default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Alvin Chan"
download as .bib file
@article{DBLP:journals/npjdm/HuangCWDLWAL24,
author = {Jane J. Huang and
Roomasa Channa and
Risa M. Wolf and
Yiwen Dong and
Mavis Liang and
Jiangxia Wang and
Michael D. Abr{\`{a}}moff and
T. Y. Alvin Liu},
title = {Autonomous artificial intelligence for diabetic eye disease increases
access and health equity in underserved populations},
journal = {npj Digit. Medicine},
volume = {7},
number = {1},
year = {2024}
}
@article{DBLP:journals/npjdm/HuangCWDLWAL24a,
author = {Jane J. Huang and
Roomasa Channa and
Risa M. Wolf and
Yiwen Dong and
Mavis Liang and
Jiangxia Wang and
Michael D. Abr{\`{a}}moff and
T. Y. Alvin Liu},
title = {Author Correction: Autonomous artificial intelligence for diabetic
eye disease increases access and health equity in underserved populations},
journal = {npj Digit. Medicine},
volume = {7},
number = {1},
year = {2024}
}
@article{DBLP:journals/pvldb/KittivorawongGHC24,
author = {Chanwut Kittivorawong and
Yongming Ge and
Yousef Helal and
Alvin Cheung},
title = {Spatialyze: {A} Geospatial Video Analytics System with Spatial-Aware
Optimizations},
journal = {Proc. {VLDB} Endow.},
volume = {17},
number = {9},
pages = {2136--2148},
year = {2024}
}
@inproceedings{DBLP:conf/cec/ChouLTYCWJK24,
author = {Yao{-}Hsin Chou and
Yun{-}Ting Lai and
Yong Feng Tong and
Alvin Young and
Ming{-}Ho Chang and
Kun{-}Min Wu and
Yu{-}Chi Jiang and
Shu{-}Yu Kuo},
title = {A Quantum-Inspired Multi-objective Portfolio Strategy Based on Trend
Ratio Model in Global Financial Network},
booktitle = {{CEC}},
pages = {1--8},
publisher = {{IEEE}},
year = {2024}
}
@inproceedings{DBLP:conf/ispd/HoCGHKLR24,
author = {Chia{-}Tung Ho and
Ajay Chandna and
David Guan and
Alvin Ho and
Minsoo Kim and
Yaguang Li and
Haoxing Ren},
title = {Novel Transformer Model Based Clustering Method for Standard Cell
Design Automation},
booktitle = {{ISPD}},
pages = {195--203},
publisher = {{ACM}},
year = {2024}
}
@article{DBLP:journals/corr/abs-2408-00118,
author = {Morgane Rivi{\`{e}}re and
Shreya Pathak and
Pier Giuseppe Sessa and
Cassidy Hardin and
Surya Bhupatiraju and
L{\'{e}}onard Hussenot and
Thomas Mesnard and
Bobak Shahriari and
Alexandre Ram{\'{e}} and
Johan Ferret and
Peter Liu and
Pouya Tafti and
Abe Friesen and
Michelle Casbon and
Sabela Ramos and
Ravin Kumar and
Charline Le Lan and
Sammy Jerome and
Anton Tsitsulin and
Nino Vieillard and
Piotr Stanczyk and
Sertan Girgin and
Nikola Momchev and
Matt Hoffman and
Shantanu Thakoor and
Jean{-}Bastien Grill and
Behnam Neyshabur and
Olivier Bachem and
Alanna Walton and
Aliaksei Severyn and
Alicia Parrish and
Aliya Ahmad and
Allen Hutchison and
Alvin Abdagic and
Amanda Carl and
Amy Shen and
Andy Brock and
Andy Coenen and
Anthony Laforge and
Antonia Paterson and
Ben Bastian and
Bilal Piot and
Bo Wu and
Brandon Royal and
Charlie Chen and
Chintu Kumar and
Chris Perry and
Chris Welty and
Christopher A. Choquette{-}Choo and
Danila Sinopalnikov and
David Weinberger and
Dimple Vijaykumar and
Dominika Rogozinska and
Dustin Herbison and
Elisa Bandy and
Emma Wang and
Eric Noland and
Erica Moreira and
Evan Senter and
Evgenii Eltyshev and
Francesco Visin and
Gabriel Rasskin and
Gary Wei and
Glenn Cameron and
Gus Martins and
Hadi Hashemi and
Hanna Klimczak{-}Plucinska and
Harleen Batra and
Harsh Dhand and
Ivan Nardini and
Jacinda Mein and
Jack Zhou and
James Svensson and
Jeff Stanway and
Jetha Chan and
Jin Peng Zhou and
Joana Carrasqueira and
Joana Iljazi and
Jocelyn Becker and
Joe Fernandez and
Joost van Amersfoort and
Josh Gordon and
Josh Lipschultz and
Josh Newlan and
Ju{-}yeong Ji and
Kareem Mohamed and
Kartikeya Badola and
Kat Black and
Katie Millican and
Keelin McDonell and
Kelvin Nguyen and
Kiranbir Sodhia and
Kish Greene and
Lars Lowe Sj{\"{o}}sund and
Lauren Usui and
Laurent Sifre and
Lena Heuermann and
Leticia Lago and
Lilly McNealus},
title = {Gemma 2: Improving Open Language Models at a Practical Size},
journal = {CoRR},
volume = {abs/2408.00118},
year = {2024}
}
@article{DBLP:journals/cim/ChenWCLO23,
author = {Zhenghua Chen and
Min Wu and
Alvin Chan and
Xiaoli Li and
Yew{-}Soon Ong},
title = {Survey on {AI} Sustainability: Emerging Trends on Learning Algorithms
and Research Challenges [Review Article]},
journal = {{IEEE} Comput. Intell. Mag.},
volume = {18},
number = {2},
pages = {60--77},
year = {2023}
}
@article{DBLP:journals/ijbi/TanSBCLLECLTKCBG23,
author = {Hong Chang Tan and
Elizabeth Shumbayawonda and
Cayden Beyer and
Lionel Tim{-}Ee Cheng and
Albert Low and
Chin Hong Lim and
Alvin Eng and
Weng Hoong Chan and
Phong Ching Lee and
Mei Fang Tay and
Stella Kin and
Jason Pik Eu Chang and
Yong Mong Bee and
George Boon Bee Goh},
title = {Multiparametric Magnetic Resonance Imaging and Magnetic Resonance
Elastography to Evaluate the Early Effects of Bariatric Surgery on
Nonalcoholic Fatty Liver Disease},
journal = {Int. J. Biomed. Imaging},
volume = {2023},
pages = {4228321:1--4228321:8},
year = {2023}
}
@article{DBLP:journals/jossw/ScheidgenHLSNFCGMBBGDLDANSDKMRDPK23,
author = {Markus Scheidgen and
Lauri Himanen and
Alvin N. Ladines and
David Sikter and
Mohammad Nakhaee and
{\'{A}}d{\'{a}}m Fekete and
Theodore Chang and
Amir Golparvar and
Jos{\'{e}} A. M{\'{a}}rquez and
Sandor Brockhauser and
Sebastian Br{\"{u}}ckner and
Luca M. Ghiringhelli and
Felix Dietrich and
Daniel Lehmberg and
Thea Denell and
Andrea Albino and
Hampus N{\"{a}}sstr{\"{o}}m and
Sherjeel Shabih and
Florian Dobener and
Markus K{\"{u}}hbach and
Rubel Mozumder and
Joseph F. Rudzinski and
Nathan Daelman and
Jos{\'{e}} M. Pizarro and
Martin Kuban and
Cuauhtemoc Salazar and
Pavel Ondracka and
Hans{-}Joachim Bungartz and
Claudia Draxl},
title = {{NOMAD:} {A} distributed web-based platform for managing materials
science research data},
journal = {J. Open Source Softw.},
volume = {8},
number = {90},
pages = {5388},
year = {2023}
}
@article{DBLP:journals/pvldb/CheungAHKLLWY23,
author = {Alvin Cheung and
Maaz Bin Safeer Ahmad and
Brandon Haynes and
Chanwut Kittivorawong and
Shadaj Laddad and
Xiaoxuan Liu and
Chenglong Wang and
Cong Yan},
title = {Towards Auto-Generated Data Systems},
journal = {Proc. {VLDB} Endow.},
volume = {16},
number = {12},
pages = {4116--4129},
year = {2023}
}
@article{DBLP:journals/ral/ChenSL23,
author = {Rui Chen and
Alvin Shek and
Changliu Liu},
title = {Robust and Context-Aware Real-Time Collaborative Robot Handling via
Dynamic Gesture Commands},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {8},
number = {6},
pages = {3510--3517},
year = {2023}
}
@inproceedings{DBLP:conf/csedu/ChanWGSL23,
author = {Alvin Toong Shoon Chan and
Peng{-}Cheng Wang and
Frank Guan and
Saw Han Soo and
Haris Lim Hao Li},
title = {Integration of Virtual Reality with Intelligent Tutoring for High
Fidelity Air Traffic Control Training},
booktitle = {{CSEDU} {(2)}},
pages = {199--206},
publisher = {{SCITEPRESS}},
year = {2023}
}
@inproceedings{DBLP:conf/icml/WanHPXHGRS23,
author = {Alvin Wan and
Hanxiang Hao and
Kaushik Patnaik and
Yueyang Xu and
Omer Hadad and
David G{\"{u}}era and
Zhile Ren and
Qi Shan},
title = {{UPSCALE:} Unconstrained Channel Pruning},
booktitle = {{ICML}},
series = {Proceedings of Machine Learning Research},
volume = {202},
pages = {35384--35412},
publisher = {{PMLR}},
year = {2023}
}
@inproceedings{DBLP:conf/icra/ShekSCL23,
author = {Alvin Shek and
Bo Ying Su and
Rui Chen and
Changliu Liu},
title = {Learning from Physical Human Feedback: An Object-Centric One-Shot
Adaptation Method},
booktitle = {{ICRA}},
pages = {9910--9916},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/vr/YeoXCLCQG23,
author = {Jin Qi Yeo and
Xinxing Xia and
Kan Chen and
Malcolm Y. H. Low and
Alvin Toong Shoon Chan and
Dongyu Qiu and
Frank Guan},
title = {{SPAT-VR:} {A} Holistic and Extensible Framework for {VR} Project
Management},
booktitle = {{VR} Workshops},
pages = {619--620},
publisher = {{IEEE}},
year = {2023}
}
@article{DBLP:journals/corr/abs-2304-06175,
author = {Rui Chen and
Alvin Shek and
Changliu Liu},
title = {Robust and Context-Aware Real-Time Collaborative Robot Handling via
Dynamic Gesture Commands},
journal = {CoRR},
volume = {abs/2304.06175},
year = {2023}
}
@article{DBLP:journals/corr/abs-2307-08771,
author = {Alvin Wan and
Hanxiang Hao and
Kaushik Patnaik and
Yueyang Xu and
Omer Hadad and
David G{\"{u}}era and
Zhile Ren and
Qi Shan},
title = {{UPSCALE:} Unconstrained Channel Pruning},
journal = {CoRR},
volume = {abs/2307.08771},
year = {2023}
}
@article{DBLP:journals/corr/abs-2308-03276,
author = {Chanwut Kittivorawong and
Yongming Ge and
Yousef Helal and
Alvin Cheung},
title = {Spatialyze: {A} Geospatial Video Analytics System with Spatial-Aware
Optimizations},
journal = {CoRR},
volume = {abs/2308.03276},
year = {2023}
}
@article{DBLP:journals/cacm/AbadiAABBBBCCDD22,
author = {Daniel Abadi and
Anastasia Ailamaki and
David G. Andersen and
Peter Bailis and
Magdalena Balazinska and
Philip A. Bernstein and
Peter A. Boncz and
Surajit Chaudhuri and
Alvin Cheung and
AnHai Doan and
Luna Dong and
Michael J. Franklin and
Juliana Freire and
Alon Y. Halevy and
Joseph M. Hellerstein and
Stratos Idreos and
Donald Kossmann and
Tim Kraska and
Sailesh Krishnamurthy and
Volker Markl and
Sergey Melnik and
Tova Milo and
C. Mohan and
Thomas Neumann and
Beng Chin Ooi and
Fatma Ozcan and
Jignesh M. Patel and
Andrew Pavlo and
Raluca A. Popa and
Raghu Ramakrishnan and
Christopher R{\'{e}} and
Michael Stonebraker and
Dan Suciu},
title = {The Seattle report on database research},
journal = {Commun. {ACM}},
volume = {65},
number = {8},
pages = {72--79},
year = {2022}
}
@article{DBLP:journals/tnn/ChanMJOXXL22,
author = {Alvin Chan and
Lei Ma and
Felix Juefei{-}Xu and
Yew{-}Soon Ong and
Xiaofei Xie and
Minhui Xue and
Yang Liu},
title = {Breaking Neural Reasoning Architectures With Metamorphic Relation-Based
Adversarial Examples},
journal = {{IEEE} Trans. Neural Networks Learn. Syst.},
volume = {33},
number = {11},
pages = {6976--6982},
year = {2022}
}
@inproceedings{DBLP:conf/embc/SahroniMW22,
author = {Alvin Sahroni and
Isnatin Miladiyah and
Nur Widiasmara},
title = {Short-term Pulse Rate Variability to Assess Psychophysiological Changes
during Online Trier Social Stress Test {(TSST)}},
booktitle = {{EMBC}},
pages = {1082--1085},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/igarss/AhmadIS22,
author = {Siti Sarah Farhana Ahmad and
Nurul Hazrina Idris and
Alvin Lau Meng Shin},
title = {Coastline Changes Over Mangrove Forest in Setiu Malaysia Using a Long-Term
Landsat Satellite Data},
booktitle = {{IGARSS}},
pages = {6809--6812},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/ijcai/ChanOT22,
author = {Alvin Chan and
Yew Soon Ong and
Clement Tan},
title = {How Does Frequency Bias Affect the Robustness of Neural Image Classifiers
against Common Corruption and Adversarial Perturbations?},
booktitle = {{IJCAI}},
pages = {659--665},
publisher = {ijcai.org},
year = {2022}
}
@inproceedings{DBLP:conf/ijcnn/NgocCBO22,
author = {Nguyen Hong Ngoc and
Alvin Chan and
Huynh Thi Thanh Binh and
Yew Soon Ong},
title = {Anti-Forensic Deepfake Personas and How To Spot Them},
booktitle = {{IJCNN}},
pages = {1--8},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/ismar/ChanLC22,
author = {Alvin Chan and
Jeannie Su Ann Lee and
Renjie Chen},
title = {Message from the {ISMAR} 2022 Demos Chairs},
booktitle = {{ISMAR} Adjunct},
pages = {xix},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/ismar/QiuOXYXLWCG22,
author = {Dongyu Qiu and
Clemen Yu Da Ow and
Xinxing Xia and
Jin Qi Yeo and
Jiazhi Xia and
Malcolm Yoke Hean Low and
Zhengkui Wang and
Alvin Toong Shoon Chan and
Frank Yunqing Guan},
title = {ViCollAR: {A} Novel System for 3D Data Visualization using Collaborative
Augmented Reality},
booktitle = {{ISMAR} Adjunct},
pages = {907--908},
publisher = {{IEEE}},
year = {2022}
}
@article{DBLP:journals/corr/abs-2203-04951,
author = {Alvin Shek and
Rui Chen and
Changliu Liu},
title = {Learning from Physical Human Feedback: An Object-Centric One-Shot
Adaptation Method},
journal = {CoRR},
volume = {abs/2203.04951},
year = {2022}
}
@article{DBLP:journals/corr/abs-2205-03824,
author = {Zhenghua Chen and
Min Wu and
Alvin Chan and
Xiaoli Li and
Yew{-}Soon Ong},
title = {A Survey on {AI} Sustainability: Emerging Trends on Learning Algorithms
and Research Challenges},
journal = {CoRR},
volume = {abs/2205.03824},
year = {2022}
}
@article{DBLP:journals/corr/abs-2205-04533,
author = {Alvin Chan and
Yew{-}Soon Ong and
Clement Tan},
title = {How Does Frequency Bias Affect the Robustness of Neural Image Classifiers
against Common Corruption and Adversarial Perturbations?},
journal = {CoRR},
volume = {abs/2205.04533},
year = {2022}
}
@article{DBLP:journals/corr/abs-2211-07889,
author = {Jessica Y. Bo and
Hen{-}Wei Huang and
Alvin Chan and
Giovanni Traverso},
title = {Pretraining {ECG} Data with Adversarial Masking Improves Model Generalizability
for Data-Scarce Tasks},
journal = {CoRR},
volume = {abs/2211.07889},
year = {2022}
}
@phdthesis{DBLP:phd/sg/Chan21,
author = {Alvin Chan},
title = {Defences and threats in safe deep learning},
school = {Nanyang Technological University, Singapore},
year = {2021}
}
@article{DBLP:journals/eswa/ChanLJ21,
author = {Alvin Chan and
Martin D. Levine and
Mehrsan Javan},
title = {Player Identification in Hockey Broadcast Videos},
journal = {Expert Syst. Appl.},
volume = {165},
pages = {113891},
year = {2021}
}
@article{DBLP:journals/midm/LaiCPKBSNDSGNCF21,
author = {Alvina Grace Lai and
Wai Hoong Chang and
Constantinos A. Parisinos and
Michail Katsoulis and
Ruth M. Blackburn and
Anoop D. Shah and
Vincent Nguyen and
Spiros C. Denaxas and
George Davey Smith and
Tom R. Gaunt and
Krishnarajah Nirantharakumar and
Murray P. Cox and
Donall Forde and
Folkert W. Asselbergs and
Steve K. Harris and
Sylvia Richardson and
Reecha Sofat and
Richard J. B. Dobson and
Aroon D. Hingorani and
Riyaz Patel and
Jonathan Sterne and
Amitava Banerjee and
Alastair K. Denniston and
Simon Ball and
Neil J. Sebire and
Nigam H. Shah and
Graham R. Foster and
Bryan Williams and
Harry Hemingway},
title = {An informatics consult approach for generating clinical evidence for
treatment decisions},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {21},
number = {1},
pages = {281},
year = {2021}
}
@article{DBLP:journals/tele/Zhou21,
author = {Alvin Zhou},
title = {Causal effects of affordance change on communication behavior: Empirical
evidence from organizational and leadership social media use},
journal = {Telematics Informatics},
volume = {59},
pages = {101549},
year = {2021}
}
@inproceedings{DBLP:conf/acl/ZhangCTFW0SYL20,
author = {Aston Zhang and
Alvin Chan and
Yi Tay and
Jie Fu and
Shuohang Wang and
Shuai Zhang and
Huajie Shao and
Shuochao Yao and
Roy Ka{-}Wei Lee},
title = {On Orthogonality Constraints for Transformers},
booktitle = {{ACL/IJCNLP} {(2)}},
pages = {375--382},
publisher = {Association for Computational Linguistics},
year = {2021}
}
@inproceedings{DBLP:conf/chil/ChanKOWLP21,
author = {Alvin Chan and
Anna Korsakova and
Yew{-}Soon Ong and
Fernaldo Richtia Winnerdy and
Kah Wai Lim and
Anh Tuan Phan},
title = {{RNA} alternative splicing prediction with discrete compositional
energy network},
booktitle = {{CHIL}},
pages = {193--203},
publisher = {{ACM}},
year = {2021}
}
@inproceedings{DBLP:conf/globecom/ZhengIPMALYYACP21,
author = {Yao Zheng and
Shekh Md Mahmudul Islam and
Yanjun Pan and
Marionne Millan and
Samson Aggelopoulos and
Brian Lu and
Alvin Yang and
Thomas Yang and
Stephanie Aelmore and
Willy Chang and
Alana Power and
Ming Li and
Olga Boric{-}Lubecke and
Victor Lubecke and
Wenhai Sun},
title = {Insider-Resistant Context-Based Pairing for Multimodality Sleep Apnea
Test},
booktitle = {{GLOBECOM}},
pages = {1--6},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/iclr/ChanOPZF21,
author = {Alvin Chan and
Yew{-}Soon Ong and
Bill Pung and
Aston Zhang and
Jie Fu},
title = {CoCon: {A} Self-Supervised Approach for Controlled Text Generation},
booktitle = {{ICLR}},
publisher = {OpenReview.net},
year = {2021}
}
@inproceedings{DBLP:conf/iclr/ZhangT0CLHF21,
author = {Aston Zhang and
Yi Tay and
Shuai Zhang and
Alvin Chan and
Anh Tuan Luu and
Siu Cheung Hui and
Jie Fu},
title = {Beyond Fully-Connected Layers with Quaternions: Parameterization of
Hypercomplex Multiplications with 1/n Parameters},
booktitle = {{ICLR}},
publisher = {OpenReview.net},
year = {2021}
}
@inproceedings{DBLP:conf/nips/ChanMKN21,
author = {Alvin Chan and
Ali Madani and
Ben Krause and
Nikhil Naik},
title = {Deep Extrapolation for Attribute-Enhanced Generation},
booktitle = {NeurIPS},
pages = {14084--14096},
year = {2021}
}
@inproceedings{DBLP:conf/nips/ZhangTSCZ21,
author = {Aston Zhang and
Yi Tay and
Yikang Shen and
Alvin Chan and
Shuai Zhang},
title = {Self-Instantiated Recurrent Units with Dynamic Soft Recursion},
booktitle = {NeurIPS},
pages = {6503--6514},
year = {2021}
}
@article{DBLP:journals/corr/abs-2102-08597,
author = {Aston Zhang and
Yi Tay and
Shuai Zhang and
Alvin Chan and
Anh Tuan Luu and
Siu Cheung Hui and
Jie Fu},
title = {Beyond Fully-Connected Layers with Quaternions: Parameterization of
Hypercomplex Multiplications with 1/n Parameters},
journal = {CoRR},
volume = {abs/2102.08597},
year = {2021}
}
@article{DBLP:journals/corr/abs-2103-04246,
author = {Alvin Chan and
Anna Korsakova and
Yew{-}Soon Ong and
Fernaldo Richtia Winnerdy and
Kah Wai Lim and
Anh Tuan Phan},
title = {{RNA} Alternative Splicing Prediction with Discrete Compositional
Energy Network},
journal = {CoRR},
volume = {abs/2103.04246},
year = {2021}
}
@article{DBLP:journals/corr/abs-2105-00314,
author = {Yao Zheng and
Shekh Md Mahmudul Islam and
Yanjun Pan and
Marionne Millan and
Samson Aggelopoulos and
Brian Lu and
Alvin Yang and
Thomas Yang and
Stephanie Aelmore and
Willy Chang and
Alana Power and
Ming Li and
Olga Boric{-}Lubecke and
Victor Lubecke and
Wenhai Sun},
title = {Technical Report: Insider-Resistant Context-Based Pairing for Multimodality
Sleep Apnea Test},
journal = {CoRR},
volume = {abs/2105.00314},
year = {2021}
}
@article{DBLP:journals/corr/abs-2107-02968,
author = {Alvin Chan and
Ali Madani and
Ben Krause and
Nikhil Naik},
title = {Deep Extrapolation for Attribute-Enhanced Generation},
journal = {CoRR},
volume = {abs/2107.02968},
year = {2021}
}
@article{DBLP:journals/corr/abs-2107-06747,
author = {Arkadiusz Sitek and
Sangtae Ahn and
Evren Asma and
Adam Chandler and
Alvin Ihsani and
Sven Prevrhal and
Arman Rahmim and
Babak Saboury and
Kris Thielemans},
title = {Artificial Intelligence in {PET:} an Industry Perspective},
journal = {CoRR},
volume = {abs/2107.06747},
year = {2021}
}
@article{DBLP:journals/corr/abs-2111-06046,
author = {Chih{-}Pin Tan and
Chin{-}Jui Chang and
Alvin W. Y. Su and
Yi{-}Hsuan Yang},
title = {Music Score Expansion with Variable-Length Infilling},
journal = {CoRR},
volume = {abs/2111.06046},
year = {2021}
}
@article{DBLP:journals/corr/abs-2111-14031,
author = {Bill Tuck Weng Pung and
Alvin Chan},
title = {FastTrees: Parallel Latent Tree-Induction for Faster Sequence Encoding},
journal = {CoRR},
volume = {abs/2111.14031},
year = {2021}
}
@article{DBLP:journals/corr/abs-2111-14034,
author = {Bill Tuck Weng Pung and
Alvin Chan},
title = {{ORCHARD:} {A} Benchmark For Measuring Systematic Generalization of
Multi-Hierarchical Reasoning},
journal = {CoRR},
volume = {abs/2111.14034},
year = {2021}
}
@article{DBLP:journals/corr/abs-2112-06020,
author = {Rui Chen and
Alvin Shek and
Changliu Liu},
title = {Learn from Human Teams: a Probabilistic Solution to Real-Time Collaborative
Robot Handling with Dynamic Gesture Commands},
journal = {CoRR},
volume = {abs/2112.06020},
year = {2021}
}
@article{DBLP:journals/cga/HanCLJTCH20,
author = {Ping{-}Hsuan Han and
Yang{-}Sheng Chen and
Iou{-}Shiuan Liu and
Yu{-}Ping Jang and
Ling Tsai and
Alvin Chang and
Yi{-}Ping Hung},
title = {A Compelling Virtual Tour of the Dunhuang Cave With an Immersive Head-Mounted
Display},
journal = {{IEEE} Computer Graphics and Applications},
volume = {40},
number = {1},
pages = {40--55},
year = {2020}
}
@article{DBLP:journals/ijisscm/PhamTA20,
author = {Thi{-}Ngan Pham and
Albert Tan and
Alvin Ang},
title = {Determining Safety Stock for an Omni-Channel Environment},
journal = {Int. J. Inf. Syst. Supply Chain Manag.},
volume = {13},
number = {2},
pages = {59--76},
year = {2020}
}
@inproceedings{DBLP:conf/acl/TayOFCCLP20,
author = {Yi Tay and
Donovan Ong and
Jie Fu and
Alvin Chan and
Nancy Chen and
Anh Tuan Luu and
Chris Pal},
title = {Would you Rather? {A} New Benchmark for Learning Machine Alignment
with Cultural Values and Social Preferences},
booktitle = {{ACL}},
pages = {5369--5373},
publisher = {Association for Computational Linguistics},
year = {2020}
}
@inproceedings{DBLP:conf/cvpr/ChanTO20,
author = {Alvin Chan and
Yi Tay and
Yew{-}Soon Ong},
title = {What It Thinks Is Important Is Important: Robustness Transfers Through
Input Gradients},
booktitle = {{CVPR}},
pages = {329--338},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/cvpr/WanDZHTXWYXCVG20,
author = {Alvin Wan and
Xiaoliang Dai and
Peizhao Zhang and
Zijian He and
Yuandong Tian and
Saining Xie and
Bichen Wu and
Matthew Yu and
Tao Xu and
Kan Chen and
Peter Vajda and
Joseph E. Gonzalez},
title = {FBNetV2: Differentiable Neural Architecture Search for Spatial and
Channel Dimensions},
booktitle = {{CVPR}},
pages = {12962--12971},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/emnlp/ChanTOZ20,
author = {Alvin Chan and
Yi Tay and
Yew{-}Soon Ong and
Aston Zhang},
title = {Poison Attacks against Text Datasets with Conditional Adversarially
Regularized Autoencoder},
booktitle = {{EMNLP} (Findings)},
series = {Findings of {ACL}},
volume = {{EMNLP} 2020},
pages = {4175--4189},
publisher = {Association for Computational Linguistics},
year = {2020}
}
@inproceedings{DBLP:conf/hicss/LaiKRLLZWL20,
author = {Gabriel Chun{-}Hei Lai and
Ron Chi{-}Wai Kwok and
Tina Rochelle and
Alvin Chung{-}Man Leung and
Yanyan Li and
Shanshan Zhang and
George Yui{-}Lam Wong and
Angel Lu},
title = {The Moderating Effect of Different Types of Internet Use on the Relationship
between Transitional Aging Changes and Self-esteem of Older Adults},
booktitle = {{HICSS}},
pages = {1--10},
publisher = {ScholarSpace},
year = {2020}
}
@inproceedings{DBLP:conf/iclr/ChanTOF20,
author = {Alvin Chan and
Yi Tay and
Yew{-}Soon Ong and
Jie Fu},
title = {Jacobian Adversarially Regularized Networks for Robustness},
booktitle = {{ICLR}},
publisher = {OpenReview.net},
year = {2020}
}
@inproceedings{DBLP:conf/miccai/RothCSNLGGQIBWB20,
author = {Holger R. Roth and
Ken Chang and
Praveer Singh and
Nir Neumark and
Wenqi Li and
Vikash Gupta and
Sharut Gupta and
Liangqiong Qu and
Alvin Ihsani and
Bernardo C. Bizzo and
Yuhong Wen and
Varun Buch and
Meesam Shah and
Felipe Kitamura and
Matheus Mendon{\c{c}}a and
Vitor Lavor and
Ahmed Harouni and
Colin Compas and
Jesse Tetreault and
Prerna Dogra and
Yan Cheng and
Selnur Erdal and
Richard D. White and
Behrooz Hashemian and
Thomas J. Schultz and
Miao Zhang and
Adam McCarthy and
B. Min Yun and
Elshaimaa Sharaf and
Katharina Viktoria Hoebel and
Jay B. Patel and
Bryan Chen and
Sean Ko and
Evan Leibovitz and
Etta D. Pisano and
Laura Coombs and
Daguang Xu and
Keith J. Dreyer and
Ittai Dayan and
Ram C. Naidu and
Mona Flores and
Daniel L. Rubin and
Jayashree Kalpathy{-}Cramer},
title = {Federated Learning for Breast Density Classification: {A} Real-World
Implementation},
booktitle = {DART/DCL@MICCAI},
series = {Lecture Notes in Computer Science},
volume = {12444},
pages = {181--191},
publisher = {Springer},
year = {2020}
}
@inproceedings{DBLP:conf/miccai/ShinIXMSFC20,
author = {Hoo{-}Chang Shin and
Alvin Ihsani and
Ziyue Xu and
Swetha Mandava and
Sharath Turuvekere Sreenivas and
Christopher Forster and
Jiook Cha},
title = {{GANDALF:} Generative Adversarial Networks with Discriminator-Adaptive
Loss Fine-Tuning for Alzheimer's Disease Diagnosis from {MRI}},
booktitle = {{MICCAI} {(2)}},
series = {Lecture Notes in Computer Science},
volume = {12262},
pages = {688--697},
publisher = {Springer},
year = {2020}
}
@inproceedings{DBLP:conf/vlsic/ChouCTLLKSCHL020,
author = {Mao{-}Hsuan Chou and
Ya{-}Tin Chang and
Tsung{-}Hsien Tsai and
Tsung{-}Che Lu and
Chia{-}Chun Liao and
Hung{-}Yi Kuo and
Ruey{-}Bin Sheen and
Chih{-}Hsien Chang and
Kenny C.{-}H. Hsieh and
Alvin Leng Sun Loke and
Mark Chen},
title = {Embedded {PLL} Phase Noise Measurement Based on a {PFD/CP} {MASH}
1-1-1 {\(\Delta\)}{\(\Sigma\)} Time-to-Digital Converter in 7nm {CMOS}},
booktitle = {{VLSI} Circuits},
pages = {1--2},
publisher = {{IEEE}},
year = {2020}
}
@article{DBLP:journals/corr/abs-2004-05565,
author = {Alvin Wan and
Xiaoliang Dai and
Peizhao Zhang and
Zijian He and
Yuandong Tian and
Saining Xie and
Bichen Wu and
Matthew Yu and
Tao Xu and
Kan Chen and
Peter Vajda and
Joseph E. Gonzalez},
title = {FBNetV2: Differentiable Neural Architecture Search for Spatial and
Channel Dimensions},
journal = {CoRR},
volume = {abs/2004.05565},
year = {2020}
}
@article{DBLP:journals/corr/abs-2006-03535,
author = {Alvin Chan and
Yew{-}Soon Ong and
Bill Pung and
Aston Zhang and
Jie Fu},
title = {CoCon: {A} Self-Supervised Approach for Controlled Text Generation},
journal = {CoRR},
volume = {abs/2006.03535},
year = {2020}
}
@article{DBLP:journals/corr/abs-2007-03201,
author = {Jordan L. Melcher and
Yao Zheng and
Dylan Anthony and
Matthew Troglia and
Yanjun Pan and
Ming Li and
Thomas Yang and
Alvin Yang and
Samson Aggelopoulos},
title = {Demo: iJam with Channel Randomization},
journal = {CoRR},
volume = {abs/2007.03201},
year = {2020}
}
@article{DBLP:journals/corr/abs-2008-04393,
author = {Hoo{-}Chang Shin and
Alvin Ihsani and
Swetha Mandava and
Sharath Turuvekere Sreenivas and
Christopher Forster and
Jiook Cha and
Alzheimer's Disease Neuroimaging Initiative},
title = {{GANBERT:} Generative Adversarial Networks with Bidirectional Encoder
Representations from Transformers for {MRI} to {PET} synthesis},
journal = {CoRR},
volume = {abs/2008.04393},
year = {2020}
}
@article{DBLP:journals/corr/abs-2008-04396,
author = {Hoo{-}Chang Shin and
Alvin Ihsani and
Ziyue Xu and
Swetha Mandava and
Sharath Turuvekere Sreenivas and
Christopher Forster and
Jiook Cha and
Alzheimer's Disease Neuroimaging Initiative},
title = {{GANDALF:} Generative Adversarial Networks with Discriminator-Adaptive
Loss Fine-tuning for Alzheimer's Disease Diagnosis from {MRI}},
journal = {CoRR},
volume = {abs/2008.04396},
year = {2020}
}
@article{DBLP:journals/corr/abs-2009-01871,
author = {Holger R. Roth and
Ken Chang and
Praveer Singh and
Nir Neumark and
Wenqi Li and
Vikash Gupta and
Sharut Gupta and
Liangqiong Qu and
Alvin Ihsani and
Bernardo C. Bizzo and
Yuhong Wen and
Varun Buch and
Meesam Shah and
Felipe Kitamura and
Matheus Mendon{\c{c}}a and
Vitor Lavor and
Ahmed Harouni and
Colin Compas and
Jesse Tetreault and
Prerna Dogra and
Yan Cheng and
Selnur Erdal and
Richard D. White and
Behrooz Hashemian and
Thomas J. Schultz and
Miao Zhang and
Adam McCarthy and
B. Min Yun and
Elshaimaa Sharaf and
Katharina Viktoria Hoebel and
Jay B. Patel and
Bryan Chen and
Sean Ko and
Evan Leibovitz and
Etta D. Pisano and
Laura Coombs and
Daguang Xu and
Keith J. Dreyer and
Ittai Dayan and
Ram C. Naidu and
Mona Flores and
Daniel L. Rubin and
Jayashree Kalpathy{-}Cramer},
title = {Federated Learning for Breast Density Classification: {A} Real-World
Implementation},
journal = {CoRR},
volume = {abs/2009.01871},
year = {2020}
}
@article{DBLP:journals/corr/abs-2009-02429,
author = {Alvin Chan and
Martin D. Levine and
Mehrsan Javan},
title = {Player Identification in Hockey Broadcast Videos},
journal = {CoRR},
volume = {abs/2009.02429},
year = {2020}
}
@article{DBLP:journals/corr/abs-2010-02684,
author = {Alvin Chan and
Yi Tay and
Yew{-}Soon Ong and
Aston Zhang},
title = {Poison Attacks against Text Datasets with Conditional Adversarially
Regularized Autoencoder},
journal = {CoRR},
volume = {abs/2010.02684},
year = {2020}
}
@article{DBLP:journals/envsoft/RoyGANDS19,
author = {Proteek Chandan Roy and
Andrey K. Guber and
Mohammad Abouali and
A. Pouyan Nejadhashemi and
Kalyanmoy Deb and
Alvin J. M. Smucker},
title = {Crop yield simulation optimization using precision irrigation and
subsurface water retention technology},
journal = {Environ. Model. Softw.},
volume = {119},
pages = {433--444},
year = {2019}
}
@article{DBLP:journals/sigmod/AbadiAABBBBCCDD19,
author = {Daniel Abadi and
Anastasia Ailamaki and
David G. Andersen and
Peter Bailis and
Magdalena Balazinska and
Philip A. Bernstein and
Peter A. Boncz and
Surajit Chaudhuri and
Alvin Cheung and
AnHai Doan and
Luna Dong and
Michael J. Franklin and
Juliana Freire and
Alon Y. Halevy and
Joseph M. Hellerstein and
Stratos Idreos and
Donald Kossmann and
Tim Kraska and
Sailesh Krishnamurthy and
Volker Markl and
Sergey Melnik and
Tova Milo and
C. Mohan and
Thomas Neumann and
Beng Chin Ooi and
Fatma Ozcan and
Jignesh M. Patel and
Andrew Pavlo and
Raluca A. Popa and
Raghu Ramakrishnan and
Christopher R{\'{e}} and
Michael Stonebraker and
Dan Suciu},
title = {The Seattle Report on Database Research},
journal = {{SIGMOD} Rec.},
volume = {48},
number = {4},
pages = {44--53},
year = {2019}
}
@article{DBLP:journals/tifs/XueQZLZSC19,
author = {Lei Xue and
Chenxiong Qian and
Hao Zhou and
Xiapu Luo and
Yajin Zhou and
Yuru Shao and
Alvin T. S. Chan},
title = {NDroid: Toward Tracking Information Flows Across Multiple Android
Contexts},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {14},
number = {3},
pages = {814--828},
year = {2019}
}
@inproceedings{DBLP:conf/cascon/ChangTLJSK19,
author = {Yee{-}Kang Chang and
Patrick Tiu and
Eric Lau and
Leo Christy Jesuraj and
Alvin So and
Gilbert Kwan},
title = {Hands-on workshop on fast, efficient {\&} seriously open cloud-native
Java},
booktitle = {{CASCON}},
pages = {373--375},
publisher = {{ACM}},
year = {2019}
}
@inproceedings{DBLP:conf/emo/RoyGANDS19,
author = {Proteek Chandan Roy and
Andrey K. Guber and
Mohammad Abouali and
A. Pouyan Nejadhashemi and
Kalyanmoy Deb and
Alvin J. M. Smucker},
title = {Simulation Optimization of Water Usage and Crop Yield Using Precision
Irrigation},
booktitle = {{EMO}},
series = {Lecture Notes in Computer Science},
volume = {11411},
pages = {695--706},
publisher = {Springer},
year = {2019}
}
@inproceedings{DBLP:conf/iccsci/DewiMC19,
author = {Lusiana Citra Dewi and
Meiliana and
Alvin Chandra},
title = {Social Media Web Scraping using Social Media Developers {API} and
Regex},
booktitle = {{ICCSCI}},
series = {Procedia Computer Science},
volume = {157},
pages = {444--449},
publisher = {Elsevier},
year = {2019}
}
@inproceedings{DBLP:conf/tale/KwanTC19,
author = {Alvin C. M. Kwan and
Kenny C. W. Tang and
Karie Chan},
title = {Impacts of Online Academic Help-Seeking Behaviors on Undergraduate
Student Self-Learning},
booktitle = {{TALE}},
pages = {1--7},
publisher = {{IEEE}},
year = {2019}
}
@article{DBLP:journals/corr/abs-1911-08040,
author = {Alvin Chan and
Yew{-}Soon Ong},
title = {Poison as a Cure: Detecting {\&} Neutralizing Variable-Sized Backdoor
Attacks in Deep Neural Networks},
journal = {CoRR},
volume = {abs/1911.08040},
year = {2019}
}
@article{DBLP:journals/corr/abs-1912-05699,
author = {Alvin Chan and
Yi Tay and
Yew{-}Soon Ong},
title = {What it Thinks is Important is Important: Robustness Transfers through
Input Gradients},
journal = {CoRR},
volume = {abs/1912.05699},
year = {2019}
}
@article{DBLP:journals/corr/abs-1912-10185,
author = {Alvin Chan and
Yi Tay and
Yew{-}Soon Ong and
Jie Fu},
title = {Jacobian Adversarially Regularized Networks for Robustness},
journal = {CoRR},
volume = {abs/1912.10185},
year = {2019}
}
@inproceedings{DBLP:conf/ijcai/ChienSCL18,
author = {Isabel Chien and
Alvin Shi and
Alex Chan and
Charlotta Lindvall},
title = {Identification of serious illness conversations in unstructured clinical
notes using deep neural networks},
booktitle = {AIH@IJCAI},
series = {{CEUR} Workshop Proceedings},
volume = {2142},
pages = {125--139},
publisher = {CEUR-WS.org},
year = {2018}
}
@inproceedings{DBLP:conf/ijcai/ChienSCL18a,
author = {Isabel Chien and
Alvin Shi and
Alex Chan and
Charlotta Lindvall},
title = {Identification of Serious Illness Conversations in Unstructured Clinical
Notes Using Deep Neural Networks},
booktitle = {AIH@IJCAI (Revised Selected Papers)},
series = {Lecture Notes in Computer Science},
volume = {11326},
pages = {199--212},
publisher = {Springer},
year = {2018}
}
@inproceedings{DBLP:conf/intcompsymp/MuchtarRMDDNC18,
author = {Kahlil Muchtar and
Faris Rahman and
Muhammad Rizky Munggaran and
Alvin Prayuda Juniarta Dwiyantoro and
Richard Dharmadi and
Indra Nugraha and
Chuan{-}Yu Chang},
title = {An Efficient Event Detection Through Background Subtraction and Deep
Convolutional Nets},
booktitle = {{ICS}},
series = {Communications in Computer and Information Science},
volume = {1013},
pages = {163--167},
publisher = {Springer},
year = {2018}
}
@article{DBLP:journals/corr/abs-1809-02444,
author = {Alvin Chan and
Lei Ma and
Felix Juefei{-}Xu and
Xiaofei Xie and
Yang Liu and
Yew{-}Soon Ong},
title = {Metamorphic Relation Based Adversarial Attacks on Differentiable Neural
Computer},
journal = {CoRR},
volume = {abs/1809.02444},
year = {2018}
}
@inproceedings{DBLP:conf/chi/BeirlZCLZ17,
author = {Diana Beirl and
Anya Zeitlin and
Jerald Chan and
Kai Ip Alvin Loh and
Xiaodi Zhong},
title = {GotYourBack: An Internet of Toilets for the Trans* Community},
booktitle = {{CHI} Extended Abstracts},
pages = {39--45},
publisher = {{ACM}},
year = {2017}
}
@inproceedings{DBLP:conf/iccad/ChangWGZZ0Z17,
author = {Liang Chang and
Zhaohao Wang and
Alvin Oliver Glova and
Jishen Zhao and
Youguang Zhang and
Yuan Xie and
Weisheng Zhao},
title = {{PRESCOTT:} Preset-based cross-point architecture for spin-orbit-torque
magnetic random access memory},
booktitle = {{ICCAD}},
pages = {245--252},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/iccsce/BalbinVAACI17,
author = {Jessie R. Balbin and
Leonardo D. Valiente and
Danielle Jaye S. Agron and
Alvin Vincent R. Antioquia and
Glenn D. Cua and
John Clement S. Ibo},
title = {Assessment of the standard level of oreochromis niloticus and chanos
chanos located in fish pen and wet market storage based on viola-jones,
thresholding and L{\({_\ast}\)}a{\({_\ast}\)}b color space},
booktitle = {{ICCSCE}},
pages = {258--262},
publisher = {{IEEE}},
year = {2017}
}
@article{DBLP:journals/cj/ZhangJLC16,
author = {Tao Zhang and
He Jiang and
Xiapu Luo and
Alvin T. S. Chan},
title = {A Literature Review of Research in Bug Resolution: Tasks, Challenges
and Future Directions},
journal = {Comput. J.},
volume = {59},
number = {5},
pages = {741--773},
year = {2016}
}
@article{DBLP:journals/ijseke/ZhangYLC16,
author = {Tao Zhang and
Geunseok Yang and
Byungjeong Lee and
Alvin T. S. Chan},
title = {Guiding Bug Triage through Developer Analysis in Bug Reports},
journal = {Int. J. Softw. Eng. Knowl. Eng.},
volume = {26},
number = {3},
pages = {405--432},
year = {2016}
}
@inproceedings{DBLP:conf/iiaiaai/ChenLCLC16,
author = {Der{-}Fa Chen and
Chun Hsu Lu and
Alvin Chang and
Hsieh His Liu and
Kuo Chih Cheng},
title = {The Relationships among Budgetary Slack, Customers' Relationship Quality
and Organizational Performance},
booktitle = {{IIAI-AAI}},
pages = {1157--1161},
publisher = {{IEEE} Computer Society},
year = {2016}
}
@inproceedings{DBLP:conf/qtna/TamVTK16,
author = {La Thanh Tam and
Alvin C. Valera and
Hwee{-}Pink Tan and
Cheryl Koh},
title = {Online Detection of Behavioral Change Using Unobtrusive Eldercare
Monitoring System},
booktitle = {{QTNA}},
pages = {16},
publisher = {{ACM}},
year = {2016}
}
@inproceedings{DBLP:conf/sigcomm/SivaramanCBKABV16,
author = {Anirudh Sivaraman and
Alvin Cheung and
Mihai Budiu and
Changhoon Kim and
Mohammad Alizadeh and
Hari Balakrishnan and
George Varghese and
Nick McKeown and
Steve Licking},
title = {Packet Transactions: High-Level Programming for Line-Rate Switches},
booktitle = {{SIGCOMM}},
pages = {15--28},
publisher = {{ACM}},
year = {2016}
}
@article{DBLP:journals/ahswn/ShiWC15,
author = {Peizhong Shi and
Yun Wang and
Alvin T. S. Chan},
title = {{ECA-CTP:} An Enhanced Congestion Avoidance Mechanism for the {CTP}
Protocol in Wireless Sensor Networks},
journal = {Ad Hoc Sens. Wirel. Networks},
volume = {28},
number = {3-4},
pages = {289--317},
year = {2015}
}
@article{DBLP:journals/chinaf/WangDSCC15,
author = {Huaimin Wang and
Bo Ding and
Dian{-}xi Shi and
Jiannong Cao and
Alvin T. S. Chan},
title = {Auxo: an architecture-centric framework supporting the online tuning
of software adaptivity},
journal = {Sci. China Inf. Sci.},
volume = {58},
number = {9},
pages = {1--15},
year = {2015}
}
@article{DBLP:journals/interfaces/AndersonAGRRSU15,
author = {Ross Anderson and
Itai Ashlagi and
David Gamarnik and
Michael Rees and
Alvin E. Roth and
Tayfun S{\"{o}}nmez and
M. Utku {\"{U}}nver},
title = {Kidney Exchange and the Alliance for Paired Donation: Operations Research
Changes the Way Kidneys Are Transplanted},
journal = {Interfaces},
volume = {45},
number = {1},
pages = {26--42},
year = {2015}
}
@article{DBLP:journals/jcsci/AdriantoYC15,
author = {Dennise Adrianto and
Violitta Yesmaya and
Alvin Chandra},
title = {Increasing Learning Frequency through Education Based Game},
journal = {J. Comput. Sci.},
volume = {11},
number = {3},
pages = {567--572},
year = {2015}
}
@article{DBLP:journals/jsac/ChanZNNVTG15,
author = {Wai Hong Ronald Chan and
Pengfei Zhang and
Ido Nevat and
Sai Ganesh Nagarajan and
Alvin C. Valera and
Hwee{-}Xian Tan and
Natarajan Gautam},
title = {Adaptive Duty Cycling in Sensor Networks With Energy Harvesting Using
Continuous-Time Markov Chain and Fluid Models},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {33},
number = {12},
pages = {2687--2700},
year = {2015}
}
@article{DBLP:journals/jss/HuangCTCL15,
author = {Rubing Huang and
Jinfu Chen and
Dave Towey and
Alvin T. S. Chan and
Yansheng Lu},
title = {Aggregate-strength interaction test suite prioritization},
journal = {J. Syst. Softw.},
volume = {99},
pages = {36--51},
year = {2015}
}
@article{DBLP:journals/mr/SethuNCOC15,
author = {Raj Sekar Sethu and
Hong Seng Ng and
Alvin Chan and
Cheng Nee Ong and
Sieng Fong Chan},
title = {Characterization of copper precipitates on aluminum copper bond pads
formed after plasma clean and de-ionized water exposure},
journal = {Microelectron. Reliab.},
volume = {55},
number = {7},
pages = {1101--1108},
year = {2015}
}
@article{DBLP:journals/tc/LiuXZBC15,
author = {Xuan Liu and
Bin Xiao and
Shigeng Zhang and
Kai Bu and
Alvin Chan},
title = {{STEP:} {A} Time-Efficient Tag Searching Protocol in Large {RFID}
Systems},
journal = {{IEEE} Trans. Computers},
volume = {64},
number = {11},
pages = {3265--3277},
year = {2015}
}
@inproceedings{DBLP:conf/amcis/ChangHLL15,
author = {Alvin Chang and
Ting{-}Kai Hwang and
Yung{-}Ming Li and
Lien{-}Fa Lin},
title = {A Contextual Group Recommender Mechanism for Location-based Service},
booktitle = {{AMCIS}},
publisher = {Association for Information Systems},
year = {2015}
}
@inproceedings{DBLP:conf/compsac/LeongCN15,
author = {Hong Va Leong and
Alvin T. S. Chan and
Grace Ngai},
title = {Approximate Web Database Snapshots},
booktitle = {{COMPSAC}},
pages = {367--376},
publisher = {{IEEE} Computer Society},
year = {2015}
}
@inproceedings{DBLP:conf/icc/ChanZZNVTG15,
author = {Wai Hong Ronald Chan and
Pengfei Zhang and
Wenyu Zhang and
Ido Nevat and
Alvin C. Valera and
Hwee{-}Xian Tan and
Natarajan Gautam},
title = {Adaptive duty cycling in sensor networks via Continuous Time Markov
Chain modelling},
booktitle = {{ICC}},
pages = {6669--6674},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/sac/ZhangYLC15,
author = {Tao Zhang and
Geunseok Yang and
Byungjeong Lee and
Alvin T. S. Chan},
title = {Predicting severity of bug report by mining bug repository with concept
profile},
booktitle = {{SAC}},
pages = {1553--1558},
publisher = {{ACM}},
year = {2015}
}
@article{DBLP:journals/corr/SivaramanBCKLVB15,
author = {Anirudh Sivaraman and
Mihai Budiu and
Alvin Cheung and
Changhoon Kim and
Steve Licking and
George Varghese and
Hari Balakrishnan and
Mohammad Alizadeh and
Nick McKeown},
title = {Packet Transactions: {A} Programming Model for Data-Plane Algorithms
at Hardware Speed},
journal = {CoRR},
volume = {abs/1512.05023},
year = {2015}
}
@article{DBLP:journals/ejasmp/LinWCCCS14,
author = {Yi{-}Ju Lin and
Tien{-}Ming Wang and
Ta{-}Chun Chen and
Yin{-}Lin Chen and
Wei{-}Chen Chang and
Alvin Wen{-}Yu Su},
title = {Musical note analysis of solo violin recordings using recursive regularization},
journal = {{EURASIP} J. Audio Speech Music. Process.},
volume = {2014},
pages = {25},
year = {2014}
}
@article{DBLP:journals/jssc/BoersAVSNAPCKSCYPNYBKZCSRR14,
author = {Michael Boers and
Bagher Afshar and
Iason Vassiliou and
Saikat Sarkar and
Sean T. Nicolson and
Ehsan Adabi and
Bevin George Perumana and
Theodoros Chalvatzis and
Spyros Kavvadias and
Padmanava Sen and
Wei Liat Chan and
Alvin Hsing{-}Ting Yu and
Ali Parsa and
Med Nariman and
Seunghwan Yoon and
Alfred Grau Besoli and
Chryssoula A. Kyriazidou and
Gerasimos Zochios and
Jesus A. Castaneda and
Tirdad Sowlati and
Maryam Rofougaran and
Ahmadreza Rofougaran},
title = {A 16TX/16RX 60 GHz 802.11ad Chipset With Single Coaxial Interface
and Polarization Diversity},
journal = {{IEEE} J. Solid State Circuits},
volume = {49},
number = {12},
pages = {3031--3045},
year = {2014}
}
@article{DBLP:journals/jssc/WangWLZDWMSWCWJY14,
author = {X. Shawn Wang and
Xin Wang and
Fei Lu and
Chen Zhang and
Zongyu Dong and
Li Wang and
Rui Ma and
Zitao Shi and
Albert Z. Wang and
Mau{-}Chung Frank Chang and
Dawn Wang and
Alvin J. Joseph and
C. Patrick Yue},
title = {Concurrent Design Analysis of High-Linearity {SP10T} Switch With 8.5
kV {ESD} Protection},
journal = {{IEEE} J. Solid State Circuits},
volume = {49},
number = {9},
pages = {1927--1941},
year = {2014}
}
@article{DBLP:journals/tcad/ChangLCLSY14,
author = {Da{-}Wei Chang and
Ing{-}Chao Lin and
Yu{-}Shiang Chien and
Ching{-}Lun Lin and
Alvin W. Y. Su and
Chung{-}Ping Young},
title = {{CASA:} Contention-Aware Scratchpad Memory Allocation for Online Hybrid
On-Chip Memory Management},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {33},
number = {12},
pages = {1806--1817},
year = {2014}
}
@inproceedings{DBLP:conf/dsn/QianLSC14,
author = {Chenxiong Qian and
Xiapu Luo and
Yuru Shao and
Alvin T. S. Chan},
title = {On Tracking Information Flows through {JNI} in Android Applications},
booktitle = {{DSN}},
pages = {180--191},
publisher = {{IEEE} Computer Society},
year = {2014}
}
@inproceedings{DBLP:conf/ismir/HsuWLMS14,
author = {Ling{-}Chi Hsu and
Yu{-}Lin Wang and
Yi{-}Ju Lin and
Cheryl D. Metcalf and
Alvin W. Y. Su},
title = {Detection of Motor Changes in Violin Playing by {EMG} Signals},
booktitle = {{ISMIR}},
pages = {495--500},
year = {2014}
}
@inproceedings{DBLP:conf/isscc/BoersVSNAAPCKSC14,
author = {Michael Boers and
Iason Vassiliou and
Saikat Sarkar and
Sean T. Nicolson and
Ehsan Adabi and
Bagher Afshar and
Bevin G. Perumana and
Theodoros Chalvatzis and
Spyros Kavadias and
Padmanava Sen and
Wei Liat Chan and
Alvin Hsing{-}Ting Yu and
Ali Parsa and
Med Nariman and
Seunghwan Yoon and
Alfred Grau Besoli and
Chryssoula A. Kyriazidou and
Gerasimos Zochios and
Namik Kocaman and
Adesh Garg and
Hans Eberhart and
Phil Yang and
Hongyu Xie and
Hea Joung Kim and
Alireza Tarighat Mehrabani and
David Garrett and
Andrew J. Blanksby and
Mong Kuan Wong and
Durai Pandian Thirupathi and
Siukai Mak and
Radha Srinivasan and
Amir Ibrahim and
Ersin Sengul and
Vincent Roussel and
Po{-}Chao Huang and
Tsuifang Yeh and
Murat Mese and
Jesus A. Castaneda and
Brima Ibrahim and
Tirdad Sowlati and
Maryam Rofougaran and
Ahmadreza Rofougaran},
title = {20.2 {A} 16TX/16RX 60GHz 802.11ad chipset with single coaxial interface
and polarization diversity},
booktitle = {{ISSCC}},
pages = {344--345},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/mm/LiNCHLC14,
author = {Jiajia Li and
Grace Ngai and
Stephen Chi{-}fai Chan and
Kien A. Hua and
Hong Va Leong and
Alvin T. S. Chan},
title = {From Writing to Painting: {A} Kinect-Based Cross-Modal Chinese Painting
Generation System},
booktitle = {{ACM} Multimedia},
pages = {57--66},
publisher = {{ACM}},
year = {2014}
}
@article{DBLP:journals/percom/WeiC13,
author = {Edwin J. Y. Wei and
Alvin T. S. Chan},
title = {{CAMPUS:} {A} middleware for automated context-aware adaptation decision
making at run time},
journal = {Pervasive Mob. Comput.},
volume = {9},
number = {1},
pages = {35--56},
year = {2013}
}
@article{DBLP:journals/sigmetrics/YangCYLHC13,
author = {Lei Yang and
Jiannong Cao and
Yin Yuan and
Tao Li and
Andy Han and
Alvin T. S. Chan},
title = {A framework for partitioning and execution of data stream applications
in mobile cloud computing},
journal = {{SIGMETRICS} Perform. Evaluation Rev.},
volume = {40},
number = {4},
pages = {23--32},
year = {2013}
}
@article{DBLP:journals/tist/ChinXWCWZ13,
author = {Alvin Chin and
Bin Xu and
Hao Wang and
Lele Chang and
Hao Wang and
Lijun Zhu},
title = {Connecting people through physical proximity and physical resources
at a conference},
journal = {{ACM} Trans. Intell. Syst. Technol.},
volume = {4},
number = {3},
pages = {50:1--50:21},
year = {2013}
}
@inproceedings{DBLP:conf/apsipa/LinCS13,
author = {Yi{-}Ju Lin and
Wei{-}Chen Chang and
Alvin W. Y. Su},
title = {Quantitative evaluation of violin solo performance},
booktitle = {{APSIPA}},
pages = {1--6},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/cogsci/ChukNCCH13,
author = {Tim Chuk and
Alvin C. W. Ng and
Emanuele Coviello and
Antoni B. Chan and
Janet H. Hsiao},
title = {Understanding eye movements in face recognition with hidden Markov
model},
booktitle = {CogSci},
publisher = {cognitivesciencesociety.org},
year = {2013}
}
@inproceedings{DBLP:conf/icpca/ShiWLC13,
author = {Peizhong Shi and
Yun Wang and
Kai Li and
Alvin T. S. Chan},
title = {Cross-Layer Adaptive End-to-End Delay Control for Asynchronous Duty-Cycle
Wireless Sensor Networks},
booktitle = {{ICPCA/SWS}},
series = {Lecture Notes in Computer Science},
volume = {8351},
pages = {520--531},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/icst/NiuNLC13,
author = {Xintao Niu and
Changhai Nie and
Yu Lei and
Alvin T. S. Chan},
title = {Identifying Failure-Inducing Combinations Using Tuple Relationship},
booktitle = {{ICST} Workshops},
pages = {271--280},
publisher = {{IEEE} Computer Society},
year = {2013}
}
@inproceedings{DBLP:conf/lcn/ShiWLC13,
author = {Peizhong Shi and
Yun Wang and
Kai Li and
Alvin T. S. Chan},
title = {Delay-Constrained and Energy-Balanced broadcasts for low duty-cycled
wireless sensor networks},
booktitle = {{LCN}},
pages = {284--287},
publisher = {{IEEE} Computer Society},
year = {2013}
}
@inproceedings{DBLP:conf/sac/LoTNCLC13,
author = {Kenneth W. K. Lo and
Will W. W. Tang and
Grace Ngai and
Alvin T. S. Chan and
Hong Va Leong and
Stephen C. F. Chan},
title = {i*Chameleon: a platform for developing multimodal application with
comprehensive development cycle},
booktitle = {{SAC}},
pages = {1103--1108},
publisher = {{ACM}},
year = {2013}
}
@inproceedings{DBLP:conf/trustcom/YuC13,
author = {Xiaochuan Yu and
Alvin Chan Toong Shoon},
title = {A Hypercubic Overlay Using Bloom-Filter Based Addressing for a Non-dedicated
Distributed Tag-Based Pub/Sub System},
booktitle = {TrustCom/ISPA/IUCC},
pages = {1008--1015},
publisher = {{IEEE} Computer Society},
year = {2013}
}
@inproceedings{DBLP:conf/trustcom/YuC13a,
author = {Xiaochuan Yu and
Alvin Chan Toong Shoon},
title = {Hope: {A} Fault-Tolerant Distributed Pub/Sub Architecture for Large-Scale
Dynamic Network Environment},
booktitle = {TrustCom/ISPA/IUCC},
pages = {1399--1406},
publisher = {{IEEE} Computer Society},
year = {2013}
}
@inproceedings{DBLP:conf/IEEEcloud/YangCTLC12,
author = {Lei Yang and
Jiannong Cao and
Shaojie Tang and
Tao Li and
Alvin T. S. Chan},
title = {A Framework for Partitioning and Execution of Data Stream Applications
in Mobile Cloud Computing},
booktitle = {{IEEE} {CLOUD}},
pages = {794--802},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/bhi/MaLLGWKL12,
author = {Heather Ting Ma and
Haiyan Lv and
Alvin F. W. Li and
James F. Griffith and
Yixiang Wang and
Anthony Wai Leung Kwok and
Ping Chung Leung},
title = {Perfusion study on Modic changes of spine based on {DCE-MRI}},
booktitle = {{BHI}},
pages = {365--367},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12,
author = {Socrates D. Vamvakos and
Bendik Kleveland and
Dipak K. Sikdar and
B. K. Ahuja and
Haidang Lin and
Jayaprakash Balachandran and
Wignes Balakrishnan and
Aldo Bottelli and
Jawji Chen and
Xiaole Chen and
Jae Choi and
Jeong Choi and
Rajesh Chopra and
Sanjay Dabral and
Kalyan Dasari and
Ronald B. David and
Shaishav Desai and
Claude R. Gauthier and
Mahmudul Hassan and
Kuo{-}Chiang Hsieh and
Ramosan Canagasaby and
Jeff Kumala and
E. P. Kwon and
Ben Lee and
Ming Liu and
Gurupada Mandal and
Sundari Mitra and
Byeong Cheol Na and
Siddharth Panwar and
Jay Patel and
Chethan Rao and
Vithal Rao and
Richard Rouse and
Ritesh Saraf and
Subramanian Seshadri and
Jae{-}K. Sim and
Clement Szeto and
Alvin Wang and
Jason Yeung},
title = {A 576 Mb {DRAM} with 16-channel 10.3125Gbps serial {I/O} and 14.5
ns latency},
booktitle = {{ESSCIRC}},
pages = {458--461},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/hpca/LimTSACRW12,
author = {Kevin T. Lim and
Yoshio Turner and
Jose Renato Santos and
Alvin AuYoung and
Jichuan Chang and
Parthasarathy Ranganathan and
Thomas F. Wenisch},
title = {System-level implications of disaggregated memory},
booktitle = {{HPCA}},
pages = {189--200},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/hpcc/XiaochuanS12,
author = {Xiaochuan Yu and
Alvin Chan Toong Shoon},
title = {A Hypercubic Event-dissemination Overlay Using Structure-aware Addressing
for Distributed XML-based Pub/sub System},
booktitle = {{HPCC-ICESS}},
pages = {179--186},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/iccel/LinLCHL12,
author = {Chih{-}Lung Lin and
Chia{-}Sheng Li and
Yi{-}Ming Chang and
Chia{-}Che Hung and
Alvin Lin},
title = {3D stylus and pressure sensing system for capacitive touch panel},
booktitle = {{ICCE}},
pages = {215--216},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/percom/LoTLCCN12,
author = {Kenneth W. K. Lo and
Wai Wa Tang and
Hong Va Leong and
Alvin T. S. Chan and
Stephen Chi{-}fai Chan and
Grace Ngai},
title = {i{\({_\ast}\)}Chameleon: {A} unified web service framework for integrating
multimodal interaction devices},
booktitle = {PerCom Workshops},
pages = {106--111},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/sin/PohYL12,
author = {Geong Sen Poh and
Kok{-}Lim Alvin Yau and
Mee Hong Ling},
title = {Analysis of a secure cooperative channel sensing protocol for cognitive
radio networks},
booktitle = {{SIN}},
pages = {41--46},
publisher = {{ACM}},
year = {2012}
}
@article{DBLP:journals/bmcbi/VeronikaWNMR11,
author = {Merlin Veronika and
Roy E. Welsch and
Alvin Ng and
Paul Matsudaira and
Jagath C. Rajapakse},
title = {Correlation of cell membrane dynamics and cell motility},
journal = {{BMC} Bioinform.},
volume = {12},
number = {{S-13}},
pages = {S19},
year = {2011}
}
@article{DBLP:journals/esticas/ChangLYSSLWLCC11,
author = {Da{-}Wei Chang and
Sheng{-}Fu Liang and
Chung{-}Ping Young and
Fu{-}Zen Shaw and
Alvin W. Y. Su and
You{-}De Liu and
Yu{-}Lin Wang and
Yi{-}Che Liu and
Jing{-}Jhong Chen and
Chun{-}Yu Chen},
title = {A Versatile Wireless Portable Monitoring System for Brain-Behavior
Approaches},
journal = {{IEEE} J. Emerg. Sel. Topics Circuits Syst.},
volume = {1},
number = {4},
pages = {440--450},
year = {2011}
}
@inproceedings{DBLP:conf/chi/TangLCCLN11,
author = {Wai Wa Tang and
Kenneth W. K. Lo and
Alvin T. S. Chan and
Stephen Chi{-}fai Chan and
Hong Va Leong and
Grace Ngai},
title = {i*Chameleon: a scalable and extensible framework for multimodal interaction},
booktitle = {{CHI} Extended Abstracts},
pages = {305--310},
publisher = {{ACM}},
year = {2011}
}
@inproceedings{DBLP:conf/ithings/XuCWCZYWZ11,
author = {Bin Xu and
Alvin Chin and
Hao Wang and
Lele Chang and
Ke Zhang and
Fangxi Yin and
Hao Wang and
Li Zhang},
title = {Physical Proximity and Online User Behaviour in an Indoor Mobile Social
Networking Application},
booktitle = {iThings/CPSCom},
pages = {273--282},
publisher = {{IEEE} Computer Society},
year = {2011}
}
@inproceedings{DBLP:conf/mdm/XiaochuanA11,
author = {Xiaochuan Yu and
Alvin Chan Toong Shoon},
title = {A Time/Space Efficient {XML} Filtering System for Mobile Environment},
booktitle = {Mobile Data Management {(1)}},
pages = {184--193},
publisher = {{IEEE} Computer Society},
year = {2011}
}
@inproceedings{DBLP:conf/sies/LinCSCC11,
author = {Yi{-}Li Lin and
Wei{-}Tso Chen and
Alvin W. Y. Su and
Da{-}Wei Chang and
Chung{-}Ho Chen},
title = {A low cost, low power, high scalability and dependability processor-cluster
platform},
booktitle = {{SIES}},
pages = {95--98},
publisher = {{IEEE}},
year = {2011}
}
@incollection{DBLP:series/hci/YeoCLTLH11,
author = {Alvin W. Yeo and
Po{-}Chan Chiu and
Tek Yong Lim and
Ping{-}Ping Tan and
Terrin Lim and
Idyawati Hussein},
title = {Usability in Malaysia},
booktitle = {Global Usability},
series = {Human-Computer Interaction Series},
pages = {211--222},
publisher = {Springer},
year = {2011}
}
@article{DBLP:journals/jise/WangCSS10,
author = {Jing{-}Xin Wang and
Yung{-}Chang Chiu and
Alvin Wen{-}Yu Su and
Ce{-}Kuen Shieh},
title = {On Parallelizing {H.264/AVC} Rate-Distortion Optimization Baseline
Profile Encoder},
journal = {J. Inf. Sci. Eng.},
volume = {26},
number = {2},
pages = {409--426},
year = {2010}
}
@inproceedings{DBLP:conf/hipc/WangWCC10,
author = {Yinfeng Wang and
Cho{-}Li Wang and
Jiannong Cao and
Alvin T. S. Chan},
title = {Optimizing data acquisition by sensor-channel co-allocation in wireless
sensor networks},
booktitle = {HiPC},
pages = {1--10},
publisher = {{IEEE} Computer Society},
year = {2010}
}
@inproceedings{DBLP:conf/sac/WeiC10,
author = {Edwin J. Y. Wei and
Alvin T. S. Chan},
title = {Towards semantic-based adaptation decisions for context-aware mobile
computing},
booktitle = {{SAC}},
pages = {563--567},
publisher = {{ACM}},
year = {2010}
}
@article{DBLP:journals/jise/SiaoCS09,
author = {Yi{-}Song Siao and
Wei{-}Chen Chang and
Alvin Wen{-}Yu Su},
title = {Pitch Detection/Tracking Strategy for Musical Recordings of Solo Bowed-String
and Wind Instruments},
journal = {J. Inf. Sci. Eng.},
volume = {25},
number = {4},
pages = {1239--1253},
year = {2009}
}
@inproceedings{DBLP:conf/crowncom/YauKT09,
author = {Kok{-}Lim Alvin Yau and
Peter Komisarczuk and
Paul D. Teal},
title = {A context-aware and Intelligent Dynamic Channel Selection scheme for
cognitive radio networks},
booktitle = {CrownCom},
pages = {1--6},
publisher = {{IEEE}},
year = {2009}
}
@inproceedings{DBLP:conf/cse/HuangCCSSL09,
author = {Sheng{-}Wei Huang and
Yung{-}Chang Chiu and
Zhong{-}Ho Chen and
Ce{-}Kuen Shieh and
Alvin Wen{-}Yu Su and
Tyng{-}Yeu Liang},
title = {A Region-Based Allocation Approach for Page-Based Scratch-Pad Memory
in Embedded Systems},
booktitle = {{CSE} {(2)}},
pages = {9--16},
publisher = {{IEEE} Computer Society},
year = {2009}
}
@inproceedings{DBLP:conf/interspeech/MartinG09,
author = {Alvin F. Martin and
Craig S. Greenberg},
title = {{NIST} 2008 speaker recognition evaluation: performance across telephone
and room microphone channels},
booktitle = {{INTERSPEECH}},
pages = {2579--2582},
publisher = {{ISCA}},
year = {2009}
}
@article{DBLP:journals/ijpcc/CheungYCC08,
author = {Ronnie Cheung and
Gang Yao and
Jiannong Cao and
Alvin T. S. Chan},
title = {A fuzzy service adaptation engine for context-aware mobile computing
middleware},
journal = {Int. J. Pervasive Comput. Commun.},
volume = {4},
number = {2},
pages = {147--165},
year = {2008}
}
@article{DBLP:journals/ivs/ChangLGKRYSZKS08,
author = {Remco Chang and
Alvin Lee and
Mohammad Ghoniem and
Robert Kosara and
William Ribarsky and
Jing Yang and
Evan A. Suma and
Caroline Ziemkiewicz and
Daniel A. Kern and
Agus Sudjianto},
title = {Scalable and interactive visual analysis of financial wire transactions
for fraud detection},
journal = {Inf. Vis.},
volume = {7},
number = {1},
pages = {63--76},
year = {2008}
}
@article{DBLP:journals/tse/ChuangC08,
author = {Siu Nam Chuang and
Alvin T. S. Chan},
title = {Dynamic QoS Adaptation for Mobile Middleware},
journal = {{IEEE} Trans. Software Eng.},
volume = {34},
number = {6},
pages = {738--752},
year = {2008}
}
@article{DBLP:journals/twc/YuCZWCCL08,
author = {Wanrong Yu and
Jiannong Cao and
Xingming Zhou and
Xiaodong Wang and
Keith C. C. Chan and
Alvin T. S. Chan and
Hong Va Leong},
title = {A High-Throughput {MAC} Protocol for Wireless Ad Hoc Networks},
journal = {{IEEE} Trans. Wirel. Commun.},
volume = {7},
number = {1},
pages = {135--145},
year = {2008}
}
@inproceedings{DBLP:conf/sac/LeongC08,
author = {Hong Va Leong and
Alvin T. S. Chan},
title = {Special track on Mobile Computing and Applications: editorial message},
booktitle = {{SAC}},
pages = {1876--1877},
publisher = {{ACM}},
year = {2008}
}
@inproceedings{DBLP:conf/semco/WeiC08,
author = {Edwin J. Y. Wei and
Alvin T. S. Chan},
title = {Semantic Approach to Middleware-Driven Run-Time Context-Aware Adaptation
Decision},
booktitle = {{ICSC}},
pages = {440--447},
publisher = {{IEEE} Computer Society},
year = {2008}
}
@article{DBLP:journals/ejwcn/ChenXWLCCC07,
author = {Yingwen Chen and
Ming Xu and
Huaimin Wang and
Hong Va Leong and
Jiannong Cao and
Keith C. C. Chan and
Alvin T. S. Chan},
title = {An Energy-Efficient Framework for Multirate Query in Wireless Sensor
Networks},
journal = {{EURASIP} J. Wirel. Commun. Netw.},
volume = {2007},
year = {2007}
}
@article{DBLP:journals/jsac/ChowLC07,
author = {Chi{-}Yin Chow and
Hong Va Leong and
Alvin T. S. Chan},
title = {GroCoca: group-based peer-to-peer cooperative caching in mobile environment},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {25},
number = {1},
pages = {179--191},
year = {2007}
}
@inproceedings{DBLP:conf/euc/WeiC07,
author = {Edwin J. Y. Wei and
Alvin T. S. Chan},
title = {Towards Context-Awareness in Ubiquitous Computing},
booktitle = {{EUC}},
series = {Lecture Notes in Computer Science},
volume = {4808},
pages = {706--717},
publisher = {Springer},
year = {2007}
}
@article{DBLP:journals/cluster/CaoCSDG06,
author = {Jiannong Cao and
Alvin T. S. Chan and
Yudong Sun and
Sajal K. Das and
Minyi Guo},
title = {A taxonomy of application scheduling tools for high performance cluster
computing},
journal = {Clust. Comput.},
volume = {9},
number = {3},
pages = {355--371},
year = {2006}
}
@article{DBLP:journals/concurrency/CaoCCC06,
author = {Jiannong Cao and
Alvin T. S. Chan and
Stephen C. F. Chan and
Nick K. C. Cheung},
title = {A robust monitor construct with runtime fault detection},
journal = {Concurr. Comput. Pract. Exp.},
volume = {18},
number = {5},
pages = {471--500},
year = {2006}
}
@article{DBLP:journals/internet/ZhengCN06,
author = {Yongjie Zheng and
Alvin T. S. Chan and
Grace Ngai},
title = {Applying Coordination for Service Adaptation in Mobile Computing},
journal = {{IEEE} Internet Comput.},
volume = {10},
number = {5},
pages = {61--67},
year = {2006}
}
@article{DBLP:journals/spe/ZhengCN06,
author = {Yongjie Zheng and
Alvin T. S. Chan and
Grace Ngai},
title = {{MCL:} a MobiGATE coordination language for highly adaptive and reconfigurable
mobile middleware},
journal = {Softw. Pract. Exp.},
volume = {36},
number = {11-12},
pages = {1355--1380},
year = {2006}
}
@article{DBLP:journals/taslp/ChangS06,
author = {Wei{-}Chen Chang and
Alvin Wen{-}Yu Su},
title = {A Multichannel Recurrent Network Analysis/Synthesis Model for Coupled-String
Instruments},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {14},
number = {6},
pages = {2233--2241},
year = {2006}
}
@article{DBLP:journals/tse/ZhengC06,
author = {Yongjie Zheng and
Alvin T. S. Chan},
title = {MobiGATE: {A} Mobile Computing Middleware for the Active Deployment
of Transport Services},
journal = {{IEEE} Trans. Software Eng.},
volume = {32},
number = {1},
pages = {35--50},
year = {2006}
}
@article{DBLP:journals/twc/FuMT06,
author = {Alvin Fu and
Eytan H. Modiano and
John N. Tsitsiklis},
title = {Optimal transmission scheduling over a fading channel with energy
and deadline constraints},
journal = {{IEEE} Trans. Wirel. Commun.},
volume = {5},
number = {3},
pages = {630--641},
year = {2006}
}
@inproceedings{DBLP:conf/chi/YeoC06,
author = {Alvin W. Yeo and
Po{-}Chan Chiu},
title = {Gaze estimation model for eye drawing},
booktitle = {{CHI} Extended Abstracts},
pages = {1559--1564},
publisher = {{ACM}},
year = {2006}
}
@inproceedings{DBLP:conf/etra/ChanY06,
author = {Po{-}Chan Chiu and
Alvin W. Yeo},
title = {Eye drawing with gaze estimation model},
booktitle = {{ETRA}},
pages = {57},
publisher = {{ACM}},
year = {2006}
}
@inproceedings{DBLP:conf/euc/CheungCYC06,
author = {Ronnie Cheung and
Jiannong Cao and
Gang Yao and
Alvin T. S. Chan},
title = {A Fuzzy-Based Service Adaptation Middleware for Context-Aware Computing},
booktitle = {{EUC}},
series = {Lecture Notes in Computer Science},
volume = {4096},
pages = {580--590},
publisher = {Springer},
year = {2006}
}
@inproceedings{DBLP:conf/fuzzIEEE/ChuangC06,
author = {Siu{-}Nam Chuang and
Alvin T. S. Chan},
title = {MobiPADS++: {A} Mobile QoS Middleware based on Hierarchical Fuzzy
Control},
booktitle = {{FUZZ-IEEE}},
pages = {2223--2230},
publisher = {{IEEE}},
year = {2006}
}
@inproceedings{DBLP:conf/gpc/YuCZWCCL06,
author = {Wanrong Yu and
Jiannong Cao and
Xingming Zhou and
Xiaodong Wang and
Keith C. C. Chan and
Alvin T. S. Chan and
Hong Va Leong},
title = {{VWMAC:} An Efficient {MAC} Protocol for Resolving Intra-flow Contention
in Wireless Ad Hoc Networks},
booktitle = {{GPC}},
series = {Lecture Notes in Computer Science},
volume = {3947},
pages = {498--508},
publisher = {Springer},
year = {2006}
}
@inproceedings{DBLP:conf/iscc/ZhengC06,
author = {Yongjie Zheng and
Alvin T. S. Chan},
title = {Coordinated Composition of Services for Adaptive Mobile Middleware},
booktitle = {{ISCC}},
pages = {789--794},
publisher = {{IEEE} Computer Society},
year = {2006}
}
@inproceedings{DBLP:conf/mdm/ChenLXCCC06,
author = {Yingwen Chen and
Hong Va Leong and
Ming Xu and
Jiannong Cao and
Keith C. C. Chan and
Alvin T. S. Chan},
title = {In-Network Data Processing forWireless Sensor Networks},
booktitle = {{MDM}},
pages = {26},
publisher = {{IEEE} Computer Society},
year = {2006}
}
@inproceedings{DBLP:conf/sac/LeongC06,
author = {Hong Va Leong and
Alvin T. S. Chan},
title = {Editorial message: special track on mobile computing and applications},
booktitle = {{SAC}},
pages = {1120--1121},
publisher = {{ACM}},
year = {2006}
}
@article{DBLP:journals/cacm/Chan05,
author = {Alvin T. S. Chan},
title = {Mobile cookies management on a smart card},
journal = {Commun. {ACM}},
volume = {48},
number = {11},
pages = {38--43},
year = {2005}
}
@article{DBLP:journals/spe/ChanCCZ05,
author = {Fan Chan and
Jiannong Cao and
Alvin T. S. Chan and
Kang Zhang},
title = {Visual programming support for graph-oriented parallel/distributed
processing},
journal = {Softw. Pract. Exp.},
volume = {35},
number = {15},
pages = {1409--1439},
year = {2005}
}
@article{DBLP:journals/tsmc/ChanCC05,
author = {Alvin T. S. Chan and
Jiannong Cao and
C. K. Chan},
title = {{WEBGOP:} collaborative web services based on graph-oriented programming},
journal = {{IEEE} Trans. Syst. Man Cybern. Part {A}},
volume = {35},
number = {6},
pages = {811--830},
year = {2005}
}
@article{DBLP:journals/www/ChuangC05,
author = {Siu Nam Chuang and
Alvin T. S. Chan},
title = {Active Service for Mobile Middleware},
journal = {World Wide Web},
volume = {8},
number = {2},
pages = {127--157},
year = {2005}
}
@inproceedings{DBLP:conf/icws/ChanW05,
author = {Alvin T. S. Chan and
Dick K. T. Wan},
title = {Web Services Mobility in a Pocket},
booktitle = {{ICWS}},
pages = {159--166},
publisher = {{IEEE} Computer Society},
year = {2005}
}
@inproceedings{DBLP:conf/isads/CaoXCL05,
author = {Jiannong Cao and
Wei Xu and
Alvin T. S. Chan and
Jing Li},
title = {A reliable multicast protocol for mailbox-based mobile agent communications},
booktitle = {{ISADS}},
pages = {74--81},
publisher = {{IEEE} Computer Society},
year = {2005}
}
@inproceedings{DBLP:conf/mdm/ChowLC05,
author = {Chi{-}Yin Chow and
Hong Va Leong and
Alvin T. S. Chan},
title = {Distributed group-based cooperative caching in a mobile broadcast
environment},
booktitle = {Mobile Data Management},
pages = {97--106},
publisher = {{ACM}},
year = {2005}
}
@inproceedings{DBLP:conf/rtcsa/CaoXCFJ05,
author = {Jiannong Cao and
Na Xing and
Alvin T. S. Chan and
Yulin Feng and
Beihong Jin},
title = {Service Adaptation Using Fuzzy Theory in Context-Aware Mobile Computing
Middleware},
booktitle = {{RTCSA}},
pages = {496--501},
publisher = {{IEEE} Computer Society},
year = {2005}
}
@inproceedings{DBLP:conf/sac/LeongC05,
author = {Hong Va Leong and
Alvin T. S. Chan},
title = {Editorial message: special track on mobile computing and applications},
booktitle = {{SAC}},
pages = {1118--1119},
publisher = {{ACM}},
year = {2005}
}
@article{DBLP:journals/cera/ChanCLN04,
author = {Alvin T. S. Chan and
Stephen Chi{-}fai Chan and
Hong Va Leong and
Vincent Ng},
title = {Advancement in Co-Operative Internet Computing Research and Applications},
journal = {Concurr. Eng. Res. Appl.},
volume = {12},
number = {3},
pages = {171--173},
year = {2004}
}
@article{DBLP:journals/cj/ChanCL04,
author = {Alvin T. S. Chan and
Siu Nam Chuang and
Jiannong Cao and
Hong Va Leong},
title = {An Event-Driven Middleware for Mobile Context Awareness},
journal = {Comput. J.},
volume = {47},
number = {3},
pages = {278--288},
year = {2004}
}
@article{DBLP:journals/ida/PampalkWC04,
author = {Elias Pampalk and
Gerhard Widmer and
Alvin T. S. Chan},
title = {A new approach to hierarchical clustering and structuring of data
with Self-Organizing Maps},
journal = {Intell. Data Anal.},
volume = {8},
number = {2},
pages = {131--149},
year = {2004}
}
@article{DBLP:journals/ieicet/ChanCCG04,
author = {Fan Chan and
Jiannong Cao and
Alvin T. S. Chan and
Minyi Guo},
title = {Programming Support for {MPMD} Parallel Computing in ClusterGOP},
journal = {{IEICE} Trans. Inf. Syst.},
volume = {87-D},
number = {7},
pages = {1693--1702},
year = {2004}
}
@article{DBLP:journals/ijcpol/ChanCLC04,
author = {Alvin T. S. Chan and
Jiannong Cao and
Chi{-}Kin Liu and
Weidong Cao},
title = {{VPL:} An Online Distance Learning Platform for Virtual Programming
Laboratory},
journal = {Int. J. Comput. Process. Orient. Lang.},
volume = {17},
number = {1},
pages = {41--59},
year = {2004}
}
@article{DBLP:journals/internet/ChuangCCC04,
author = {Siu Nam Chuang and
Alvin T. S. Chan and
Jiannong Cao and
Ronnie Cheung},
title = {Actively Deployable Mobile Services for Adaptive Web Access},
journal = {{IEEE} Internet Comput.},
volume = {8},
number = {2},
pages = {26--33},
year = {2004}
}
@article{DBLP:journals/jpdc/CaoCCWD04,
author = {Jiannong Cao and
Min Cao and
Alvin T. S. Chan and
Gengfeng Wu and
Sajal K. Das},
title = {A framework for architecting and high-level programming support of
{CORBA} applications},
journal = {J. Parallel Distributed Comput.},
volume = {64},
number = {6},
pages = {725--739},
year = {2004}
}
@article{DBLP:journals/tse/WongCL04,
author = {Eugene Y. C. Wong and
Alvin T. S. Chan and
Hong Va Leong},
title = {Xstream: {A} Middleware for Streaming {XML} Contents over Wireless
Environments},
journal = {{IEEE} Trans. Software Eng.},
volume = {30},
number = {12},
pages = {918--935},
year = {2004}
}
@inproceedings{DBLP:conf/aina/ChowLC04,
author = {Chi{-}Yin Chow and
Hong Va Leong and
Alvin T. S. Chan},
title = {Cache Signatures for Peer-to-Peer Cooperative Caching in Mobile Environments},
booktitle = {{AINA} {(1)}},
pages = {96--101},
publisher = {{IEEE} Computer Society},
year = {2004}
}
@inproceedings{DBLP:conf/compsac/ZhengC04,
author = {Yongjie Zheng and
Alvin T. S. Chan},
title = {Stream Composition for Highly Adaptive and Reconfigurable Mobile Middleware},
booktitle = {{COMPSAC}},
pages = {122--127},
publisher = {{IEEE} Computer Society},
year = {2004}
}
@inproceedings{DBLP:conf/icdcsw/ChowLC04,
author = {Chi{-}Yin Chow and
Hong Va Leong and
Alvin T. S. Chan},
title = {Peer-to-Peer Cooperative Caching in Mobile Environments},
booktitle = {{ICDCS} Workshops},
pages = {528--533},
publisher = {{IEEE} Computer Society},
year = {2004}
}
@inproceedings{DBLP:conf/icip/HuangCLSK04,
author = {Win{-}Bin Huang and
Wei{-}Chen Chang and
Yen{-}Wei Lu and
Alvin Wen{-}Yu Su and
Yau{-}Hwang Kuo},
title = {Halftone/contone conversion using neural networks},
booktitle = {{ICIP}},
pages = {3547--3550},
publisher = {{IEEE}},
year = {2004}
}
@inproceedings{DBLP:conf/icpp/CaoTC04,
author = {Jiannong Cao and
Daniel C. K. Tse and
Alvin T. S. Chan},
title = {PDAgent: {A} Platform for Developing and Deploying Mobile Agent-Enabled
Applications for Wireless Devices},
booktitle = {{ICPP}},
pages = {510--517},
publisher = {{IEEE} Computer Society},
year = {2004}
}
@inproceedings{DBLP:conf/icpp/ChowLC04,
author = {Chi{-}Yin Chow and
Hong Va Leong and
Alvin T. S. Chan},
title = {Group-Based Cooperative Cache Management for Mobile Clients in a Mobile
Environment},
booktitle = {{ICPP}},
pages = {83--90},
publisher = {{IEEE} Computer Society},
year = {2004}
}
@inproceedings{DBLP:conf/icpp/ZhengC04,
author = {Yongjie Zheng and
Alvin T. S. Chan},
title = {MobiGATE: {A} Mobile Gateway Proxy for the Active Deployment of Transport
Entities},
booktitle = {{ICPP}},
pages = {566--573},
publisher = {{IEEE} Computer Society},
year = {2004}
}
@inproceedings{DBLP:conf/ispa/ChanWC04,
author = {Alvin T. S. Chan and
Peter Y. H. Wong and
Siu Nam Chuang},
title = {{CRL:} {A} Context-Aware Request Language for Mobile Computing},
booktitle = {{ISPA}},
series = {Lecture Notes in Computer Science},
volume = {3358},
pages = {529--533},
publisher = {Springer},
year = {2004}
}
@inproceedings{DBLP:conf/ispa/ChiuSWSL04,
author = {Yung{-}Chang Chiu and
Ce{-}Kuen Shieh and
Jing{-}Xin Wang and
Alvin Wen{-}Yu Su and
Tyng{-}Yeu Liang},
title = {A Real Time {MPEG-4} Parallel Encoder on Software Distributed Shared
Memory Systems},
booktitle = {{ISPA}},
series = {Lecture Notes in Computer Science},
volume = {3358},
pages = {965--974},
publisher = {Springer},
year = {2004}
}
@inproceedings{DBLP:conf/ispan/ChowLC04,
author = {Chi{-}Yin Chow and
Hong Va Leong and
Alvin T. S. Chan},
title = {Peer-to-Peer Cooperative Caching in a Hybrid Data Delivery Environment},
booktitle = {{ISPAN}},
pages = {79--85},
publisher = {{IEEE} Computer Society},
year = {2004}
}
@inproceedings{DBLP:conf/sac/Chan04,
author = {Alvin T. S. Chan},
title = {Cookies on-the-move: managing cookies on a smart card},
booktitle = {{SAC}},
pages = {1693--1697},
publisher = {{ACM}},
year = {2004}
}
@inproceedings{DBLP:conf/sac/LeongC04,
author = {Hong Va Leong and
Alvin T. S. Chan},
title = {Editorial message: special track on mobile computing and applications},
booktitle = {{SAC}},
pages = {1149--1150},
publisher = {{ACM}},
year = {2004}
}
@inproceedings{DBLP:conf/sac/WongCL04,
author = {Eugene Y. C. Wong and
Alvin T. S. Chan and
Hong Va Leong},
title = {Efficient management of {XML} contents over wireless environment by
Xstream},
booktitle = {{SAC}},
pages = {1122--1127},
publisher = {{ACM}},
year = {2004}
}
@article{DBLP:journals/scp/CaoCSZ03,
author = {Jiannong Cao and
Alvin T. S. Chan and
Yudong Sun and
Kang Zhang},
title = {Dynamic configuration management in a graph-oriented Distributed Programming
Environment},
journal = {Sci. Comput. Program.},
volume = {48},
number = {1},
pages = {43--65},
year = {2003}
}
@article{DBLP:journals/spe/CaoMCL03,
author = {Jiannong Cao and
Xiaoxing Ma and
Alvin T. S. Chan and
Jian Lu},
title = {Architecting and implementing distributed Web applications using the
graph-oriented approach},
journal = {Softw. Pract. Exp.},
volume = {33},
number = {9},
pages = {799--820},
year = {2003}
}
@article{DBLP:journals/tse/ChanC03,
author = {Alvin T. S. Chan and
Siu Nam Chuang},
title = {MobiPADS: {A} Reflective Middleware for Context-Aware Mobile Computing},
journal = {{IEEE} Trans. Software Eng.},
volume = {29},
number = {12},
pages = {1072--1085},
year = {2003}
}
@inproceedings{DBLP:conf/appt/RenCCL03,
author = {Zhihong Ren and
Jiannong Cao and
Alvin T. S. Chan and
Jing Li},
title = {Composition and Automation of Grid Services},
booktitle = {{APPT}},
series = {Lecture Notes in Computer Science},
volume = {2834},
pages = {352--362},
publisher = {Springer},
year = {2003}
}
@inproceedings{DBLP:conf/compsac/WongCL03,
author = {Eugene Y. C. Wong and
Alvin T. S. Chan and
Hong Va Leong},
title = {Semantic-based Approach to Streaming {XML} Contents using Xstream},
booktitle = {{COMPSAC}},
pages = {91},
publisher = {{IEEE} Computer Society},
year = {2003}
}
@inproceedings{DBLP:conf/icpp/RenCCL03,
author = {Zhihong Ren and
Jiannong Cao and
Alvin T. S. Chan and
Jing Li},
title = {Toward a Formal Approach to Composite Web Service Construction and
Automation},
booktitle = {{ICPP}},
pages = {436},
publisher = {{IEEE} Computer Society},
year = {2003}
}
@inproceedings{DBLP:conf/icwl/ChanCLC03,
author = {Alvin T. S. Chan and
Jiannong Cao and
Chi{-}Kin Liu and
Weidong Cao},
title = {Design and Implementation of {VPL:} {A} Virtual Programming Laboratory
for Online Distance Learning},
booktitle = {{ICWL}},
series = {Lecture Notes in Computer Science},
volume = {2783},
pages = {509--519},
publisher = {Springer},
year = {2003}
}
@inproceedings{DBLP:conf/infocom/FuMT03,
author = {Alvin Fu and
Eytan H. Modiano and
John N. Tsitsiklis},
title = {Optimal Energy Allocation for Delay-Constrained Data Transmission
over a Time-Varying Channel},
booktitle = {{INFOCOM}},
pages = {1095--1105},
publisher = {{IEEE} Computer Society},
year = {2003}
}
@inproceedings{DBLP:conf/iscc/ChanCC03,
author = {Alvin T. S. Chan and
C. K. Chan and
Jiannong Cao},
title = {Programming Distributed Web Services Using WebGOP: {A} Graph-Oriented
Approach},
booktitle = {{ISCC}},
pages = {413--418},
publisher = {{IEEE} Computer Society},
year = {2003}
}
@inproceedings{DBLP:conf/sac/Chan03,
author = {Alvin T. S. Chan},
title = {Integrating Smart Card Access to Web-Based Medical Information System},
booktitle = {{SAC}},
pages = {246--250},
publisher = {{ACM}},
year = {2003}
}
@inproceedings{DBLP:conf/sac/ChanLCHLL03,
author = {Alvin T. S. Chan and
Hong Va Leong and
Joseph Chan and
Alan Hon and
Larry Lau and
Leo Li},
title = {Bluepoint: {A} Bluetooth-based Architecture for Location-Positioning
Services},
booktitle = {{SAC}},
pages = {990--995},
publisher = {{ACM}},
year = {2003}
}
@inproceedings{DBLP:conf/sac/LeongC03,
author = {Hong Va Leong and
Alvin T. S. Chan},
title = {Mobile Computing and Applications Track Editorial},
booktitle = {{SAC}},
pages = {853--854},
publisher = {{ACM}},
year = {2003}
}
@inproceedings{DBLP:conf/seke/MaLCCZ03,
author = {Xiaoxing Ma and
Jian Lu and
Jiannong Cao and
Alvin T. S. Chan and
Kang Zhang},
title = {A Graph-Oriented Approach to the Description and Implementation of
Distributed and Dynamic Software Architecture},
booktitle = {{SEKE}},
pages = {518--525},
year = {2003}
}
@inproceedings{DBLP:conf/www/ChuangCCC03,
author = {Siu Nam Chuang and
Alvin T. S. Chan and
Jiannong Cao and
Ronnie Cheung},
title = {Dynamic service reconfiguration for wireless web access},
booktitle = {{WWW}},
pages = {58--67},
publisher = {{ACM}},
year = {2003}
}
@inproceedings{DBLP:conf/www/WongCL03,
author = {Eugene Y. C. Wong and
Alvin T. S. Chan and
Hong Va Leong},
title = {Xstream: {A} Framework for the Efficient Streaming of {XML} Documents
over a Wireless Environment},
booktitle = {{WWW} (Posters)},
year = {2003}
}
@article{DBLP:journals/bmcbi/MutchBMRR02,
author = {David M. Mutch and
Alvin Berger and
Robert Mansourian and
Andreas Rytz and
Matthew{-}Alan Roberts},
title = {The limit fold change model: {A} practical approach for selecting
differentially expressed genes from microarray data},
journal = {{BMC} Bioinform.},
volume = {3},
pages = {17},
year = {2002}
}
@article{DBLP:journals/internet/ChanTCL02,
author = {Alvin T. S. Chan and
Florine Tse and
Jiannong Cao and
Hong Va Leong},
title = {Enabling Distributed Corba Access to Smart Card Applications},
journal = {{IEEE} Internet Comput.},
volume = {6},
number = {3},
pages = {27--36},
year = {2002}
}
@article{DBLP:journals/jasis/LukLDCCA02,
author = {Robert W. P. Luk and
Hong Va Leong and
Tharam S. Dillon and
Alvin T. S. Chan and
W. Bruce Croft and
James Allan},
title = {A survey in indexing and searching {XML} documents},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {53},
number = {6},
pages = {415--437},
year = {2002}
}
@inproceedings{DBLP:conf/icpads/CaoCCW02,
author = {Jiannong Cao and
Min Cao and
Alvin T. S. Chan and
Gengfeng Wu},
title = {Architectural Level support for Dynamic Reconfiguration and Fault
Tolerance in Component-Based Distributed Software},
booktitle = {{ICPADS}},
pages = {251--256},
publisher = {{IEEE} Computer Society},
year = {2002}
}
@inproceedings{DBLP:conf/icpp/ChuangCC02,
author = {Siu Nam Chuang and
Alvin T. S. Chan and
Jiannong Cao},
title = {Dynamic Service Composition for Wireless Web Access},
booktitle = {{ICPP}},
pages = {429--436},
publisher = {{IEEE} Computer Society},
year = {2002}
}
@inproceedings{DBLP:conf/icpp/MaCL02,
author = {Xiaoxing Ma and
Alvin T. S. Chan and
Jian Lu},
title = {WebGOP: {A} Framework for Architecting and Programming Dynamic Distributed
Web Applications},
booktitle = {{ICPP}},
pages = {266--275},
publisher = {{IEEE} Computer Society},
year = {2002}
}
@inproceedings{DBLP:conf/icwl/CaoCCY02,
author = {Jiannong Cao and
Alvin T. S. Chan and
Weidong Cao and
Cassidy Yeung},
title = {Virtual Programming Lab for Online Distance Learning},
booktitle = {{ICWL}},
series = {Lecture Notes in Computer Science},
volume = {2436},
pages = {216--227},
publisher = {Springer},
year = {2002}
}
@inproceedings{DBLP:conf/ipps/CaoLC02,
author = {Jiannong Cao and
Patrick Leung and
Alvin T. S. Chan},
title = {A Scalable and Reliable Multicast Communiction Service in Java},
booktitle = {{IPDPS}},
publisher = {{IEEE} Computer Society},
year = {2002}
}
@inproceedings{DBLP:conf/nnsp/ChangS02,
author = {Wei{-}Chen Chang and
Alvin Wen{-}Yu Su},
title = {A multi-channel recurrent network for synthesizing struck coupled-string
musical instruments},
booktitle = {{NNSP}},
pages = {677--686},
publisher = {{IEEE}},
year = {2002}
}
@inproceedings{DBLP:conf/sac/MakLC02,
author = {Jess Y. S. Mak and
Hong Va Leong and
Alvin T. S. Chan},
title = {Dynamic structuring of web information for access visualization},
booktitle = {{SAC}},
pages = {778--784},
publisher = {{ACM}},
year = {2002}
}
@inproceedings{DBLP:conf/wcnc/ChuangCC02,
author = {Siu{-}Nam Chuang and
Alvin T. S. Chan and
Jiannong Cao},
title = {An active service framework supporting wireless Web access},
booktitle = {{WCNC}},
pages = {630--634},
publisher = {{IEEE}},
year = {2002}
}
@article{DBLP:journals/cacm/ChanCCY01,
author = {Alvin T. S. Chan and
Jiannong Cao and
Henry C. B. Chan and
Gilbert H. Young},
title = {A web-enabled framework for smart card applications in health services},
journal = {Commun. {ACM}},
volume = {44},
number = {9},
pages = {76--82},
year = {2001}
}
@article{DBLP:journals/cera/ChanLNC01,
author = {Stephen C. F. Chan and
Paul S. H. Lee and
Vincent T. Y. Ng and
Alvin T. S. Chan},
title = {Synchronous Collaborative Development of {UML} Models on the Internet},
journal = {Concurr. Eng. Res. Appl.},
volume = {9},
number = {2},
pages = {111--119},
year = {2001}
}
@article{DBLP:journals/join/CaoCC01,
author = {Jiannong Cao and
Nick K. C. Cheung and
Alvin T. S. Chan},
title = {{JDM:} Building Distributed Synchronization Support into Java},
journal = {J. Interconnect. Networks},
volume = {2},
number = {3},
pages = {269--282},
year = {2001}
}
@inproceedings{DBLP:conf/doa/ChanTCL01,
author = {Alvin T. S. Chan and
Florine Tse and
Jiannong Cao and
Hong Va Leong},
title = {Distributed Object Programming Environment for Smart Card Application
Development},
booktitle = {{DOA}},
pages = {251--259},
publisher = {{IEEE} Computer Society},
year = {2001}
}
@inproceedings{DBLP:conf/dsn/CaoCC01,
author = {Jiannong Cao and
Nick K. C. Cheung and
Alvin T. S. Chan},
title = {Run-Time Fault Detection in Monitor Based Concurrent Programming},
booktitle = {{DSN}},
pages = {357--368},
publisher = {{IEEE} Computer Society},
year = {2001}
}
@inproceedings{DBLP:conf/icalt/ChanCC01,
author = {Alvin T. S. Chan and
Steven Y. C. Chan and
Jiannong Cao},
title = {{SAC:} {A} Self-Paced and Adaptive Courseware System},
booktitle = {{ICALT}},
pages = {78--81},
publisher = {{IEEE} Computer Society},
year = {2001}
}
@inproceedings{DBLP:conf/icppw/CaoCW01,
author = {Jiannong Cao and
Alvin T. S. Chan and
Jie Wu},
title = {Achieving Replication Consistency Using Cooperating Mobile Agents},
booktitle = {{ICPP} Workshops},
pages = {453--458},
publisher = {{IEEE} Computer Society},
year = {2001}
}
@inproceedings{DBLP:conf/ipps/CheungCC01,
author = {Nick K. C. Cheung and
Jiannong Cao and
Alvin T. S. Chan},
title = {Analysis and Evaluation of a Distributed Monitor Construct in Java},
booktitle = {{IPDPS}},
pages = {108},
publisher = {{IEEE} Computer Society},
year = {2001}
}
@inproceedings{DBLP:conf/mdm/ChanHCC01,
author = {Alvin T. S. Chan and
Dan He and
Siu Nam Chuang and
Jiannong Cao},
title = {Towards a Programmable Mobile {IP}},
booktitle = {Mobile Data Management},
series = {Lecture Notes in Computer Science},
volume = {1987},
pages = {210--221},
publisher = {Springer},
year = {2001}
}
@article{DBLP:journals/ijmi/Chan00,
author = {Alvin T. S. Chan},
title = {WWW+smart card: towards a mobile health care management system},
journal = {Int. J. Medical Informatics},
volume = {57},
number = {2-3},
pages = {127--137},
year = {2000}
}
@inproceedings{DBLP:conf/cifer/Kuruc00,
author = {Alvin Kuruc},
title = {Apples to oranges: reconciling "vegas" from inconsistent valuation
models by a stochastic change of coordinates},
booktitle = {CIFEr},
pages = {143--146},
publisher = {{IEEE}},
year = {2000}
}
@article{DBLP:journals/cn/Chan99,
author = {Alvin T. S. Chan},
title = {Web-Enabled Smart Card for Ubiquitous Access of Patient's Medical
Record},
journal = {Comput. Networks},
volume = {31},
number = {11-16},
pages = {1591--1598},
year = {1999}
}
@inproceedings{DBLP:conf/icassp/GarciaM99,
author = {Alvin Garcia and
Richard J. Mammone},
title = {Channel-robust speaker identification using modified-mean cepstral
mean normalization with frequency warping},
booktitle = {{ICASSP}},
pages = {325--328},
publisher = {{IEEE} Computer Society},
year = {1999}
}
@inproceedings{DBLP:conf/interspeech/PrzybockiM99,
author = {Mark A. Przybocki and
Alvin F. Martin},
title = {The 1999 {NIST} speaker recognition evaluation, using summed two-channel
telephone data for speaker detection and speaker tracking},
booktitle = {{EUROSPEECH}},
pages = {2215--2218},
publisher = {{ISCA}},
year = {1999}
}
@inproceedings{DBLP:conf/wcnc/ChanC99,
author = {Alvin T. S. Chan and
Jiannong Cao},
title = {{PANTA:} {A} graph-oriented programmable active network transport
architecture},
booktitle = {{WCNC}},
pages = {1293--1297},
publisher = {{IEEE}},
year = {1999}
}
@article{DBLP:journals/tse/McLellanRFCS98,
author = {Samuel G. McLellan and
Alvin W. Roesler and
Zongming Fei and
Savita Chandran and
Clay Spinuzzi},
title = {Experience Using Web-Based Shotgun Measures for Large-System Characterization
and Improvement},
journal = {{IEEE} Trans. Software Eng.},
volume = {24},
number = {4},
pages = {268--277},
year = {1998}
}
@inproceedings{DBLP:conf/isca/WoodCFHLLLMPR93,
author = {David A. Wood and
Satish Chandra and
Babak Falsafi and
Mark D. Hill and
James R. Larus and
Alvin R. Lebeck and
James C. Lewis and
Shubhendu S. Mukherjee and
Subbarao Palacharla and
Steven K. Reinhardt},
title = {Mechanisms for Cooperative Shared Memory},
booktitle = {{ISCA}},
pages = {156--167},
publisher = {{ACM}},
year = {1993}
}
@inproceedings{DBLP:conf/compcon/DespainPDCC86,
author = {Alvin M. Despain and
Yale N. Patt and
Tep P. Dobry and
Jung{-}Herng Chang and
Wayne Citrin},
title = {High Performance Prolog, The Multiplicative Effect of Several Levels
of Implementation},
booktitle = {{COMPCON}},
pages = {178--185},
publisher = {{IEEE} Computer Society},
year = {1986}
}
@inproceedings{DBLP:conf/compcon/ChangDD85,
author = {Jung{-}Herng Chang and
Alvin M. Despain and
Doug DeGroot},
title = {AND-Parallelism of Logic Programs Based on a Static Data Dependency
Analysis},
booktitle = {{COMPCON}},
pages = {218--226},
publisher = {{IEEE} Computer Society},
year = {1985}
}
@inproceedings{DBLP:conf/slp/ChangD85,
author = {Jung{-}Herng Chang and
Alvin M. Despain},
title = {Semi-Intelligent Backtracking of Prolog Based on Static Data Dependency
Analysis},
booktitle = {{SLP}},
pages = {10--21},
publisher = {{IEEE-CS}},
year = {1985}
}
@article{DBLP:journals/mss/RothM82,
author = {Alvin E. Roth and
Michael W. K. Malouf},
title = {Scale changes and shared information in bargaining: An experimental
study},
journal = {Math. Soc. Sci.},
volume = {3},
number = {2},
pages = {157--177},
year = {1982}
}
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-11-14 02:23 CET from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
