Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Alvin Chan"
download as .bib file
@article{DBLP:journals/npjdm/HuangCWDLWAL24,
author = {Jane J. Huang and
Roomasa Channa and
Risa M. Wolf and
Yiwen Dong and
Mavis Liang and
Jiangxia Wang and
Michael D. Abr{\`{a}}moff and
T. Y. Alvin Liu},
title = {Autonomous artificial intelligence for diabetic eye disease increases
access and health equity in underserved populations},
journal = {npj Digit. Medicine},
volume = {7},
number = {1},
year = {2024},
url = {https://doi.org/10.1038/s41746-024-01197-3},
doi = {10.1038/S41746-024-01197-3},
timestamp = {Thu, 29 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/HuangCWDLWAL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pvldb/KittivorawongGHC24,
author = {Chanwut Kittivorawong and
Yongming Ge and
Yousef Helal and
Alvin Cheung},
title = {Spatialyze: {A} Geospatial Video Analytics System with Spatial-Aware
Optimizations},
journal = {Proc. {VLDB} Endow.},
volume = {17},
number = {9},
pages = {2136--2148},
year = {2024},
url = {https://www.vldb.org/pvldb/vol17/p2136-kittivorawong.pdf},
timestamp = {Thu, 18 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pvldb/KittivorawongGHC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/ChouLTYCWJK24,
author = {Yao{-}Hsin Chou and
Yun{-}Ting Lai and
Yong Feng Tong and
Alvin Young and
Ming{-}Ho Chang and
Kun{-}Min Wu and
Yu{-}Chi Jiang and
Shu{-}Yu Kuo},
title = {A Quantum-Inspired Multi-objective Portfolio Strategy Based on Trend
Ratio Model in Global Financial Network},
booktitle = {{IEEE} Congress on Evolutionary Computation, {CEC} 2024, Yokohama,
Japan, June 30 - July 5, 2024},
pages = {1--8},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/CEC60901.2024.10611925},
doi = {10.1109/CEC60901.2024.10611925},
timestamp = {Tue, 20 Aug 2024 15:15:31 +0200},
biburl = {https://dblp.org/rec/conf/cec/ChouLTYCWJK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispd/HoCGHKLR24,
author = {Chia{-}Tung Ho and
Ajay Chandna and
David Guan and
Alvin Ho and
Minsoo Kim and
Yaguang Li and
Haoxing Ren},
editor = {Iris Hui{-}Ru Jiang and
Gracieli Posser},
title = {Novel Transformer Model Based Clustering Method for Standard Cell
Design Automation},
booktitle = {Proceedings of the 2024 International Symposium on Physical Design,
{ISPD} 2024, Taipei, Taiwan, March 12-15, 2024},
pages = {195--203},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3626184.3633314},
doi = {10.1145/3626184.3633314},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ispd/HoCGHKLR24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2408-00118,
author = {Morgane Rivi{\`{e}}re and
Shreya Pathak and
Pier Giuseppe Sessa and
Cassidy Hardin and
Surya Bhupatiraju and
L{\'{e}}onard Hussenot and
Thomas Mesnard and
Bobak Shahriari and
Alexandre Ram{\'{e}} and
Johan Ferret and
Peter Liu and
Pouya Tafti and
Abe Friesen and
Michelle Casbon and
Sabela Ramos and
Ravin Kumar and
Charline Le Lan and
Sammy Jerome and
Anton Tsitsulin and
Nino Vieillard and
Piotr Stanczyk and
Sertan Girgin and
Nikola Momchev and
Matt Hoffman and
Shantanu Thakoor and
Jean{-}Bastien Grill and
Behnam Neyshabur and
Olivier Bachem and
Alanna Walton and
Aliaksei Severyn and
Alicia Parrish and
Aliya Ahmad and
Allen Hutchison and
Alvin Abdagic and
Amanda Carl and
Amy Shen and
Andy Brock and
Andy Coenen and
Anthony Laforge and
Antonia Paterson and
Ben Bastian and
Bilal Piot and
Bo Wu and
Brandon Royal and
Charlie Chen and
Chintu Kumar and
Chris Perry and
Chris Welty and
Christopher A. Choquette{-}Choo and
Danila Sinopalnikov and
David Weinberger and
Dimple Vijaykumar and
Dominika Rogozinska and
Dustin Herbison and
Elisa Bandy and
Emma Wang and
Eric Noland and
Erica Moreira and
Evan Senter and
Evgenii Eltyshev and
Francesco Visin and
Gabriel Rasskin and
Gary Wei and
Glenn Cameron and
Gus Martins and
Hadi Hashemi and
Hanna Klimczak{-}Plucinska and
Harleen Batra and
Harsh Dhand and
Ivan Nardini and
Jacinda Mein and
Jack Zhou and
James Svensson and
Jeff Stanway and
Jetha Chan and
Jin Peng Zhou and
Joana Carrasqueira and
Joana Iljazi and
Jocelyn Becker and
Joe Fernandez and
Joost van Amersfoort and
Josh Gordon and
Josh Lipschultz and
Josh Newlan and
Ju{-}yeong Ji and
Kareem Mohamed and
Kartikeya Badola and
Kat Black and
Katie Millican and
Keelin McDonell and
Kelvin Nguyen and
Kiranbir Sodhia and
Kish Greene and
Lars Lowe Sj{\"{o}}sund and
Lauren Usui and
Laurent Sifre and
Lena Heuermann and
Leticia Lago and
Lilly McNealus},
title = {Gemma 2: Improving Open Language Models at a Practical Size},
journal = {CoRR},
volume = {abs/2408.00118},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2408.00118},
doi = {10.48550/ARXIV.2408.00118},
eprinttype = {arXiv},
eprint = {2408.00118},
timestamp = {Fri, 06 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2408-00118.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cim/ChenWCLO23,
author = {Zhenghua Chen and
Min Wu and
Alvin Chan and
Xiaoli Li and
Yew{-}Soon Ong},
title = {Survey on {AI} Sustainability: Emerging Trends on Learning Algorithms
and Research Challenges [Review Article]},
journal = {{IEEE} Comput. Intell. Mag.},
volume = {18},
number = {2},
pages = {60--77},
year = {2023},
url = {https://doi.org/10.1109/MCI.2023.3245733},
doi = {10.1109/MCI.2023.3245733},
timestamp = {Sat, 29 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cim/ChenWCLO23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbi/TanSBCLLECLTKCBG23,
author = {Hong Chang Tan and
Elizabeth Shumbayawonda and
Cayden Beyer and
Lionel Tim{-}Ee Cheng and
Albert Low and
Chin Hong Lim and
Alvin Eng and
Weng Hoong Chan and
Phong Ching Lee and
Mei Fang Tay and
Stella Kin and
Jason Pik Eu Chang and
Yong Mong Bee and
George Boon Bee Goh},
title = {Multiparametric Magnetic Resonance Imaging and Magnetic Resonance
Elastography to Evaluate the Early Effects of Bariatric Surgery on
Nonalcoholic Fatty Liver Disease},
journal = {Int. J. Biomed. Imaging},
volume = {2023},
pages = {4228321:1--4228321:8},
year = {2023},
url = {https://doi.org/10.1155/2023/4228321},
doi = {10.1155/2023/4228321},
timestamp = {Fri, 27 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbi/TanSBCLLECLTKCBG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jossw/ScheidgenHLSNFCGMBBGDLDANSDKMRDPK23,
author = {Markus Scheidgen and
Lauri Himanen and
Alvin N. Ladines and
David Sikter and
Mohammad Nakhaee and
{\'{A}}d{\'{a}}m Fekete and
Theodore Chang and
Amir Golparvar and
Jos{\'{e}} A. M{\'{a}}rquez and
Sandor Brockhauser and
Sebastian Br{\"{u}}ckner and
Luca M. Ghiringhelli and
Felix Dietrich and
Daniel Lehmberg and
Thea Denell and
Andrea Albino and
Hampus N{\"{a}}sstr{\"{o}}m and
Sherjeel Shabih and
Florian Dobener and
Markus K{\"{u}}hbach and
Rubel Mozumder and
Joseph F. Rudzinski and
Nathan Daelman and
Jos{\'{e}} M. Pizarro and
Martin Kuban and
Cuauhtemoc Salazar and
Pavel Ondracka and
Hans{-}Joachim Bungartz and
Claudia Draxl},
title = {{NOMAD:} {A} distributed web-based platform for managing materials
science research data},
journal = {J. Open Source Softw.},
volume = {8},
number = {90},
pages = {5388},
year = {2023},
url = {https://doi.org/10.21105/joss.05388},
doi = {10.21105/JOSS.05388},
timestamp = {Tue, 28 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jossw/ScheidgenHLSNFCGMBBGDLDANSDKMRDPK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pvldb/CheungAHKLLWY23,
author = {Alvin Cheung and
Maaz Bin Safeer Ahmad and
Brandon Haynes and
Chanwut Kittivorawong and
Shadaj Laddad and
Xiaoxuan Liu and
Chenglong Wang and
Cong Yan},
title = {Towards Auto-Generated Data Systems},
journal = {Proc. {VLDB} Endow.},
volume = {16},
number = {12},
pages = {4116--4129},
year = {2023},
url = {https://www.vldb.org/pvldb/vol16/p4116-cheung.pdf},
doi = {10.14778/3611540.3611635},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pvldb/CheungAHKLLWY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ral/ChenSL23,
author = {Rui Chen and
Alvin Shek and
Changliu Liu},
title = {Robust and Context-Aware Real-Time Collaborative Robot Handling via
Dynamic Gesture Commands},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {8},
number = {6},
pages = {3510--3517},
year = {2023},
url = {https://doi.org/10.1109/LRA.2023.3268586},
doi = {10.1109/LRA.2023.3268586},
timestamp = {Tue, 19 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ral/ChenSL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csedu/ChanWGSL23,
author = {Alvin Toong Shoon Chan and
Peng{-}Cheng Wang and
Frank Guan and
Saw Han Soo and
Haris Lim Hao Li},
editor = {Jelena Jovanovic and
Irene{-}Angelica Chounta and
James Uhomoibhi and
Bruce M. McLaren},
title = {Integration of Virtual Reality with Intelligent Tutoring for High
Fidelity Air Traffic Control Training},
booktitle = {Proceedings of the 15th International Conference on Computer Supported
Education, {CSEDU} 2023, Prague, Czech Republic, April 21-23, 2023,
Volume 2},
pages = {199--206},
publisher = {{SCITEPRESS}},
year = {2023},
url = {https://doi.org/10.5220/0011732200003470},
doi = {10.5220/0011732200003470},
timestamp = {Wed, 29 May 2024 11:49:33 +0200},
biburl = {https://dblp.org/rec/conf/csedu/ChanWGSL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/WanHPXHGRS23,
author = {Alvin Wan and
Hanxiang Hao and
Kaushik Patnaik and
Yueyang Xu and
Omer Hadad and
David G{\"{u}}era and
Zhile Ren and
Qi Shan},
editor = {Andreas Krause and
Emma Brunskill and
Kyunghyun Cho and
Barbara Engelhardt and
Sivan Sabato and
Jonathan Scarlett},
title = {{UPSCALE:} Unconstrained Channel Pruning},
booktitle = {International Conference on Machine Learning, {ICML} 2023, 23-29 July
2023, Honolulu, Hawaii, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {202},
pages = {35384--35412},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v202/wan23a.html},
timestamp = {Mon, 28 Aug 2023 17:23:08 +0200},
biburl = {https://dblp.org/rec/conf/icml/WanHPXHGRS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/ShekSCL23,
author = {Alvin Shek and
Bo Ying Su and
Rui Chen and
Changliu Liu},
title = {Learning from Physical Human Feedback: An Object-Centric One-Shot
Adaptation Method},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2023, London, UK, May 29 - June 2, 2023},
pages = {9910--9916},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICRA48891.2023.10161416},
doi = {10.1109/ICRA48891.2023.10161416},
timestamp = {Tue, 19 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icra/ShekSCL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vr/YeoXCLCQG23,
author = {Jin Qi Yeo and
Xinxing Xia and
Kan Chen and
Malcolm Y. H. Low and
Alvin Toong Shoon Chan and
Dongyu Qiu and
Frank Guan},
title = {{SPAT-VR:} {A} Holistic and Extensible Framework for {VR} Project
Management},
booktitle = {{IEEE} Conference on Virtual Reality and 3D User Interfaces Abstracts
and Workshops, {VR} Workshops 2023, Shanghai, China, March 25-29,
2023},
pages = {619--620},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/VRW58643.2023.00152},
doi = {10.1109/VRW58643.2023.00152},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vr/YeoXCLCQG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-06175,
author = {Rui Chen and
Alvin Shek and
Changliu Liu},
title = {Robust and Context-Aware Real-Time Collaborative Robot Handling via
Dynamic Gesture Commands},
journal = {CoRR},
volume = {abs/2304.06175},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.06175},
doi = {10.48550/ARXIV.2304.06175},
eprinttype = {arXiv},
eprint = {2304.06175},
timestamp = {Tue, 19 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-06175.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-08771,
author = {Alvin Wan and
Hanxiang Hao and
Kaushik Patnaik and
Yueyang Xu and
Omer Hadad and
David G{\"{u}}era and
Zhile Ren and
Qi Shan},
title = {{UPSCALE:} Unconstrained Channel Pruning},
journal = {CoRR},
volume = {abs/2307.08771},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.08771},
doi = {10.48550/ARXIV.2307.08771},
eprinttype = {arXiv},
eprint = {2307.08771},
timestamp = {Tue, 25 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-08771.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-03276,
author = {Chanwut Kittivorawong and
Yongming Ge and
Yousef Helal and
Alvin Cheung},
title = {Spatialyze: {A} Geospatial Video Analytics System with Spatial-Aware
Optimizations},
journal = {CoRR},
volume = {abs/2308.03276},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.03276},
doi = {10.48550/ARXIV.2308.03276},
eprinttype = {arXiv},
eprint = {2308.03276},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-03276.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/AbadiAABBBBCCDD22,
author = {Daniel Abadi and
Anastasia Ailamaki and
David G. Andersen and
Peter Bailis and
Magdalena Balazinska and
Philip A. Bernstein and
Peter A. Boncz and
Surajit Chaudhuri and
Alvin Cheung and
AnHai Doan and
Luna Dong and
Michael J. Franklin and
Juliana Freire and
Alon Y. Halevy and
Joseph M. Hellerstein and
Stratos Idreos and
Donald Kossmann and
Tim Kraska and
Sailesh Krishnamurthy and
Volker Markl and
Sergey Melnik and
Tova Milo and
C. Mohan and
Thomas Neumann and
Beng Chin Ooi and
Fatma Ozcan and
Jignesh M. Patel and
Andrew Pavlo and
Raluca A. Popa and
Raghu Ramakrishnan and
Christopher R{\'{e}} and
Michael Stonebraker and
Dan Suciu},
title = {The Seattle report on database research},
journal = {Commun. {ACM}},
volume = {65},
number = {8},
pages = {72--79},
year = {2022},
url = {https://doi.org/10.1145/3524284},
doi = {10.1145/3524284},
timestamp = {Thu, 02 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cacm/AbadiAABBBBCCDD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/ChanMJOXXL22,
author = {Alvin Chan and
Lei Ma and
Felix Juefei{-}Xu and
Yew{-}Soon Ong and
Xiaofei Xie and
Minhui Xue and
Yang Liu},
title = {Breaking Neural Reasoning Architectures With Metamorphic Relation-Based
Adversarial Examples},
journal = {{IEEE} Trans. Neural Networks Learn. Syst.},
volume = {33},
number = {11},
pages = {6976--6982},
year = {2022},
url = {https://doi.org/10.1109/TNNLS.2021.3072166},
doi = {10.1109/TNNLS.2021.3072166},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tnn/ChanMJOXXL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/SahroniMW22,
author = {Alvin Sahroni and
Isnatin Miladiyah and
Nur Widiasmara},
title = {Short-term Pulse Rate Variability to Assess Psychophysiological Changes
during Online Trier Social Stress Test {(TSST)}},
booktitle = {44th Annual International Conference of the {IEEE} Engineering in
Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland,
United Kingdom, July 11-15, 2022},
pages = {1082--1085},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/EMBC48229.2022.9871398},
doi = {10.1109/EMBC48229.2022.9871398},
timestamp = {Thu, 22 Sep 2022 19:31:35 +0200},
biburl = {https://dblp.org/rec/conf/embc/SahroniMW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/AhmadIS22,
author = {Siti Sarah Farhana Ahmad and
Nurul Hazrina Idris and
Alvin Lau Meng Shin},
title = {Coastline Changes Over Mangrove Forest in Setiu Malaysia Using a Long-Term
Landsat Satellite Data},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2022, Kuala Lumpur, Malaysia, July 17-22, 2022},
pages = {6809--6812},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IGARSS46834.2022.9883142},
doi = {10.1109/IGARSS46834.2022.9883142},
timestamp = {Tue, 04 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/AhmadIS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/ChanOT22,
author = {Alvin Chan and
Yew Soon Ong and
Clement Tan},
editor = {Luc De Raedt},
title = {How Does Frequency Bias Affect the Robustness of Neural Image Classifiers
against Common Corruption and Adversarial Perturbations?},
booktitle = {Proceedings of the Thirty-First International Joint Conference on
Artificial Intelligence, {IJCAI} 2022, Vienna, Austria, 23-29 July
2022},
pages = {659--665},
publisher = {ijcai.org},
year = {2022},
url = {https://doi.org/10.24963/ijcai.2022/93},
doi = {10.24963/IJCAI.2022/93},
timestamp = {Wed, 27 Jul 2022 16:43:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/ChanOT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/NgocCBO22,
author = {Nguyen Hong Ngoc and
Alvin Chan and
Huynh Thi Thanh Binh and
Yew Soon Ong},
title = {Anti-Forensic Deepfake Personas and How To Spot Them},
booktitle = {International Joint Conference on Neural Networks, {IJCNN} 2022, Padua,
Italy, July 18-23, 2022},
pages = {1--8},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IJCNN55064.2022.9892357},
doi = {10.1109/IJCNN55064.2022.9892357},
timestamp = {Mon, 10 Oct 2022 17:40:09 +0200},
biburl = {https://dblp.org/rec/conf/ijcnn/NgocCBO22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismar/ChanLC22,
author = {Alvin Chan and
Jeannie Su Ann Lee and
Renjie Chen},
title = {Message from the {ISMAR} 2022 Demos Chairs},
booktitle = {2022 {IEEE} International Symposium on Mixed and Augmented Reality
Adjunct (ISMAR-Adjunct), Singapore, Singapore, October 17-21, 2022},
pages = {xix},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISMAR-Adjunct57072.2022.00007},
doi = {10.1109/ISMAR-ADJUNCT57072.2022.00007},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ismar/ChanLC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismar/QiuOXYXLWCG22,
author = {Dongyu Qiu and
Clemen Yu Da Ow and
Xinxing Xia and
Jin Qi Yeo and
Jiazhi Xia and
Malcolm Yoke Hean Low and
Zhengkui Wang and
Alvin Toong Shoon Chan and
Frank Yunqing Guan},
title = {ViCollAR: {A} Novel System for 3D Data Visualization using Collaborative
Augmented Reality},
booktitle = {2022 {IEEE} International Symposium on Mixed and Augmented Reality
Adjunct (ISMAR-Adjunct), Singapore, Singapore, October 17-21, 2022},
pages = {907--908},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISMAR-Adjunct57072.2022.00199},
doi = {10.1109/ISMAR-ADJUNCT57072.2022.00199},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ismar/QiuOXYXLWCG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-04951,
author = {Alvin Shek and
Rui Chen and
Changliu Liu},
title = {Learning from Physical Human Feedback: An Object-Centric One-Shot
Adaptation Method},
journal = {CoRR},
volume = {abs/2203.04951},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2203.04951},
doi = {10.48550/ARXIV.2203.04951},
eprinttype = {arXiv},
eprint = {2203.04951},
timestamp = {Tue, 19 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2203-04951.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-03824,
author = {Zhenghua Chen and
Min Wu and
Alvin Chan and
Xiaoli Li and
Yew{-}Soon Ong},
title = {A Survey on {AI} Sustainability: Emerging Trends on Learning Algorithms
and Research Challenges},
journal = {CoRR},
volume = {abs/2205.03824},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.03824},
doi = {10.48550/ARXIV.2205.03824},
eprinttype = {arXiv},
eprint = {2205.03824},
timestamp = {Wed, 11 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-03824.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-04533,
author = {Alvin Chan and
Yew{-}Soon Ong and
Clement Tan},
title = {How Does Frequency Bias Affect the Robustness of Neural Image Classifiers
against Common Corruption and Adversarial Perturbations?},
journal = {CoRR},
volume = {abs/2205.04533},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.04533},
doi = {10.48550/ARXIV.2205.04533},
eprinttype = {arXiv},
eprint = {2205.04533},
timestamp = {Wed, 11 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-04533.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-07889,
author = {Jessica Y. Bo and
Hen{-}Wei Huang and
Alvin Chan and
Giovanni Traverso},
title = {Pretraining {ECG} Data with Adversarial Masking Improves Model Generalizability
for Data-Scarce Tasks},
journal = {CoRR},
volume = {abs/2211.07889},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.07889},
doi = {10.48550/ARXIV.2211.07889},
eprinttype = {arXiv},
eprint = {2211.07889},
timestamp = {Wed, 23 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-07889.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/sg/Chan21,
author = {Alvin Chan},
title = {Defences and threats in safe deep learning},
school = {Nanyang Technological University, Singapore},
year = {2021},
url = {https://doi.org/10.32657/10356/152976},
doi = {10.32657/10356/152976},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/sg/Chan21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/ChanLJ21,
author = {Alvin Chan and
Martin D. Levine and
Mehrsan Javan},
title = {Player Identification in Hockey Broadcast Videos},
journal = {Expert Syst. Appl.},
volume = {165},
pages = {113891},
year = {2021},
url = {https://doi.org/10.1016/j.eswa.2020.113891},
doi = {10.1016/J.ESWA.2020.113891},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eswa/ChanLJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/LaiCPKBSNDSGNCF21,
author = {Alvina Grace Lai and
Wai Hoong Chang and
Constantinos A. Parisinos and
Michail Katsoulis and
Ruth M. Blackburn and
Anoop D. Shah and
Vincent Nguyen and
Spiros C. Denaxas and
George Davey Smith and
Tom R. Gaunt and
Krishnarajah Nirantharakumar and
Murray P. Cox and
Donall Forde and
Folkert W. Asselbergs and
Steve K. Harris and
Sylvia Richardson and
Reecha Sofat and
Richard J. B. Dobson and
Aroon D. Hingorani and
Riyaz Patel and
Jonathan Sterne and
Amitava Banerjee and
Alastair K. Denniston and
Simon Ball and
Neil J. Sebire and
Nigam H. Shah and
Graham R. Foster and
Bryan Williams and
Harry Hemingway},
title = {An informatics consult approach for generating clinical evidence for
treatment decisions},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {21},
number = {1},
pages = {281},
year = {2021},
url = {https://doi.org/10.1186/s12911-021-01638-z},
doi = {10.1186/S12911-021-01638-Z},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/midm/LaiCPKBSNDSGNCF21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tele/Zhou21,
author = {Alvin Zhou},
title = {Causal effects of affordance change on communication behavior: Empirical
evidence from organizational and leadership social media use},
journal = {Telematics Informatics},
volume = {59},
pages = {101549},
year = {2021},
url = {https://doi.org/10.1016/j.tele.2020.101549},
doi = {10.1016/J.TELE.2020.101549},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tele/Zhou21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ZhangCTFW0SYL20,
author = {Aston Zhang and
Alvin Chan and
Yi Tay and
Jie Fu and
Shuohang Wang and
Shuai Zhang and
Huajie Shao and
Shuochao Yao and
Roy Ka{-}Wei Lee},
editor = {Chengqing Zong and
Fei Xia and
Wenjie Li and
Roberto Navigli},
title = {On Orthogonality Constraints for Transformers},
booktitle = {Proceedings of the 59th Annual Meeting of the Association for Computational
Linguistics and the 11th International Joint Conference on Natural
Language Processing, {ACL/IJCNLP} 2021, (Volume 2: Short Papers),
Virtual Event, August 1-6, 2021},
pages = {375--382},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.acl-short.48},
doi = {10.18653/V1/2021.ACL-SHORT.48},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ZhangCTFW0SYL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chil/ChanKOWLP21,
author = {Alvin Chan and
Anna Korsakova and
Yew{-}Soon Ong and
Fernaldo Richtia Winnerdy and
Kah Wai Lim and
Anh Tuan Phan},
editor = {Marzyeh Ghassemi and
Tristan Naumann and
Emma Pierson},
title = {{RNA} alternative splicing prediction with discrete compositional
energy network},
booktitle = {{ACM} {CHIL} '21: {ACM} Conference on Health, Inference, and Learning,
Virtual Event, USA, April 8-9, 2021},
pages = {193--203},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3450439.3451857},
doi = {10.1145/3450439.3451857},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chil/ChanKOWLP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/ZhengIPMALYYACP21,
author = {Yao Zheng and
Shekh Md Mahmudul Islam and
Yanjun Pan and
Marionne Millan and
Samson Aggelopoulos and
Brian Lu and
Alvin Yang and
Thomas Yang and
Stephanie Aelmore and
Willy Chang and
Alana Power and
Ming Li and
Olga Boric{-}Lubecke and
Victor Lubecke and
Wenhai Sun},
title = {Insider-Resistant Context-Based Pairing for Multimodality Sleep Apnea
Test},
booktitle = {{IEEE} Global Communications Conference, {GLOBECOM} 2021, Madrid,
Spain, December 7-11, 2021},
pages = {1--6},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/GLOBECOM46510.2021.9685852},
doi = {10.1109/GLOBECOM46510.2021.9685852},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/globecom/ZhengIPMALYYACP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/ChanOPZF21,
author = {Alvin Chan and
Yew{-}Soon Ong and
Bill Pung and
Aston Zhang and
Jie Fu},
title = {CoCon: {A} Self-Supervised Approach for Controlled Text Generation},
booktitle = {9th International Conference on Learning Representations, {ICLR} 2021,
Virtual Event, Austria, May 3-7, 2021},
publisher = {OpenReview.net},
year = {2021},
url = {https://openreview.net/forum?id=VD\_ozqvBy4W},
timestamp = {Wed, 23 Jun 2021 17:36:39 +0200},
biburl = {https://dblp.org/rec/conf/iclr/ChanOPZF21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/ZhangT0CLHF21,
author = {Aston Zhang and
Yi Tay and
Shuai Zhang and
Alvin Chan and
Anh Tuan Luu and
Siu Cheung Hui and
Jie Fu},
title = {Beyond Fully-Connected Layers with Quaternions: Parameterization of
Hypercomplex Multiplications with 1/n Parameters},
booktitle = {9th International Conference on Learning Representations, {ICLR} 2021,
Virtual Event, Austria, May 3-7, 2021},
publisher = {OpenReview.net},
year = {2021},
url = {https://openreview.net/forum?id=rcQdycl0zyk},
timestamp = {Wed, 23 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/ZhangT0CLHF21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ChanMKN21,
author = {Alvin Chan and
Ali Madani and
Ben Krause and
Nikhil Naik},
editor = {Marc'Aurelio Ranzato and
Alina Beygelzimer and
Yann N. Dauphin and
Percy Liang and
Jennifer Wortman Vaughan},
title = {Deep Extrapolation for Attribute-Enhanced Generation},
booktitle = {Advances in Neural Information Processing Systems 34: Annual Conference
on Neural Information Processing Systems 2021, NeurIPS 2021, December
6-14, 2021, virtual},
pages = {14084--14096},
year = {2021},
url = {https://proceedings.neurips.cc/paper/2021/hash/75da5036f659fe64b53f3d9b39412967-Abstract.html},
timestamp = {Tue, 03 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/ChanMKN21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ZhangTSCZ21,
author = {Aston Zhang and
Yi Tay and
Yikang Shen and
Alvin Chan and
Shuai Zhang},
editor = {Marc'Aurelio Ranzato and
Alina Beygelzimer and
Yann N. Dauphin and
Percy Liang and
Jennifer Wortman Vaughan},
title = {Self-Instantiated Recurrent Units with Dynamic Soft Recursion},
booktitle = {Advances in Neural Information Processing Systems 34: Annual Conference
on Neural Information Processing Systems 2021, NeurIPS 2021, December
6-14, 2021, virtual},
pages = {6503--6514},
year = {2021},
url = {https://proceedings.neurips.cc/paper/2021/hash/3341f6f048384ec73a7ba2e77d2db48b-Abstract.html},
timestamp = {Tue, 03 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/ZhangTSCZ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-08597,
author = {Aston Zhang and
Yi Tay and
Shuai Zhang and
Alvin Chan and
Anh Tuan Luu and
Siu Cheung Hui and
Jie Fu},
title = {Beyond Fully-Connected Layers with Quaternions: Parameterization of
Hypercomplex Multiplications with 1/n Parameters},
journal = {CoRR},
volume = {abs/2102.08597},
year = {2021},
url = {https://arxiv.org/abs/2102.08597},
eprinttype = {arXiv},
eprint = {2102.08597},
timestamp = {Wed, 23 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2102-08597.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-04246,
author = {Alvin Chan and
Anna Korsakova and
Yew{-}Soon Ong and
Fernaldo Richtia Winnerdy and
Kah Wai Lim and
Anh Tuan Phan},
title = {{RNA} Alternative Splicing Prediction with Discrete Compositional
Energy Network},
journal = {CoRR},
volume = {abs/2103.04246},
year = {2021},
url = {https://arxiv.org/abs/2103.04246},
eprinttype = {arXiv},
eprint = {2103.04246},
timestamp = {Tue, 16 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2103-04246.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2105-00314,
author = {Yao Zheng and
Shekh Md Mahmudul Islam and
Yanjun Pan and
Marionne Millan and
Samson Aggelopoulos and
Brian Lu and
Alvin Yang and
Thomas Yang and
Stephanie Aelmore and
Willy Chang and
Alana Power and
Ming Li and
Olga Boric{-}Lubecke and
Victor Lubecke and
Wenhai Sun},
title = {Technical Report: Insider-Resistant Context-Based Pairing for Multimodality
Sleep Apnea Test},
journal = {CoRR},
volume = {abs/2105.00314},
year = {2021},
url = {https://arxiv.org/abs/2105.00314},
eprinttype = {arXiv},
eprint = {2105.00314},
timestamp = {Mon, 30 Oct 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2105-00314.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-02968,
author = {Alvin Chan and
Ali Madani and
Ben Krause and
Nikhil Naik},
title = {Deep Extrapolation for Attribute-Enhanced Generation},
journal = {CoRR},
volume = {abs/2107.02968},
year = {2021},
url = {https://arxiv.org/abs/2107.02968},
eprinttype = {arXiv},
eprint = {2107.02968},
timestamp = {Tue, 20 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2107-02968.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-06747,
author = {Arkadiusz Sitek and
Sangtae Ahn and
Evren Asma and
Adam Chandler and
Alvin Ihsani and
Sven Prevrhal and
Arman Rahmim and
Babak Saboury and
Kris Thielemans},
title = {Artificial Intelligence in {PET:} an Industry Perspective},
journal = {CoRR},
volume = {abs/2107.06747},
year = {2021},
url = {https://arxiv.org/abs/2107.06747},
eprinttype = {arXiv},
eprint = {2107.06747},
timestamp = {Wed, 21 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2107-06747.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-06046,
author = {Chih{-}Pin Tan and
Chin{-}Jui Chang and
Alvin W. Y. Su and
Yi{-}Hsuan Yang},
title = {Music Score Expansion with Variable-Length Infilling},
journal = {CoRR},
volume = {abs/2111.06046},
year = {2021},
url = {https://arxiv.org/abs/2111.06046},
eprinttype = {arXiv},
eprint = {2111.06046},
timestamp = {Tue, 16 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-06046.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-14031,
author = {Bill Tuck Weng Pung and
Alvin Chan},
title = {FastTrees: Parallel Latent Tree-Induction for Faster Sequence Encoding},
journal = {CoRR},
volume = {abs/2111.14031},
year = {2021},
url = {https://arxiv.org/abs/2111.14031},
eprinttype = {arXiv},
eprint = {2111.14031},
timestamp = {Wed, 01 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-14031.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-14034,
author = {Bill Tuck Weng Pung and
Alvin Chan},
title = {{ORCHARD:} {A} Benchmark For Measuring Systematic Generalization of
Multi-Hierarchical Reasoning},
journal = {CoRR},
volume = {abs/2111.14034},
year = {2021},
url = {https://arxiv.org/abs/2111.14034},
eprinttype = {arXiv},
eprint = {2111.14034},
timestamp = {Wed, 01 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-14034.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-06020,
author = {Rui Chen and
Alvin Shek and
Changliu Liu},
title = {Learn from Human Teams: a Probabilistic Solution to Real-Time Collaborative
Robot Handling with Dynamic Gesture Commands},
journal = {CoRR},
volume = {abs/2112.06020},
year = {2021},
url = {https://arxiv.org/abs/2112.06020},
eprinttype = {arXiv},
eprint = {2112.06020},
timestamp = {Tue, 19 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-06020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cga/HanCLJTCH20,
author = {Ping{-}Hsuan Han and
Yang{-}Sheng Chen and
Iou{-}Shiuan Liu and
Yu{-}Ping Jang and
Ling Tsai and
Alvin Chang and
Yi{-}Ping Hung},
title = {A Compelling Virtual Tour of the Dunhuang Cave With an Immersive Head-Mounted
Display},
journal = {{IEEE} Computer Graphics and Applications},
volume = {40},
number = {1},
pages = {40--55},
year = {2020},
url = {https://doi.org/10.1109/MCG.2019.2936753},
doi = {10.1109/MCG.2019.2936753},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cga/HanCLJTCH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijisscm/PhamTA20,
author = {Thi{-}Ngan Pham and
Albert Tan and
Alvin Ang},
title = {Determining Safety Stock for an Omni-Channel Environment},
journal = {Int. J. Inf. Syst. Supply Chain Manag.},
volume = {13},
number = {2},
pages = {59--76},
year = {2020},
url = {https://doi.org/10.4018/IJISSCM.2020040104},
doi = {10.4018/IJISSCM.2020040104},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijisscm/PhamTA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/TayOFCCLP20,
author = {Yi Tay and
Donovan Ong and
Jie Fu and
Alvin Chan and
Nancy Chen and
Anh Tuan Luu and
Chris Pal},
editor = {Dan Jurafsky and
Joyce Chai and
Natalie Schluter and
Joel R. Tetreault},
title = {Would you Rather? {A} New Benchmark for Learning Machine Alignment
with Cultural Values and Social Preferences},
booktitle = {Proceedings of the 58th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2020, Online, July 5-10, 2020},
pages = {5369--5373},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.acl-main.477},
doi = {10.18653/V1/2020.ACL-MAIN.477},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/TayOFCCLP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ChanTO20,
author = {Alvin Chan and
Yi Tay and
Yew{-}Soon Ong},
title = {What It Thinks Is Important Is Important: Robustness Transfers Through
Input Gradients},
booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2020, Seattle, WA, USA, June 13-19, 2020},
pages = {329--338},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020},
url = {https://openaccess.thecvf.com/content\_CVPR\_2020/html/Chan\_What\_It\_Thinks\_Is\_Important\_Is\_Important\_Robustness\_Transfers\_Through\_CVPR\_2020\_paper.html},
doi = {10.1109/CVPR42600.2020.00041},
timestamp = {Tue, 31 Aug 2021 14:00:04 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/ChanTO20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/WanDZHTXWYXCVG20,
author = {Alvin Wan and
Xiaoliang Dai and
Peizhao Zhang and
Zijian He and
Yuandong Tian and
Saining Xie and
Bichen Wu and
Matthew Yu and
Tao Xu and
Kan Chen and
Peter Vajda and
Joseph E. Gonzalez},
title = {FBNetV2: Differentiable Neural Architecture Search for Spatial and
Channel Dimensions},
booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2020, Seattle, WA, USA, June 13-19, 2020},
pages = {12962--12971},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020},
url = {https://openaccess.thecvf.com/content\_CVPR\_2020/html/Wan\_FBNetV2\_Differentiable\_Neural\_Architecture\_Search\_for\_Spatial\_and\_Channel\_Dimensions\_CVPR\_2020\_paper.html},
doi = {10.1109/CVPR42600.2020.01298},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/WanDZHTXWYXCVG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ChanTOZ20,
author = {Alvin Chan and
Yi Tay and
Yew{-}Soon Ong and
Aston Zhang},
editor = {Trevor Cohn and
Yulan He and
Yang Liu},
title = {Poison Attacks against Text Datasets with Conditional Adversarially
Regularized Autoencoder},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2020, Online Event, 16-20 November 2020},
series = {Findings of {ACL}},
volume = {{EMNLP} 2020},
pages = {4175--4189},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.findings-emnlp.373},
doi = {10.18653/V1/2020.FINDINGS-EMNLP.373},
timestamp = {Tue, 20 Aug 2024 07:54:42 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ChanTOZ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/LaiKRLLZWL20,
author = {Gabriel Chun{-}Hei Lai and
Ron Chi{-}Wai Kwok and
Tina Rochelle and
Alvin Chung{-}Man Leung and
Yanyan Li and
Shanshan Zhang and
George Yui{-}Lam Wong and
Angel Lu},
title = {The Moderating Effect of Different Types of Internet Use on the Relationship
between Transitional Aging Changes and Self-esteem of Older Adults},
booktitle = {53rd Hawaii International Conference on System Sciences, {HICSS} 2020,
Maui, Hawaii, USA, January 7-10, 2020},
pages = {1--10},
publisher = {ScholarSpace},
year = {2020},
url = {https://hdl.handle.net/10125/64206},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hicss/LaiKRLLZWL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/ChanTOF20,
author = {Alvin Chan and
Yi Tay and
Yew{-}Soon Ong and
Jie Fu},
title = {Jacobian Adversarially Regularized Networks for Robustness},
booktitle = {8th International Conference on Learning Representations, {ICLR} 2020,
Addis Ababa, Ethiopia, April 26-30, 2020},
publisher = {OpenReview.net},
year = {2020},
url = {https://openreview.net/forum?id=Hke0V1rKPS},
timestamp = {Thu, 07 May 2020 17:11:47 +0200},
biburl = {https://dblp.org/rec/conf/iclr/ChanTOF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/RothCSNLGGQIBWB20,
author = {Holger R. Roth and
Ken Chang and
Praveer Singh and
Nir Neumark and
Wenqi Li and
Vikash Gupta and
Sharut Gupta and
Liangqiong Qu and
Alvin Ihsani and
Bernardo C. Bizzo and
Yuhong Wen and
Varun Buch and
Meesam Shah and
Felipe Kitamura and
Matheus Mendon{\c{c}}a and
Vitor Lavor and
Ahmed Harouni and
Colin Compas and
Jesse Tetreault and
Prerna Dogra and
Yan Cheng and
Selnur Erdal and
Richard D. White and
Behrooz Hashemian and
Thomas J. Schultz and
Miao Zhang and
Adam McCarthy and
B. Min Yun and
Elshaimaa Sharaf and
Katharina Viktoria Hoebel and
Jay B. Patel and
Bryan Chen and
Sean Ko and
Evan Leibovitz and
Etta D. Pisano and
Laura Coombs and
Daguang Xu and
Keith J. Dreyer and
Ittai Dayan and
Ram C. Naidu and
Mona Flores and
Daniel L. Rubin and
Jayashree Kalpathy{-}Cramer},
editor = {Shadi Albarqouni and
Spyridon Bakas and
Konstantinos Kamnitsas and
M. Jorge Cardoso and
Bennett A. Landman and
Wenqi Li and
Fausto Milletari and
Nicola Rieke and
Holger Roth and
Daguang Xu and
Ziyue Xu},
title = {Federated Learning for Breast Density Classification: {A} Real-World
Implementation},
booktitle = {Domain Adaptation and Representation Transfer, and Distributed and
Collaborative Learning - Second {MICCAI} Workshop, {DART} 2020, and
First {MICCAI} Workshop, {DCL} 2020, Held in Conjunction with {MICCAI}
2020, Lima, Peru, October 4-8, 2020, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12444},
pages = {181--191},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-60548-3\_18},
doi = {10.1007/978-3-030-60548-3\_18},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miccai/RothCSNLGGQIBWB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/ShinIXMSFC20,
author = {Hoo{-}Chang Shin and
Alvin Ihsani and
Ziyue Xu and
Swetha Mandava and
Sharath Turuvekere Sreenivas and
Christopher Forster and
Jiook Cha},
editor = {Anne L. Martel and
Purang Abolmaesumi and
Danail Stoyanov and
Diana Mateus and
Maria A. Zuluaga and
S. Kevin Zhou and
Daniel Racoceanu and
Leo Joskowicz},
title = {{GANDALF:} Generative Adversarial Networks with Discriminator-Adaptive
Loss Fine-Tuning for Alzheimer's Disease Diagnosis from {MRI}},
booktitle = {Medical Image Computing and Computer Assisted Intervention - {MICCAI}
2020 - 23rd International Conference, Lima, Peru, October 4-8, 2020,
Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {12262},
pages = {688--697},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-59713-9\_66},
doi = {10.1007/978-3-030-59713-9\_66},
timestamp = {Mon, 05 Oct 2020 18:46:15 +0200},
biburl = {https://dblp.org/rec/conf/miccai/ShinIXMSFC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/ChouCTLLKSCHL020,
author = {Mao{-}Hsuan Chou and
Ya{-}Tin Chang and
Tsung{-}Hsien Tsai and
Tsung{-}Che Lu and
Chia{-}Chun Liao and
Hung{-}Yi Kuo and
Ruey{-}Bin Sheen and
Chih{-}Hsien Chang and
Kenny C.{-}H. Hsieh and
Alvin Leng Sun Loke and
Mark Chen},
title = {Embedded {PLL} Phase Noise Measurement Based on a {PFD/CP} {MASH}
1-1-1 {\(\Delta\)}{\(\Sigma\)} Time-to-Digital Converter in 7nm {CMOS}},
booktitle = {{IEEE} Symposium on {VLSI} Circuits, {VLSI} Circuits 2020, Honolulu,
HI, USA, June 16-19, 2020},
pages = {1--2},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/VLSICircuits18222.2020.9162789},
doi = {10.1109/VLSICIRCUITS18222.2020.9162789},
timestamp = {Fri, 01 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/ChouCTLLKSCHL020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-05565,
author = {Alvin Wan and
Xiaoliang Dai and
Peizhao Zhang and
Zijian He and
Yuandong Tian and
Saining Xie and
Bichen Wu and
Matthew Yu and
Tao Xu and
Kan Chen and
Peter Vajda and
Joseph E. Gonzalez},
title = {FBNetV2: Differentiable Neural Architecture Search for Spatial and
Channel Dimensions},
journal = {CoRR},
volume = {abs/2004.05565},
year = {2020},
url = {https://arxiv.org/abs/2004.05565},
eprinttype = {arXiv},
eprint = {2004.05565},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2004-05565.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-03535,
author = {Alvin Chan and
Yew{-}Soon Ong and
Bill Pung and
Aston Zhang and
Jie Fu},
title = {CoCon: {A} Self-Supervised Approach for Controlled Text Generation},
journal = {CoRR},
volume = {abs/2006.03535},
year = {2020},
url = {https://arxiv.org/abs/2006.03535},
eprinttype = {arXiv},
eprint = {2006.03535},
timestamp = {Tue, 09 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2006-03535.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2007-03201,
author = {Jordan L. Melcher and
Yao Zheng and
Dylan Anthony and
Matthew Troglia and
Yanjun Pan and
Ming Li and
Thomas Yang and
Alvin Yang and
Samson Aggelopoulos},
title = {Demo: iJam with Channel Randomization},
journal = {CoRR},
volume = {abs/2007.03201},
year = {2020},
url = {https://arxiv.org/abs/2007.03201},
eprinttype = {arXiv},
eprint = {2007.03201},
timestamp = {Mon, 30 Oct 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2007-03201.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-04393,
author = {Hoo{-}Chang Shin and
Alvin Ihsani and
Swetha Mandava and
Sharath Turuvekere Sreenivas and
Christopher Forster and
Jiook Cha and
Alzheimer's Disease Neuroimaging Initiative},
title = {{GANBERT:} Generative Adversarial Networks with Bidirectional Encoder
Representations from Transformers for {MRI} to {PET} synthesis},
journal = {CoRR},
volume = {abs/2008.04393},
year = {2020},
url = {https://arxiv.org/abs/2008.04393},
eprinttype = {arXiv},
eprint = {2008.04393},
timestamp = {Mon, 17 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2008-04393.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-04396,
author = {Hoo{-}Chang Shin and
Alvin Ihsani and
Ziyue Xu and
Swetha Mandava and
Sharath Turuvekere Sreenivas and
Christopher Forster and
Jiook Cha and
Alzheimer's Disease Neuroimaging Initiative},
title = {{GANDALF:} Generative Adversarial Networks with Discriminator-Adaptive
Loss Fine-tuning for Alzheimer's Disease Diagnosis from {MRI}},
journal = {CoRR},
volume = {abs/2008.04396},
year = {2020},
url = {https://arxiv.org/abs/2008.04396},
eprinttype = {arXiv},
eprint = {2008.04396},
timestamp = {Mon, 17 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2008-04396.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2009-01871,
author = {Holger R. Roth and
Ken Chang and
Praveer Singh and
Nir Neumark and
Wenqi Li and
Vikash Gupta and
Sharut Gupta and
Liangqiong Qu and
Alvin Ihsani and
Bernardo C. Bizzo and
Yuhong Wen and
Varun Buch and
Meesam Shah and
Felipe Kitamura and
Matheus Mendon{\c{c}}a and
Vitor Lavor and
Ahmed Harouni and
Colin Compas and
Jesse Tetreault and
Prerna Dogra and
Yan Cheng and
Selnur Erdal and
Richard D. White and
Behrooz Hashemian and
Thomas J. Schultz and
Miao Zhang and
Adam McCarthy and
B. Min Yun and
Elshaimaa Sharaf and
Katharina Viktoria Hoebel and
Jay B. Patel and
Bryan Chen and
Sean Ko and
Evan Leibovitz and
Etta D. Pisano and
Laura Coombs and
Daguang Xu and
Keith J. Dreyer and
Ittai Dayan and
Ram C. Naidu and
Mona Flores and
Daniel L. Rubin and
Jayashree Kalpathy{-}Cramer},
title = {Federated Learning for Breast Density Classification: {A} Real-World
Implementation},
journal = {CoRR},
volume = {abs/2009.01871},
year = {2020},
url = {https://arxiv.org/abs/2009.01871},
eprinttype = {arXiv},
eprint = {2009.01871},
timestamp = {Fri, 11 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2009-01871.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2009-02429,
author = {Alvin Chan and
Martin D. Levine and
Mehrsan Javan},
title = {Player Identification in Hockey Broadcast Videos},
journal = {CoRR},
volume = {abs/2009.02429},
year = {2020},
url = {https://arxiv.org/abs/2009.02429},
eprinttype = {arXiv},
eprint = {2009.02429},
timestamp = {Wed, 16 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2009-02429.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-02684,
author = {Alvin Chan and
Yi Tay and
Yew{-}Soon Ong and
Aston Zhang},
title = {Poison Attacks against Text Datasets with Conditional Adversarially
Regularized Autoencoder},
journal = {CoRR},
volume = {abs/2010.02684},
year = {2020},
url = {https://arxiv.org/abs/2010.02684},
eprinttype = {arXiv},
eprint = {2010.02684},
timestamp = {Mon, 12 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-02684.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/RoyGANDS19,
author = {Proteek Chandan Roy and
Andrey K. Guber and
Mohammad Abouali and
A. Pouyan Nejadhashemi and
Kalyanmoy Deb and
Alvin J. M. Smucker},
title = {Crop yield simulation optimization using precision irrigation and
subsurface water retention technology},
journal = {Environ. Model. Softw.},
volume = {119},
pages = {433--444},
year = {2019},
url = {https://doi.org/10.1016/j.envsoft.2019.07.006},
doi = {10.1016/J.ENVSOFT.2019.07.006},
timestamp = {Wed, 10 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/envsoft/RoyGANDS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmod/AbadiAABBBBCCDD19,
author = {Daniel Abadi and
Anastasia Ailamaki and
David G. Andersen and
Peter Bailis and
Magdalena Balazinska and
Philip A. Bernstein and
Peter A. Boncz and
Surajit Chaudhuri and
Alvin Cheung and
AnHai Doan and
Luna Dong and
Michael J. Franklin and
Juliana Freire and
Alon Y. Halevy and
Joseph M. Hellerstein and
Stratos Idreos and
Donald Kossmann and
Tim Kraska and
Sailesh Krishnamurthy and
Volker Markl and
Sergey Melnik and
Tova Milo and
C. Mohan and
Thomas Neumann and
Beng Chin Ooi and
Fatma Ozcan and
Jignesh M. Patel and
Andrew Pavlo and
Raluca A. Popa and
Raghu Ramakrishnan and
Christopher R{\'{e}} and
Michael Stonebraker and
Dan Suciu},
title = {The Seattle Report on Database Research},
journal = {{SIGMOD} Rec.},
volume = {48},
number = {4},
pages = {44--53},
year = {2019},
url = {https://doi.org/10.1145/3385658.3385668},
doi = {10.1145/3385658.3385668},
timestamp = {Thu, 02 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigmod/AbadiAABBBBCCDD19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/XueQZLZSC19,
author = {Lei Xue and
Chenxiong Qian and
Hao Zhou and
Xiapu Luo and
Yajin Zhou and
Yuru Shao and
Alvin T. S. Chan},
title = {NDroid: Toward Tracking Information Flows Across Multiple Android
Contexts},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {14},
number = {3},
pages = {814--828},
year = {2019},
url = {https://doi.org/10.1109/TIFS.2018.2866347},
doi = {10.1109/TIFS.2018.2866347},
timestamp = {Mon, 05 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/XueQZLZSC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cascon/ChangTLJSK19,
author = {Yee{-}Kang Chang and
Patrick Tiu and
Eric Lau and
Leo Christy Jesuraj and
Alvin So and
Gilbert Kwan},
editor = {Tima Pakfetrat and
Guy{-}Vincent Jourdan and
Kostas Kontogiannis and
Robert F. Enenkel},
title = {Hands-on workshop on fast, efficient {\&} seriously open cloud-native
Java},
booktitle = {Proceedings of the 29th Annual International Conference on Computer
Science and Software Engineering, {CASCON} 2019, Markham, Ontario,
Canada, November 4-6, 2019},
pages = {373--375},
publisher = {{ACM}},
year = {2019},
url = {https://dl.acm.org/doi/10.5555/3370272.3370322},
doi = {10.5555/3370272.3370322},
timestamp = {Wed, 04 May 2022 13:02:28 +0200},
biburl = {https://dblp.org/rec/conf/cascon/ChangTLJSK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emo/RoyGANDS19,
author = {Proteek Chandan Roy and
Andrey K. Guber and
Mohammad Abouali and
A. Pouyan Nejadhashemi and
Kalyanmoy Deb and
Alvin J. M. Smucker},
editor = {Kalyanmoy Deb and
Erik D. Goodman and
Carlos A. Coello Coello and
Kathrin Klamroth and
Kaisa Miettinen and
Sanaz Mostaghim and
Patrick M. Reed},
title = {Simulation Optimization of Water Usage and Crop Yield Using Precision
Irrigation},
booktitle = {Evolutionary Multi-Criterion Optimization - 10th International Conference,
{EMO} 2019, East Lansing, MI, USA, March 10-13, 2019, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {11411},
pages = {695--706},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-12598-1\_55},
doi = {10.1007/978-3-030-12598-1\_55},
timestamp = {Wed, 10 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emo/RoyGANDS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccsci/DewiMC19,
author = {Lusiana Citra Dewi and
Meiliana and
Alvin Chandra},
editor = {Widodo Budiharto},
title = {Social Media Web Scraping using Social Media Developers {API} and
Regex},
booktitle = {Enabling Collaboration to Escalate Impact of Research Results for
Society: The 4th International Conference on Computer Science and
Computational Intelligence, {ICCSCI} 2019, 12-13 September 2019, Yogyakarta,
Indonesia},
series = {Procedia Computer Science},
volume = {157},
pages = {444--449},
publisher = {Elsevier},
year = {2019},
url = {https://doi.org/10.1016/j.procs.2019.08.237},
doi = {10.1016/J.PROCS.2019.08.237},
timestamp = {Fri, 19 Apr 2024 13:31:15 +0200},
biburl = {https://dblp.org/rec/conf/iccsci/DewiMC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tale/KwanTC19,
author = {Alvin C. M. Kwan and
Kenny C. W. Tang and
Karie Chan},
title = {Impacts of Online Academic Help-Seeking Behaviors on Undergraduate
Student Self-Learning},
booktitle = {{IEEE} International Conference on Engineering, Technology and Education,
{TALE} 2019, Yogyakarta, Indonesia, December 10-13, 2019},
pages = {1--7},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/TALE48000.2019.9226027},
doi = {10.1109/TALE48000.2019.9226027},
timestamp = {Tue, 10 Nov 2020 09:31:22 +0100},
biburl = {https://dblp.org/rec/conf/tale/KwanTC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1911-08040,
author = {Alvin Chan and
Yew{-}Soon Ong},
title = {Poison as a Cure: Detecting {\&} Neutralizing Variable-Sized Backdoor
Attacks in Deep Neural Networks},
journal = {CoRR},
volume = {abs/1911.08040},
year = {2019},
url = {http://arxiv.org/abs/1911.08040},
eprinttype = {arXiv},
eprint = {1911.08040},
timestamp = {Tue, 03 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1911-08040.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1912-05699,
author = {Alvin Chan and
Yi Tay and
Yew{-}Soon Ong},
title = {What it Thinks is Important is Important: Robustness Transfers through
Input Gradients},
journal = {CoRR},
volume = {abs/1912.05699},
year = {2019},
url = {http://arxiv.org/abs/1912.05699},
eprinttype = {arXiv},
eprint = {1912.05699},
timestamp = {Thu, 02 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1912-05699.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1912-10185,
author = {Alvin Chan and
Yi Tay and
Yew{-}Soon Ong and
Jie Fu},
title = {Jacobian Adversarially Regularized Networks for Robustness},
journal = {CoRR},
volume = {abs/1912.10185},
year = {2019},
url = {http://arxiv.org/abs/1912.10185},
eprinttype = {arXiv},
eprint = {1912.10185},
timestamp = {Fri, 03 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1912-10185.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/ChienSCL18,
author = {Isabel Chien and
Alvin Shi and
Alex Chan and
Charlotta Lindvall},
editor = {Isabelle Bichindaritz and
Christian Guttmann and
Pau Herrero and
Fernando Koch and
Andrew Koster and
Richard Lenz and
Beatriz L{\'{o}}pez Ib{\'{a}}{\~{n}}ez and
Cindy Marling and
Clare Martin and
Sara Montagna and
Stefania Montani and
Manfred Reichert and
David Ria{\~{n}}o and
Michael Ignaz Schumacher and
Annette ten Teije and
Nirmalie Wiratunga},
title = {Identification of serious illness conversations in unstructured clinical
notes using deep neural networks},
booktitle = {Proceedings of the First Joint Workshop on {AI} in Health organized
as part of the Federated {AI} Meeting {(FAIM} 2018), co-located with
{AAMAS} 2018, {ICML} 2018, {IJCAI} 2018 and {ICCBR} 2018, Stockholm,
Sweden, July 13-14, 2018},
series = {{CEUR} Workshop Proceedings},
volume = {2142},
pages = {125--139},
publisher = {CEUR-WS.org},
year = {2018},
url = {https://ceur-ws.org/Vol-2142/paper8.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:31 +0100},
biburl = {https://dblp.org/rec/conf/ijcai/ChienSCL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/ChienSCL18a,
author = {Isabel Chien and
Alvin Shi and
Alex Chan and
Charlotta Lindvall},
editor = {Fernando Koch and
Andrew Koster and
David Ria{\~{n}}o and
Sara Montagna and
Michael Schumacher and
Annette ten Teije and
Christian Guttmann and
Manfred Reichert and
Isabelle Bichindaritz and
Pau Herrero and
Richard Lenz and
Beatriz L{\'{o}}pez and
Cindy Marling and
Clare Martin and
Stefania Montani and
Nirmalie Wiratunga},
title = {Identification of Serious Illness Conversations in Unstructured Clinical
Notes Using Deep Neural Networks},
booktitle = {Artificial Intelligence in Health - First International Workshop,
AIH@IJCAI 2018, Stockholm, Sweden, July 13-14, 2018, Revised Selected
Papers},
series = {Lecture Notes in Computer Science},
volume = {11326},
pages = {199--212},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-12738-1\_15},
doi = {10.1007/978-3-030-12738-1\_15},
timestamp = {Wed, 12 Jan 2022 09:08:26 +0100},
biburl = {https://dblp.org/rec/conf/ijcai/ChienSCL18a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/intcompsymp/MuchtarRMDDNC18,
author = {Kahlil Muchtar and
Faris Rahman and
Muhammad Rizky Munggaran and
Alvin Prayuda Juniarta Dwiyantoro and
Richard Dharmadi and
Indra Nugraha and
Chuan{-}Yu Chang},
editor = {Chuan{-}Yu Chang and
Chien{-}Chou Lin and
Horng{-}Horng Lin},
title = {An Efficient Event Detection Through Background Subtraction and Deep
Convolutional Nets},
booktitle = {New Trends in Computer Technologies and Applications - 23rd International
Computer Symposium, {ICS} 2018, Yunlin, Taiwan, December 20-22, 2018,
Revised Selected Papers},
series = {Communications in Computer and Information Science},
volume = {1013},
pages = {163--167},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-981-13-9190-3\_16},
doi = {10.1007/978-981-13-9190-3\_16},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/intcompsymp/MuchtarRMDDNC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-02444,
author = {Alvin Chan and
Lei Ma and
Felix Juefei{-}Xu and
Xiaofei Xie and
Yang Liu and
Yew{-}Soon Ong},
title = {Metamorphic Relation Based Adversarial Attacks on Differentiable Neural
Computer},
journal = {CoRR},
volume = {abs/1809.02444},
year = {2018},
url = {http://arxiv.org/abs/1809.02444},
eprinttype = {arXiv},
eprint = {1809.02444},
timestamp = {Tue, 03 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1809-02444.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/BeirlZCLZ17,
author = {Diana Beirl and
Anya Zeitlin and
Jerald Chan and
Kai Ip Alvin Loh and
Xiaodi Zhong},
editor = {Gloria Mark and
Susan R. Fussell and
Cliff Lampe and
m. c. schraefel and
Juan Pablo Hourcade and
Caroline Appert and
Daniel Wigdor},
title = {GotYourBack: An Internet of Toilets for the Trans* Community},
booktitle = {Proceedings of the 2017 {CHI} Conference on Human Factors in Computing
Systems, Denver, CO, USA, May 06-11, 2017, Extended Abstracts},
pages = {39--45},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3027063.3049272},
doi = {10.1145/3027063.3049272},
timestamp = {Tue, 06 Nov 2018 16:58:46 +0100},
biburl = {https://dblp.org/rec/conf/chi/BeirlZCLZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccad/ChangWGZZ0Z17,
author = {Liang Chang and
Zhaohao Wang and
Alvin Oliver Glova and
Jishen Zhao and
Youguang Zhang and
Yuan Xie and
Weisheng Zhao},
editor = {Sri Parameswaran},
title = {{PRESCOTT:} Preset-based cross-point architecture for spin-orbit-torque
magnetic random access memory},
booktitle = {2017 {IEEE/ACM} International Conference on Computer-Aided Design,
{ICCAD} 2017, Irvine, CA, USA, November 13-16, 2017},
pages = {245--252},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICCAD.2017.8203785},
doi = {10.1109/ICCAD.2017.8203785},
timestamp = {Tue, 07 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccad/ChangWGZZ0Z17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccsce/BalbinVAACI17,
author = {Jessie R. Balbin and
Leonardo D. Valiente and
Danielle Jaye S. Agron and
Alvin Vincent R. Antioquia and
Glenn D. Cua and
John Clement S. Ibo},
title = {Assessment of the standard level of oreochromis niloticus and chanos
chanos located in fish pen and wet market storage based on viola-jones,
thresholding and L{\({_\ast}\)}a{\({_\ast}\)}b color space},
booktitle = {7th {IEEE} International Conference on Control System, Computing and
Engineering, {ICCSCE} 2017, Penang, Malaysia, November 24-26, 2017},
pages = {258--262},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICCSCE.2017.8284415},
doi = {10.1109/ICCSCE.2017.8284415},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccsce/BalbinVAACI17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/ZhangJLC16,
author = {Tao Zhang and
He Jiang and
Xiapu Luo and
Alvin T. S. Chan},
title = {A Literature Review of Research in Bug Resolution: Tasks, Challenges
and Future Directions},
journal = {Comput. J.},
volume = {59},
number = {5},
pages = {741--773},
year = {2016},
url = {https://doi.org/10.1093/comjnl/bxv114},
doi = {10.1093/COMJNL/BXV114},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cj/ZhangJLC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijseke/ZhangYLC16,
author = {Tao Zhang and
Geunseok Yang and
Byungjeong Lee and
Alvin T. S. Chan},
title = {Guiding Bug Triage through Developer Analysis in Bug Reports},
journal = {Int. J. Softw. Eng. Knowl. Eng.},
volume = {26},
number = {3},
pages = {405--432},
year = {2016},
url = {https://doi.org/10.1142/S0218194016500170},
doi = {10.1142/S0218194016500170},
timestamp = {Wed, 22 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijseke/ZhangYLC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iiaiaai/ChenLCLC16,
author = {Der{-}Fa Chen and
Chun Hsu Lu and
Alvin Chang and
Hsieh His Liu and
Kuo Chih Cheng},
title = {The Relationships among Budgetary Slack, Customers' Relationship Quality
and Organizational Performance},
booktitle = {5th {IIAI} International Congress on Advanced Applied Informatics,
{IIAI-AAI} 2016, Kumamoto, Japan, July 10-14, 2016},
pages = {1157--1161},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/IIAI-AAI.2016.24},
doi = {10.1109/IIAI-AAI.2016.24},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iiaiaai/ChenLCLC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/qtna/TamVTK16,
author = {La Thanh Tam and
Alvin C. Valera and
Hwee{-}Pink Tan and
Cheryl Koh},
editor = {Winston Seah and
Yutaka Takahashi},
title = {Online Detection of Behavioral Change Using Unobtrusive Eldercare
Monitoring System},
booktitle = {Proceedings of the 11th International Conference on Queueing Theory
and Network Applications, {QTNA} 2016, Wellington, New Zealand, December
13-15, 2016},
pages = {16},
publisher = {{ACM}},
year = {2016},
url = {http://dl.acm.org/citation.cfm?id=3016053},
timestamp = {Tue, 06 Nov 2018 16:57:05 +0100},
biburl = {https://dblp.org/rec/conf/qtna/TamVTK16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/SivaramanCBKABV16,
author = {Anirudh Sivaraman and
Alvin Cheung and
Mihai Budiu and
Changhoon Kim and
Mohammad Alizadeh and
Hari Balakrishnan and
George Varghese and
Nick McKeown and
Steve Licking},
editor = {Marinho P. Barcellos and
Jon Crowcroft and
Amin Vahdat and
Sachin Katti},
title = {Packet Transactions: High-Level Programming for Line-Rate Switches},
booktitle = {Proceedings of the {ACM} {SIGCOMM} 2016 Conference, Florianopolis,
Brazil, August 22-26, 2016},
pages = {15--28},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2934872.2934900},
doi = {10.1145/2934872.2934900},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigcomm/SivaramanCBKABV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ahswn/ShiWC15,
author = {Peizhong Shi and
Yun Wang and
Alvin T. S. Chan},
title = {{ECA-CTP:} An Enhanced Congestion Avoidance Mechanism for the {CTP}
Protocol in Wireless Sensor Networks},
journal = {Ad Hoc Sens. Wirel. Networks},
volume = {28},
number = {3-4},
pages = {289--317},
year = {2015},
url = {http://www.oldcitypublishing.com/journals/ahswn-home/ahswn-issue-contents/ahswn-volume-28-number-3-4-2015/ahswn-28-3-4-p-289-317/},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ahswn/ShiWC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chinaf/WangDSCC15,
author = {Huaimin Wang and
Bo Ding and
Dian{-}xi Shi and
Jiannong Cao and
Alvin T. S. Chan},
title = {Auxo: an architecture-centric framework supporting the online tuning
of software adaptivity},
journal = {Sci. China Inf. Sci.},
volume = {58},
number = {9},
pages = {1--15},
year = {2015},
url = {https://doi.org/10.1007/s11432-015-5307-9},
doi = {10.1007/S11432-015-5307-9},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/chinaf/WangDSCC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/interfaces/AndersonAGRRSU15,
author = {Ross Anderson and
Itai Ashlagi and
David Gamarnik and
Michael Rees and
Alvin E. Roth and
Tayfun S{\"{o}}nmez and
M. Utku {\"{U}}nver},
title = {Kidney Exchange and the Alliance for Paired Donation: Operations Research
Changes the Way Kidneys Are Transplanted},
journal = {Interfaces},
volume = {45},
number = {1},
pages = {26--42},
year = {2015},
url = {https://doi.org/10.1287/inte.2014.0766},
doi = {10.1287/INTE.2014.0766},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/interfaces/AndersonAGRRSU15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcsci/AdriantoYC15,
author = {Dennise Adrianto and
Violitta Yesmaya and
Alvin Chandra},
title = {Increasing Learning Frequency through Education Based Game},
journal = {J. Comput. Sci.},
volume = {11},
number = {3},
pages = {567--572},
year = {2015},
url = {https://doi.org/10.3844/jcssp.2015.567.572},
doi = {10.3844/JCSSP.2015.567.572},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcsci/AdriantoYC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/ChanZNNVTG15,
author = {Wai Hong Ronald Chan and
Pengfei Zhang and
Ido Nevat and
Sai Ganesh Nagarajan and
Alvin C. Valera and
Hwee{-}Xian Tan and
Natarajan Gautam},
title = {Adaptive Duty Cycling in Sensor Networks With Energy Harvesting Using
Continuous-Time Markov Chain and Fluid Models},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {33},
number = {12},
pages = {2687--2700},
year = {2015},
url = {https://doi.org/10.1109/JSAC.2015.2478717},
doi = {10.1109/JSAC.2015.2478717},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jsac/ChanZNNVTG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jss/HuangCTCL15,
author = {Rubing Huang and
Jinfu Chen and
Dave Towey and
Alvin T. S. Chan and
Yansheng Lu},
title = {Aggregate-strength interaction test suite prioritization},
journal = {J. Syst. Softw.},
volume = {99},
pages = {36--51},
year = {2015},
url = {https://doi.org/10.1016/j.jss.2014.09.002},
doi = {10.1016/J.JSS.2014.09.002},
timestamp = {Tue, 18 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jss/HuangCTCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/SethuNCOC15,
author = {Raj Sekar Sethu and
Hong Seng Ng and
Alvin Chan and
Cheng Nee Ong and
Sieng Fong Chan},
title = {Characterization of copper precipitates on aluminum copper bond pads
formed after plasma clean and de-ionized water exposure},
journal = {Microelectron. Reliab.},
volume = {55},
number = {7},
pages = {1101--1108},
year = {2015},
url = {https://doi.org/10.1016/j.microrel.2015.03.018},
doi = {10.1016/J.MICROREL.2015.03.018},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/SethuNCOC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/LiuXZBC15,
author = {Xuan Liu and
Bin Xiao and
Shigeng Zhang and
Kai Bu and
Alvin Chan},
title = {{STEP:} {A} Time-Efficient Tag Searching Protocol in Large {RFID}
Systems},
journal = {{IEEE} Trans. Computers},
volume = {64},
number = {11},
pages = {3265--3277},
year = {2015},
url = {https://doi.org/10.1109/TC.2015.2394461},
doi = {10.1109/TC.2015.2394461},
timestamp = {Wed, 23 Aug 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/LiuXZBC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcis/ChangHLL15,
author = {Alvin Chang and
Ting{-}Kai Hwang and
Yung{-}Ming Li and
Lien{-}Fa Lin},
title = {A Contextual Group Recommender Mechanism for Location-based Service},
booktitle = {21st Americas Conference on Information Systems, {AMCIS} 2015, Puerto
Rico, August 13-15, 2015},
publisher = {Association for Information Systems},
year = {2015},
url = {http://aisel.aisnet.org/amcis2015/e-Biz/GeneralPresentations/2},
timestamp = {Sun, 13 Dec 2015 13:10:52 +0100},
biburl = {https://dblp.org/rec/conf/amcis/ChangHLL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compsac/LeongCN15,
author = {Hong Va Leong and
Alvin T. S. Chan and
Grace Ngai},
editor = {Sheikh Iqbal Ahamed and
Carl K. Chang and
William C. Chu and
Ivica Crnkovic and
Pao{-}Ann Hsiung and
Gang Huang and
Jingwei Yang},
title = {Approximate Web Database Snapshots},
booktitle = {39th {IEEE} Annual Computer Software and Applications Conference,
{COMPSAC} 2015, Taichung, Taiwan, July 1-5, 2015. Volume 2},
pages = {367--376},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/COMPSAC.2015.144},
doi = {10.1109/COMPSAC.2015.144},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/compsac/LeongCN15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/ChanZZNVTG15,
author = {Wai Hong Ronald Chan and
Pengfei Zhang and
Wenyu Zhang and
Ido Nevat and
Alvin C. Valera and
Hwee{-}Xian Tan and
Natarajan Gautam},
title = {Adaptive duty cycling in sensor networks via Continuous Time Markov
Chain modelling},
booktitle = {2015 {IEEE} International Conference on Communications, {ICC} 2015,
London, United Kingdom, June 8-12, 2015},
pages = {6669--6674},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICC.2015.7249388},
doi = {10.1109/ICC.2015.7249388},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icc/ChanZZNVTG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/ZhangYLC15,
author = {Tao Zhang and
Geunseok Yang and
Byungjeong Lee and
Alvin T. S. Chan},
editor = {Roger L. Wainwright and
Juan Manuel Corchado and
Alessio Bechini and
Jiman Hong},
title = {Predicting severity of bug report by mining bug repository with concept
profile},
booktitle = {Proceedings of the 30th Annual {ACM} Symposium on Applied Computing,
Salamanca, Spain, April 13-17, 2015},
pages = {1553--1558},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2695664.2695872},
doi = {10.1145/2695664.2695872},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sac/ZhangYLC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/SivaramanBCKLVB15,
author = {Anirudh Sivaraman and
Mihai Budiu and
Alvin Cheung and
Changhoon Kim and
Steve Licking and
George Varghese and
Hari Balakrishnan and
Mohammad Alizadeh and
Nick McKeown},
title = {Packet Transactions: {A} Programming Model for Data-Plane Algorithms
at Hardware Speed},
journal = {CoRR},
volume = {abs/1512.05023},
year = {2015},
url = {http://arxiv.org/abs/1512.05023},
eprinttype = {arXiv},
eprint = {1512.05023},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/SivaramanBCKLVB15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejasmp/LinWCCCS14,
author = {Yi{-}Ju Lin and
Tien{-}Ming Wang and
Ta{-}Chun Chen and
Yin{-}Lin Chen and
Wei{-}Chen Chang and
Alvin Wen{-}Yu Su},
title = {Musical note analysis of solo violin recordings using recursive regularization},
journal = {{EURASIP} J. Audio Speech Music. Process.},
volume = {2014},
pages = {25},
year = {2014},
url = {https://doi.org/10.1186/s13636-014-0025-6},
doi = {10.1186/S13636-014-0025-6},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ejasmp/LinWCCCS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BoersAVSNAPCKSCYPNYBKZCSRR14,
author = {Michael Boers and
Bagher Afshar and
Iason Vassiliou and
Saikat Sarkar and
Sean T. Nicolson and
Ehsan Adabi and
Bevin George Perumana and
Theodoros Chalvatzis and
Spyros Kavvadias and
Padmanava Sen and
Wei Liat Chan and
Alvin Hsing{-}Ting Yu and
Ali Parsa and
Med Nariman and
Seunghwan Yoon and
Alfred Grau Besoli and
Chryssoula A. Kyriazidou and
Gerasimos Zochios and
Jesus A. Castaneda and
Tirdad Sowlati and
Maryam Rofougaran and
Ahmadreza Rofougaran},
title = {A 16TX/16RX 60 GHz 802.11ad Chipset With Single Coaxial Interface
and Polarization Diversity},
journal = {{IEEE} J. Solid State Circuits},
volume = {49},
number = {12},
pages = {3031--3045},
year = {2014},
url = {https://doi.org/10.1109/JSSC.2014.2356462},
doi = {10.1109/JSSC.2014.2356462},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/BoersAVSNAPCKSCYPNYBKZCSRR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WangWLZDWMSWCWJY14,
author = {X. Shawn Wang and
Xin Wang and
Fei Lu and
Chen Zhang and
Zongyu Dong and
Li Wang and
Rui Ma and
Zitao Shi and
Albert Z. Wang and
Mau{-}Chung Frank Chang and
Dawn Wang and
Alvin J. Joseph and
C. Patrick Yue},
title = {Concurrent Design Analysis of High-Linearity {SP10T} Switch With 8.5
kV {ESD} Protection},
journal = {{IEEE} J. Solid State Circuits},
volume = {49},
number = {9},
pages = {1927--1941},
year = {2014},
url = {https://doi.org/10.1109/JSSC.2014.2331956},
doi = {10.1109/JSSC.2014.2331956},
timestamp = {Mon, 08 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/WangWLZDWMSWCWJY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/ChangLCLSY14,
author = {Da{-}Wei Chang and
Ing{-}Chao Lin and
Yu{-}Shiang Chien and
Ching{-}Lun Lin and
Alvin W. Y. Su and
Chung{-}Ping Young},
title = {{CASA:} Contention-Aware Scratchpad Memory Allocation for Online Hybrid
On-Chip Memory Management},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {33},
number = {12},
pages = {1806--1817},
year = {2014},
url = {https://doi.org/10.1109/TCAD.2014.2363385},
doi = {10.1109/TCAD.2014.2363385},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcad/ChangLCLSY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsn/QianLSC14,
author = {Chenxiong Qian and
Xiapu Luo and
Yuru Shao and
Alvin T. S. Chan},
title = {On Tracking Information Flows through {JNI} in Android Applications},
booktitle = {44th Annual {IEEE/IFIP} International Conference on Dependable Systems
and Networks, {DSN} 2014, Atlanta, GA, USA, June 23-26, 2014},
pages = {180--191},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/DSN.2014.30},
doi = {10.1109/DSN.2014.30},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsn/QianLSC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismir/HsuWLMS14,
author = {Ling{-}Chi Hsu and
Yu{-}Lin Wang and
Yi{-}Ju Lin and
Cheryl D. Metcalf and
Alvin W. Y. Su},
editor = {Hsin{-}Min Wang and
Yi{-}Hsuan Yang and
Jin Ha Lee},
title = {Detection of Motor Changes in Violin Playing by {EMG} Signals},
booktitle = {Proceedings of the 15th International Society for Music Information
Retrieval Conference, {ISMIR} 2014, Taipei, Taiwan, October 27-31,
2014},
pages = {495--500},
year = {2014},
url = {http://www.terasoft.com.tw/conf/ismir2014/proceedings/T090\_227\_Paper.pdf},
timestamp = {Tue, 04 Jan 2022 10:38:12 +0100},
biburl = {https://dblp.org/rec/conf/ismir/HsuWLMS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/BoersVSNAAPCKSC14,
author = {Michael Boers and
Iason Vassiliou and
Saikat Sarkar and
Sean T. Nicolson and
Ehsan Adabi and
Bagher Afshar and
Bevin G. Perumana and
Theodoros Chalvatzis and
Spyros Kavadias and
Padmanava Sen and
Wei Liat Chan and
Alvin Hsing{-}Ting Yu and
Ali Parsa and
Med Nariman and
Seunghwan Yoon and
Alfred Grau Besoli and
Chryssoula A. Kyriazidou and
Gerasimos Zochios and
Namik Kocaman and
Adesh Garg and
Hans Eberhart and
Phil Yang and
Hongyu Xie and
Hea Joung Kim and
Alireza Tarighat Mehrabani and
David Garrett and
Andrew J. Blanksby and
Mong Kuan Wong and
Durai Pandian Thirupathi and
Siukai Mak and
Radha Srinivasan and
Amir Ibrahim and
Ersin Sengul and
Vincent Roussel and
Po{-}Chao Huang and
Tsuifang Yeh and
Murat Mese and
Jesus A. Castaneda and
Brima Ibrahim and
Tirdad Sowlati and
Maryam Rofougaran and
Ahmadreza Rofougaran},
title = {20.2 {A} 16TX/16RX 60GHz 802.11ad chipset with single coaxial interface
and polarization diversity},
booktitle = {2014 {IEEE} International Conference on Solid-State Circuits Conference,
{ISSCC} 2014, Digest of Technical Papers, San Francisco, CA, USA,
February 9-13, 2014},
pages = {344--345},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISSCC.2014.6757462},
doi = {10.1109/ISSCC.2014.6757462},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/BoersVSNAAPCKSC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/LiNCHLC14,
author = {Jiajia Li and
Grace Ngai and
Stephen Chi{-}fai Chan and
Kien A. Hua and
Hong Va Leong and
Alvin T. S. Chan},
editor = {Kien A. Hua and
Yong Rui and
Ralf Steinmetz and
Alan Hanjalic and
Apostol Natsev and
Wenwu Zhu},
title = {From Writing to Painting: {A} Kinect-Based Cross-Modal Chinese Painting
Generation System},
booktitle = {Proceedings of the {ACM} International Conference on Multimedia, {MM}
'14, Orlando, FL, USA, November 03 - 07, 2014},
pages = {57--66},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2647868.2654911},
doi = {10.1145/2647868.2654911},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mm/LiNCHLC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/percom/WeiC13,
author = {Edwin J. Y. Wei and
Alvin T. S. Chan},
title = {{CAMPUS:} {A} middleware for automated context-aware adaptation decision
making at run time},
journal = {Pervasive Mob. Comput.},
volume = {9},
number = {1},
pages = {35--56},
year = {2013},
url = {https://doi.org/10.1016/j.pmcj.2011.10.002},
doi = {10.1016/J.PMCJ.2011.10.002},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/percom/WeiC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmetrics/YangCYLHC13,
author = {Lei Yang and
Jiannong Cao and
Yin Yuan and
Tao Li and
Andy Han and
Alvin T. S. Chan},
title = {A framework for partitioning and execution of data stream applications
in mobile cloud computing},
journal = {{SIGMETRICS} Perform. Evaluation Rev.},
volume = {40},
number = {4},
pages = {23--32},
year = {2013},
url = {https://doi.org/10.1145/2479942.2479946},
doi = {10.1145/2479942.2479946},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigmetrics/YangCYLHC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tist/ChinXWCWZ13,
author = {Alvin Chin and
Bin Xu and
Hao Wang and
Lele Chang and
Hao Wang and
Lijun Zhu},
title = {Connecting people through physical proximity and physical resources
at a conference},
journal = {{ACM} Trans. Intell. Syst. Technol.},
volume = {4},
number = {3},
pages = {50:1--50:21},
year = {2013},
url = {https://doi.org/10.1145/2483669.2483683},
doi = {10.1145/2483669.2483683},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tist/ChinXWCWZ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apsipa/LinCS13,
author = {Yi{-}Ju Lin and
Wei{-}Chen Chang and
Alvin W. Y. Su},
title = {Quantitative evaluation of violin solo performance},
booktitle = {Asia-Pacific Signal and Information Processing Association Annual
Summit and Conference, {APSIPA} 2013, Kaohsiung, Taiwan, October 29
- November 1, 2013},
pages = {1--6},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/APSIPA.2013.6694296},
doi = {10.1109/APSIPA.2013.6694296},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/apsipa/LinCS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/ChukNCCH13,
author = {Tim Chuk and
Alvin C. W. Ng and
Emanuele Coviello and
Antoni B. Chan and
Janet H. Hsiao},
editor = {Markus Knauff and
Michael Pauen and
Natalie Sebanz and
Ipke Wachsmuth},
title = {Understanding eye movements in face recognition with hidden Markov
model},
booktitle = {Proceedings of the 35th Annual Meeting of the Cognitive Science Society,
CogSci 2013, Berlin, Germany, July 31 - August 3, 2013},
publisher = {cognitivesciencesociety.org},
year = {2013},
url = {https://escholarship.org/uc/item/1197p8wz},
timestamp = {Tue, 30 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cogsci/ChukNCCH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpca/ShiWLC13,
author = {Peizhong Shi and
Yun Wang and
Kai Li and
Alvin T. S. Chan},
editor = {Qiaohong Zu and
Maria Vargas{-}Vera and
Bo Hu},
title = {Cross-Layer Adaptive End-to-End Delay Control for Asynchronous Duty-Cycle
Wireless Sensor Networks},
booktitle = {Pervasive Computing and the Networked World - Joint International
Conference, {ICPCA/SWS} 2013, Vina del Mar, Chile, December 5-7, 2013.
Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {8351},
pages = {520--531},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-319-09265-2\_53},
doi = {10.1007/978-3-319-09265-2\_53},
timestamp = {Tue, 14 May 2019 10:00:51 +0200},
biburl = {https://dblp.org/rec/conf/icpca/ShiWLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icst/NiuNLC13,
author = {Xintao Niu and
Changhai Nie and
Yu Lei and
Alvin T. S. Chan},
title = {Identifying Failure-Inducing Combinations Using Tuple Relationship},
booktitle = {Sixth {IEEE} International Conference on Software Testing, Verification
and Validation, {ICST} 2013 Workshops Proceedings, Luxembourg, Luxembourg,
March 18-22, 2013},
pages = {271--280},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/ICSTW.2013.38},
doi = {10.1109/ICSTW.2013.38},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icst/NiuNLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lcn/ShiWLC13,
author = {Peizhong Shi and
Yun Wang and
Kai Li and
Alvin T. S. Chan},
title = {Delay-Constrained and Energy-Balanced broadcasts for low duty-cycled
wireless sensor networks},
booktitle = {38th Annual {IEEE} Conference on Local Computer Networks, Sydney,
Australia, October 21-24, 2013},
pages = {284--287},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/LCN.2013.6761250},
doi = {10.1109/LCN.2013.6761250},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/lcn/ShiWLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/LoTNCLC13,
author = {Kenneth W. K. Lo and
Will W. W. Tang and
Grace Ngai and
Alvin T. S. Chan and
Hong Va Leong and
Stephen C. F. Chan},
editor = {Sung Y. Shin and
Jos{\'{e}} Carlos Maldonado},
title = {i*Chameleon: a platform for developing multimodal application with
comprehensive development cycle},
booktitle = {Proceedings of the 28th Annual {ACM} Symposium on Applied Computing,
{SAC} '13, Coimbra, Portugal, March 18-22, 2013},
pages = {1103--1108},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2480362.2480570},
doi = {10.1145/2480362.2480570},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sac/LoTNCLC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trustcom/YuC13,
author = {Xiaochuan Yu and
Alvin Chan Toong Shoon},
title = {A Hypercubic Overlay Using Bloom-Filter Based Addressing for a Non-dedicated
Distributed Tag-Based Pub/Sub System},
booktitle = {12th {IEEE} International Conference on Trust, Security and Privacy
in Computing and Communications, TrustCom 2013 / 11th {IEEE} International
Symposium on Parallel and Distributed Processing with Applications,
{ISPA-13} / 12th {IEEE} International Conference on Ubiquitous Computing
and Communications, IUCC-2013, Melbourne, Australia, July 16-18, 2013},
pages = {1008--1015},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/TrustCom.2013.123},
doi = {10.1109/TRUSTCOM.2013.123},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/trustcom/YuC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trustcom/YuC13a,
author = {Xiaochuan Yu and
Alvin Chan Toong Shoon},
title = {Hope: {A} Fault-Tolerant Distributed Pub/Sub Architecture for Large-Scale
Dynamic Network Environment},
booktitle = {12th {IEEE} International Conference on Trust, Security and Privacy
in Computing and Communications, TrustCom 2013 / 11th {IEEE} International
Symposium on Parallel and Distributed Processing with Applications,
{ISPA-13} / 12th {IEEE} International Conference on Ubiquitous Computing
and Communications, IUCC-2013, Melbourne, Australia, July 16-18, 2013},
pages = {1399--1406},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/TrustCom.2013.169},
doi = {10.1109/TRUSTCOM.2013.169},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/trustcom/YuC13a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEcloud/YangCTLC12,
author = {Lei Yang and
Jiannong Cao and
Shaojie Tang and
Tao Li and
Alvin T. S. Chan},
editor = {Rong Chang},
title = {A Framework for Partitioning and Execution of Data Stream Applications
in Mobile Cloud Computing},
booktitle = {2012 {IEEE} Fifth International Conference on Cloud Computing, Honolulu,
HI, USA, June 24-29, 2012},
pages = {794--802},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/CLOUD.2012.97},
doi = {10.1109/CLOUD.2012.97},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/IEEEcloud/YangCTLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bhi/MaLLGWKL12,
author = {Heather Ting Ma and
Haiyan Lv and
Alvin F. W. Li and
James F. Griffith and
Yixiang Wang and
Anthony Wai Leung Kwok and
Ping Chung Leung},
title = {Perfusion study on Modic changes of spine based on {DCE-MRI}},
booktitle = {Proceedings of 2012 {IEEE-EMBS} International Conference on Biomedical
and Health Informatics, Hong Kong, China, January 5-7, 2012},
pages = {365--367},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/BHI.2012.6211589},
doi = {10.1109/BHI.2012.6211589},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bhi/MaLLGWKL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12,
author = {Socrates D. Vamvakos and
Bendik Kleveland and
Dipak K. Sikdar and
B. K. Ahuja and
Haidang Lin and
Jayaprakash Balachandran and
Wignes Balakrishnan and
Aldo Bottelli and
Jawji Chen and
Xiaole Chen and
Jae Choi and
Jeong Choi and
Rajesh Chopra and
Sanjay Dabral and
Kalyan Dasari and
Ronald B. David and
Shaishav Desai and
Claude R. Gauthier and
Mahmudul Hassan and
Kuo{-}Chiang Hsieh and
Ramosan Canagasaby and
Jeff Kumala and
E. P. Kwon and
Ben Lee and
Ming Liu and
Gurupada Mandal and
Sundari Mitra and
Byeong Cheol Na and
Siddharth Panwar and
Jay Patel and
Chethan Rao and
Vithal Rao and
Richard Rouse and
Ritesh Saraf and
Subramanian Seshadri and
Jae{-}K. Sim and
Clement Szeto and
Alvin Wang and
Jason Yeung},
title = {A 576 Mb {DRAM} with 16-channel 10.3125Gbps serial {I/O} and 14.5
ns latency},
booktitle = {Proceedings of the 38th European Solid-State Circuit conference, {ESSCIRC}
2012, Bordeaux, France, September 17-21, 2012},
pages = {458--461},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ESSCIRC.2012.6341354},
doi = {10.1109/ESSCIRC.2012.6341354},
timestamp = {Thu, 26 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/LimTSACRW12,
author = {Kevin T. Lim and
Yoshio Turner and
Jose Renato Santos and
Alvin AuYoung and
Jichuan Chang and
Parthasarathy Ranganathan and
Thomas F. Wenisch},
title = {System-level implications of disaggregated memory},
booktitle = {18th {IEEE} International Symposium on High Performance Computer Architecture,
{HPCA} 2012, New Orleans, LA, USA, 25-29 February, 2012},
pages = {189--200},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/HPCA.2012.6168955},
doi = {10.1109/HPCA.2012.6168955},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpca/LimTSACRW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpcc/XiaochuanS12,
author = {Xiaochuan Yu and
Alvin Chan Toong Shoon},
editor = {Geyong Min and
Jia Hu and
Lei (Chris) Liu and
Laurence Tianruo Yang and
Seetharami Seelam and
Laurent Lef{\`{e}}vre},
title = {A Hypercubic Event-dissemination Overlay Using Structure-aware Addressing
for Distributed XML-based Pub/sub System},
booktitle = {14th {IEEE} International Conference on High Performance Computing
and Communication {\&} 9th {IEEE} International Conference on
Embedded Software and Systems, {HPCC-ICESS} 2012, Liverpool, United
Kingdom, June 25-27, 2012},
pages = {179--186},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/HPCC.2012.32},
doi = {10.1109/HPCC.2012.32},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpcc/XiaochuanS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccel/LinLCHL12,
author = {Chih{-}Lung Lin and
Chia{-}Sheng Li and
Yi{-}Ming Chang and
Chia{-}Che Hung and
Alvin Lin},
title = {3D stylus and pressure sensing system for capacitive touch panel},
booktitle = {{IEEE} International Conference on Consumer Electronics, {ICCE} 2012,
Las Vegas, NV, USA, January 13-16, 2012},
pages = {215--216},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICCE.2012.6161835},
doi = {10.1109/ICCE.2012.6161835},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccel/LinLCHL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/percom/LoTLCCN12,
author = {Kenneth W. K. Lo and
Wai Wa Tang and
Hong Va Leong and
Alvin T. S. Chan and
Stephen Chi{-}fai Chan and
Grace Ngai},
title = {i{\({_\ast}\)}Chameleon: {A} unified web service framework for integrating
multimodal interaction devices},
booktitle = {Tenth Annual {IEEE} International Conference on Pervasive Computing
and Communications, PerCom 2012, March 19-23, 2012, Lugano, Switzerland,
Workshop Proceedings},
pages = {106--111},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/PerComW.2012.6197460},
doi = {10.1109/PERCOMW.2012.6197460},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/percom/LoTLCCN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sin/PohYL12,
author = {Geong Sen Poh and
Kok{-}Lim Alvin Yau and
Mee Hong Ling},
editor = {Manoj Singh Gaur and
Atilla El{\c{c}}i and
Oleg B. Makarevich and
Mehmet A. Orgun and
Virendra Singh},
title = {Analysis of a secure cooperative channel sensing protocol for cognitive
radio networks},
booktitle = {5th International Conference of Security of Information and Networks,
{SIN} '12, Jaipur, India, October 22 - 26, 2012},
pages = {41--46},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2388576.2388581},
doi = {10.1145/2388576.2388581},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sin/PohYL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/VeronikaWNMR11,
author = {Merlin Veronika and
Roy E. Welsch and
Alvin Ng and
Paul Matsudaira and
Jagath C. Rajapakse},
title = {Correlation of cell membrane dynamics and cell motility},
journal = {{BMC} Bioinform.},
volume = {12},
number = {{S-13}},
pages = {S19},
year = {2011},
url = {https://doi.org/10.1186/1471-2105-12-S13-S19},
doi = {10.1186/1471-2105-12-S13-S19},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/VeronikaWNMR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esticas/ChangLYSSLWLCC11,
author = {Da{-}Wei Chang and
Sheng{-}Fu Liang and
Chung{-}Ping Young and
Fu{-}Zen Shaw and
Alvin W. Y. Su and
You{-}De Liu and
Yu{-}Lin Wang and
Yi{-}Che Liu and
Jing{-}Jhong Chen and
Chun{-}Yu Chen},
title = {A Versatile Wireless Portable Monitoring System for Brain-Behavior
Approaches},
journal = {{IEEE} J. Emerg. Sel. Topics Circuits Syst.},
volume = {1},
number = {4},
pages = {440--450},
year = {2011},
url = {https://doi.org/10.1109/JETCAS.2011.2181454},
doi = {10.1109/JETCAS.2011.2181454},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/esticas/ChangLYSSLWLCC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/TangLCCLN11,
author = {Wai Wa Tang and
Kenneth W. K. Lo and
Alvin T. S. Chan and
Stephen Chi{-}fai Chan and
Hong Va Leong and
Grace Ngai},
editor = {Desney S. Tan and
Saleema Amershi and
Bo Begole and
Wendy A. Kellogg and
Manas Tungare},
title = {i*Chameleon: a scalable and extensible framework for multimodal interaction},
booktitle = {Proceedings of the International Conference on Human Factors in Computing
Systems, {CHI} 2011, Extended Abstracts Volume, Vancouver, BC, Canada,
May 7-12, 2011},
pages = {305--310},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/1979742.1979703},
doi = {10.1145/1979742.1979703},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/TangLCCLN11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ithings/XuCWCZYWZ11,
author = {Bin Xu and
Alvin Chin and
Hao Wang and
Lele Chang and
Ke Zhang and
Fangxi Yin and
Hao Wang and
Li Zhang},
title = {Physical Proximity and Online User Behaviour in an Indoor Mobile Social
Networking Application},
booktitle = {2011 {IEEE} International Conference on Internet of Things (iThings)
{\&} 4th {IEEE} International Conference on Cyber, Physical and
Social Computing (CPSCom), Dalian, China, October 19-22, 2011},
pages = {273--282},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/iThings/CPSCom.2011.74},
doi = {10.1109/ITHINGS/CPSCOM.2011.74},
timestamp = {Wed, 17 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ithings/XuCWCZYWZ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mdm/XiaochuanA11,
author = {Xiaochuan Yu and
Alvin Chan Toong Shoon},
editor = {Arkady B. Zaslavsky and
Panos K. Chrysanthis and
Dik Lun Lee and
Dipanjan Chakraborty and
Vana Kalogeraki and
Mohamed F. Mokbel and
Chi{-}Yin Chow},
title = {A Time/Space Efficient {XML} Filtering System for Mobile Environment},
booktitle = {12th {IEEE} International Conference on Mobile Data Management, {MDM}
2011, Lule{\aa}, Sweden, June 6-9, 2011, Volume 1},
pages = {184--193},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/MDM.2011.78},
doi = {10.1109/MDM.2011.78},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mdm/XiaochuanA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sies/LinCSCC11,
author = {Yi{-}Li Lin and
Wei{-}Tso Chen and
Alvin W. Y. Su and
Da{-}Wei Chang and
Chung{-}Ho Chen},
title = {A low cost, low power, high scalability and dependability processor-cluster
platform},
booktitle = {Industrial Embedded Systems (SIES), 2011 6th {IEEE} International
Symposium on, {SIES} 2011. Vasteras, Sweden, June 15-17, 2011},
pages = {95--98},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/SIES.2011.5953689},
doi = {10.1109/SIES.2011.5953689},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/sies/LinCSCC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/hci/YeoCLTLH11,
author = {Alvin W. Yeo and
Po{-}Chan Chiu and
Tek Yong Lim and
Ping{-}Ping Tan and
Terrin Lim and
Idyawati Hussein},
editor = {Ian Douglas and
Zhengjie Liu},
title = {Usability in Malaysia},
booktitle = {Global Usability},
series = {Human-Computer Interaction Series},
pages = {211--222},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-0-85729-304-6\_12},
doi = {10.1007/978-0-85729-304-6\_12},
timestamp = {Wed, 14 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/series/hci/YeoCLTLH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jise/WangCSS10,
author = {Jing{-}Xin Wang and
Yung{-}Chang Chiu and
Alvin Wen{-}Yu Su and
Ce{-}Kuen Shieh},
title = {On Parallelizing {H.264/AVC} Rate-Distortion Optimization Baseline
Profile Encoder},
journal = {J. Inf. Sci. Eng.},
volume = {26},
number = {2},
pages = {409--426},
year = {2010},
url = {http://www.iis.sinica.edu.tw/page/jise/2010/201003\_06.html},
timestamp = {Fri, 16 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jise/WangCSS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hipc/WangWCC10,
author = {Yinfeng Wang and
Cho{-}Li Wang and
Jiannong Cao and
Alvin T. S. Chan},
title = {Optimizing data acquisition by sensor-channel co-allocation in wireless
sensor networks},
booktitle = {2010 International Conference on High Performance Computing, HiPC
2010, Dona Paula, Goa, India, December 19-22, 2010},
pages = {1--10},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/HIPC.2010.5713167},
doi = {10.1109/HIPC.2010.5713167},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hipc/WangWCC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/WeiC10,
author = {Edwin J. Y. Wei and
Alvin T. S. Chan},
editor = {Sung Y. Shin and
Sascha Ossowski and
Michael Schumacher and
Mathew J. Palakal and
Chih{-}Cheng Hung},
title = {Towards semantic-based adaptation decisions for context-aware mobile
computing},
booktitle = {Proceedings of the 2010 {ACM} Symposium on Applied Computing (SAC),
Sierre, Switzerland, March 22-26, 2010},
pages = {563--567},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1774088.1774205},
doi = {10.1145/1774088.1774205},
timestamp = {Sun, 02 Jun 2019 21:18:37 +0200},
biburl = {https://dblp.org/rec/conf/sac/WeiC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jise/SiaoCS09,
author = {Yi{-}Song Siao and
Wei{-}Chen Chang and
Alvin Wen{-}Yu Su},
title = {Pitch Detection/Tracking Strategy for Musical Recordings of Solo Bowed-String
and Wind Instruments},
journal = {J. Inf. Sci. Eng.},
volume = {25},
number = {4},
pages = {1239--1253},
year = {2009},
url = {http://www.iis.sinica.edu.tw/page/jise/2009/200907\_17.html},
timestamp = {Fri, 16 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jise/SiaoCS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/crowncom/YauKT09,
author = {Kok{-}Lim Alvin Yau and
Peter Komisarczuk and
Paul D. Teal},
editor = {Thomas Kaiser and
Markus Fidler},
title = {A context-aware and Intelligent Dynamic Channel Selection scheme for
cognitive radio networks},
booktitle = {4th International {ICST} Conference on Cognitive Radio Oriented Wireless
Networks and Communications, {CROWNCOM} 2009, Hannover, Germany, June
22-24, 2009},
pages = {1--6},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/CROWNCOM.2009.5189427},
doi = {10.1109/CROWNCOM.2009.5189427},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/crowncom/YauKT09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cse/HuangCCSSL09,
author = {Sheng{-}Wei Huang and
Yung{-}Chang Chiu and
Zhong{-}Ho Chen and
Ce{-}Kuen Shieh and
Alvin Wen{-}Yu Su and
Tyng{-}Yeu Liang},
title = {A Region-Based Allocation Approach for Page-Based Scratch-Pad Memory
in Embedded Systems},
booktitle = {Proceedings of the 12th {IEEE} International Conference on Computational
Science and Engineering, {CSE} 2009, Vancouver, BC, Canada, August
29-31, 2009},
pages = {9--16},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/CSE.2009.350},
doi = {10.1109/CSE.2009.350},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cse/HuangCCSSL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/MartinG09,
author = {Alvin F. Martin and
Craig S. Greenberg},
title = {{NIST} 2008 speaker recognition evaluation: performance across telephone
and room microphone channels},
booktitle = {10th Annual Conference of the International Speech Communication Association,
{INTERSPEECH} 2009, Brighton, United Kingdom, September 6-10, 2009},
pages = {2579--2582},
publisher = {{ISCA}},
year = {2009},
url = {https://doi.org/10.21437/Interspeech.2009-679},
doi = {10.21437/INTERSPEECH.2009-679},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/MartinG09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijpcc/CheungYCC08,
author = {Ronnie Cheung and
Gang Yao and
Jiannong Cao and
Alvin T. S. Chan},
title = {A fuzzy service adaptation engine for context-aware mobile computing
middleware},
journal = {Int. J. Pervasive Comput. Commun.},
volume = {4},
number = {2},
pages = {147--165},
year = {2008},
url = {https://doi.org/10.1108/17427370810890256},
doi = {10.1108/17427370810890256},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijpcc/CheungYCC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ivs/ChangLGKRYSZKS08,
author = {Remco Chang and
Alvin Lee and
Mohammad Ghoniem and
Robert Kosara and
William Ribarsky and
Jing Yang and
Evan A. Suma and
Caroline Ziemkiewicz and
Daniel A. Kern and
Agus Sudjianto},
title = {Scalable and interactive visual analysis of financial wire transactions
for fraud detection},
journal = {Inf. Vis.},
volume = {7},
number = {1},
pages = {63--76},
year = {2008},
url = {https://doi.org/10.1057/palgrave.ivs.9500172},
doi = {10.1057/PALGRAVE.IVS.9500172},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ivs/ChangLGKRYSZKS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/ChuangC08,
author = {Siu Nam Chuang and
Alvin T. S. Chan},
title = {Dynamic QoS Adaptation for Mobile Middleware},
journal = {{IEEE} Trans. Software Eng.},
volume = {34},
number = {6},
pages = {738--752},
year = {2008},
url = {https://doi.org/10.1109/TSE.2008.44},
doi = {10.1109/TSE.2008.44},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tse/ChuangC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/twc/YuCZWCCL08,
author = {Wanrong Yu and
Jiannong Cao and
Xingming Zhou and
Xiaodong Wang and
Keith C. C. Chan and
Alvin T. S. Chan and
Hong Va Leong},
title = {A High-Throughput {MAC} Protocol for Wireless Ad Hoc Networks},
journal = {{IEEE} Trans. Wirel. Commun.},
volume = {7},
number = {1},
pages = {135--145},
year = {2008},
url = {https://doi.org/10.1109/TWC.2008.06094},
doi = {10.1109/TWC.2008.06094},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/twc/YuCZWCCL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/LeongC08,
author = {Hong Va Leong and
Alvin T. S. Chan},
editor = {Roger L. Wainwright and
Hisham Haddad},
title = {Special track on Mobile Computing and Applications: editorial message},
booktitle = {Proceedings of the 2008 {ACM} Symposium on Applied Computing (SAC),
Fortaleza, Ceara, Brazil, March 16-20, 2008},
pages = {1876--1877},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1363686.1364142},
doi = {10.1145/1363686.1364142},
timestamp = {Tue, 06 Nov 2018 11:06:48 +0100},
biburl = {https://dblp.org/rec/conf/sac/LeongC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semco/WeiC08,
author = {Edwin J. Y. Wei and
Alvin T. S. Chan},
title = {Semantic Approach to Middleware-Driven Run-Time Context-Aware Adaptation
Decision},
booktitle = {Proceedings of the 2th {IEEE} International Conference on Semantic
Computing {(ICSC} 2008), August 4-7, 2008, Santa Clara, California,
{USA}},
pages = {440--447},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ICSC.2008.49},
doi = {10.1109/ICSC.2008.49},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/semco/WeiC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejwcn/ChenXWLCCC07,
author = {Yingwen Chen and
Ming Xu and
Huaimin Wang and
Hong Va Leong and
Jiannong Cao and
Keith C. C. Chan and
Alvin T. S. Chan},
title = {An Energy-Efficient Framework for Multirate Query in Wireless Sensor
Networks},
journal = {{EURASIP} J. Wirel. Commun. Netw.},
volume = {2007},
year = {2007},
url = {https://doi.org/10.1155/2007/48984},
doi = {10.1155/2007/48984},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ejwcn/ChenXWLCCC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/ChowLC07,
author = {Chi{-}Yin Chow and
Hong Va Leong and
Alvin T. S. Chan},
title = {GroCoca: group-based peer-to-peer cooperative caching in mobile environment},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {25},
number = {1},
pages = {179--191},
year = {2007},
url = {https://doi.org/10.1109/JSAC.2007.070118},
doi = {10.1109/JSAC.2007.070118},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/ChowLC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euc/WeiC07,
author = {Edwin J. Y. Wei and
Alvin T. S. Chan},
editor = {Tei{-}Wei Kuo and
Edwin Hsing{-}Mean Sha and
Minyi Guo and
Laurence Tianruo Yang and
Zili Shao},
title = {Towards Context-Awareness in Ubiquitous Computing},
booktitle = {Embedded and Ubiquitous Computing, International Conference, {EUC}
2007, Taipei, Taiwan, December 17-20, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4808},
pages = {706--717},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-77092-3\_61},
doi = {10.1007/978-3-540-77092-3\_61},
timestamp = {Tue, 14 May 2019 10:00:47 +0200},
biburl = {https://dblp.org/rec/conf/euc/WeiC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cluster/CaoCSDG06,
author = {Jiannong Cao and
Alvin T. S. Chan and
Yudong Sun and
Sajal K. Das and
Minyi Guo},
title = {A taxonomy of application scheduling tools for high performance cluster
computing},
journal = {Clust. Comput.},
volume = {9},
number = {3},
pages = {355--371},
year = {2006},
url = {https://doi.org/10.1007/s10586-006-9747-2},
doi = {10.1007/S10586-006-9747-2},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cluster/CaoCSDG06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/concurrency/CaoCCC06,
author = {Jiannong Cao and
Alvin T. S. Chan and
Stephen C. F. Chan and
Nick K. C. Cheung},
title = {A robust monitor construct with runtime fault detection},
journal = {Concurr. Comput. Pract. Exp.},
volume = {18},
number = {5},
pages = {471--500},
year = {2006},
url = {https://doi.org/10.1002/cpe.934},
doi = {10.1002/CPE.934},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/concurrency/CaoCCC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/internet/ZhengCN06,
author = {Yongjie Zheng and
Alvin T. S. Chan and
Grace Ngai},
title = {Applying Coordination for Service Adaptation in Mobile Computing},
journal = {{IEEE} Internet Comput.},
volume = {10},
number = {5},
pages = {61--67},
year = {2006},
url = {https://doi.org/10.1109/MIC.2006.93},
doi = {10.1109/MIC.2006.93},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/internet/ZhengCN06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spe/ZhengCN06,
author = {Yongjie Zheng and
Alvin T. S. Chan and
Grace Ngai},
title = {{MCL:} a MobiGATE coordination language for highly adaptive and reconfigurable
mobile middleware},
journal = {Softw. Pract. Exp.},
volume = {36},
number = {11-12},
pages = {1355--1380},
year = {2006},
url = {https://doi.org/10.1002/spe.757},
doi = {10.1002/SPE.757},
timestamp = {Thu, 09 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/spe/ZhengCN06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/ChangS06,
author = {Wei{-}Chen Chang and
Alvin Wen{-}Yu Su},
title = {A Multichannel Recurrent Network Analysis/Synthesis Model for Coupled-String
Instruments},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {14},
number = {6},
pages = {2233--2241},
year = {2006},
url = {https://doi.org/10.1109/TASL.2006.872610},
doi = {10.1109/TASL.2006.872610},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taslp/ChangS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/ZhengC06,
author = {Yongjie Zheng and
Alvin T. S. Chan},
title = {MobiGATE: {A} Mobile Computing Middleware for the Active Deployment
of Transport Services},
journal = {{IEEE} Trans. Software Eng.},
volume = {32},
number = {1},
pages = {35--50},
year = {2006},
url = {https://doi.org/10.1109/TSE.2006.11},
doi = {10.1109/TSE.2006.11},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tse/ZhengC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/twc/FuMT06,
author = {Alvin Fu and
Eytan H. Modiano and
John N. Tsitsiklis},
title = {Optimal transmission scheduling over a fading channel with energy
and deadline constraints},
journal = {{IEEE} Trans. Wirel. Commun.},
volume = {5},
number = {3},
pages = {630--641},
year = {2006},
url = {https://doi.org/10.1109/TWC.2006.1611093},
doi = {10.1109/TWC.2006.1611093},
timestamp = {Mon, 22 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/twc/FuMT06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/YeoC06,
author = {Alvin W. Yeo and
Po{-}Chan Chiu},
editor = {Gary M. Olson and
Robin Jeffries},
title = {Gaze estimation model for eye drawing},
booktitle = {Extended Abstracts Proceedings of the 2006 Conference on Human Factors
in Computing Systems, {CHI} 2006, Montr{\'{e}}al, Qu{\'{e}}bec,
Canada, April 22-27, 2006},
pages = {1559--1564},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1125451.1125736},
doi = {10.1145/1125451.1125736},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/YeoC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/etra/ChanY06,
author = {Po{-}Chan Chiu and
Alvin W. Yeo},
editor = {Kari{-}Jouko R{\"{a}}ih{\"{a}} and
Andrew T. Duchowski},
title = {Eye drawing with gaze estimation model},
booktitle = {Proceedings of the Eye Tracking Research {\&} Application Symposium,
{ETRA} 2006, San Diego, California, USA, March 27-29, 2006},
pages = {57},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1117309.1117342},
doi = {10.1145/1117309.1117342},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/etra/ChanY06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euc/CheungCYC06,
author = {Ronnie Cheung and
Jiannong Cao and
Gang Yao and
Alvin T. S. Chan},
editor = {Edwin Hsing{-}Mean Sha and
Sung{-}Kook Han and
Cheng{-}Zhong Xu and
Moon{-}hae Kim and
Laurence Tianruo Yang and
Bin Xiao},
title = {A Fuzzy-Based Service Adaptation Middleware for Context-Aware Computing},
booktitle = {Embedded and Ubiquitous Computing, International Conference, {EUC}
2006, Seoul, Korea, August 1-4, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4096},
pages = {580--590},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11802167\_59},
doi = {10.1007/11802167\_59},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/euc/CheungCYC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fuzzIEEE/ChuangC06,
author = {Siu{-}Nam Chuang and
Alvin T. S. Chan},
title = {MobiPADS++: {A} Mobile QoS Middleware based on Hierarchical Fuzzy
Control},
booktitle = {{IEEE} International Conference on Fuzzy Systems, {FUZZ-IEEE} 2006,
Vancouver, BC, Canada, July 16-21, 2006},
pages = {2223--2230},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/FUZZY.2006.1682009},
doi = {10.1109/FUZZY.2006.1682009},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/fuzzIEEE/ChuangC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gpc/YuCZWCCL06,
author = {Wanrong Yu and
Jiannong Cao and
Xingming Zhou and
Xiaodong Wang and
Keith C. C. Chan and
Alvin T. S. Chan and
Hong Va Leong},
editor = {Yeh{-}Ching Chung and
Jos{\'{e}} E. Moreira},
title = {{VWMAC:} An Efficient {MAC} Protocol for Resolving Intra-flow Contention
in Wireless Ad Hoc Networks},
booktitle = {Advances in Grid and Pervasive Computing, First International Conference,
{GPC} 2006, Taichung, Taiwan, May 3-5, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3947},
pages = {498--508},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11745693\_49},
doi = {10.1007/11745693\_49},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gpc/YuCZWCCL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscc/ZhengC06,
author = {Yongjie Zheng and
Alvin T. S. Chan},
editor = {Paolo Bellavista and
Chi{-}Ming Chen and
Antonio Corradi and
Mahmoud Daneshmand},
title = {Coordinated Composition of Services for Adaptive Mobile Middleware},
booktitle = {Proceedings of the 11th {IEEE} Symposium on Computers and Communications
{(ISCC} 2006), 26-29 June 2006, Cagliari, Sardinia, Italy},
pages = {789--794},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ISCC.2006.55},
doi = {10.1109/ISCC.2006.55},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iscc/ZhengC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mdm/ChenLXCCC06,
author = {Yingwen Chen and
Hong Va Leong and
Ming Xu and
Jiannong Cao and
Keith C. C. Chan and
Alvin T. S. Chan},
title = {In-Network Data Processing forWireless Sensor Networks},
booktitle = {7th International Conference on Mobile Data Management {(MDM} 2006),
Nara, Japan, May 9-13, 2006},
pages = {26},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/MDM.2006.96},
doi = {10.1109/MDM.2006.96},
timestamp = {Wed, 14 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mdm/ChenLXCCC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/LeongC06,
author = {Hong Va Leong and
Alvin T. S. Chan},
editor = {Hisham Haddad},
title = {Editorial message: special track on mobile computing and applications},
booktitle = {Proceedings of the 2006 {ACM} Symposium on Applied Computing (SAC),
Dijon, France, April 23-27, 2006},
pages = {1120--1121},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1141277.1141544},
doi = {10.1145/1141277.1141544},
timestamp = {Tue, 06 Nov 2018 11:06:49 +0100},
biburl = {https://dblp.org/rec/conf/sac/LeongC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/Chan05,
author = {Alvin T. S. Chan},
title = {Mobile cookies management on a smart card},
journal = {Commun. {ACM}},
volume = {48},
number = {11},
pages = {38--43},
year = {2005},
url = {https://doi.org/10.1145/1096000.1096002},
doi = {10.1145/1096000.1096002},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/Chan05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spe/ChanCCZ05,
author = {Fan Chan and
Jiannong Cao and
Alvin T. S. Chan and
Kang Zhang},
title = {Visual programming support for graph-oriented parallel/distributed
processing},
journal = {Softw. Pract. Exp.},
volume = {35},
number = {15},
pages = {1409--1439},
year = {2005},
url = {https://doi.org/10.1002/spe.676},
doi = {10.1002/SPE.676},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/spe/ChanCCZ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/ChanCC05,
author = {Alvin T. S. Chan and
Jiannong Cao and
C. K. Chan},
title = {{WEBGOP:} collaborative web services based on graph-oriented programming},
journal = {{IEEE} Trans. Syst. Man Cybern. Part {A}},
volume = {35},
number = {6},
pages = {811--830},
year = {2005},
url = {https://doi.org/10.1109/TSMCA.2005.851342},
doi = {10.1109/TSMCA.2005.851342},
timestamp = {Mon, 25 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsmc/ChanCC05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/www/ChuangC05,
author = {Siu Nam Chuang and
Alvin T. S. Chan},
title = {Active Service for Mobile Middleware},
journal = {World Wide Web},
volume = {8},
number = {2},
pages = {127--157},
year = {2005},
url = {https://doi.org/10.1007/s11280-004-4871-5},
doi = {10.1007/S11280-004-4871-5},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/www/ChuangC05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icws/ChanW05,
author = {Alvin T. S. Chan and
Dick K. T. Wan},
title = {Web Services Mobility in a Pocket},
booktitle = {2005 {IEEE} International Conference on Web Services {(ICWS} 2005),
11-15 July 2005, Orlando, FL, {USA}},
pages = {159--166},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ICWS.2005.134},
doi = {10.1109/ICWS.2005.134},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icws/ChanW05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isads/CaoXCL05,
author = {Jiannong Cao and
Wei Xu and
Alvin T. S. Chan and
Jing Li},
editor = {Qingquan Qian},
title = {A reliable multicast protocol for mailbox-based mobile agent communications},
booktitle = {2005 International Symposium on Autonomous Decentralized Systems,
{ISADS} 2005, Chengdu, China, April 4-8, 2005, Proceedings},
pages = {74--81},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ISADS.2005.1452023},
doi = {10.1109/ISADS.2005.1452023},
timestamp = {Tue, 06 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isads/CaoXCL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mdm/ChowLC05,
author = {Chi{-}Yin Chow and
Hong Va Leong and
Alvin T. S. Chan},
editor = {Panos K. Chrysanthis and
George Samaras},
title = {Distributed group-based cooperative caching in a mobile broadcast
environment},
booktitle = {6th International Conference on Mobile Data Management {(MDM} 2005),
Ayia Napa, Cyprus, May 9-13, 2005},
pages = {97--106},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1071246.1071261},
doi = {10.1145/1071246.1071261},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mdm/ChowLC05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rtcsa/CaoXCFJ05,
author = {Jiannong Cao and
Na Xing and
Alvin T. S. Chan and
Yulin Feng and
Beihong Jin},
title = {Service Adaptation Using Fuzzy Theory in Context-Aware Mobile Computing
Middleware},
booktitle = {11th {IEEE} International Conference on Embedded and Real-Time Computing
Systems and Applications {(RTCSA} 2005), 17-19 August 2005, Hong Kong,
China},
pages = {496--501},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/RTCSA.2005.93},
doi = {10.1109/RTCSA.2005.93},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/rtcsa/CaoXCFJ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/LeongC05,
author = {Hong Va Leong and
Alvin T. S. Chan},
editor = {Hisham Haddad and
Lorie M. Liebrock and
Andrea Omicini and
Roger L. Wainwright},
title = {Editorial message: special track on mobile computing and applications},
booktitle = {Proceedings of the 2005 {ACM} Symposium on Applied Computing (SAC),
Santa Fe, New Mexico, USA, March 13-17, 2005},
pages = {1118--1119},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1066677.1066930},
doi = {10.1145/1066677.1066930},
timestamp = {Tue, 06 Nov 2018 11:06:45 +0100},
biburl = {https://dblp.org/rec/conf/sac/LeongC05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cera/ChanCLN04,
author = {Alvin T. S. Chan and
Stephen Chi{-}fai Chan and
Hong Va Leong and
Vincent Ng},
title = {Advancement in Co-Operative Internet Computing Research and Applications},
journal = {Concurr. Eng. Res. Appl.},
volume = {12},
number = {3},
pages = {171--173},
year = {2004},
url = {https://doi.org/10.1177/1063293X04047007},
doi = {10.1177/1063293X04047007},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cera/ChanCLN04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/ChanCL04,
author = {Alvin T. S. Chan and
Siu Nam Chuang and
Jiannong Cao and
Hong Va Leong},
title = {An Event-Driven Middleware for Mobile Context Awareness},
journal = {Comput. J.},
volume = {47},
number = {3},
pages = {278--288},
year = {2004},
url = {https://doi.org/10.1093/comjnl/47.3.278},
doi = {10.1093/COMJNL/47.3.278},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cj/ChanCL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ida/PampalkWC04,
author = {Elias Pampalk and
Gerhard Widmer and
Alvin T. S. Chan},
title = {A new approach to hierarchical clustering and structuring of data
with Self-Organizing Maps},
journal = {Intell. Data Anal.},
volume = {8},
number = {2},
pages = {131--149},
year = {2004},
url = {http://content.iospress.com/articles/intelligent-data-analysis/ida00158},
timestamp = {Mon, 18 May 2015 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ida/PampalkWC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/ChanCCG04,
author = {Fan Chan and
Jiannong Cao and
Alvin T. S. Chan and
Minyi Guo},
title = {Programming Support for {MPMD} Parallel Computing in ClusterGOP},
journal = {{IEICE} Trans. Inf. Syst.},
volume = {87-D},
number = {7},
pages = {1693--1702},
year = {2004},
url = {http://search.ieice.org/bin/summary.php?id=e87-d\_7\_1693},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieicet/ChanCCG04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcpol/ChanCLC04,
author = {Alvin T. S. Chan and
Jiannong Cao and
Chi{-}Kin Liu and
Weidong Cao},
title = {{VPL:} An Online Distance Learning Platform for Virtual Programming
Laboratory},
journal = {Int. J. Comput. Process. Orient. Lang.},
volume = {17},
number = {1},
pages = {41--59},
year = {2004},
url = {https://doi.org/10.1142/S0219427904000973},
doi = {10.1142/S0219427904000973},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijcpol/ChanCLC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/internet/ChuangCCC04,
author = {Siu Nam Chuang and
Alvin T. S. Chan and
Jiannong Cao and
Ronnie Cheung},
title = {Actively Deployable Mobile Services for Adaptive Web Access},
journal = {{IEEE} Internet Comput.},
volume = {8},
number = {2},
pages = {26--33},
year = {2004},
url = {https://doi.org/10.1109/MIC.2004.1273483},
doi = {10.1109/MIC.2004.1273483},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/internet/ChuangCCC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/CaoCCWD04,
author = {Jiannong Cao and
Min Cao and
Alvin T. S. Chan and
Gengfeng Wu and
Sajal K. Das},
title = {A framework for architecting and high-level programming support of
{CORBA} applications},
journal = {J. Parallel Distributed Comput.},
volume = {64},
number = {6},
pages = {725--739},
year = {2004},
url = {https://doi.org/10.1016/j.jpdc.2003.10.006},
doi = {10.1016/J.JPDC.2003.10.006},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jpdc/CaoCCWD04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/WongCL04,
author = {Eugene Y. C. Wong and
Alvin T. S. Chan and
Hong Va Leong},
title = {Xstream: {A} Middleware for Streaming {XML} Contents over Wireless
Environments},
journal = {{IEEE} Trans. Software Eng.},
volume = {30},
number = {12},
pages = {918--935},
year = {2004},
url = {https://doi.org/10.1109/TSE.2004.108},
doi = {10.1109/TSE.2004.108},
timestamp = {Thu, 15 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tse/WongCL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aina/ChowLC04,
author = {Chi{-}Yin Chow and
Hong Va Leong and
Alvin T. S. Chan},
title = {Cache Signatures for Peer-to-Peer Cooperative Caching in Mobile Environments},
booktitle = {18th International Conference on Advanced Information Networking and
Applications {(AINA} 2004), 29-31 March 2004, Fukuoka, Japan},
pages = {96--101},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/AINA.2004.1283894},
doi = {10.1109/AINA.2004.1283894},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aina/ChowLC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compsac/ZhengC04,
author = {Yongjie Zheng and
Alvin T. S. Chan},
title = {Stream Composition for Highly Adaptive and Reconfigurable Mobile Middleware},
booktitle = {28th International Computer Software and Applications Conference {(COMPSAC}
2004), Design and Assessment of Trustworthy Software-Based Systems,
27-30 September 2004, Hong Kong, China, Proceedings},
pages = {122--127},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/CMPSAC.2004.1342815},
doi = {10.1109/CMPSAC.2004.1342815},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/compsac/ZhengC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdcsw/ChowLC04,
author = {Chi{-}Yin Chow and
Hong Va Leong and
Alvin T. S. Chan},
title = {Peer-to-Peer Cooperative Caching in Mobile Environments},
booktitle = {24th International Conference on Distributed Computing Systems Workshops
{(ICDCS} 2004 Workshops), 23-24 March 2004, Hachioji, Tokyo, Japan},
pages = {528--533},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/ICDCSW.2004.1284083},
doi = {10.1109/ICDCSW.2004.1284083},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdcsw/ChowLC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/HuangCLSK04,
author = {Win{-}Bin Huang and
Wei{-}Chen Chang and
Yen{-}Wei Lu and
Alvin Wen{-}Yu Su and
Yau{-}Hwang Kuo},
title = {Halftone/contone conversion using neural networks},
booktitle = {Proceedings of the 2004 International Conference on Image Processing,
{ICIP} 2004, Singapore, October 24-27, 2004},
pages = {3547--3550},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/ICIP.2004.1421882},
doi = {10.1109/ICIP.2004.1421882},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icip/HuangCLSK04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/CaoTC04,
author = {Jiannong Cao and
Daniel C. K. Tse and
Alvin T. S. Chan},
title = {PDAgent: {A} Platform for Developing and Deploying Mobile Agent-Enabled
Applications for Wireless Devices},
booktitle = {33rd International Conference on Parallel Processing {(ICPP} 2004),
15-18 August 2004, Montreal, Quebec, Canada},
pages = {510--517},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/ICPP.2004.1327961},
doi = {10.1109/ICPP.2004.1327961},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpp/CaoTC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/ChowLC04,
author = {Chi{-}Yin Chow and
Hong Va Leong and
Alvin T. S. Chan},
title = {Group-Based Cooperative Cache Management for Mobile Clients in a Mobile
Environment},
booktitle = {33rd International Conference on Parallel Processing {(ICPP} 2004),
15-18 August 2004, Montreal, Quebec, Canada},
pages = {83--90},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/ICPP.2004.1327907},
doi = {10.1109/ICPP.2004.1327907},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpp/ChowLC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/ZhengC04,
author = {Yongjie Zheng and
Alvin T. S. Chan},
title = {MobiGATE: {A} Mobile Gateway Proxy for the Active Deployment of Transport
Entities},
booktitle = {33rd International Conference on Parallel Processing {(ICPP} 2004),
15-18 August 2004, Montreal, Quebec, Canada},
pages = {566--573},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/ICPP.2004.1327967},
doi = {10.1109/ICPP.2004.1327967},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpp/ZhengC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispa/ChanWC04,
author = {Alvin T. S. Chan and
Peter Y. H. Wong and
Siu Nam Chuang},
editor = {Jiannong Cao and
Laurence Tianruo Yang and
Minyi Guo and
Francis Chi{-}Moon Lau},
title = {{CRL:} {A} Context-Aware Request Language for Mobile Computing},
booktitle = {Parallel and Distributed Processing and Applications, Second InternationalSymposium,
{ISPA} 2004, Hong Kong, China, December 13-15, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3358},
pages = {529--533},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30566-8\_63},
doi = {10.1007/978-3-540-30566-8\_63},
timestamp = {Tue, 14 Apr 2020 13:23:10 +0200},
biburl = {https://dblp.org/rec/conf/ispa/ChanWC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispa/ChiuSWSL04,
author = {Yung{-}Chang Chiu and
Ce{-}Kuen Shieh and
Jing{-}Xin Wang and
Alvin Wen{-}Yu Su and
Tyng{-}Yeu Liang},
editor = {Jiannong Cao and
Laurence Tianruo Yang and
Minyi Guo and
Francis Chi{-}Moon Lau},
title = {A Real Time {MPEG-4} Parallel Encoder on Software Distributed Shared
Memory Systems},
booktitle = {Parallel and Distributed Processing and Applications, Second InternationalSymposium,
{ISPA} 2004, Hong Kong, China, December 13-15, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3358},
pages = {965--974},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30566-8\_110},
doi = {10.1007/978-3-540-30566-8\_110},
timestamp = {Sun, 21 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ispa/ChiuSWSL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispan/ChowLC04,
author = {Chi{-}Yin Chow and
Hong Va Leong and
Alvin T. S. Chan},
title = {Peer-to-Peer Cooperative Caching in a Hybrid Data Delivery Environment},
booktitle = {7th International Symposium on Parallel Architectures, Algorithms,
and Networks {(I-SPAN} 2004), 10-12 May 2004, Hong Kong, SAR, China},
pages = {79--85},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/ISPAN.2004.1300461},
doi = {10.1109/ISPAN.2004.1300461},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ispan/ChowLC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/Chan04,
author = {Alvin T. S. Chan},
editor = {Hisham Haddad and
Andrea Omicini and
Roger L. Wainwright and
Lorie M. Liebrock},
title = {Cookies on-the-move: managing cookies on a smart card},
booktitle = {Proceedings of the 2004 {ACM} Symposium on Applied Computing (SAC),
Nicosia, Cyprus, March 14-17, 2004},
pages = {1693--1697},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/967900.968236},
doi = {10.1145/967900.968236},
timestamp = {Tue, 06 Nov 2018 11:06:44 +0100},
biburl = {https://dblp.org/rec/conf/sac/Chan04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/LeongC04,
author = {Hong Va Leong and
Alvin T. S. Chan},
editor = {Hisham Haddad and
Andrea Omicini and
Roger L. Wainwright and
Lorie M. Liebrock},
title = {Editorial message: special track on mobile computing and applications},
booktitle = {Proceedings of the 2004 {ACM} Symposium on Applied Computing (SAC),
Nicosia, Cyprus, March 14-17, 2004},
pages = {1149--1150},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/967900.968134},
doi = {10.1145/967900.968134},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sac/LeongC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/WongCL04,
author = {Eugene Y. C. Wong and
Alvin T. S. Chan and
Hong Va Leong},
editor = {Hisham Haddad and
Andrea Omicini and
Roger L. Wainwright and
Lorie M. Liebrock},
title = {Efficient management of {XML} contents over wireless environment by
Xstream},
booktitle = {Proceedings of the 2004 {ACM} Symposium on Applied Computing (SAC),
Nicosia, Cyprus, March 14-17, 2004},
pages = {1122--1127},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/967900.968128},
doi = {10.1145/967900.968128},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sac/WongCL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scp/CaoCSZ03,
author = {Jiannong Cao and
Alvin T. S. Chan and
Yudong Sun and
Kang Zhang},
title = {Dynamic configuration management in a graph-oriented Distributed Programming
Environment},
journal = {Sci. Comput. Program.},
volume = {48},
number = {1},
pages = {43--65},
year = {2003},
url = {https://doi.org/10.1016/S0167-6423(02)00168-5},
doi = {10.1016/S0167-6423(02)00168-5},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/scp/CaoCSZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spe/CaoMCL03,
author = {Jiannong Cao and
Xiaoxing Ma and
Alvin T. S. Chan and
Jian Lu},
title = {Architecting and implementing distributed Web applications using the
graph-oriented approach},
journal = {Softw. Pract. Exp.},
volume = {33},
number = {9},
pages = {799--820},
year = {2003},
url = {https://doi.org/10.1002/spe.526},
doi = {10.1002/SPE.526},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/spe/CaoMCL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/ChanC03,
author = {Alvin T. S. Chan and
Siu Nam Chuang},
title = {MobiPADS: {A} Reflective Middleware for Context-Aware Mobile Computing},
journal = {{IEEE} Trans. Software Eng.},
volume = {29},
number = {12},
pages = {1072--1085},
year = {2003},
url = {https://doi.org/10.1109/TSE.2003.1265522},
doi = {10.1109/TSE.2003.1265522},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tse/ChanC03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/appt/RenCCL03,
author = {Zhihong Ren and
Jiannong Cao and
Alvin T. S. Chan and
Jing Li},
editor = {Xingming Zhou and
Stefan J{\"{a}}hnichen and
Ming Xu and
Jiannong Cao},
title = {Composition and Automation of Grid Services},
booktitle = {Advanced Parallel Programming Technologies, 5th International Workshop,
{APPT} 2003, Xiamen, China, September 17-19, 2003, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2834},
pages = {352--362},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/978-3-540-39425-9\_42},
doi = {10.1007/978-3-540-39425-9\_42},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/appt/RenCCL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compsac/WongCL03,
author = {Eugene Y. C. Wong and
Alvin T. S. Chan and
Hong Va Leong},
title = {Semantic-based Approach to Streaming {XML} Contents using Xstream},
booktitle = {27th International Computer Software and Applications Conference {(COMPSAC}
2003): Design and Assessment of Trustworthy Software-Based Systems,
3-6 November 2003, Dallas, TX, USA, Proceedings},
pages = {91},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/CMPSAC.2003.1245326},
doi = {10.1109/CMPSAC.2003.1245326},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/compsac/WongCL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/RenCCL03,
author = {Zhihong Ren and
Jiannong Cao and
Alvin T. S. Chan and
Jing Li},
title = {Toward a Formal Approach to Composite Web Service Construction and
Automation},
booktitle = {32nd International Conference on Parallel Processing {(ICPP} 2003),
6-9 October 2003, Kaohsiung, Taiwan},
pages = {436},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/ICPP.2003.1240608},
doi = {10.1109/ICPP.2003.1240608},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icpp/RenCCL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwl/ChanCLC03,
author = {Alvin T. S. Chan and
Jiannong Cao and
Chi{-}Kin Liu and
Weidong Cao},
editor = {Wanlei Zhou and
Paul Nicholson and
Brian J. Corbitt and
Joseph Fong},
title = {Design and Implementation of {VPL:} {A} Virtual Programming Laboratory
for Online Distance Learning},
booktitle = {Advances in Web-Based Learning - {ICWL} 2003, Second International
Conference, Melbourne, Australia, August 18-20, 2003, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2783},
pages = {509--519},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/978-3-540-45200-3\_47},
doi = {10.1007/978-3-540-45200-3\_47},
timestamp = {Fri, 22 Apr 2022 17:07:03 +0200},
biburl = {https://dblp.org/rec/conf/icwl/ChanCLC03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/FuMT03,
author = {Alvin Fu and
Eytan H. Modiano and
John N. Tsitsiklis},
title = {Optimal Energy Allocation for Delay-Constrained Data Transmission
over a Time-Varying Channel},
booktitle = {Proceedings {IEEE} {INFOCOM} 2003, The 22nd Annual Joint Conference
of the {IEEE} Computer and Communications Societies, San Franciso,
CA, USA, March 30 - April 3, 2003},
pages = {1095--1105},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/INFCOM.2003.1208946},
doi = {10.1109/INFCOM.2003.1208946},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/infocom/FuMT03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscc/ChanCC03,
author = {Alvin T. S. Chan and
C. K. Chan and
Jiannong Cao},
title = {Programming Distributed Web Services Using WebGOP: {A} Graph-Oriented
Approach},
booktitle = {Proceedings of the Eighth {IEEE} Symposium on Computers and Communications
{(ISCC} 2003), 30 June - 3 July 2003, Kiris-Kemer, Turkey},
pages = {413--418},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/ISCC.2003.1214154},
doi = {10.1109/ISCC.2003.1214154},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iscc/ChanCC03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/Chan03,
author = {Alvin T. S. Chan},
editor = {Gary B. Lamont and
Hisham Haddad and
George A. Papadopoulos and
Brajendra Panda},
title = {Integrating Smart Card Access to Web-Based Medical Information System},
booktitle = {Proceedings of the 2003 {ACM} Symposium on Applied Computing (SAC),
March 9-12, 2003, Melbourne, FL, {USA}},
pages = {246--250},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/952532.952583},
doi = {10.1145/952532.952583},
timestamp = {Tue, 06 Nov 2018 11:06:45 +0100},
biburl = {https://dblp.org/rec/conf/sac/Chan03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/ChanLCHLL03,
author = {Alvin T. S. Chan and
Hong Va Leong and
Joseph Chan and
Alan Hon and
Larry Lau and
Leo Li},
editor = {Gary B. Lamont and
Hisham Haddad and
George A. Papadopoulos and
Brajendra Panda},
title = {Bluepoint: {A} Bluetooth-based Architecture for Location-Positioning
Services},
booktitle = {Proceedings of the 2003 {ACM} Symposium on Applied Computing (SAC),
March 9-12, 2003, Melbourne, FL, {USA}},
pages = {990--995},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/952532.952727},
doi = {10.1145/952532.952727},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sac/ChanLCHLL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/LeongC03,
author = {Hong Va Leong and
Alvin T. S. Chan},
editor = {Gary B. Lamont and
Hisham Haddad and
George A. Papadopoulos and
Brajendra Panda},
title = {Mobile Computing and Applications Track Editorial},
booktitle = {Proceedings of the 2003 {ACM} Symposium on Applied Computing (SAC),
March 9-12, 2003, Melbourne, FL, {USA}},
pages = {853--854},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/952532.952701},
doi = {10.1145/952532.952701},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sac/LeongC03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/seke/MaLCCZ03,
author = {Xiaoxing Ma and
Jian Lu and
Jiannong Cao and
Alvin T. S. Chan and
Kang Zhang},
title = {A Graph-Oriented Approach to the Description and Implementation of
Distributed and Dynamic Software Architecture},
booktitle = {Proceedings of the Fifteenth International Conference on Software
Engineering {\&} Knowledge Engineering (SEKE'2003), Hotel Sofitel,
San Francisco Bay, CA, USA, July 1-3, 2003},
pages = {518--525},
year = {2003},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/seke/MaLCCZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/ChuangCCC03,
author = {Siu Nam Chuang and
Alvin T. S. Chan and
Jiannong Cao and
Ronnie Cheung},
editor = {Guszt{\'{a}}v Hencsey and
Bebo White and
Yih{-}Farn Robin Chen and
L{\'{a}}szl{\'{o}} Kov{\'{a}}cs and
Steve Lawrence},
title = {Dynamic service reconfiguration for wireless web access},
booktitle = {Proceedings of the Twelfth International World Wide Web Conference,
{WWW} 2003, Budapest, Hungary, May 20-24, 2003},
pages = {58--67},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/775152.775162},
doi = {10.1145/775152.775162},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/www/ChuangCCC03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/WongCL03,
author = {Eugene Y. C. Wong and
Alvin T. S. Chan and
Hong Va Leong},
editor = {Irwin King and
Tam{\'{a}}s M{\'{a}}ray},
title = {Xstream: {A} Framework for the Efficient Streaming of {XML} Documents
over a Wireless Environment},
booktitle = {Proceedings of the Twelfth International World Wide Web Conference
- Posters, {WWW} 2003, Budapest, Hungary, May 20-24, 2003},
year = {2003},
url = {http://www2003.org/cdrom/papers/poster/p317/p317-wong.html},
timestamp = {Wed, 17 Jul 2013 16:59:51 +0200},
biburl = {https://dblp.org/rec/conf/www/WongCL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/MutchBMRR02,
author = {David M. Mutch and
Alvin Berger and
Robert Mansourian and
Andreas Rytz and
Matthew{-}Alan Roberts},
title = {The limit fold change model: {A} practical approach for selecting
differentially expressed genes from microarray data},
journal = {{BMC} Bioinform.},
volume = {3},
pages = {17},
year = {2002},
url = {https://doi.org/10.1186/1471-2105-3-17},
doi = {10.1186/1471-2105-3-17},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/MutchBMRR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/internet/ChanTCL02,
author = {Alvin T. S. Chan and
Florine Tse and
Jiannong Cao and
Hong Va Leong},
title = {Enabling Distributed Corba Access to Smart Card Applications},
journal = {{IEEE} Internet Comput.},
volume = {6},
number = {3},
pages = {27--36},
year = {2002},
url = {https://doi.org/10.1109/MIC.2002.1003127},
doi = {10.1109/MIC.2002.1003127},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/internet/ChanTCL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/LukLDCCA02,
author = {Robert W. P. Luk and
Hong Va Leong and
Tharam S. Dillon and
Alvin T. S. Chan and
W. Bruce Croft and
James Allan},
title = {A survey in indexing and searching {XML} documents},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {53},
number = {6},
pages = {415--437},
year = {2002},
url = {https://doi.org/10.1002/asi.10056},
doi = {10.1002/ASI.10056},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasis/LukLDCCA02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpads/CaoCCW02,
author = {Jiannong Cao and
Min Cao and
Alvin T. S. Chan and
Gengfeng Wu},
title = {Architectural Level support for Dynamic Reconfiguration and Fault
Tolerance in Component-Based Distributed Software},
booktitle = {9th International Conference on Parallel and Distributed Systems,
{ICPADS} 2002, Taiwan, ROC, December 17-20, 2002},
pages = {251--256},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/ICPADS.2002.1183408},
doi = {10.1109/ICPADS.2002.1183408},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpads/CaoCCW02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/ChuangCC02,
author = {Siu Nam Chuang and
Alvin T. S. Chan and
Jiannong Cao},
title = {Dynamic Service Composition for Wireless Web Access},
booktitle = {31st International Conference on Parallel Processing {(ICPP} 2002),
20-23 August 2002, Vancouver, BC, Canada},
pages = {429--436},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/ICPP.2002.1040899},
doi = {10.1109/ICPP.2002.1040899},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpp/ChuangCC02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/MaCL02,
author = {Xiaoxing Ma and
Alvin T. S. Chan and
Jian Lu},
title = {WebGOP: {A} Framework for Architecting and Programming Dynamic Distributed
Web Applications},
booktitle = {31st International Conference on Parallel Processing {(ICPP} 2002),
20-23 August 2002, Vancouver, BC, Canada},
pages = {266--275},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/ICPP.2002.1040882},
doi = {10.1109/ICPP.2002.1040882},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpp/MaCL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwl/CaoCCY02,
author = {Jiannong Cao and
Alvin T. S. Chan and
Weidong Cao and
Cassidy Yeung},
editor = {Joseph Fong and
Ronnie Chu Ting Cheung and
Hong Va Leong and
Qing Li},
title = {Virtual Programming Lab for Online Distance Learning},
booktitle = {Advances in Web-Based Learning, First International Conference, {ICWL}
2002, Hong Kong, China, August 17-19, 2002, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2436},
pages = {216--227},
publisher = {Springer},
year = {2002},
url = {https://doi.org/10.1007/3-540-45689-9\_18},
doi = {10.1007/3-540-45689-9\_18},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icwl/CaoCCY02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/CaoLC02,
author = {Jiannong Cao and
Patrick Leung and
Alvin T. S. Chan},
title = {A Scalable and Reliable Multicast Communiction Service in Java},
booktitle = {16th International Parallel and Distributed Processing Symposium {(IPDPS}
2002), 15-19 April 2002, Fort Lauderdale, FL, USA, CD-ROM/Abstracts
Proceedings},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/IPDPS.2002.1016501},
doi = {10.1109/IPDPS.2002.1016501},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/CaoLC02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nnsp/ChangS02,
author = {Wei{-}Chen Chang and
Alvin Wen{-}Yu Su},
title = {A multi-channel recurrent network for synthesizing struck coupled-string
musical instruments},
booktitle = {Proceedings of the 12th {IEEE} Workshop on Neural Networks for Signal
Processing, {NNSP} 2002, Martigny, Valais, Switzerland, September
4-6, 2002},
pages = {677--686},
publisher = {{IEEE}},
year = {2002},
url = {https://doi.org/10.1109/NNSP.2002.1030079},
doi = {10.1109/NNSP.2002.1030079},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/nnsp/ChangS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/MakLC02,
author = {Jess Y. S. Mak and
Hong Va Leong and
Alvin T. S. Chan},
editor = {Gary B. Lamont and
Hisham Haddad and
George A. Papadopoulos and
Brajendra Panda},
title = {Dynamic structuring of web information for access visualization},
booktitle = {Proceedings of the 2002 {ACM} Symposium on Applied Computing (SAC),
March 10-14, 2002, Madrid, Spain},
pages = {778--784},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/508791.508942},
doi = {10.1145/508791.508942},
timestamp = {Tue, 06 Nov 2018 11:06:47 +0100},
biburl = {https://dblp.org/rec/conf/sac/MakLC02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/ChuangCC02,
author = {Siu{-}Nam Chuang and
Alvin T. S. Chan and
Jiannong Cao},
title = {An active service framework supporting wireless Web access},
booktitle = {2002 {IEEE} Wireless Communications and Networking Conference Record,
{WCNC} 2002, Orlando, Florida, USA, MArch 17-21, 2002},
pages = {630--634},
publisher = {{IEEE}},
year = {2002},
url = {https://doi.org/10.1109/WCNC.2002.993341},
doi = {10.1109/WCNC.2002.993341},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wcnc/ChuangCC02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ChanCCY01,
author = {Alvin T. S. Chan and
Jiannong Cao and
Henry C. B. Chan and
Gilbert H. Young},
title = {A web-enabled framework for smart card applications in health services},
journal = {Commun. {ACM}},
volume = {44},
number = {9},
pages = {76--82},
year = {2001},
url = {https://doi.org/10.1145/383694.383710},
doi = {10.1145/383694.383710},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cacm/ChanCCY01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cera/ChanLNC01,
author = {Stephen C. F. Chan and
Paul S. H. Lee and
Vincent T. Y. Ng and
Alvin T. S. Chan},
title = {Synchronous Collaborative Development of {UML} Models on the Internet},
journal = {Concurr. Eng. Res. Appl.},
volume = {9},
number = {2},
pages = {111--119},
year = {2001},
url = {https://doi.org/10.1177/1063293X0100900204},
doi = {10.1177/1063293X0100900204},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cera/ChanLNC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/join/CaoCC01,
author = {Jiannong Cao and
Nick K. C. Cheung and
Alvin T. S. Chan},
title = {{JDM:} Building Distributed Synchronization Support into Java},
journal = {J. Interconnect. Networks},
volume = {2},
number = {3},
pages = {269--282},
year = {2001},
url = {https://doi.org/10.1142/S0219265901000373},
doi = {10.1142/S0219265901000373},
timestamp = {Fri, 05 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/join/CaoCC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/doa/ChanTCL01,
author = {Alvin T. S. Chan and
Florine Tse and
Jiannong Cao and
Hong Va Leong},
title = {Distributed Object Programming Environment for Smart Card Application
Development},
booktitle = {3rd International Symposium on Distributed Objects and Applications,
{DOA} 2001, Rome, Italy, September 17-20, 2001},
pages = {251--259},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/DOA.2001.954090},
doi = {10.1109/DOA.2001.954090},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/doa/ChanTCL01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsn/CaoCC01,
author = {Jiannong Cao and
Nick K. C. Cheung and
Alvin T. S. Chan},
title = {Run-Time Fault Detection in Monitor Based Concurrent Programming},
booktitle = {2001 International Conference on Dependable Systems and Networks {(DSN}
2001) (formerly: FTCS), 1-4 July 2001, G{\"{o}}teborg, Sweden,
Proceedings},
pages = {357--368},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/DSN.2001.941420},
doi = {10.1109/DSN.2001.941420},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsn/CaoCC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/ChanCC01,
author = {Alvin T. S. Chan and
Steven Y. C. Chan and
Jiannong Cao},
editor = {Toshio Okamoto and
Roger Hartley and
Kinshuk and
John P. Klus},
title = {{SAC:} {A} Self-Paced and Adaptive Courseware System},
booktitle = {Proceedings {IEEE} International Conference on Advanced Learning Technology:
Issues, Achievements and Challenges, Madison, WI, USA, August 6-8,
2001},
pages = {78--81},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/ICALT.2001.943860},
doi = {10.1109/ICALT.2001.943860},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icalt/ChanCC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icppw/CaoCW01,
author = {Jiannong Cao and
Alvin T. S. Chan and
Jie Wu},
title = {Achieving Replication Consistency Using Cooperating Mobile Agents},
booktitle = {30th International Workshops on Parallel Processing {(ICPP} 2001 Workshops),
3-7 September 2001, Valencia, Spain},
pages = {453--458},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/ICPPW.2001.951986},
doi = {10.1109/ICPPW.2001.951986},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icppw/CaoCW01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/CheungCC01,
author = {Nick K. C. Cheung and
Jiannong Cao and
Alvin T. S. Chan},
title = {Analysis and Evaluation of a Distributed Monitor Construct in Java},
booktitle = {Proceedings of the 15th International Parallel {\&} Distributed
Processing Symposium (IPDPS-01), San Francisco, CA, USA, April 23-27,
2001},
pages = {108},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/IPDPS.2001.925078},
doi = {10.1109/IPDPS.2001.925078},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/CheungCC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mdm/ChanHCC01,
author = {Alvin T. S. Chan and
Dan He and
Siu Nam Chuang and
Jiannong Cao},
editor = {Kian{-}Lee Tan and
Michael J. Franklin and
John C. S. Lui},
title = {Towards a Programmable Mobile {IP}},
booktitle = {Mobile Data Management, Second International Conference, {MDM} 2001,
Hong Kong, China, January 8-10, 2001, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1987},
pages = {210--221},
publisher = {Springer},
year = {2001},
url = {https://doi.org/10.1007/3-540-44498-X\_17},
doi = {10.1007/3-540-44498-X\_17},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mdm/ChanHCC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/Chan00,
author = {Alvin T. S. Chan},
title = {WWW+smart card: towards a mobile health care management system},
journal = {Int. J. Medical Informatics},
volume = {57},
number = {2-3},
pages = {127--137},
year = {2000},
url = {https://doi.org/10.1016/S1386-5056(00)00061-7},
doi = {10.1016/S1386-5056(00)00061-7},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijmi/Chan00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cifer/Kuruc00,
author = {Alvin Kuruc},
title = {Apples to oranges: reconciling "vegas" from inconsistent valuation
models by a stochastic change of coordinates},
booktitle = {Proceedings of the {IEEE/IAFE/INFORMS} 2000 Conference on Computational
Intelligence for Financial Engineering, CIFEr 2000, New York City,
USA, March 28, 2000},
pages = {143--146},
publisher = {{IEEE}},
year = {2000},
url = {https://doi.org/10.1109/CIFER.2000.844612},
doi = {10.1109/CIFER.2000.844612},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cifer/Kuruc00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/Chan99,
author = {Alvin T. S. Chan},
title = {Web-Enabled Smart Card for Ubiquitous Access of Patient's Medical
Record},
journal = {Comput. Networks},
volume = {31},
number = {11-16},
pages = {1591--1598},
year = {1999},
url = {https://doi.org/10.1016/S1389-1286(99)00056-0},
doi = {10.1016/S1389-1286(99)00056-0},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cn/Chan99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/GarciaM99,
author = {Alvin Garcia and
Richard J. Mammone},
title = {Channel-robust speaker identification using modified-mean cepstral
mean normalization with frequency warping},
booktitle = {Proceedings of the 1999 {IEEE} International Conference on Acoustics,
Speech, and Signal Processing, {ICASSP} '99, Phoenix, Arizona, USA,
March 15-19, 1999},
pages = {325--328},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/ICASSP.1999.758128},
doi = {10.1109/ICASSP.1999.758128},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/GarciaM99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/PrzybockiM99,
author = {Mark A. Przybocki and
Alvin F. Martin},
title = {The 1999 {NIST} speaker recognition evaluation, using summed two-channel
telephone data for speaker detection and speaker tracking},
booktitle = {Sixth European Conference on Speech Communication and Technology,
{EUROSPEECH} 1999, Budapest, Hungary, September 5-9, 1999},
pages = {2215--2218},
publisher = {{ISCA}},
year = {1999},
url = {https://doi.org/10.21437/Eurospeech.1999-491},
doi = {10.21437/EUROSPEECH.1999-491},
timestamp = {Sat, 01 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/PrzybockiM99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/ChanC99,
author = {Alvin T. S. Chan and
Jiannong Cao},
title = {{PANTA:} {A} graph-oriented programmable active network transport
architecture},
booktitle = {1999 {IEEE} Wireless Communications and Networking Conference, {WCNC}
1999, September 21-24, 1999, New Orleans, Louisiana, {USA}},
pages = {1293--1297},
publisher = {{IEEE}},
year = {1999},
url = {https://doi.org/10.1109/WCNC.1999.796946},
doi = {10.1109/WCNC.1999.796946},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wcnc/ChanC99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/McLellanRFCS98,
author = {Samuel G. McLellan and
Alvin W. Roesler and
Zongming Fei and
Savita Chandran and
Clay Spinuzzi},
title = {Experience Using Web-Based Shotgun Measures for Large-System Characterization
and Improvement},
journal = {{IEEE} Trans. Software Eng.},
volume = {24},
number = {4},
pages = {268--277},
year = {1998},
url = {https://doi.org/10.1109/32.677184},
doi = {10.1109/32.677184},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tse/McLellanRFCS98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/WoodCFHLLLMPR93,
author = {David A. Wood and
Satish Chandra and
Babak Falsafi and
Mark D. Hill and
James R. Larus and
Alvin R. Lebeck and
James C. Lewis and
Shubhendu S. Mukherjee and
Subbarao Palacharla and
Steven K. Reinhardt},
editor = {Alan Jay Smith},
title = {Mechanisms for Cooperative Shared Memory},
booktitle = {Proceedings of the 20th Annual International Symposium on Computer
Architecture, San Diego, CA, USA, May 1993},
pages = {156--167},
publisher = {{ACM}},
year = {1993},
url = {https://doi.org/10.1145/165123.165151},
doi = {10.1145/165123.165151},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isca/WoodCFHLLLMPR93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compcon/DespainPDCC86,
author = {Alvin M. Despain and
Yale N. Patt and
Tep P. Dobry and
Jung{-}Herng Chang and
Wayne Citrin},
title = {High Performance Prolog, The Multiplicative Effect of Several Levels
of Implementation},
booktitle = {Spring COMPCON'86, Digest of Papers, Thirty-First {IEEE} Computer
Society International Conference, San Francisco, California, USA,
March 3-6, 1986},
pages = {178--185},
publisher = {{IEEE} Computer Society},
year = {1986},
timestamp = {Wed, 28 Jun 2006 09:47:20 +0200},
biburl = {https://dblp.org/rec/conf/compcon/DespainPDCC86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compcon/ChangDD85,
author = {Jung{-}Herng Chang and
Alvin M. Despain and
Doug DeGroot},
title = {AND-Parallelism of Logic Programs Based on a Static Data Dependency
Analysis},
booktitle = {Spring COMPCON'85, Digest of Papers, Thirtieth {IEEE} Computer Society
International Conference, San Francisco, California, USA, February
25-28, 1985},
pages = {218--226},
publisher = {{IEEE} Computer Society},
year = {1985},
timestamp = {Wed, 28 Jun 2006 12:59:39 +0200},
biburl = {https://dblp.org/rec/conf/compcon/ChangDD85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/slp/ChangD85,
author = {Jung{-}Herng Chang and
Alvin M. Despain},
title = {Semi-Intelligent Backtracking of Prolog Based on Static Data Dependency
Analysis},
booktitle = {Proceedings of the 1985 Symposium on Logic Programming, Boston, Massachusetts,
USA, July 15-18, 1985},
pages = {10--21},
publisher = {{IEEE-CS}},
year = {1985},
timestamp = {Wed, 04 Dec 2013 14:42:59 +0100},
biburl = {https://dblp.org/rec/conf/slp/ChangD85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mss/RothM82,
author = {Alvin E. Roth and
Michael W. K. Malouf},
title = {Scale changes and shared information in bargaining: An experimental
study},
journal = {Math. Soc. Sci.},
volume = {3},
number = {2},
pages = {157--177},
year = {1982},
url = {https://doi.org/10.1016/0165-4896(82)90054-3},
doi = {10.1016/0165-4896(82)90054-3},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mss/RothM82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-09-07 20:49 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
