Search dblp for Publications

export results for "Alvin Chan"

 download as .bib file

@article{DBLP:journals/npjdm/HuangCWDLWAL24,
  author       = {Jane J. Huang and
                  Roomasa Channa and
                  Risa M. Wolf and
                  Yiwen Dong and
                  Mavis Liang and
                  Jiangxia Wang and
                  Michael D. Abr{\`{a}}moff and
                  T. Y. Alvin Liu},
  title        = {Autonomous artificial intelligence for diabetic eye disease increases
                  access and health equity in underserved populations},
  journal      = {npj Digit. Medicine},
  volume       = {7},
  number       = {1},
  year         = {2024},
  url          = {https://doi.org/10.1038/s41746-024-01197-3},
  doi          = {10.1038/S41746-024-01197-3},
  timestamp    = {Thu, 29 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/npjdm/HuangCWDLWAL24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/HuangCWDLWAL24a,
  author       = {Jane J. Huang and
                  Roomasa Channa and
                  Risa M. Wolf and
                  Yiwen Dong and
                  Mavis Liang and
                  Jiangxia Wang and
                  Michael D. Abr{\`{a}}moff and
                  T. Y. Alvin Liu},
  title        = {Author Correction: Autonomous artificial intelligence for diabetic
                  eye disease increases access and health equity in underserved populations},
  journal      = {npj Digit. Medicine},
  volume       = {7},
  number       = {1},
  year         = {2024},
  url          = {https://doi.org/10.1038/s41746-024-01229-y},
  doi          = {10.1038/S41746-024-01229-Y},
  timestamp    = {Fri, 20 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/npjdm/HuangCWDLWAL24a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pvldb/KittivorawongGHC24,
  author       = {Chanwut Kittivorawong and
                  Yongming Ge and
                  Yousef Helal and
                  Alvin Cheung},
  title        = {Spatialyze: {A} Geospatial Video Analytics System with Spatial-Aware
                  Optimizations},
  journal      = {Proc. {VLDB} Endow.},
  volume       = {17},
  number       = {9},
  pages        = {2136--2148},
  year         = {2024},
  url          = {https://www.vldb.org/pvldb/vol17/p2136-kittivorawong.pdf},
  timestamp    = {Thu, 18 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pvldb/KittivorawongGHC24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/ChouLTYCWJK24,
  author       = {Yao{-}Hsin Chou and
                  Yun{-}Ting Lai and
                  Yong Feng Tong and
                  Alvin Young and
                  Ming{-}Ho Chang and
                  Kun{-}Min Wu and
                  Yu{-}Chi Jiang and
                  Shu{-}Yu Kuo},
  title        = {A Quantum-Inspired Multi-objective Portfolio Strategy Based on Trend
                  Ratio Model in Global Financial Network},
  booktitle    = {{IEEE} Congress on Evolutionary Computation, {CEC} 2024, Yokohama,
                  Japan, June 30 - July 5, 2024},
  pages        = {1--8},
  year         = {2024},
  crossref     = {DBLP:conf/cec/2024},
  url          = {https://doi.org/10.1109/CEC60901.2024.10611925},
  doi          = {10.1109/CEC60901.2024.10611925},
  timestamp    = {Tue, 20 Aug 2024 15:15:31 +0200},
  biburl       = {https://dblp.org/rec/conf/cec/ChouLTYCWJK24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispd/HoCGHKLR24,
  author       = {Chia{-}Tung Ho and
                  Ajay Chandna and
                  David Guan and
                  Alvin Ho and
                  Minsoo Kim and
                  Yaguang Li and
                  Haoxing Ren},
  title        = {Novel Transformer Model Based Clustering Method for Standard Cell
                  Design Automation},
  booktitle    = {Proceedings of the 2024 International Symposium on Physical Design,
                  {ISPD} 2024, Taipei, Taiwan, March 12-15, 2024},
  pages        = {195--203},
  year         = {2024},
  crossref     = {DBLP:conf/ispd/2024},
  url          = {https://doi.org/10.1145/3626184.3633314},
  doi          = {10.1145/3626184.3633314},
  timestamp    = {Mon, 01 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ispd/HoCGHKLR24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2408-00118,
  author       = {Morgane Rivi{\`{e}}re and
                  Shreya Pathak and
                  Pier Giuseppe Sessa and
                  Cassidy Hardin and
                  Surya Bhupatiraju and
                  L{\'{e}}onard Hussenot and
                  Thomas Mesnard and
                  Bobak Shahriari and
                  Alexandre Ram{\'{e}} and
                  Johan Ferret and
                  Peter Liu and
                  Pouya Tafti and
                  Abe Friesen and
                  Michelle Casbon and
                  Sabela Ramos and
                  Ravin Kumar and
                  Charline Le Lan and
                  Sammy Jerome and
                  Anton Tsitsulin and
                  Nino Vieillard and
                  Piotr Stanczyk and
                  Sertan Girgin and
                  Nikola Momchev and
                  Matt Hoffman and
                  Shantanu Thakoor and
                  Jean{-}Bastien Grill and
                  Behnam Neyshabur and
                  Olivier Bachem and
                  Alanna Walton and
                  Aliaksei Severyn and
                  Alicia Parrish and
                  Aliya Ahmad and
                  Allen Hutchison and
                  Alvin Abdagic and
                  Amanda Carl and
                  Amy Shen and
                  Andy Brock and
                  Andy Coenen and
                  Anthony Laforge and
                  Antonia Paterson and
                  Ben Bastian and
                  Bilal Piot and
                  Bo Wu and
                  Brandon Royal and
                  Charlie Chen and
                  Chintu Kumar and
                  Chris Perry and
                  Chris Welty and
                  Christopher A. Choquette{-}Choo and
                  Danila Sinopalnikov and
                  David Weinberger and
                  Dimple Vijaykumar and
                  Dominika Rogozinska and
                  Dustin Herbison and
                  Elisa Bandy and
                  Emma Wang and
                  Eric Noland and
                  Erica Moreira and
                  Evan Senter and
                  Evgenii Eltyshev and
                  Francesco Visin and
                  Gabriel Rasskin and
                  Gary Wei and
                  Glenn Cameron and
                  Gus Martins and
                  Hadi Hashemi and
                  Hanna Klimczak{-}Plucinska and
                  Harleen Batra and
                  Harsh Dhand and
                  Ivan Nardini and
                  Jacinda Mein and
                  Jack Zhou and
                  James Svensson and
                  Jeff Stanway and
                  Jetha Chan and
                  Jin Peng Zhou and
                  Joana Carrasqueira and
                  Joana Iljazi and
                  Jocelyn Becker and
                  Joe Fernandez and
                  Joost van Amersfoort and
                  Josh Gordon and
                  Josh Lipschultz and
                  Josh Newlan and
                  Ju{-}yeong Ji and
                  Kareem Mohamed and
                  Kartikeya Badola and
                  Kat Black and
                  Katie Millican and
                  Keelin McDonell and
                  Kelvin Nguyen and
                  Kiranbir Sodhia and
                  Kish Greene and
                  Lars Lowe Sj{\"{o}}sund and
                  Lauren Usui and
                  Laurent Sifre and
                  Lena Heuermann and
                  Leticia Lago and
                  Lilly McNealus},
  title        = {Gemma 2: Improving Open Language Models at a Practical Size},
  journal      = {CoRR},
  volume       = {abs/2408.00118},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2408.00118},
  doi          = {10.48550/ARXIV.2408.00118},
  eprinttype    = {arXiv},
  eprint       = {2408.00118},
  timestamp    = {Mon, 30 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2408-00118.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cim/ChenWCLO23,
  author       = {Zhenghua Chen and
                  Min Wu and
                  Alvin Chan and
                  Xiaoli Li and
                  Yew{-}Soon Ong},
  title        = {Survey on {AI} Sustainability: Emerging Trends on Learning Algorithms
                  and Research Challenges [Review Article]},
  journal      = {{IEEE} Comput. Intell. Mag.},
  volume       = {18},
  number       = {2},
  pages        = {60--77},
  year         = {2023},
  url          = {https://doi.org/10.1109/MCI.2023.3245733},
  doi          = {10.1109/MCI.2023.3245733},
  timestamp    = {Sat, 29 Apr 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cim/ChenWCLO23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbi/TanSBCLLECLTKCBG23,
  author       = {Hong Chang Tan and
                  Elizabeth Shumbayawonda and
                  Cayden Beyer and
                  Lionel Tim{-}Ee Cheng and
                  Albert Low and
                  Chin Hong Lim and
                  Alvin Eng and
                  Weng Hoong Chan and
                  Phong Ching Lee and
                  Mei Fang Tay and
                  Stella Kin and
                  Jason Pik Eu Chang and
                  Yong Mong Bee and
                  George Boon Bee Goh},
  title        = {Multiparametric Magnetic Resonance Imaging and Magnetic Resonance
                  Elastography to Evaluate the Early Effects of Bariatric Surgery on
                  Nonalcoholic Fatty Liver Disease},
  journal      = {Int. J. Biomed. Imaging},
  volume       = {2023},
  pages        = {4228321:1--4228321:8},
  year         = {2023},
  url          = {https://doi.org/10.1155/2023/4228321},
  doi          = {10.1155/2023/4228321},
  timestamp    = {Fri, 27 Oct 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijbi/TanSBCLLECLTKCBG23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jossw/ScheidgenHLSNFCGMBBGDLDANSDKMRDPK23,
  author       = {Markus Scheidgen and
                  Lauri Himanen and
                  Alvin N. Ladines and
                  David Sikter and
                  Mohammad Nakhaee and
                  {\'{A}}d{\'{a}}m Fekete and
                  Theodore Chang and
                  Amir Golparvar and
                  Jos{\'{e}} A. M{\'{a}}rquez and
                  Sandor Brockhauser and
                  Sebastian Br{\"{u}}ckner and
                  Luca M. Ghiringhelli and
                  Felix Dietrich and
                  Daniel Lehmberg and
                  Thea Denell and
                  Andrea Albino and
                  Hampus N{\"{a}}sstr{\"{o}}m and
                  Sherjeel Shabih and
                  Florian Dobener and
                  Markus K{\"{u}}hbach and
                  Rubel Mozumder and
                  Joseph F. Rudzinski and
                  Nathan Daelman and
                  Jos{\'{e}} M. Pizarro and
                  Martin Kuban and
                  Cuauhtemoc Salazar and
                  Pavel Ondracka and
                  Hans{-}Joachim Bungartz and
                  Claudia Draxl},
  title        = {{NOMAD:} {A} distributed web-based platform for managing materials
                  science research data},
  journal      = {J. Open Source Softw.},
  volume       = {8},
  number       = {90},
  pages        = {5388},
  year         = {2023},
  url          = {https://doi.org/10.21105/joss.05388},
  doi          = {10.21105/JOSS.05388},
  timestamp    = {Tue, 28 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jossw/ScheidgenHLSNFCGMBBGDLDANSDKMRDPK23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pvldb/CheungAHKLLWY23,
  author       = {Alvin Cheung and
                  Maaz Bin Safeer Ahmad and
                  Brandon Haynes and
                  Chanwut Kittivorawong and
                  Shadaj Laddad and
                  Xiaoxuan Liu and
                  Chenglong Wang and
                  Cong Yan},
  title        = {Towards Auto-Generated Data Systems},
  journal      = {Proc. {VLDB} Endow.},
  volume       = {16},
  number       = {12},
  pages        = {4116--4129},
  year         = {2023},
  url          = {https://www.vldb.org/pvldb/vol16/p4116-cheung.pdf},
  doi          = {10.14778/3611540.3611635},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pvldb/CheungAHKLLWY23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ral/ChenSL23,
  author       = {Rui Chen and
                  Alvin Shek and
                  Changliu Liu},
  title        = {Robust and Context-Aware Real-Time Collaborative Robot Handling via
                  Dynamic Gesture Commands},
  journal      = {{IEEE} Robotics Autom. Lett.},
  volume       = {8},
  number       = {6},
  pages        = {3510--3517},
  year         = {2023},
  url          = {https://doi.org/10.1109/LRA.2023.3268586},
  doi          = {10.1109/LRA.2023.3268586},
  timestamp    = {Tue, 19 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ral/ChenSL23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csedu/ChanWGSL23,
  author       = {Alvin Toong Shoon Chan and
                  Peng{-}Cheng Wang and
                  Frank Guan and
                  Saw Han Soo and
                  Haris Lim Hao Li},
  title        = {Integration of Virtual Reality with Intelligent Tutoring for High
                  Fidelity Air Traffic Control Training},
  booktitle    = {Proceedings of the 15th International Conference on Computer Supported
                  Education, {CSEDU} 2023, Prague, Czech Republic, April 21-23, 2023,
                  Volume 2},
  pages        = {199--206},
  year         = {2023},
  crossref     = {DBLP:conf/csedu/2023-2},
  url          = {https://doi.org/10.5220/0011732200003470},
  doi          = {10.5220/0011732200003470},
  timestamp    = {Wed, 29 May 2024 11:49:33 +0200},
  biburl       = {https://dblp.org/rec/conf/csedu/ChanWGSL23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/WanHPXHGRS23,
  author       = {Alvin Wan and
                  Hanxiang Hao and
                  Kaushik Patnaik and
                  Yueyang Xu and
                  Omer Hadad and
                  David G{\"{u}}era and
                  Zhile Ren and
                  Qi Shan},
  title        = {{UPSCALE:} Unconstrained Channel Pruning},
  booktitle    = {International Conference on Machine Learning, {ICML} 2023, 23-29 July
                  2023, Honolulu, Hawaii, {USA}},
  pages        = {35384--35412},
  year         = {2023},
  crossref     = {DBLP:conf/icml/2023},
  url          = {https://proceedings.mlr.press/v202/wan23a.html},
  timestamp    = {Mon, 28 Aug 2023 17:23:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icml/WanHPXHGRS23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/ShekSCL23,
  author       = {Alvin Shek and
                  Bo Ying Su and
                  Rui Chen and
                  Changliu Liu},
  title        = {Learning from Physical Human Feedback: An Object-Centric One-Shot
                  Adaptation Method},
  booktitle    = {{IEEE} International Conference on Robotics and Automation, {ICRA}
                  2023, London, UK, May 29 - June 2, 2023},
  pages        = {9910--9916},
  year         = {2023},
  crossref     = {DBLP:conf/icra/2023},
  url          = {https://doi.org/10.1109/ICRA48891.2023.10161416},
  doi          = {10.1109/ICRA48891.2023.10161416},
  timestamp    = {Tue, 19 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icra/ShekSCL23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vr/YeoXCLCQG23,
  author       = {Jin Qi Yeo and
                  Xinxing Xia and
                  Kan Chen and
                  Malcolm Y. H. Low and
                  Alvin Toong Shoon Chan and
                  Dongyu Qiu and
                  Frank Guan},
  title        = {{SPAT-VR:} {A} Holistic and Extensible Framework for {VR} Project
                  Management},
  booktitle    = {{IEEE} Conference on Virtual Reality and 3D User Interfaces Abstracts
                  and Workshops, {VR} Workshops 2023, Shanghai, China, March 25-29,
                  2023},
  pages        = {619--620},
  year         = {2023},
  crossref     = {DBLP:conf/vr/2023w},
  url          = {https://doi.org/10.1109/VRW58643.2023.00152},
  doi          = {10.1109/VRW58643.2023.00152},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/vr/YeoXCLCQG23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-06175,
  author       = {Rui Chen and
                  Alvin Shek and
                  Changliu Liu},
  title        = {Robust and Context-Aware Real-Time Collaborative Robot Handling via
                  Dynamic Gesture Commands},
  journal      = {CoRR},
  volume       = {abs/2304.06175},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2304.06175},
  doi          = {10.48550/ARXIV.2304.06175},
  eprinttype    = {arXiv},
  eprint       = {2304.06175},
  timestamp    = {Tue, 19 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2304-06175.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-08771,
  author       = {Alvin Wan and
                  Hanxiang Hao and
                  Kaushik Patnaik and
                  Yueyang Xu and
                  Omer Hadad and
                  David G{\"{u}}era and
                  Zhile Ren and
                  Qi Shan},
  title        = {{UPSCALE:} Unconstrained Channel Pruning},
  journal      = {CoRR},
  volume       = {abs/2307.08771},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2307.08771},
  doi          = {10.48550/ARXIV.2307.08771},
  eprinttype    = {arXiv},
  eprint       = {2307.08771},
  timestamp    = {Tue, 25 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2307-08771.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-03276,
  author       = {Chanwut Kittivorawong and
                  Yongming Ge and
                  Yousef Helal and
                  Alvin Cheung},
  title        = {Spatialyze: {A} Geospatial Video Analytics System with Spatial-Aware
                  Optimizations},
  journal      = {CoRR},
  volume       = {abs/2308.03276},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2308.03276},
  doi          = {10.48550/ARXIV.2308.03276},
  eprinttype    = {arXiv},
  eprint       = {2308.03276},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2308-03276.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/AbadiAABBBBCCDD22,
  author       = {Daniel Abadi and
                  Anastasia Ailamaki and
                  David G. Andersen and
                  Peter Bailis and
                  Magdalena Balazinska and
                  Philip A. Bernstein and
                  Peter A. Boncz and
                  Surajit Chaudhuri and
                  Alvin Cheung and
                  AnHai Doan and
                  Luna Dong and
                  Michael J. Franklin and
                  Juliana Freire and
                  Alon Y. Halevy and
                  Joseph M. Hellerstein and
                  Stratos Idreos and
                  Donald Kossmann and
                  Tim Kraska and
                  Sailesh Krishnamurthy and
                  Volker Markl and
                  Sergey Melnik and
                  Tova Milo and
                  C. Mohan and
                  Thomas Neumann and
                  Beng Chin Ooi and
                  Fatma Ozcan and
                  Jignesh M. Patel and
                  Andrew Pavlo and
                  Raluca A. Popa and
                  Raghu Ramakrishnan and
                  Christopher R{\'{e}} and
                  Michael Stonebraker and
                  Dan Suciu},
  title        = {The Seattle report on database research},
  journal      = {Commun. {ACM}},
  volume       = {65},
  number       = {8},
  pages        = {72--79},
  year         = {2022},
  url          = {https://doi.org/10.1145/3524284},
  doi          = {10.1145/3524284},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cacm/AbadiAABBBBCCDD22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/ChanMJOXXL22,
  author       = {Alvin Chan and
                  Lei Ma and
                  Felix Juefei{-}Xu and
                  Yew{-}Soon Ong and
                  Xiaofei Xie and
                  Minhui Xue and
                  Yang Liu},
  title        = {Breaking Neural Reasoning Architectures With Metamorphic Relation-Based
                  Adversarial Examples},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {33},
  number       = {11},
  pages        = {6976--6982},
  year         = {2022},
  url          = {https://doi.org/10.1109/TNNLS.2021.3072166},
  doi          = {10.1109/TNNLS.2021.3072166},
  timestamp    = {Wed, 07 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnn/ChanMJOXXL22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/SahroniMW22,
  author       = {Alvin Sahroni and
                  Isnatin Miladiyah and
                  Nur Widiasmara},
  title        = {Short-term Pulse Rate Variability to Assess Psychophysiological Changes
                  during Online Trier Social Stress Test {(TSST)}},
  booktitle    = {44th Annual International Conference of the {IEEE} Engineering in
                  Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland,
                  United Kingdom, July 11-15, 2022},
  pages        = {1082--1085},
  year         = {2022},
  crossref     = {DBLP:conf/embc/2022},
  url          = {https://doi.org/10.1109/EMBC48229.2022.9871398},
  doi          = {10.1109/EMBC48229.2022.9871398},
  timestamp    = {Thu, 22 Sep 2022 19:31:35 +0200},
  biburl       = {https://dblp.org/rec/conf/embc/SahroniMW22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/AhmadIS22,
  author       = {Siti Sarah Farhana Ahmad and
                  Nurul Hazrina Idris and
                  Alvin Lau Meng Shin},
  title        = {Coastline Changes Over Mangrove Forest in Setiu Malaysia Using a Long-Term
                  Landsat Satellite Data},
  booktitle    = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
                  2022, Kuala Lumpur, Malaysia, July 17-22, 2022},
  pages        = {6809--6812},
  year         = {2022},
  crossref     = {DBLP:conf/igarss/2022},
  url          = {https://doi.org/10.1109/IGARSS46834.2022.9883142},
  doi          = {10.1109/IGARSS46834.2022.9883142},
  timestamp    = {Tue, 04 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/igarss/AhmadIS22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/ChanOT22,
  author       = {Alvin Chan and
                  Yew Soon Ong and
                  Clement Tan},
  title        = {How Does Frequency Bias Affect the Robustness of Neural Image Classifiers
                  against Common Corruption and Adversarial Perturbations?},
  booktitle    = {Proceedings of the Thirty-First International Joint Conference on
                  Artificial Intelligence, {IJCAI} 2022, Vienna, Austria, 23-29 July
                  2022},
  pages        = {659--665},
  year         = {2022},
  crossref     = {DBLP:conf/ijcai/2022},
  url          = {https://doi.org/10.24963/ijcai.2022/93},
  doi          = {10.24963/IJCAI.2022/93},
  timestamp    = {Wed, 27 Jul 2022 16:43:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ijcai/ChanOT22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/NgocCBO22,
  author       = {Nguyen Hong Ngoc and
                  Alvin Chan and
                  Huynh Thi Thanh Binh and
                  Yew Soon Ong},
  title        = {Anti-Forensic Deepfake Personas and How To Spot Them},
  booktitle    = {International Joint Conference on Neural Networks, {IJCNN} 2022, Padua,
                  Italy, July 18-23, 2022},
  pages        = {1--8},
  year         = {2022},
  crossref     = {DBLP:conf/ijcnn/2022},
  url          = {https://doi.org/10.1109/IJCNN55064.2022.9892357},
  doi          = {10.1109/IJCNN55064.2022.9892357},
  timestamp    = {Mon, 10 Oct 2022 17:40:09 +0200},
  biburl       = {https://dblp.org/rec/conf/ijcnn/NgocCBO22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismar/ChanLC22,
  author       = {Alvin Chan and
                  Jeannie Su Ann Lee and
                  Renjie Chen},
  title        = {Message from the {ISMAR} 2022 Demos Chairs},
  booktitle    = {2022 {IEEE} International Symposium on Mixed and Augmented Reality
                  Adjunct (ISMAR-Adjunct), Singapore, Singapore, October 17-21, 2022},
  pages        = {xix},
  year         = {2022},
  crossref     = {DBLP:conf/ismar/2022a},
  url          = {https://doi.org/10.1109/ISMAR-Adjunct57072.2022.00007},
  doi          = {10.1109/ISMAR-ADJUNCT57072.2022.00007},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ismar/ChanLC22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismar/QiuOXYXLWCG22,
  author       = {Dongyu Qiu and
                  Clemen Yu Da Ow and
                  Xinxing Xia and
                  Jin Qi Yeo and
                  Jiazhi Xia and
                  Malcolm Yoke Hean Low and
                  Zhengkui Wang and
                  Alvin Toong Shoon Chan and
                  Frank Yunqing Guan},
  title        = {ViCollAR: {A} Novel System for 3D Data Visualization using Collaborative
                  Augmented Reality},
  booktitle    = {2022 {IEEE} International Symposium on Mixed and Augmented Reality
                  Adjunct (ISMAR-Adjunct), Singapore, Singapore, October 17-21, 2022},
  pages        = {907--908},
  year         = {2022},
  crossref     = {DBLP:conf/ismar/2022a},
  url          = {https://doi.org/10.1109/ISMAR-Adjunct57072.2022.00199},
  doi          = {10.1109/ISMAR-ADJUNCT57072.2022.00199},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ismar/QiuOXYXLWCG22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-04951,
  author       = {Alvin Shek and
                  Rui Chen and
                  Changliu Liu},
  title        = {Learning from Physical Human Feedback: An Object-Centric One-Shot
                  Adaptation Method},
  journal      = {CoRR},
  volume       = {abs/2203.04951},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2203.04951},
  doi          = {10.48550/ARXIV.2203.04951},
  eprinttype    = {arXiv},
  eprint       = {2203.04951},
  timestamp    = {Tue, 19 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2203-04951.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-03824,
  author       = {Zhenghua Chen and
                  Min Wu and
                  Alvin Chan and
                  Xiaoli Li and
                  Yew{-}Soon Ong},
  title        = {A Survey on {AI} Sustainability: Emerging Trends on Learning Algorithms
                  and Research Challenges},
  journal      = {CoRR},
  volume       = {abs/2205.03824},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2205.03824},
  doi          = {10.48550/ARXIV.2205.03824},
  eprinttype    = {arXiv},
  eprint       = {2205.03824},
  timestamp    = {Wed, 11 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2205-03824.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-04533,
  author       = {Alvin Chan and
                  Yew{-}Soon Ong and
                  Clement Tan},
  title        = {How Does Frequency Bias Affect the Robustness of Neural Image Classifiers
                  against Common Corruption and Adversarial Perturbations?},
  journal      = {CoRR},
  volume       = {abs/2205.04533},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2205.04533},
  doi          = {10.48550/ARXIV.2205.04533},
  eprinttype    = {arXiv},
  eprint       = {2205.04533},
  timestamp    = {Wed, 11 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2205-04533.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-07889,
  author       = {Jessica Y. Bo and
                  Hen{-}Wei Huang and
                  Alvin Chan and
                  Giovanni Traverso},
  title        = {Pretraining {ECG} Data with Adversarial Masking Improves Model Generalizability
                  for Data-Scarce Tasks},
  journal      = {CoRR},
  volume       = {abs/2211.07889},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2211.07889},
  doi          = {10.48550/ARXIV.2211.07889},
  eprinttype    = {arXiv},
  eprint       = {2211.07889},
  timestamp    = {Wed, 23 Nov 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2211-07889.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/sg/Chan21,
  author       = {Alvin Chan},
  title        = {Defences and threats in safe deep learning},
  school       = {Nanyang Technological University, Singapore},
  year         = {2021},
  url          = {https://doi.org/10.32657/10356/152976},
  doi          = {10.32657/10356/152976},
  timestamp    = {Thu, 27 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/phd/sg/Chan21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/ChanLJ21,
  author       = {Alvin Chan and
                  Martin D. Levine and
                  Mehrsan Javan},
  title        = {Player Identification in Hockey Broadcast Videos},
  journal      = {Expert Syst. Appl.},
  volume       = {165},
  pages        = {113891},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.eswa.2020.113891},
  doi          = {10.1016/J.ESWA.2020.113891},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/ChanLJ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/LaiCPKBSNDSGNCF21,
  author       = {Alvina Grace Lai and
                  Wai Hoong Chang and
                  Constantinos A. Parisinos and
                  Michail Katsoulis and
                  Ruth M. Blackburn and
                  Anoop D. Shah and
                  Vincent Nguyen and
                  Spiros C. Denaxas and
                  George Davey Smith and
                  Tom R. Gaunt and
                  Krishnarajah Nirantharakumar and
                  Murray P. Cox and
                  Donall Forde and
                  Folkert W. Asselbergs and
                  Steve K. Harris and
                  Sylvia Richardson and
                  Reecha Sofat and
                  Richard J. B. Dobson and
                  Aroon D. Hingorani and
                  Riyaz Patel and
                  Jonathan Sterne and
                  Amitava Banerjee and
                  Alastair K. Denniston and
                  Simon Ball and
                  Neil J. Sebire and
                  Nigam H. Shah and
                  Graham R. Foster and
                  Bryan Williams and
                  Harry Hemingway},
  title        = {An informatics consult approach for generating clinical evidence for
                  treatment decisions},
  journal      = {{BMC} Medical Informatics Decis. Mak.},
  volume       = {21},
  number       = {1},
  pages        = {281},
  year         = {2021},
  url          = {https://doi.org/10.1186/s12911-021-01638-z},
  doi          = {10.1186/S12911-021-01638-Z},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/midm/LaiCPKBSNDSGNCF21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tele/Zhou21,
  author       = {Alvin Zhou},
  title        = {Causal effects of affordance change on communication behavior: Empirical
                  evidence from organizational and leadership social media use},
  journal      = {Telematics Informatics},
  volume       = {59},
  pages        = {101549},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.tele.2020.101549},
  doi          = {10.1016/J.TELE.2020.101549},
  timestamp    = {Mon, 28 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tele/Zhou21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ZhangCTFW0SYL20,
  author       = {Aston Zhang and
                  Alvin Chan and
                  Yi Tay and
                  Jie Fu and
                  Shuohang Wang and
                  Shuai Zhang and
                  Huajie Shao and
                  Shuochao Yao and
                  Roy Ka{-}Wei Lee},
  title        = {On Orthogonality Constraints for Transformers},
  booktitle    = {Proceedings of the 59th Annual Meeting of the Association for Computational
                  Linguistics and the 11th International Joint Conference on Natural
                  Language Processing, {ACL/IJCNLP} 2021, (Volume 2: Short Papers),
                  Virtual Event, August 1-6, 2021},
  pages        = {375--382},
  year         = {2021},
  crossref     = {DBLP:conf/acl/2021-2},
  url          = {https://doi.org/10.18653/v1/2021.acl-short.48},
  doi          = {10.18653/V1/2021.ACL-SHORT.48},
  timestamp    = {Mon, 30 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/acl/ZhangCTFW0SYL20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chil/ChanKOWLP21,
  author       = {Alvin Chan and
                  Anna Korsakova and
                  Yew{-}Soon Ong and
                  Fernaldo Richtia Winnerdy and
                  Kah Wai Lim and
                  Anh Tuan Phan},
  title        = {{RNA} alternative splicing prediction with discrete compositional
                  energy network},
  booktitle    = {{ACM} {CHIL} '21: {ACM} Conference on Health, Inference, and Learning,
                  Virtual Event, USA, April 8-9, 2021},
  pages        = {193--203},
  year         = {2021},
  crossref     = {DBLP:conf/chil/2021},
  url          = {https://doi.org/10.1145/3450439.3451857},
  doi          = {10.1145/3450439.3451857},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/chil/ChanKOWLP21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/ZhengIPMALYYACP21,
  author       = {Yao Zheng and
                  Shekh Md Mahmudul Islam and
                  Yanjun Pan and
                  Marionne Millan and
                  Samson Aggelopoulos and
                  Brian Lu and
                  Alvin Yang and
                  Thomas Yang and
                  Stephanie Aelmore and
                  Willy Chang and
                  Alana Power and
                  Ming Li and
                  Olga Boric{-}Lubecke and
                  Victor Lubecke and
                  Wenhai Sun},
  title        = {Insider-Resistant Context-Based Pairing for Multimodality Sleep Apnea
                  Test},
  booktitle    = {{IEEE} Global Communications Conference, {GLOBECOM} 2021, Madrid,
                  Spain, December 7-11, 2021},
  pages        = {1--6},
  year         = {2021},
  crossref     = {DBLP:conf/globecom/2021},
  url          = {https://doi.org/10.1109/GLOBECOM46510.2021.9685852},
  doi          = {10.1109/GLOBECOM46510.2021.9685852},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/globecom/ZhengIPMALYYACP21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/ChanOPZF21,
  author       = {Alvin Chan and
                  Yew{-}Soon Ong and
                  Bill Pung and
                  Aston Zhang and
                  Jie Fu},
  title        = {CoCon: {A} Self-Supervised Approach for Controlled Text Generation},
  booktitle    = {9th International Conference on Learning Representations, {ICLR} 2021,
                  Virtual Event, Austria, May 3-7, 2021},
  year         = {2021},
  crossref     = {DBLP:conf/iclr/2021},
  url          = {https://openreview.net/forum?id=VD\_ozqvBy4W},
  timestamp    = {Wed, 23 Jun 2021 17:36:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iclr/ChanOPZF21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/ZhangT0CLHF21,
  author       = {Aston Zhang and
                  Yi Tay and
                  Shuai Zhang and
                  Alvin Chan and
                  Anh Tuan Luu and
                  Siu Cheung Hui and
                  Jie Fu},
  title        = {Beyond Fully-Connected Layers with Quaternions: Parameterization of
                  Hypercomplex Multiplications with 1/n Parameters},
  booktitle    = {9th International Conference on Learning Representations, {ICLR} 2021,
                  Virtual Event, Austria, May 3-7, 2021},
  year         = {2021},
  crossref     = {DBLP:conf/iclr/2021},
  url          = {https://openreview.net/forum?id=rcQdycl0zyk},
  timestamp    = {Tue, 24 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iclr/ZhangT0CLHF21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ChanMKN21,
  author       = {Alvin Chan and
                  Ali Madani and
                  Ben Krause and
                  Nikhil Naik},
  title        = {Deep Extrapolation for Attribute-Enhanced Generation},
  booktitle    = {Advances in Neural Information Processing Systems 34: Annual Conference
                  on Neural Information Processing Systems 2021, NeurIPS 2021, December
                  6-14, 2021, virtual},
  pages        = {14084--14096},
  year         = {2021},
  crossref     = {DBLP:conf/nips/2021},
  url          = {https://proceedings.neurips.cc/paper/2021/hash/75da5036f659fe64b53f3d9b39412967-Abstract.html},
  timestamp    = {Tue, 03 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/nips/ChanMKN21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ZhangTSCZ21,
  author       = {Aston Zhang and
                  Yi Tay and
                  Yikang Shen and
                  Alvin Chan and
                  Shuai Zhang},
  title        = {Self-Instantiated Recurrent Units with Dynamic Soft Recursion},
  booktitle    = {Advances in Neural Information Processing Systems 34: Annual Conference
                  on Neural Information Processing Systems 2021, NeurIPS 2021, December
                  6-14, 2021, virtual},
  pages        = {6503--6514},
  year         = {2021},
  crossref     = {DBLP:conf/nips/2021},
  url          = {https://proceedings.neurips.cc/paper/2021/hash/3341f6f048384ec73a7ba2e77d2db48b-Abstract.html},
  timestamp    = {Tue, 03 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/nips/ZhangTSCZ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-08597,
  author       = {Aston Zhang and
                  Yi Tay and
                  Shuai Zhang and
                  Alvin Chan and
                  Anh Tuan Luu and
                  Siu Cheung Hui and
                  Jie Fu},
  title        = {Beyond Fully-Connected Layers with Quaternions: Parameterization of
                  Hypercomplex Multiplications with 1/n Parameters},
  journal      = {CoRR},
  volume       = {abs/2102.08597},
  year         = {2021},
  url          = {https://arxiv.org/abs/2102.08597},
  eprinttype    = {arXiv},
  eprint       = {2102.08597},
  timestamp    = {Tue, 24 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2102-08597.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-04246,
  author       = {Alvin Chan and
                  Anna Korsakova and
                  Yew{-}Soon Ong and
                  Fernaldo Richtia Winnerdy and
                  Kah Wai Lim and
                  Anh Tuan Phan},
  title        = {{RNA} Alternative Splicing Prediction with Discrete Compositional
                  Energy Network},
  journal      = {CoRR},
  volume       = {abs/2103.04246},
  year         = {2021},
  url          = {https://arxiv.org/abs/2103.04246},
  eprinttype    = {arXiv},
  eprint       = {2103.04246},
  timestamp    = {Tue, 16 Mar 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2103-04246.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2105-00314,
  author       = {Yao Zheng and
                  Shekh Md Mahmudul Islam and
                  Yanjun Pan and
                  Marionne Millan and
                  Samson Aggelopoulos and
                  Brian Lu and
                  Alvin Yang and
                  Thomas Yang and
                  Stephanie Aelmore and
                  Willy Chang and
                  Alana Power and
                  Ming Li and
                  Olga Boric{-}Lubecke and
                  Victor Lubecke and
                  Wenhai Sun},
  title        = {Technical Report: Insider-Resistant Context-Based Pairing for Multimodality
                  Sleep Apnea Test},
  journal      = {CoRR},
  volume       = {abs/2105.00314},
  year         = {2021},
  url          = {https://arxiv.org/abs/2105.00314},
  eprinttype    = {arXiv},
  eprint       = {2105.00314},
  timestamp    = {Mon, 30 Oct 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2105-00314.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-02968,
  author       = {Alvin Chan and
                  Ali Madani and
                  Ben Krause and
                  Nikhil Naik},
  title        = {Deep Extrapolation for Attribute-Enhanced Generation},
  journal      = {CoRR},
  volume       = {abs/2107.02968},
  year         = {2021},
  url          = {https://arxiv.org/abs/2107.02968},
  eprinttype    = {arXiv},
  eprint       = {2107.02968},
  timestamp    = {Tue, 20 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2107-02968.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-06747,
  author       = {Arkadiusz Sitek and
                  Sangtae Ahn and
                  Evren Asma and
                  Adam Chandler and
                  Alvin Ihsani and
                  Sven Prevrhal and
                  Arman Rahmim and
                  Babak Saboury and
                  Kris Thielemans},
  title        = {Artificial Intelligence in {PET:} an Industry Perspective},
  journal      = {CoRR},
  volume       = {abs/2107.06747},
  year         = {2021},
  url          = {https://arxiv.org/abs/2107.06747},
  eprinttype    = {arXiv},
  eprint       = {2107.06747},
  timestamp    = {Wed, 21 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2107-06747.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-06046,
  author       = {Chih{-}Pin Tan and
                  Chin{-}Jui Chang and
                  Alvin W. Y. Su and
                  Yi{-}Hsuan Yang},
  title        = {Music Score Expansion with Variable-Length Infilling},
  journal      = {CoRR},
  volume       = {abs/2111.06046},
  year         = {2021},
  url          = {https://arxiv.org/abs/2111.06046},
  eprinttype    = {arXiv},
  eprint       = {2111.06046},
  timestamp    = {Tue, 16 Nov 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2111-06046.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-14031,
  author       = {Bill Tuck Weng Pung and
                  Alvin Chan},
  title        = {FastTrees: Parallel Latent Tree-Induction for Faster Sequence Encoding},
  journal      = {CoRR},
  volume       = {abs/2111.14031},
  year         = {2021},
  url          = {https://arxiv.org/abs/2111.14031},
  eprinttype    = {arXiv},
  eprint       = {2111.14031},
  timestamp    = {Wed, 01 Dec 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2111-14031.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-14034,
  author       = {Bill Tuck Weng Pung and
                  Alvin Chan},
  title        = {{ORCHARD:} {A} Benchmark For Measuring Systematic Generalization of
                  Multi-Hierarchical Reasoning},
  journal      = {CoRR},
  volume       = {abs/2111.14034},
  year         = {2021},
  url          = {https://arxiv.org/abs/2111.14034},
  eprinttype    = {arXiv},
  eprint       = {2111.14034},
  timestamp    = {Wed, 01 Dec 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2111-14034.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-06020,
  author       = {Rui Chen and
                  Alvin Shek and
                  Changliu Liu},
  title        = {Learn from Human Teams: a Probabilistic Solution to Real-Time Collaborative
                  Robot Handling with Dynamic Gesture Commands},
  journal      = {CoRR},
  volume       = {abs/2112.06020},
  year         = {2021},
  url          = {https://arxiv.org/abs/2112.06020},
  eprinttype    = {arXiv},
  eprint       = {2112.06020},
  timestamp    = {Tue, 19 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2112-06020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cga/HanCLJTCH20,
  author       = {Ping{-}Hsuan Han and
                  Yang{-}Sheng Chen and
                  Iou{-}Shiuan Liu and
                  Yu{-}Ping Jang and
                  Ling Tsai and
                  Alvin Chang and
                  Yi{-}Ping Hung},
  title        = {A Compelling Virtual Tour of the Dunhuang Cave With an Immersive Head-Mounted
                  Display},
  journal      = {{IEEE} Computer Graphics and Applications},
  volume       = {40},
  number       = {1},
  pages        = {40--55},
  year         = {2020},
  url          = {https://doi.org/10.1109/MCG.2019.2936753},
  doi          = {10.1109/MCG.2019.2936753},
  timestamp    = {Sat, 30 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cga/HanCLJTCH20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijisscm/PhamTA20,
  author       = {Thi{-}Ngan Pham and
                  Albert Tan and
                  Alvin Ang},
  title        = {Determining Safety Stock for an Omni-Channel Environment},
  journal      = {Int. J. Inf. Syst. Supply Chain Manag.},
  volume       = {13},
  number       = {2},
  pages        = {59--76},
  year         = {2020},
  url          = {https://doi.org/10.4018/IJISSCM.2020040104},
  doi          = {10.4018/IJISSCM.2020040104},
  timestamp    = {Tue, 08 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijisscm/PhamTA20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/TayOFCCLP20,
  author       = {Yi Tay and
                  Donovan Ong and
                  Jie Fu and
                  Alvin Chan and
                  Nancy Chen and
                  Anh Tuan Luu and
                  Chris Pal},
  title        = {Would you Rather? {A} New Benchmark for Learning Machine Alignment
                  with Cultural Values and Social Preferences},
  booktitle    = {Proceedings of the 58th Annual Meeting of the Association for Computational
                  Linguistics, {ACL} 2020, Online, July 5-10, 2020},
  pages        = {5369--5373},
  year         = {2020},
  crossref     = {DBLP:conf/acl/2020},
  url          = {https://doi.org/10.18653/v1/2020.acl-main.477},
  doi          = {10.18653/V1/2020.ACL-MAIN.477},
  timestamp    = {Thu, 19 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/acl/TayOFCCLP20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ChanTO20,
  author       = {Alvin Chan and
                  Yi Tay and
                  Yew{-}Soon Ong},
  title        = {What It Thinks Is Important Is Important: Robustness Transfers Through
                  Input Gradients},
  booktitle    = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2020, Seattle, WA, USA, June 13-19, 2020},
  pages        = {329--338},
  year         = {2020},
  crossref     = {DBLP:conf/cvpr/2020},
  url          = {https://openaccess.thecvf.com/content\_CVPR\_2020/html/Chan\_What\_It\_Thinks\_Is\_Important\_Is\_Important\_Robustness\_Transfers\_Through\_CVPR\_2020\_paper.html},
  doi          = {10.1109/CVPR42600.2020.00041},
  timestamp    = {Tue, 31 Aug 2021 14:00:04 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/ChanTO20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/WanDZHTXWYXCVG20,
  author       = {Alvin Wan and
                  Xiaoliang Dai and
                  Peizhao Zhang and
                  Zijian He and
                  Yuandong Tian and
                  Saining Xie and
                  Bichen Wu and
                  Matthew Yu and
                  Tao Xu and
                  Kan Chen and
                  Peter Vajda and
                  Joseph E. Gonzalez},
  title        = {FBNetV2: Differentiable Neural Architecture Search for Spatial and
                  Channel Dimensions},
  booktitle    = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2020, Seattle, WA, USA, June 13-19, 2020},
  pages        = {12962--12971},
  year         = {2020},
  crossref     = {DBLP:conf/cvpr/2020},
  url          = {https://openaccess.thecvf.com/content\_CVPR\_2020/html/Wan\_FBNetV2\_Differentiable\_Neural\_Architecture\_Search\_for\_Spatial\_and\_Channel\_Dimensions\_CVPR\_2020\_paper.html},
  doi          = {10.1109/CVPR42600.2020.01298},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/WanDZHTXWYXCVG20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ChanTOZ20,
  author       = {Alvin Chan and
                  Yi Tay and
                  Yew{-}Soon Ong and
                  Aston Zhang},
  title        = {Poison Attacks against Text Datasets with Conditional Adversarially
                  Regularized Autoencoder},
  booktitle    = {Findings of the Association for Computational Linguistics: {EMNLP}
                  2020, Online Event, 16-20 November 2020},
  pages        = {4175--4189},
  year         = {2020},
  crossref     = {DBLP:conf/emnlp/2020f},
  url          = {https://doi.org/10.18653/v1/2020.findings-emnlp.373},
  doi          = {10.18653/V1/2020.FINDINGS-EMNLP.373},
  timestamp    = {Tue, 20 Aug 2024 07:54:42 +0200},
  biburl       = {https://dblp.org/rec/conf/emnlp/ChanTOZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/LaiKRLLZWL20,
  author       = {Gabriel Chun{-}Hei Lai and
                  Ron Chi{-}Wai Kwok and
                  Tina Rochelle and
                  Alvin Chung{-}Man Leung and
                  Yanyan Li and
                  Shanshan Zhang and
                  George Yui{-}Lam Wong and
                  Angel Lu},
  title        = {The Moderating Effect of Different Types of Internet Use on the Relationship
                  between Transitional Aging Changes and Self-esteem of Older Adults},
  booktitle    = {53rd Hawaii International Conference on System Sciences, {HICSS} 2020,
                  Maui, Hawaii, USA, January 7-10, 2020},
  pages        = {1--10},
  year         = {2020},
  crossref     = {DBLP:conf/hicss/2020},
  url          = {https://hdl.handle.net/10125/64206},
  timestamp    = {Wed, 04 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/hicss/LaiKRLLZWL20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/ChanTOF20,
  author       = {Alvin Chan and
                  Yi Tay and
                  Yew{-}Soon Ong and
                  Jie Fu},
  title        = {Jacobian Adversarially Regularized Networks for Robustness},
  booktitle    = {8th International Conference on Learning Representations, {ICLR} 2020,
                  Addis Ababa, Ethiopia, April 26-30, 2020},
  year         = {2020},
  crossref     = {DBLP:conf/iclr/2020},
  url          = {https://openreview.net/forum?id=Hke0V1rKPS},
  timestamp    = {Thu, 07 May 2020 17:11:47 +0200},
  biburl       = {https://dblp.org/rec/conf/iclr/ChanTOF20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/RothCSNLGGQIBWB20,
  author       = {Holger R. Roth and
                  Ken Chang and
                  Praveer Singh and
                  Nir Neumark and
                  Wenqi Li and
                  Vikash Gupta and
                  Sharut Gupta and
                  Liangqiong Qu and
                  Alvin Ihsani and
                  Bernardo C. Bizzo and
                  Yuhong Wen and
                  Varun Buch and
                  Meesam Shah and
                  Felipe Kitamura and
                  Matheus Mendon{\c{c}}a and
                  Vitor Lavor and
                  Ahmed Harouni and
                  Colin Compas and
                  Jesse Tetreault and
                  Prerna Dogra and
                  Yan Cheng and
                  Selnur Erdal and
                  Richard D. White and
                  Behrooz Hashemian and
                  Thomas J. Schultz and
                  Miao Zhang and
                  Adam McCarthy and
                  B. Min Yun and
                  Elshaimaa Sharaf and
                  Katharina Viktoria Hoebel and
                  Jay B. Patel and
                  Bryan Chen and
                  Sean Ko and
                  Evan Leibovitz and
                  Etta D. Pisano and
                  Laura Coombs and
                  Daguang Xu and
                  Keith J. Dreyer and
                  Ittai Dayan and
                  Ram C. Naidu and
                  Mona Flores and
                  Daniel L. Rubin and
                  Jayashree Kalpathy{-}Cramer},
  title        = {Federated Learning for Breast Density Classification: {A} Real-World
                  Implementation},
  booktitle    = {Domain Adaptation and Representation Transfer, and Distributed and
                  Collaborative Learning - Second {MICCAI} Workshop, {DART} 2020, and
                  First {MICCAI} Workshop, {DCL} 2020, Held in Conjunction with {MICCAI}
                  2020, Lima, Peru, October 4-8, 2020, Proceedings},
  pages        = {181--191},
  year         = {2020},
  crossref     = {DBLP:conf/miccai/2020dart},
  url          = {https://doi.org/10.1007/978-3-030-60548-3\_18},
  doi          = {10.1007/978-3-030-60548-3\_18},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/miccai/RothCSNLGGQIBWB20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/ShinIXMSFC20,
  author       = {Hoo{-}Chang Shin and
                  Alvin Ihsani and
                  Ziyue Xu and
                  Swetha Mandava and
                  Sharath Turuvekere Sreenivas and
                  Christopher Forster and
                  Jiook Cha},
  title        = {{GANDALF:} Generative Adversarial Networks with Discriminator-Adaptive
                  Loss Fine-Tuning for Alzheimer's Disease Diagnosis from {MRI}},
  booktitle    = {Medical Image Computing and Computer Assisted Intervention - {MICCAI}
                  2020 - 23rd International Conference, Lima, Peru, October 4-8, 2020,
                  Proceedings, Part {II}},
  pages        = {688--697},
  year         = {2020},
  crossref     = {DBLP:conf/miccai/2020-2},
  url          = {https://doi.org/10.1007/978-3-030-59713-9\_66},
  doi          = {10.1007/978-3-030-59713-9\_66},
  timestamp    = {Mon, 05 Oct 2020 18:46:15 +0200},
  biburl       = {https://dblp.org/rec/conf/miccai/ShinIXMSFC20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/ChouCTLLKSCHL020,
  author       = {Mao{-}Hsuan Chou and
                  Ya{-}Tin Chang and
                  Tsung{-}Hsien Tsai and
                  Tsung{-}Che Lu and
                  Chia{-}Chun Liao and
                  Hung{-}Yi Kuo and
                  Ruey{-}Bin Sheen and
                  Chih{-}Hsien Chang and
                  Kenny C.{-}H. Hsieh and
                  Alvin Leng Sun Loke and
                  Mark Chen},
  title        = {Embedded {PLL} Phase Noise Measurement Based on a {PFD/CP} {MASH}
                  1-1-1 {\(\Delta\)}{\(\Sigma\)} Time-to-Digital Converter in 7nm {CMOS}},
  booktitle    = {{IEEE} Symposium on {VLSI} Circuits, {VLSI} Circuits 2020, Honolulu,
                  HI, USA, June 16-19, 2020},
  pages        = {1--2},
  year         = {2020},
  crossref     = {DBLP:conf/vlsic/2020},
  url          = {https://doi.org/10.1109/VLSICircuits18222.2020.9162789},
  doi          = {10.1109/VLSICIRCUITS18222.2020.9162789},
  timestamp    = {Fri, 01 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/vlsic/ChouCTLLKSCHL020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-05565,
  author       = {Alvin Wan and
                  Xiaoliang Dai and
                  Peizhao Zhang and
                  Zijian He and
                  Yuandong Tian and
                  Saining Xie and
                  Bichen Wu and
                  Matthew Yu and
                  Tao Xu and
                  Kan Chen and
                  Peter Vajda and
                  Joseph E. Gonzalez},
  title        = {FBNetV2: Differentiable Neural Architecture Search for Spatial and
                  Channel Dimensions},
  journal      = {CoRR},
  volume       = {abs/2004.05565},
  year         = {2020},
  url          = {https://arxiv.org/abs/2004.05565},
  eprinttype    = {arXiv},
  eprint       = {2004.05565},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2004-05565.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-03535,
  author       = {Alvin Chan and
                  Yew{-}Soon Ong and
                  Bill Pung and
                  Aston Zhang and
                  Jie Fu},
  title        = {CoCon: {A} Self-Supervised Approach for Controlled Text Generation},
  journal      = {CoRR},
  volume       = {abs/2006.03535},
  year         = {2020},
  url          = {https://arxiv.org/abs/2006.03535},
  eprinttype    = {arXiv},
  eprint       = {2006.03535},
  timestamp    = {Tue, 09 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2006-03535.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2007-03201,
  author       = {Jordan L. Melcher and
                  Yao Zheng and
                  Dylan Anthony and
                  Matthew Troglia and
                  Yanjun Pan and
                  Ming Li and
                  Thomas Yang and
                  Alvin Yang and
                  Samson Aggelopoulos},
  title        = {Demo: iJam with Channel Randomization},
  journal      = {CoRR},
  volume       = {abs/2007.03201},
  year         = {2020},
  url          = {https://arxiv.org/abs/2007.03201},
  eprinttype    = {arXiv},
  eprint       = {2007.03201},
  timestamp    = {Mon, 30 Oct 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2007-03201.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-04393,
  author       = {Hoo{-}Chang Shin and
                  Alvin Ihsani and
                  Swetha Mandava and
                  Sharath Turuvekere Sreenivas and
                  Christopher Forster and
                  Jiook Cha and
                  Alzheimer's Disease Neuroimaging Initiative},
  title        = {{GANBERT:} Generative Adversarial Networks with Bidirectional Encoder
                  Representations from Transformers for {MRI} to {PET} synthesis},
  journal      = {CoRR},
  volume       = {abs/2008.04393},
  year         = {2020},
  url          = {https://arxiv.org/abs/2008.04393},
  eprinttype    = {arXiv},
  eprint       = {2008.04393},
  timestamp    = {Mon, 17 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2008-04393.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-04396,
  author       = {Hoo{-}Chang Shin and
                  Alvin Ihsani and
                  Ziyue Xu and
                  Swetha Mandava and
                  Sharath Turuvekere Sreenivas and
                  Christopher Forster and
                  Jiook Cha and
                  Alzheimer's Disease Neuroimaging Initiative},
  title        = {{GANDALF:} Generative Adversarial Networks with Discriminator-Adaptive
                  Loss Fine-tuning for Alzheimer's Disease Diagnosis from {MRI}},
  journal      = {CoRR},
  volume       = {abs/2008.04396},
  year         = {2020},
  url          = {https://arxiv.org/abs/2008.04396},
  eprinttype    = {arXiv},
  eprint       = {2008.04396},
  timestamp    = {Mon, 17 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2008-04396.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2009-01871,
  author       = {Holger R. Roth and
                  Ken Chang and
                  Praveer Singh and
                  Nir Neumark and
                  Wenqi Li and
                  Vikash Gupta and
                  Sharut Gupta and
                  Liangqiong Qu and
                  Alvin Ihsani and
                  Bernardo C. Bizzo and
                  Yuhong Wen and
                  Varun Buch and
                  Meesam Shah and
                  Felipe Kitamura and
                  Matheus Mendon{\c{c}}a and
                  Vitor Lavor and
                  Ahmed Harouni and
                  Colin Compas and
                  Jesse Tetreault and
                  Prerna Dogra and
                  Yan Cheng and
                  Selnur Erdal and
                  Richard D. White and
                  Behrooz Hashemian and
                  Thomas J. Schultz and
                  Miao Zhang and
                  Adam McCarthy and
                  B. Min Yun and
                  Elshaimaa Sharaf and
                  Katharina Viktoria Hoebel and
                  Jay B. Patel and
                  Bryan Chen and
                  Sean Ko and
                  Evan Leibovitz and
                  Etta D. Pisano and
                  Laura Coombs and
                  Daguang Xu and
                  Keith J. Dreyer and
                  Ittai Dayan and
                  Ram C. Naidu and
                  Mona Flores and
                  Daniel L. Rubin and
                  Jayashree Kalpathy{-}Cramer},
  title        = {Federated Learning for Breast Density Classification: {A} Real-World
                  Implementation},
  journal      = {CoRR},
  volume       = {abs/2009.01871},
  year         = {2020},
  url          = {https://arxiv.org/abs/2009.01871},
  eprinttype    = {arXiv},
  eprint       = {2009.01871},
  timestamp    = {Fri, 11 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2009-01871.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2009-02429,
  author       = {Alvin Chan and
                  Martin D. Levine and
                  Mehrsan Javan},
  title        = {Player Identification in Hockey Broadcast Videos},
  journal      = {CoRR},
  volume       = {abs/2009.02429},
  year         = {2020},
  url          = {https://arxiv.org/abs/2009.02429},
  eprinttype    = {arXiv},
  eprint       = {2009.02429},
  timestamp    = {Wed, 16 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2009-02429.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-02684,
  author       = {Alvin Chan and
                  Yi Tay and
                  Yew{-}Soon Ong and
                  Aston Zhang},
  title        = {Poison Attacks against Text Datasets with Conditional Adversarially
                  Regularized Autoencoder},
  journal      = {CoRR},
  volume       = {abs/2010.02684},
  year         = {2020},
  url          = {https://arxiv.org/abs/2010.02684},
  eprinttype    = {arXiv},
  eprint       = {2010.02684},
  timestamp    = {Mon, 12 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2010-02684.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/RoyGANDS19,
  author       = {Proteek Chandan Roy and
                  Andrey K. Guber and
                  Mohammad Abouali and
                  A. Pouyan Nejadhashemi and
                  Kalyanmoy Deb and
                  Alvin J. M. Smucker},
  title        = {Crop yield simulation optimization using precision irrigation and
                  subsurface water retention technology},
  journal      = {Environ. Model. Softw.},
  volume       = {119},
  pages        = {433--444},
  year         = {2019},
  url          = {https://doi.org/10.1016/j.envsoft.2019.07.006},
  doi          = {10.1016/J.ENVSOFT.2019.07.006},
  timestamp    = {Wed, 10 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/envsoft/RoyGANDS19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmod/AbadiAABBBBCCDD19,
  author       = {Daniel Abadi and
                  Anastasia Ailamaki and
                  David G. Andersen and
                  Peter Bailis and
                  Magdalena Balazinska and
                  Philip A. Bernstein and
                  Peter A. Boncz and
                  Surajit Chaudhuri and
                  Alvin Cheung and
                  AnHai Doan and
                  Luna Dong and
                  Michael J. Franklin and
                  Juliana Freire and
                  Alon Y. Halevy and
                  Joseph M. Hellerstein and
                  Stratos Idreos and
                  Donald Kossmann and
                  Tim Kraska and
                  Sailesh Krishnamurthy and
                  Volker Markl and
                  Sergey Melnik and
                  Tova Milo and
                  C. Mohan and
                  Thomas Neumann and
                  Beng Chin Ooi and
                  Fatma Ozcan and
                  Jignesh M. Patel and
                  Andrew Pavlo and
                  Raluca A. Popa and
                  Raghu Ramakrishnan and
                  Christopher R{\'{e}} and
                  Michael Stonebraker and
                  Dan Suciu},
  title        = {The Seattle Report on Database Research},
  journal      = {{SIGMOD} Rec.},
  volume       = {48},
  number       = {4},
  pages        = {44--53},
  year         = {2019},
  url          = {https://doi.org/10.1145/3385658.3385668},
  doi          = {10.1145/3385658.3385668},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sigmod/AbadiAABBBBCCDD19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/XueQZLZSC19,
  author       = {Lei Xue and
                  Chenxiong Qian and
                  Hao Zhou and
                  Xiapu Luo and
                  Yajin Zhou and
                  Yuru Shao and
                  Alvin T. S. Chan},
  title        = {NDroid: Toward Tracking Information Flows Across Multiple Android
                  Contexts},
  journal      = {{IEEE} Trans. Inf. Forensics Secur.},
  volume       = {14},
  number       = {3},
  pages        = {814--828},
  year         = {2019},
  url          = {https://doi.org/10.1109/TIFS.2018.2866347},
  doi          = {10.1109/TIFS.2018.2866347},
  timestamp    = {Mon, 05 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tifs/XueQZLZSC19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cascon/ChangTLJSK19,
  author       = {Yee{-}Kang Chang and
                  Patrick Tiu and
                  Eric Lau and
                  Leo Christy Jesuraj and
                  Alvin So and
                  Gilbert Kwan},
  title        = {Hands-on workshop on fast, efficient {\&} seriously open cloud-native
                  Java},
  booktitle    = {Proceedings of the 29th Annual International Conference on Computer
                  Science and Software Engineering, {CASCON} 2019, Markham, Ontario,
                  Canada, November 4-6, 2019},
  pages        = {373--375},
  year         = {2019},
  crossref     = {DBLP:conf/cascon/2019},
  url          = {https://dl.acm.org/doi/10.5555/3370272.3370322},
  doi          = {10.5555/3370272.3370322},
  timestamp    = {Wed, 04 May 2022 13:02:28 +0200},
  biburl       = {https://dblp.org/rec/conf/cascon/ChangTLJSK19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emo/RoyGANDS19,
  author       = {Proteek Chandan Roy and
                  Andrey K. Guber and
                  Mohammad Abouali and
                  A. Pouyan Nejadhashemi and
                  Kalyanmoy Deb and
                  Alvin J. M. Smucker},
  title        = {Simulation Optimization of Water Usage and Crop Yield Using Precision
                  Irrigation},
  booktitle    = {Evolutionary Multi-Criterion Optimization - 10th International Conference,
                  {EMO} 2019, East Lansing, MI, USA, March 10-13, 2019, Proceedings},
  pages        = {695--706},
  year         = {2019},
  crossref     = {DBLP:conf/emo/2019},
  url          = {https://doi.org/10.1007/978-3-030-12598-1\_55},
  doi          = {10.1007/978-3-030-12598-1\_55},
  timestamp    = {Wed, 10 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/emo/RoyGANDS19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccsci/DewiMC19,
  author       = {Lusiana Citra Dewi and
                  Meiliana and
                  Alvin Chandra},
  title        = {Social Media Web Scraping using Social Media Developers {API} and
                  Regex},
  booktitle    = {Enabling Collaboration to Escalate Impact of Research Results for
                  Society: The 4th International Conference on Computer Science and
                  Computational Intelligence, {ICCSCI} 2019, 12-13 September 2019, Yogyakarta,
                  Indonesia},
  pages        = {444--449},
  year         = {2019},
  crossref     = {DBLP:conf/iccsci/2019},
  url          = {https://doi.org/10.1016/j.procs.2019.08.237},
  doi          = {10.1016/J.PROCS.2019.08.237},
  timestamp    = {Fri, 19 Apr 2024 13:31:15 +0200},
  biburl       = {https://dblp.org/rec/conf/iccsci/DewiMC19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tale/KwanTC19,
  author       = {Alvin C. M. Kwan and
                  Kenny C. W. Tang and
                  Karie Chan},
  title        = {Impacts of Online Academic Help-Seeking Behaviors on Undergraduate
                  Student Self-Learning},
  booktitle    = {{IEEE} International Conference on Engineering, Technology and Education,
                  {TALE} 2019, Yogyakarta, Indonesia, December 10-13, 2019},
  pages        = {1--7},
  year         = {2019},
  crossref     = {DBLP:conf/tale/2019},
  url          = {https://doi.org/10.1109/TALE48000.2019.9226027},
  doi          = {10.1109/TALE48000.2019.9226027},
  timestamp    = {Tue, 10 Nov 2020 09:31:22 +0100},
  biburl       = {https://dblp.org/rec/conf/tale/KwanTC19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1911-08040,
  author       = {Alvin Chan and
                  Yew{-}Soon Ong},
  title        = {Poison as a Cure: Detecting {\&} Neutralizing Variable-Sized Backdoor
                  Attacks in Deep Neural Networks},
  journal      = {CoRR},
  volume       = {abs/1911.08040},
  year         = {2019},
  url          = {http://arxiv.org/abs/1911.08040},
  eprinttype    = {arXiv},
  eprint       = {1911.08040},
  timestamp    = {Tue, 03 Dec 2019 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1911-08040.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1912-05699,
  author       = {Alvin Chan and
                  Yi Tay and
                  Yew{-}Soon Ong},
  title        = {What it Thinks is Important is Important: Robustness Transfers through
                  Input Gradients},
  journal      = {CoRR},
  volume       = {abs/1912.05699},
  year         = {2019},
  url          = {http://arxiv.org/abs/1912.05699},
  eprinttype    = {arXiv},
  eprint       = {1912.05699},
  timestamp    = {Thu, 02 Jan 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1912-05699.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1912-10185,
  author       = {Alvin Chan and
                  Yi Tay and
                  Yew{-}Soon Ong and
                  Jie Fu},
  title        = {Jacobian Adversarially Regularized Networks for Robustness},
  journal      = {CoRR},
  volume       = {abs/1912.10185},
  year         = {2019},
  url          = {http://arxiv.org/abs/1912.10185},
  eprinttype    = {arXiv},
  eprint       = {1912.10185},
  timestamp    = {Fri, 03 Jan 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1912-10185.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/ChienSCL18,
  author       = {Isabel Chien and
                  Alvin Shi and
                  Alex Chan and
                  Charlotta Lindvall},
  title        = {Identification of serious illness conversations in unstructured clinical
                  notes using deep neural networks},
  booktitle    = {Proceedings of the First Joint Workshop on {AI} in Health organized
                  as part of the Federated {AI} Meeting {(FAIM} 2018), co-located with
                  {AAMAS} 2018, {ICML} 2018, {IJCAI} 2018 and {ICCBR} 2018, Stockholm,
                  Sweden, July 13-14, 2018},
  pages        = {125--139},
  year         = {2018},
  crossref     = {DBLP:conf/ijcai/2018aih},
  url          = {https://ceur-ws.org/Vol-2142/paper8.pdf},
  timestamp    = {Fri, 10 Mar 2023 16:23:31 +0100},
  biburl       = {https://dblp.org/rec/conf/ijcai/ChienSCL18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/ChienSCL18a,
  author       = {Isabel Chien and
                  Alvin Shi and
                  Alex Chan and
                  Charlotta Lindvall},
  title        = {Identification of Serious Illness Conversations in Unstructured Clinical
                  Notes Using Deep Neural Networks},
  booktitle    = {Artificial Intelligence in Health - First International Workshop,
                  AIH@IJCAI 2018, Stockholm, Sweden, July 13-14, 2018, Revised Selected
                  Papers},
  pages        = {199--212},
  year         = {2018},
  crossref     = {DBLP:conf/ijcai/2018aih-s},
  url          = {https://doi.org/10.1007/978-3-030-12738-1\_15},
  doi          = {10.1007/978-3-030-12738-1\_15},
  timestamp    = {Wed, 12 Jan 2022 09:08:26 +0100},
  biburl       = {https://dblp.org/rec/conf/ijcai/ChienSCL18a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/intcompsymp/MuchtarRMDDNC18,
  author       = {Kahlil Muchtar and
                  Faris Rahman and
                  Muhammad Rizky Munggaran and
                  Alvin Prayuda Juniarta Dwiyantoro and
                  Richard Dharmadi and
                  Indra Nugraha and
                  Chuan{-}Yu Chang},
  title        = {An Efficient Event Detection Through Background Subtraction and Deep
                  Convolutional Nets},
  booktitle    = {New Trends in Computer Technologies and Applications - 23rd International
                  Computer Symposium, {ICS} 2018, Yunlin, Taiwan, December 20-22, 2018,
                  Revised Selected Papers},
  pages        = {163--167},
  year         = {2018},
  crossref     = {DBLP:conf/intcompsymp/2018},
  url          = {https://doi.org/10.1007/978-981-13-9190-3\_16},
  doi          = {10.1007/978-981-13-9190-3\_16},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/intcompsymp/MuchtarRMDDNC18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-02444,
  author       = {Alvin Chan and
                  Lei Ma and
                  Felix Juefei{-}Xu and
                  Xiaofei Xie and
                  Yang Liu and
                  Yew{-}Soon Ong},
  title        = {Metamorphic Relation Based Adversarial Attacks on Differentiable Neural
                  Computer},
  journal      = {CoRR},
  volume       = {abs/1809.02444},
  year         = {2018},
  url          = {http://arxiv.org/abs/1809.02444},
  eprinttype    = {arXiv},
  eprint       = {1809.02444},
  timestamp    = {Tue, 03 Dec 2019 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1809-02444.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/BeirlZCLZ17,
  author       = {Diana Beirl and
                  Anya Zeitlin and
                  Jerald Chan and
                  Kai Ip Alvin Loh and
                  Xiaodi Zhong},
  title        = {GotYourBack: An Internet of Toilets for the Trans* Community},
  booktitle    = {Proceedings of the 2017 {CHI} Conference on Human Factors in Computing
                  Systems, Denver, CO, USA, May 06-11, 2017, Extended Abstracts},
  pages        = {39--45},
  year         = {2017},
  crossref     = {DBLP:conf/chi/2017a},
  url          = {https://doi.org/10.1145/3027063.3049272},
  doi          = {10.1145/3027063.3049272},
  timestamp    = {Tue, 06 Nov 2018 16:58:46 +0100},
  biburl       = {https://dblp.org/rec/conf/chi/BeirlZCLZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccad/ChangWGZZ0Z17,
  author       = {Liang Chang and
                  Zhaohao Wang and
                  Alvin Oliver Glova and
                  Jishen Zhao and
                  Youguang Zhang and
                  Yuan Xie and
                  Weisheng Zhao},
  title        = {{PRESCOTT:} Preset-based cross-point architecture for spin-orbit-torque
                  magnetic random access memory},
  booktitle    = {2017 {IEEE/ACM} International Conference on Computer-Aided Design,
                  {ICCAD} 2017, Irvine, CA, USA, November 13-16, 2017},
  pages        = {245--252},
  year         = {2017},
  crossref     = {DBLP:conf/iccad/2017},
  url          = {https://doi.org/10.1109/ICCAD.2017.8203785},
  doi          = {10.1109/ICCAD.2017.8203785},
  timestamp    = {Tue, 07 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iccad/ChangWGZZ0Z17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccsce/BalbinVAACI17,
  author       = {Jessie R. Balbin and
                  Leonardo D. Valiente and
                  Danielle Jaye S. Agron and
                  Alvin Vincent R. Antioquia and
                  Glenn D. Cua and
                  John Clement S. Ibo},
  title        = {Assessment of the standard level of oreochromis niloticus and chanos
                  chanos located in fish pen and wet market storage based on viola-jones,
                  thresholding and L{\({_\ast}\)}a{\({_\ast}\)}b color space},
  booktitle    = {7th {IEEE} International Conference on Control System, Computing and
                  Engineering, {ICCSCE} 2017, Penang, Malaysia, November 24-26, 2017},
  pages        = {258--262},
  year         = {2017},
  crossref     = {DBLP:conf/iccsce/2017},
  url          = {https://doi.org/10.1109/ICCSCE.2017.8284415},
  doi          = {10.1109/ICCSCE.2017.8284415},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iccsce/BalbinVAACI17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/ZhangJLC16,
  author       = {Tao Zhang and
                  He Jiang and
                  Xiapu Luo and
                  Alvin T. S. Chan},
  title        = {A Literature Review of Research in Bug Resolution: Tasks, Challenges
                  and Future Directions},
  journal      = {Comput. J.},
  volume       = {59},
  number       = {5},
  pages        = {741--773},
  year         = {2016},
  url          = {https://doi.org/10.1093/comjnl/bxv114},
  doi          = {10.1093/COMJNL/BXV114},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cj/ZhangJLC16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijseke/ZhangYLC16,
  author       = {Tao Zhang and
                  Geunseok Yang and
                  Byungjeong Lee and
                  Alvin T. S. Chan},
  title        = {Guiding Bug Triage through Developer Analysis in Bug Reports},
  journal      = {Int. J. Softw. Eng. Knowl. Eng.},
  volume       = {26},
  number       = {3},
  pages        = {405--432},
  year         = {2016},
  url          = {https://doi.org/10.1142/S0218194016500170},
  doi          = {10.1142/S0218194016500170},
  timestamp    = {Wed, 22 Jul 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijseke/ZhangYLC16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iiaiaai/ChenLCLC16,
  author       = {Der{-}Fa Chen and
                  Chun Hsu Lu and
                  Alvin Chang and
                  Hsieh His Liu and
                  Kuo Chih Cheng},
  title        = {The Relationships among Budgetary Slack, Customers' Relationship Quality
                  and Organizational Performance},
  booktitle    = {5th {IIAI} International Congress on Advanced Applied Informatics,
                  {IIAI-AAI} 2016, Kumamoto, Japan, July 10-14, 2016},
  pages        = {1157--1161},
  year         = {2016},
  crossref     = {DBLP:conf/iiaiaai/2016},
  url          = {https://doi.org/10.1109/IIAI-AAI.2016.24},
  doi          = {10.1109/IIAI-AAI.2016.24},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iiaiaai/ChenLCLC16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/qtna/TamVTK16,
  author       = {La Thanh Tam and
                  Alvin C. Valera and
                  Hwee{-}Pink Tan and
                  Cheryl Koh},
  title        = {Online Detection of Behavioral Change Using Unobtrusive Eldercare
                  Monitoring System},
  booktitle    = {Proceedings of the 11th International Conference on Queueing Theory
                  and Network Applications, {QTNA} 2016, Wellington, New Zealand, December
                  13-15, 2016},
  pages        = {16},
  year         = {2016},
  crossref     = {DBLP:conf/qtna/2016},
  url          = {http://dl.acm.org/citation.cfm?id=3016053},
  timestamp    = {Tue, 06 Nov 2018 16:57:05 +0100},
  biburl       = {https://dblp.org/rec/conf/qtna/TamVTK16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/SivaramanCBKABV16,
  author       = {Anirudh Sivaraman and
                  Alvin Cheung and
                  Mihai Budiu and
                  Changhoon Kim and
                  Mohammad Alizadeh and
                  Hari Balakrishnan and
                  George Varghese and
                  Nick McKeown and
                  Steve Licking},
  title        = {Packet Transactions: High-Level Programming for Line-Rate Switches},
  booktitle    = {Proceedings of the {ACM} {SIGCOMM} 2016 Conference, Florianopolis,
                  Brazil, August 22-26, 2016},
  pages        = {15--28},
  year         = {2016},
  crossref     = {DBLP:conf/sigcomm/2016},
  url          = {https://doi.org/10.1145/2934872.2934900},
  doi          = {10.1145/2934872.2934900},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sigcomm/SivaramanCBKABV16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ahswn/ShiWC15,
  author       = {Peizhong Shi and
                  Yun Wang and
                  Alvin T. S. Chan},
  title        = {{ECA-CTP:} An Enhanced Congestion Avoidance Mechanism for the {CTP}
                  Protocol in Wireless Sensor Networks},
  journal      = {Ad Hoc Sens. Wirel. Networks},
  volume       = {28},
  number       = {3-4},
  pages        = {289--317},
  year         = {2015},
  url          = {http://www.oldcitypublishing.com/journals/ahswn-home/ahswn-issue-contents/ahswn-volume-28-number-3-4-2015/ahswn-28-3-4-p-289-317/},
  timestamp    = {Sat, 25 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ahswn/ShiWC15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chinaf/WangDSCC15,
  author       = {Huaimin Wang and
                  Bo Ding and
                  Dian{-}xi Shi and
                  Jiannong Cao and
                  Alvin T. S. Chan},
  title        = {Auxo: an architecture-centric framework supporting the online tuning
                  of software adaptivity},
  journal      = {Sci. China Inf. Sci.},
  volume       = {58},
  number       = {9},
  pages        = {1--15},
  year         = {2015},
  url          = {https://doi.org/10.1007/s11432-015-5307-9},
  doi          = {10.1007/S11432-015-5307-9},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/chinaf/WangDSCC15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/interfaces/AndersonAGRRSU15,
  author       = {Ross Anderson and
                  Itai Ashlagi and
                  David Gamarnik and
                  Michael Rees and
                  Alvin E. Roth and
                  Tayfun S{\"{o}}nmez and
                  M. Utku {\"{U}}nver},
  title        = {Kidney Exchange and the Alliance for Paired Donation: Operations Research
                  Changes the Way Kidneys Are Transplanted},
  journal      = {Interfaces},
  volume       = {45},
  number       = {1},
  pages        = {26--42},
  year         = {2015},
  url          = {https://doi.org/10.1287/inte.2014.0766},
  doi          = {10.1287/INTE.2014.0766},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/interfaces/AndersonAGRRSU15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcsci/AdriantoYC15,
  author       = {Dennise Adrianto and
                  Violitta Yesmaya and
                  Alvin Chandra},
  title        = {Increasing Learning Frequency through Education Based Game},
  journal      = {J. Comput. Sci.},
  volume       = {11},
  number       = {3},
  pages        = {567--572},
  year         = {2015},
  url          = {https://doi.org/10.3844/jcssp.2015.567.572},
  doi          = {10.3844/JCSSP.2015.567.572},
  timestamp    = {Sat, 25 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jcsci/AdriantoYC15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/ChanZNNVTG15,
  author       = {Wai Hong Ronald Chan and
                  Pengfei Zhang and
                  Ido Nevat and
                  Sai Ganesh Nagarajan and
                  Alvin C. Valera and
                  Hwee{-}Xian Tan and
                  Natarajan Gautam},
  title        = {Adaptive Duty Cycling in Sensor Networks With Energy Harvesting Using
                  Continuous-Time Markov Chain and Fluid Models},
  journal      = {{IEEE} J. Sel. Areas Commun.},
  volume       = {33},
  number       = {12},
  pages        = {2687--2700},
  year         = {2015},
  url          = {https://doi.org/10.1109/JSAC.2015.2478717},
  doi          = {10.1109/JSAC.2015.2478717},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jsac/ChanZNNVTG15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jss/HuangCTCL15,
  author       = {Rubing Huang and
                  Jinfu Chen and
                  Dave Towey and
                  Alvin T. S. Chan and
                  Yansheng Lu},
  title        = {Aggregate-strength interaction test suite prioritization},
  journal      = {J. Syst. Softw.},
  volume       = {99},
  pages        = {36--51},
  year         = {2015},
  url          = {https://doi.org/10.1016/j.jss.2014.09.002},
  doi          = {10.1016/J.JSS.2014.09.002},
  timestamp    = {Tue, 18 May 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jss/HuangCTCL15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/SethuNCOC15,
  author       = {Raj Sekar Sethu and
                  Hong Seng Ng and
                  Alvin Chan and
                  Cheng Nee Ong and
                  Sieng Fong Chan},
  title        = {Characterization of copper precipitates on aluminum copper bond pads
                  formed after plasma clean and de-ionized water exposure},
  journal      = {Microelectron. Reliab.},
  volume       = {55},
  number       = {7},
  pages        = {1101--1108},
  year         = {2015},
  url          = {https://doi.org/10.1016/j.microrel.2015.03.018},
  doi          = {10.1016/J.MICROREL.2015.03.018},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/mr/SethuNCOC15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/LiuXZBC15,
  author       = {Xuan Liu and
                  Bin Xiao and
                  Shigeng Zhang and
                  Kai Bu and
                  Alvin Chan},
  title        = {{STEP:} {A} Time-Efficient Tag Searching Protocol in Large {RFID}
                  Systems},
  journal      = {{IEEE} Trans. Computers},
  volume       = {64},
  number       = {11},
  pages        = {3265--3277},
  year         = {2015},
  url          = {https://doi.org/10.1109/TC.2015.2394461},
  doi          = {10.1109/TC.2015.2394461},
  timestamp    = {Wed, 23 Aug 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tc/LiuXZBC15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcis/ChangHLL15,
  author       = {Alvin Chang and
                  Ting{-}Kai Hwang and
                  Yung{-}Ming Li and
                  Lien{-}Fa Lin},
  title        = {A Contextual Group Recommender Mechanism for Location-based Service},
  booktitle    = {21st Americas Conference on Information Systems, {AMCIS} 2015, Puerto
                  Rico, August 13-15, 2015},
  year         = {2015},
  crossref     = {DBLP:conf/amcis/2015},
  url          = {http://aisel.aisnet.org/amcis2015/e-Biz/GeneralPresentations/2},
  timestamp    = {Sun, 13 Dec 2015 13:10:52 +0100},
  biburl       = {https://dblp.org/rec/conf/amcis/ChangHLL15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compsac/LeongCN15,
  author       = {Hong Va Leong and
                  Alvin T. S. Chan and
                  Grace Ngai},
  title        = {Approximate Web Database Snapshots},
  booktitle    = {39th {IEEE} Annual Computer Software and Applications Conference,
                  {COMPSAC} 2015, Taichung, Taiwan, July 1-5, 2015. Volume 2},
  pages        = {367--376},
  year         = {2015},
  crossref     = {DBLP:conf/compsac/2015},
  url          = {https://doi.org/10.1109/COMPSAC.2015.144},
  doi          = {10.1109/COMPSAC.2015.144},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/compsac/LeongCN15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/ChanZZNVTG15,
  author       = {Wai Hong Ronald Chan and
                  Pengfei Zhang and
                  Wenyu Zhang and
                  Ido Nevat and
                  Alvin C. Valera and
                  Hwee{-}Xian Tan and
                  Natarajan Gautam},
  title        = {Adaptive duty cycling in sensor networks via Continuous Time Markov
                  Chain modelling},
  booktitle    = {2015 {IEEE} International Conference on Communications, {ICC} 2015,
                  London, United Kingdom, June 8-12, 2015},
  pages        = {6669--6674},
  year         = {2015},
  crossref     = {DBLP:conf/icc/2015},
  url          = {https://doi.org/10.1109/ICC.2015.7249388},
  doi          = {10.1109/ICC.2015.7249388},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icc/ChanZZNVTG15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/ZhangYLC15,
  author       = {Tao Zhang and
                  Geunseok Yang and
                  Byungjeong Lee and
                  Alvin T. S. Chan},
  title        = {Predicting severity of bug report by mining bug repository with concept
                  profile},
  booktitle    = {Proceedings of the 30th Annual {ACM} Symposium on Applied Computing,
                  Salamanca, Spain, April 13-17, 2015},
  pages        = {1553--1558},
  year         = {2015},
  crossref     = {DBLP:conf/sac/2015},
  url          = {https://doi.org/10.1145/2695664.2695872},
  doi          = {10.1145/2695664.2695872},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sac/ZhangYLC15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/SivaramanBCKLVB15,
  author       = {Anirudh Sivaraman and
                  Mihai Budiu and
                  Alvin Cheung and
                  Changhoon Kim and
                  Steve Licking and
                  George Varghese and
                  Hari Balakrishnan and
                  Mohammad Alizadeh and
                  Nick McKeown},
  title        = {Packet Transactions: {A} Programming Model for Data-Plane Algorithms
                  at Hardware Speed},
  journal      = {CoRR},
  volume       = {abs/1512.05023},
  year         = {2015},
  url          = {http://arxiv.org/abs/1512.05023},
  eprinttype    = {arXiv},
  eprint       = {1512.05023},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/SivaramanBCKLVB15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejasmp/LinWCCCS14,
  author       = {Yi{-}Ju Lin and
                  Tien{-}Ming Wang and
                  Ta{-}Chun Chen and
                  Yin{-}Lin Chen and
                  Wei{-}Chen Chang and
                  Alvin Wen{-}Yu Su},
  title        = {Musical note analysis of solo violin recordings using recursive regularization},
  journal      = {{EURASIP} J. Audio Speech Music. Process.},
  volume       = {2014},
  pages        = {25},
  year         = {2014},
  url          = {https://doi.org/10.1186/s13636-014-0025-6},
  doi          = {10.1186/S13636-014-0025-6},
  timestamp    = {Tue, 29 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ejasmp/LinWCCCS14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BoersAVSNAPCKSCYPNYBKZCSRR14,
  author       = {Michael Boers and
                  Bagher Afshar and
                  Iason Vassiliou and
                  Saikat Sarkar and
                  Sean T. Nicolson and
                  Ehsan Adabi and
                  Bevin George Perumana and
                  Theodoros Chalvatzis and
                  Spyros Kavvadias and
                  Padmanava Sen and
                  Wei Liat Chan and
                  Alvin Hsing{-}Ting Yu and
                  Ali Parsa and
                  Med Nariman and
                  Seunghwan Yoon and
                  Alfred Grau Besoli and
                  Chryssoula A. Kyriazidou and
                  Gerasimos Zochios and
                  Jesus A. Castaneda and
                  Tirdad Sowlati and
                  Maryam Rofougaran and
                  Ahmadreza Rofougaran},
  title        = {A 16TX/16RX 60 GHz 802.11ad Chipset With Single Coaxial Interface
                  and Polarization Diversity},
  journal      = {{IEEE} J. Solid State Circuits},
  volume       = {49},
  number       = {12},
  pages        = {3031--3045},
  year         = {2014},
  url          = {https://doi.org/10.1109/JSSC.2014.2356462},
  doi          = {10.1109/JSSC.2014.2356462},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jssc/BoersAVSNAPCKSCYPNYBKZCSRR14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WangWLZDWMSWCWJY14,
  author       = {X. Shawn Wang and
                  Xin Wang and
                  Fei Lu and
                  Chen Zhang and
                  Zongyu Dong and
                  Li Wang and
                  Rui Ma and
                  Zitao Shi and
                  Albert Z. Wang and
                  Mau{-}Chung Frank Chang and
                  Dawn Wang and
                  Alvin J. Joseph and
                  C. Patrick Yue},
  title        = {Concurrent Design Analysis of High-Linearity {SP10T} Switch With 8.5
                  kV {ESD} Protection},
  journal      = {{IEEE} J. Solid State Circuits},
  volume       = {49},
  number       = {9},
  pages        = {1927--1941},
  year         = {2014},
  url          = {https://doi.org/10.1109/JSSC.2014.2331956},
  doi          = {10.1109/JSSC.2014.2331956},
  timestamp    = {Mon, 08 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jssc/WangWLZDWMSWCWJY14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/ChangLCLSY14,
  author       = {Da{-}Wei Chang and
                  Ing{-}Chao Lin and
                  Yu{-}Shiang Chien and
                  Ching{-}Lun Lin and
                  Alvin W. Y. Su and
                  Chung{-}Ping Young},
  title        = {{CASA:} Contention-Aware Scratchpad Memory Allocation for Online Hybrid
                  On-Chip Memory Management},
  journal      = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
  volume       = {33},
  number       = {12},
  pages        = {1806--1817},
  year         = {2014},
  url          = {https://doi.org/10.1109/TCAD.2014.2363385},
  doi          = {10.1109/TCAD.2014.2363385},
  timestamp    = {Thu, 24 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcad/ChangLCLSY14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsn/QianLSC14,
  author       = {Chenxiong Qian and
                  Xiapu Luo and
                  Yuru Shao and
                  Alvin T. S. Chan},
  title        = {On Tracking Information Flows through {JNI} in Android Applications},
  booktitle    = {44th Annual {IEEE/IFIP} International Conference on Dependable Systems
                  and Networks, {DSN} 2014, Atlanta, GA, USA, June 23-26, 2014},
  pages        = {180--191},
  year         = {2014},
  crossref     = {DBLP:conf/dsn/2014},
  url          = {https://doi.org/10.1109/DSN.2014.30},
  doi          = {10.1109/DSN.2014.30},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dsn/QianLSC14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismir/HsuWLMS14,
  author       = {Ling{-}Chi Hsu and
                  Yu{-}Lin Wang and
                  Yi{-}Ju Lin and
                  Cheryl D. Metcalf and
                  Alvin W. Y. Su},
  title        = {Detection of Motor Changes in Violin Playing by {EMG} Signals},
  booktitle    = {Proceedings of the 15th International Society for Music Information
                  Retrieval Conference, {ISMIR} 2014, Taipei, Taiwan, October 27-31,
                  2014},
  pages        = {495--500},
  year         = {2014},
  crossref     = {DBLP:conf/ismir/2014},
  url          = {http://www.terasoft.com.tw/conf/ismir2014/proceedings/T090\_227\_Paper.pdf},
  timestamp    = {Tue, 04 Jan 2022 10:38:12 +0100},
  biburl       = {https://dblp.org/rec/conf/ismir/HsuWLMS14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/BoersVSNAAPCKSC14,
  author       = {Michael Boers and
                  Iason Vassiliou and
                  Saikat Sarkar and
                  Sean T. Nicolson and
                  Ehsan Adabi and
                  Bagher Afshar and
                  Bevin G. Perumana and
                  Theodoros Chalvatzis and
                  Spyros Kavadias and
                  Padmanava Sen and
                  Wei Liat Chan and
                  Alvin Hsing{-}Ting Yu and
                  Ali Parsa and
                  Med Nariman and
                  Seunghwan Yoon and
                  Alfred Grau Besoli and
                  Chryssoula A. Kyriazidou and
                  Gerasimos Zochios and
                  Namik Kocaman and
                  Adesh Garg and
                  Hans Eberhart and
                  Phil Yang and
                  Hongyu Xie and
                  Hea Joung Kim and
                  Alireza Tarighat Mehrabani and
                  David Garrett and
                  Andrew J. Blanksby and
                  Mong Kuan Wong and
                  Durai Pandian Thirupathi and
                  Siukai Mak and
                  Radha Srinivasan and
                  Amir Ibrahim and
                  Ersin Sengul and
                  Vincent Roussel and
                  Po{-}Chao Huang and
                  Tsuifang Yeh and
                  Murat Mese and
                  Jesus A. Castaneda and
                  Brima Ibrahim and
                  Tirdad Sowlati and
                  Maryam Rofougaran and
                  Ahmadreza Rofougaran},
  title        = {20.2 {A} 16TX/16RX 60GHz 802.11ad chipset with single coaxial interface
                  and polarization diversity},
  booktitle    = {2014 {IEEE} International Conference on Solid-State Circuits Conference,
                  {ISSCC} 2014, Digest of Technical Papers, San Francisco, CA, USA,
                  February 9-13, 2014},
  pages        = {344--345},
  year         = {2014},
  crossref     = {DBLP:conf/isscc/2014},
  url          = {https://doi.org/10.1109/ISSCC.2014.6757462},
  doi          = {10.1109/ISSCC.2014.6757462},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/isscc/BoersVSNAAPCKSC14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/LiNCHLC14,
  author       = {Jiajia Li and
                  Grace Ngai and
                  Stephen Chi{-}fai Chan and
                  Kien A. Hua and
                  Hong Va Leong and
                  Alvin T. S. Chan},
  title        = {From Writing to Painting: {A} Kinect-Based Cross-Modal Chinese Painting
                  Generation System},
  booktitle    = {Proceedings of the {ACM} International Conference on Multimedia, {MM}
                  '14, Orlando, FL, USA, November 03 - 07, 2014},
  pages        = {57--66},
  year         = {2014},
  crossref     = {DBLP:conf/mm/2014},
  url          = {https://doi.org/10.1145/2647868.2654911},
  doi          = {10.1145/2647868.2654911},
  timestamp    = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/mm/LiNCHLC14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/percom/WeiC13,
  author       = {Edwin J. Y. Wei and
                  Alvin T. S. Chan},
  title        = {{CAMPUS:} {A} middleware for automated context-aware adaptation decision
                  making at run time},
  journal      = {Pervasive Mob. Comput.},
  volume       = {9},
  number       = {1},
  pages        = {35--56},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.pmcj.2011.10.002},
  doi          = {10.1016/J.PMCJ.2011.10.002},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/percom/WeiC13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmetrics/YangCYLHC13,
  author       = {Lei Yang and
                  Jiannong Cao and
                  Yin Yuan and
                  Tao Li and
                  Andy Han and
                  Alvin T. S. Chan},
  title        = {A framework for partitioning and execution of data stream applications
                  in mobile cloud computing},
  journal      = {{SIGMETRICS} Perform. Evaluation Rev.},
  volume       = {40},
  number       = {4},
  pages        = {23--32},
  year         = {2013},
  url          = {https://doi.org/10.1145/2479942.2479946},
  doi          = {10.1145/2479942.2479946},
  timestamp    = {Sat, 25 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sigmetrics/YangCYLHC13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tist/ChinXWCWZ13,
  author       = {Alvin Chin and
                  Bin Xu and
                  Hao Wang and
                  Lele Chang and
                  Hao Wang and
                  Lijun Zhu},
  title        = {Connecting people through physical proximity and physical resources
                  at a conference},
  journal      = {{ACM} Trans. Intell. Syst. Technol.},
  volume       = {4},
  number       = {3},
  pages        = {50:1--50:21},
  year         = {2013},
  url          = {https://doi.org/10.1145/2483669.2483683},
  doi          = {10.1145/2483669.2483683},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tist/ChinXWCWZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apsipa/LinCS13,
  author       = {Yi{-}Ju Lin and
                  Wei{-}Chen Chang and
                  Alvin W. Y. Su},
  title        = {Quantitative evaluation of violin solo performance},
  booktitle    = {Asia-Pacific Signal and Information Processing Association Annual
                  Summit and Conference, {APSIPA} 2013, Kaohsiung, Taiwan, October 29
                  - November 1, 2013},
  pages        = {1--6},
  year         = {2013},
  crossref     = {DBLP:conf/apsipa/2013},
  url          = {https://doi.org/10.1109/APSIPA.2013.6694296},
  doi          = {10.1109/APSIPA.2013.6694296},
  timestamp    = {Wed, 16 Oct 2019 14:14:55 +0200},
  biburl       = {https://dblp.org/rec/conf/apsipa/LinCS13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/ChukNCCH13,
  author       = {Tim Chuk and
                  Alvin C. W. Ng and
                  Emanuele Coviello and
                  Antoni B. Chan and
                  Janet H. Hsiao},
  title        = {Understanding eye movements in face recognition with hidden Markov
                  model},
  booktitle    = {Proceedings of the 35th Annual Meeting of the Cognitive Science Society,
                  CogSci 2013, Berlin, Germany, July 31 - August 3, 2013},
  year         = {2013},
  crossref     = {DBLP:conf/cogsci/2013},
  url          = {https://escholarship.org/uc/item/1197p8wz},
  timestamp    = {Tue, 30 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cogsci/ChukNCCH13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpca/ShiWLC13,
  author       = {Peizhong Shi and
                  Yun Wang and
                  Kai Li and
                  Alvin T. S. Chan},
  title        = {Cross-Layer Adaptive End-to-End Delay Control for Asynchronous Duty-Cycle
                  Wireless Sensor Networks},
  booktitle    = {Pervasive Computing and the Networked World - Joint International
                  Conference, {ICPCA/SWS} 2013, Vina del Mar, Chile, December 5-7, 2013.
                  Revised Selected Papers},
  pages        = {520--531},
  year         = {2013},
  crossref     = {DBLP:conf/icpca/2013},
  url          = {https://doi.org/10.1007/978-3-319-09265-2\_53},
  doi          = {10.1007/978-3-319-09265-2\_53},
  timestamp    = {Tue, 14 May 2019 10:00:51 +0200},
  biburl       = {https://dblp.org/rec/conf/icpca/ShiWLC13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icst/NiuNLC13,
  author       = {Xintao Niu and
                  Changhai Nie and
                  Yu Lei and
                  Alvin T. S. Chan},
  title        = {Identifying Failure-Inducing Combinations Using Tuple Relationship},
  booktitle    = {Sixth {IEEE} International Conference on Software Testing, Verification
                  and Validation, {ICST} 2013 Workshops Proceedings, Luxembourg, Luxembourg,
                  March 18-22, 2013},
  pages        = {271--280},
  year         = {2013},
  crossref     = {DBLP:conf/icst/2013w},
  url          = {https://doi.org/10.1109/ICSTW.2013.38},
  doi          = {10.1109/ICSTW.2013.38},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icst/NiuNLC13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lcn/ShiWLC13,
  author       = {Peizhong Shi and
                  Yun Wang and
                  Kai Li and
                  Alvin T. S. Chan},
  title        = {Delay-Constrained and Energy-Balanced broadcasts for low duty-cycled
                  wireless sensor networks},
  booktitle    = {38th Annual {IEEE} Conference on Local Computer Networks, Sydney,
                  Australia, October 21-24, 2013},
  pages        = {284--287},
  year         = {2013},
  crossref     = {DBLP:conf/lcn/2013},
  url          = {https://doi.org/10.1109/LCN.2013.6761250},
  doi          = {10.1109/LCN.2013.6761250},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/lcn/ShiWLC13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/LoTNCLC13,
  author       = {Kenneth W. K. Lo and
                  Will W. W. Tang and
                  Grace Ngai and
                  Alvin T. S. Chan and
                  Hong Va Leong and
                  Stephen C. F. Chan},
  title        = {i*Chameleon: a platform for developing multimodal application with
                  comprehensive development cycle},
  booktitle    = {Proceedings of the 28th Annual {ACM} Symposium on Applied Computing,
                  {SAC} '13, Coimbra, Portugal, March 18-22, 2013},
  pages        = {1103--1108},
  year         = {2013},
  crossref     = {DBLP:conf/sac/2013},
  url          = {https://doi.org/10.1145/2480362.2480570},
  doi          = {10.1145/2480362.2480570},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sac/LoTNCLC13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trustcom/YuC13,
  author       = {Xiaochuan Yu and
                  Alvin Chan Toong Shoon},
  title        = {A Hypercubic Overlay Using Bloom-Filter Based Addressing for a Non-dedicated
                  Distributed Tag-Based Pub/Sub System},
  booktitle    = {12th {IEEE} International Conference on Trust, Security and Privacy
                  in Computing and Communications, TrustCom 2013 / 11th {IEEE} International
                  Symposium on Parallel and Distributed Processing with Applications,
                  {ISPA-13} / 12th {IEEE} International Conference on Ubiquitous Computing
                  and Communications, IUCC-2013, Melbourne, Australia, July 16-18, 2013},
  pages        = {1008--1015},
  year         = {2013},
  crossref     = {DBLP:conf/trustcom/2013},
  url          = {https://doi.org/10.1109/TrustCom.2013.123},
  doi          = {10.1109/TRUSTCOM.2013.123},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/trustcom/YuC13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trustcom/YuC13a,
  author       = {Xiaochuan Yu and
                  Alvin Chan Toong Shoon},
  title        = {Hope: {A} Fault-Tolerant Distributed Pub/Sub Architecture for Large-Scale
                  Dynamic Network Environment},
  booktitle    = {12th {IEEE} International Conference on Trust, Security and Privacy
                  in Computing and Communications, TrustCom 2013 / 11th {IEEE} International
                  Symposium on Parallel and Distributed Processing with Applications,
                  {ISPA-13} / 12th {IEEE} International Conference on Ubiquitous Computing
                  and Communications, IUCC-2013, Melbourne, Australia, July 16-18, 2013},
  pages        = {1399--1406},
  year         = {2013},
  crossref     = {DBLP:conf/trustcom/2013},
  url          = {https://doi.org/10.1109/TrustCom.2013.169},
  doi          = {10.1109/TRUSTCOM.2013.169},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/trustcom/YuC13a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEcloud/YangCTLC12,
  author       = {Lei Yang and
                  Jiannong Cao and
                  Shaojie Tang and
                  Tao Li and
                  Alvin T. S. Chan},
  title        = {A Framework for Partitioning and Execution of Data Stream Applications
                  in Mobile Cloud Computing},
  booktitle    = {2012 {IEEE} Fifth International Conference on Cloud Computing, Honolulu,
                  HI, USA, June 24-29, 2012},
  pages        = {794--802},
  year         = {2012},
  crossref     = {DBLP:conf/IEEEcloud/2012},
  url          = {https://doi.org/10.1109/CLOUD.2012.97},
  doi          = {10.1109/CLOUD.2012.97},
  timestamp    = {Tue, 02 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/IEEEcloud/YangCTLC12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bhi/MaLLGWKL12,
  author       = {Heather Ting Ma and
                  Haiyan Lv and
                  Alvin F. W. Li and
                  James F. Griffith and
                  Yixiang Wang and
                  Anthony Wai Leung Kwok and
                  Ping Chung Leung},
  title        = {Perfusion study on Modic changes of spine based on {DCE-MRI}},
  booktitle    = {Proceedings of 2012 {IEEE-EMBS} International Conference on Biomedical
                  and Health Informatics, Hong Kong, China, January 5-7, 2012},
  pages        = {365--367},
  year         = {2012},
  crossref     = {DBLP:conf/bhi/2012},
  url          = {https://doi.org/10.1109/BHI.2012.6211589},
  doi          = {10.1109/BHI.2012.6211589},
  timestamp    = {Sat, 19 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/bhi/MaLLGWKL12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12,
  author       = {Socrates D. Vamvakos and
                  Bendik Kleveland and
                  Dipak K. Sikdar and
                  B. K. Ahuja and
                  Haidang Lin and
                  Jayaprakash Balachandran and
                  Wignes Balakrishnan and
                  Aldo Bottelli and
                  Jawji Chen and
                  Xiaole Chen and
                  Jae Choi and
                  Jeong Choi and
                  Rajesh Chopra and
                  Sanjay Dabral and
                  Kalyan Dasari and
                  Ronald B. David and
                  Shaishav Desai and
                  Claude R. Gauthier and
                  Mahmudul Hassan and
                  Kuo{-}Chiang Hsieh and
                  Ramosan Canagasaby and
                  Jeff Kumala and
                  E. P. Kwon and
                  Ben Lee and
                  Ming Liu and
                  Gurupada Mandal and
                  Sundari Mitra and
                  Byeong Cheol Na and
                  Siddharth Panwar and
                  Jay Patel and
                  Chethan Rao and
                  Vithal Rao and
                  Richard Rouse and
                  Ritesh Saraf and
                  Subramanian Seshadri and
                  Jae{-}K. Sim and
                  Clement Szeto and
                  Alvin Wang and
                  Jason Yeung},
  title        = {A 576 Mb {DRAM} with 16-channel 10.3125Gbps serial {I/O} and 14.5
                  ns latency},
  booktitle    = {Proceedings of the 38th European Solid-State Circuit conference, {ESSCIRC}
                  2012, Bordeaux, France, September 17-21, 2012},
  pages        = {458--461},
  year         = {2012},
  crossref     = {DBLP:conf/esscirc/2012},
  url          = {https://doi.org/10.1109/ESSCIRC.2012.6341354},
  doi          = {10.1109/ESSCIRC.2012.6341354},
  timestamp    = {Thu, 26 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/LimTSACRW12,
  author       = {Kevin T. Lim and
                  Yoshio Turner and
                  Jose Renato Santos and
                  Alvin AuYoung and
                  Jichuan Chang and
                  Parthasarathy Ranganathan and
                  Thomas F. Wenisch},
  title        = {System-level implications of disaggregated memory},
  booktitle    = {18th {IEEE} International Symposium on High Performance Computer Architecture,
                  {HPCA} 2012, New Orleans, LA, USA, 25-29 February, 2012},
  pages        = {189--200},
  year         = {2012},
  crossref     = {DBLP:conf/hpca/2012},
  url          = {https://doi.org/10.1109/HPCA.2012.6168955},
  doi          = {10.1109/HPCA.2012.6168955},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/hpca/LimTSACRW12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpcc/XiaochuanS12,
  author       = {Xiaochuan Yu and
                  Alvin Chan Toong Shoon},
  title        = {A Hypercubic Event-dissemination Overlay Using Structure-aware Addressing
                  for Distributed XML-based Pub/sub System},
  booktitle    = {14th {IEEE} International Conference on High Performance Computing
                  and Communication {\&} 9th {IEEE} International Conference on
                  Embedded Software and Systems, {HPCC-ICESS} 2012, Liverpool, United
                  Kingdom, June 25-27, 2012},
  pages        = {179--186},
  year         = {2012},
  crossref     = {DBLP:conf/hpcc/2012},
  url          = {https://doi.org/10.1109/HPCC.2012.32},
  doi          = {10.1109/HPCC.2012.32},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/hpcc/XiaochuanS12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccel/LinLCHL12,
  author       = {Chih{-}Lung Lin and
                  Chia{-}Sheng Li and
                  Yi{-}Ming Chang and
                  Chia{-}Che Hung and
                  Alvin Lin},
  title        = {3D stylus and pressure sensing system for capacitive touch panel},
  booktitle    = {{IEEE} International Conference on Consumer Electronics, {ICCE} 2012,
                  Las Vegas, NV, USA, January 13-16, 2012},
  pages        = {215--216},
  year         = {2012},
  crossref     = {DBLP:conf/iccel/2012},
  url          = {https://doi.org/10.1109/ICCE.2012.6161835},
  doi          = {10.1109/ICCE.2012.6161835},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccel/LinLCHL12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/percom/LoTLCCN12,
  author       = {Kenneth W. K. Lo and
                  Wai Wa Tang and
                  Hong Va Leong and
                  Alvin T. S. Chan and
                  Stephen Chi{-}fai Chan and
                  Grace Ngai},
  title        = {i{\({_\ast}\)}Chameleon: {A} unified web service framework for integrating
                  multimodal interaction devices},
  booktitle    = {Tenth Annual {IEEE} International Conference on Pervasive Computing
                  and Communications, PerCom 2012, March 19-23, 2012, Lugano, Switzerland,
                  Workshop Proceedings},
  pages        = {106--111},
  year         = {2012},
  crossref     = {DBLP:conf/percom/2012w},
  url          = {https://doi.org/10.1109/PerComW.2012.6197460},
  doi          = {10.1109/PERCOMW.2012.6197460},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/percom/LoTLCCN12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sin/PohYL12,
  author       = {Geong Sen Poh and
                  Kok{-}Lim Alvin Yau and
                  Mee Hong Ling},
  title        = {Analysis of a secure cooperative channel sensing protocol for cognitive
                  radio networks},
  booktitle    = {5th International Conference of Security of Information and Networks,
                  {SIN} '12, Jaipur, India, October 22 - 26, 2012},
  pages        = {41--46},
  year         = {2012},
  crossref     = {DBLP:conf/sin/2012},
  url          = {https://doi.org/10.1145/2388576.2388581},
  doi          = {10.1145/2388576.2388581},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sin/PohYL12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/VeronikaWNMR11,
  author       = {Merlin Veronika and
                  Roy E. Welsch and
                  Alvin Ng and
                  Paul Matsudaira and
                  Jagath C. Rajapakse},
  title        = {Correlation of cell membrane dynamics and cell motility},
  journal      = {{BMC} Bioinform.},
  volume       = {12},
  number       = {{S-13}},
  pages        = {S19},
  year         = {2011},
  url          = {https://doi.org/10.1186/1471-2105-12-S13-S19},
  doi          = {10.1186/1471-2105-12-S13-S19},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/bmcbi/VeronikaWNMR11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esticas/ChangLYSSLWLCC11,
  author       = {Da{-}Wei Chang and
                  Sheng{-}Fu Liang and
                  Chung{-}Ping Young and
                  Fu{-}Zen Shaw and
                  Alvin W. Y. Su and
                  You{-}De Liu and
                  Yu{-}Lin Wang and
                  Yi{-}Che Liu and
                  Jing{-}Jhong Chen and
                  Chun{-}Yu Chen},
  title        = {A Versatile Wireless Portable Monitoring System for Brain-Behavior
                  Approaches},
  journal      = {{IEEE} J. Emerg. Sel. Topics Circuits Syst.},
  volume       = {1},
  number       = {4},
  pages        = {440--450},
  year         = {2011},
  url          = {https://doi.org/10.1109/JETCAS.2011.2181454},
  doi          = {10.1109/JETCAS.2011.2181454},
  timestamp    = {Sat, 20 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/esticas/ChangLYSSLWLCC11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/TangLCCLN11,
  author       = {Wai Wa Tang and
                  Kenneth W. K. Lo and
                  Alvin T. S. Chan and
                  Stephen Chi{-}fai Chan and
                  Hong Va Leong and
                  Grace Ngai},
  title        = {i*Chameleon: a scalable and extensible framework for multimodal interaction},
  booktitle    = {Proceedings of the International Conference on Human Factors in Computing
                  Systems, {CHI} 2011, Extended Abstracts Volume, Vancouver, BC, Canada,
                  May 7-12, 2011},
  pages        = {305--310},
  year         = {2011},
  crossref     = {DBLP:conf/chi/2011a},
  url          = {https://doi.org/10.1145/1979742.1979703},
  doi          = {10.1145/1979742.1979703},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/chi/TangLCCLN11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ithings/XuCWCZYWZ11,
  author       = {Bin Xu and
                  Alvin Chin and
                  Hao Wang and
                  Lele Chang and
                  Ke Zhang and
                  Fangxi Yin and
                  Hao Wang and
                  Li Zhang},
  title        = {Physical Proximity and Online User Behaviour in an Indoor Mobile Social
                  Networking Application},
  booktitle    = {2011 {IEEE} International Conference on Internet of Things (iThings)
                  {\&} 4th {IEEE} International Conference on Cyber, Physical and
                  Social Computing (CPSCom), Dalian, China, October 19-22, 2011},
  pages        = {273--282},
  year         = {2011},
  crossref     = {DBLP:conf/ithings/2011},
  url          = {https://doi.org/10.1109/iThings/CPSCom.2011.74},
  doi          = {10.1109/ITHINGS/CPSCOM.2011.74},
  timestamp    = {Wed, 17 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ithings/XuCWCZYWZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mdm/XiaochuanA11,
  author       = {Xiaochuan Yu and
                  Alvin Chan Toong Shoon},
  title        = {A Time/Space Efficient {XML} Filtering System for Mobile Environment},
  booktitle    = {12th {IEEE} International Conference on Mobile Data Management, {MDM}
                  2011, Lule{\aa}, Sweden, June 6-9, 2011, Volume 1},
  pages        = {184--193},
  year         = {2011},
  crossref     = {DBLP:conf/mdm/2011-1},
  url          = {https://doi.org/10.1109/MDM.2011.78},
  doi          = {10.1109/MDM.2011.78},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/mdm/XiaochuanA11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sies/LinCSCC11,
  author       = {Yi{-}Li Lin and
                  Wei{-}Tso Chen and
                  Alvin W. Y. Su and
                  Da{-}Wei Chang and
                  Chung{-}Ho Chen},
  title        = {A low cost, low power, high scalability and dependability processor-cluster
                  platform},
  booktitle    = {Industrial Embedded Systems (SIES), 2011 6th {IEEE} International
                  Symposium on, {SIES} 2011. Vasteras, Sweden, June 15-17, 2011},
  pages        = {95--98},
  year         = {2011},
  crossref     = {DBLP:conf/sies/2011},
  url          = {https://doi.org/10.1109/SIES.2011.5953689},
  doi          = {10.1109/SIES.2011.5953689},
  timestamp    = {Wed, 16 Oct 2019 14:14:53 +0200},
  biburl       = {https://dblp.org/rec/conf/sies/LinCSCC11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/hci/YeoCLTLH11,
  author       = {Alvin W. Yeo and
                  Po{-}Chan Chiu and
                  Tek Yong Lim and
                  Ping{-}Ping Tan and
                  Terrin Lim and
                  Idyawati Hussein},
  title        = {Usability in Malaysia},
  booktitle    = {Global Usability},
  pages        = {211--222},
  year         = {2011},
  crossref     = {DBLP:series/hci/DouglasL11},
  url          = {https://doi.org/10.1007/978-0-85729-304-6\_12},
  doi          = {10.1007/978-0-85729-304-6\_12},
  timestamp    = {Wed, 14 Jun 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/series/hci/YeoCLTLH11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jise/WangCSS10,
  author       = {Jing{-}Xin Wang and
                  Yung{-}Chang Chiu and
                  Alvin Wen{-}Yu Su and
                  Ce{-}Kuen Shieh},
  title        = {On Parallelizing {H.264/AVC} Rate-Distortion Optimization Baseline
                  Profile Encoder},
  journal      = {J. Inf. Sci. Eng.},
  volume       = {26},
  number       = {2},
  pages        = {409--426},
  year         = {2010},
  url          = {http://www.iis.sinica.edu.tw/page/jise/2010/201003\_06.html},
  timestamp    = {Fri, 16 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jise/WangCSS10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hipc/WangWCC10,
  author       = {Yinfeng Wang and
                  Cho{-}Li Wang and
                  Jiannong Cao and
                  Alvin T. S. Chan},
  title        = {Optimizing data acquisition by sensor-channel co-allocation in wireless
                  sensor networks},
  booktitle    = {2010 International Conference on High Performance Computing, HiPC
                  2010, Dona Paula, Goa, India, December 19-22, 2010},
  pages        = {1--10},
  year         = {2010},
  crossref     = {DBLP:conf/hipc/2010},
  url          = {https://doi.org/10.1109/HIPC.2010.5713167},
  doi          = {10.1109/HIPC.2010.5713167},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/hipc/WangWCC10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/WeiC10,
  author       = {Edwin J. Y. Wei and
                  Alvin T. S. Chan},
  title        = {Towards semantic-based adaptation decisions for context-aware mobile
                  computing},
  booktitle    = {Proceedings of the 2010 {ACM} Symposium on Applied Computing (SAC),
                  Sierre, Switzerland, March 22-26, 2010},
  pages        = {563--567},
  year         = {2010},
  crossref     = {DBLP:conf/sac/2010},
  url          = {https://doi.org/10.1145/1774088.1774205},
  doi          = {10.1145/1774088.1774205},
  timestamp    = {Sun, 02 Jun 2019 21:18:37 +0200},
  biburl       = {https://dblp.org/rec/conf/sac/WeiC10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jise/SiaoCS09,
  author       = {Yi{-}Song Siao and
                  Wei{-}Chen Chang and
                  Alvin Wen{-}Yu Su},
  title        = {Pitch Detection/Tracking Strategy for Musical Recordings of Solo Bowed-String
                  and Wind Instruments},
  journal      = {J. Inf. Sci. Eng.},
  volume       = {25},
  number       = {4},
  pages        = {1239--1253},
  year         = {2009},
  url          = {http://www.iis.sinica.edu.tw/page/jise/2009/200907\_17.html},
  timestamp    = {Fri, 16 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jise/SiaoCS09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/crowncom/YauKT09,
  author       = {Kok{-}Lim Alvin Yau and
                  Peter Komisarczuk and
                  Paul D. Teal},
  title        = {A context-aware and Intelligent Dynamic Channel Selection scheme for
                  cognitive radio networks},
  booktitle    = {4th International {ICST} Conference on Cognitive Radio Oriented Wireless
                  Networks and Communications, {CROWNCOM} 2009, Hannover, Germany, June
                  22-24, 2009},
  pages        = {1--6},
  year         = {2009},
  crossref     = {DBLP:conf/crowncom/2009},
  url          = {https://doi.org/10.1109/CROWNCOM.2009.5189427},
  doi          = {10.1109/CROWNCOM.2009.5189427},
  timestamp    = {Wed, 16 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/crowncom/YauKT09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cse/HuangCCSSL09,
  author       = {Sheng{-}Wei Huang and
                  Yung{-}Chang Chiu and
                  Zhong{-}Ho Chen and
                  Ce{-}Kuen Shieh and
                  Alvin Wen{-}Yu Su and
                  Tyng{-}Yeu Liang},
  title        = {A Region-Based Allocation Approach for Page-Based Scratch-Pad Memory
                  in Embedded Systems},
  booktitle    = {Proceedings of the 12th {IEEE} International Conference on Computational
                  Science and Engineering, {CSE} 2009, Vancouver, BC, Canada, August
                  29-31, 2009},
  pages        = {9--16},
  year         = {2009},
  crossref     = {DBLP:conf/cse/2009},
  url          = {https://doi.org/10.1109/CSE.2009.350},
  doi          = {10.1109/CSE.2009.350},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cse/HuangCCSSL09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/MartinG09,
  author       = {Alvin F. Martin and
                  Craig S. Greenberg},
  title        = {{NIST} 2008 speaker recognition evaluation: performance across telephone
                  and room microphone channels},
  booktitle    = {10th Annual Conference of the International Speech Communication Association,
                  {INTERSPEECH} 2009, Brighton, United Kingdom, September 6-10, 2009},
  pages        = {2579--2582},
  year         = {2009},
  crossref     = {DBLP:conf/interspeech/2009},
  url          = {https://doi.org/10.21437/Interspeech.2009-679},
  doi          = {10.21437/INTERSPEECH.2009-679},
  timestamp    = {Tue, 11 Jun 2024 16:45:43 +0200},
  biburl       = {https://dblp.org/rec/conf/interspeech/MartinG09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijpcc/CheungYCC08,
  author       = {Ronnie Cheung and
                  Gang Yao and
                  Jiannong Cao and
                  Alvin T. S. Chan},
  title        = {A fuzzy service adaptation engine for context-aware mobile computing
                  middleware},
  journal      = {Int. J. Pervasive Comput. Commun.},
  volume       = {4},
  number       = {2},
  pages        = {147--165},
  year         = {2008},
  url          = {https://doi.org/10.1108/17427370810890256},
  doi          = {10.1108/17427370810890256},
  timestamp    = {Thu, 16 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijpcc/CheungYCC08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ivs/ChangLGKRYSZKS08,
  author       = {Remco Chang and
                  Alvin Lee and
                  Mohammad Ghoniem and
                  Robert Kosara and
                  William Ribarsky and
                  Jing Yang and
                  Evan A. Suma and
                  Caroline Ziemkiewicz and
                  Daniel A. Kern and
                  Agus Sudjianto},
  title        = {Scalable and interactive visual analysis of financial wire transactions
                  for fraud detection},
  journal      = {Inf. Vis.},
  volume       = {7},
  number       = {1},
  pages        = {63--76},
  year         = {2008},
  url          = {https://doi.org/10.1057/palgrave.ivs.9500172},
  doi          = {10.1057/PALGRAVE.IVS.9500172},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ivs/ChangLGKRYSZKS08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/ChuangC08,
  author       = {Siu Nam Chuang and
                  Alvin T. S. Chan},
  title        = {Dynamic QoS Adaptation for Mobile Middleware},
  journal      = {{IEEE} Trans. Software Eng.},
  volume       = {34},
  number       = {6},
  pages        = {738--752},
  year         = {2008},
  url          = {https://doi.org/10.1109/TSE.2008.44},
  doi          = {10.1109/TSE.2008.44},
  timestamp    = {Wed, 17 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tse/ChuangC08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/twc/YuCZWCCL08,
  author       = {Wanrong Yu and
                  Jiannong Cao and
                  Xingming Zhou and
                  Xiaodong Wang and
                  Keith C. C. Chan and
                  Alvin T. S. Chan and
                  Hong Va Leong},
  title        = {A High-Throughput {MAC} Protocol for Wireless Ad Hoc Networks},
  journal      = {{IEEE} Trans. Wirel. Commun.},
  volume       = {7},
  number       = {1},
  pages        = {135--145},
  year         = {2008},
  url          = {https://doi.org/10.1109/TWC.2008.06094},
  doi          = {10.1109/TWC.2008.06094},
  timestamp    = {Sun, 06 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/twc/YuCZWCCL08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/LeongC08,
  author       = {Hong Va Leong and
                  Alvin T. S. Chan},
  title        = {Special track on Mobile Computing and Applications: editorial message},
  booktitle    = {Proceedings of the 2008 {ACM} Symposium on Applied Computing (SAC),
                  Fortaleza, Ceara, Brazil, March 16-20, 2008},
  pages        = {1876--1877},
  year         = {2008},
  crossref     = {DBLP:conf/sac/2008},
  url          = {https://doi.org/10.1145/1363686.1364142},
  doi          = {10.1145/1363686.1364142},
  timestamp    = {Tue, 06 Nov 2018 11:06:48 +0100},
  biburl       = {https://dblp.org/rec/conf/sac/LeongC08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semco/WeiC08,
  author       = {Edwin J. Y. Wei and
                  Alvin T. S. Chan},
  title        = {Semantic Approach to Middleware-Driven Run-Time Context-Aware Adaptation
                  Decision},
  booktitle    = {Proceedings of the 2th {IEEE} International Conference on Semantic
                  Computing {(ICSC} 2008), August 4-7, 2008, Santa Clara, California,
                  {USA}},
  pages        = {440--447},
  year         = {2008},
  crossref     = {DBLP:conf/semco/2008},
  url          = {https://doi.org/10.1109/ICSC.2008.49},
  doi          = {10.1109/ICSC.2008.49},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/semco/WeiC08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejwcn/ChenXWLCCC07,
  author       = {Yingwen Chen and
                  Ming Xu and
                  Huaimin Wang and
                  Hong Va Leong and
                  Jiannong Cao and
                  Keith C. C. Chan and
                  Alvin T. S. Chan},
  title        = {An Energy-Efficient Framework for Multirate Query in Wireless Sensor
                  Networks},
  journal      = {{EURASIP} J. Wirel. Commun. Netw.},
  volume       = {2007},
  year         = {2007},
  url          = {https://doi.org/10.1155/2007/48984},
  doi          = {10.1155/2007/48984},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ejwcn/ChenXWLCCC07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/ChowLC07,
  author       = {Chi{-}Yin Chow and
                  Hong Va Leong and
                  Alvin T. S. Chan},
  title        = {GroCoca: group-based peer-to-peer cooperative caching in mobile environment},
  journal      = {{IEEE} J. Sel. Areas Commun.},
  volume       = {25},
  number       = {1},
  pages        = {179--191},
  year         = {2007},
  url          = {https://doi.org/10.1109/JSAC.2007.070118},
  doi          = {10.1109/JSAC.2007.070118},
  timestamp    = {Thu, 02 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jsac/ChowLC07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euc/WeiC07,
  author       = {Edwin J. Y. Wei and
                  Alvin T. S. Chan},
  title        = {Towards Context-Awareness in Ubiquitous Computing},
  booktitle    = {Embedded and Ubiquitous Computing, International Conference, {EUC}
                  2007, Taipei, Taiwan, December 17-20, 2007, Proceedings},
  pages        = {706--717},
  year         = {2007},
  crossref     = {DBLP:conf/euc/2007},
  url          = {https://doi.org/10.1007/978-3-540-77092-3\_61},
  doi          = {10.1007/978-3-540-77092-3\_61},
  timestamp    = {Tue, 14 May 2019 10:00:47 +0200},
  biburl       = {https://dblp.org/rec/conf/euc/WeiC07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cluster/CaoCSDG06,
  author       = {Jiannong Cao and
                  Alvin T. S. Chan and
                  Yudong Sun and
                  Sajal K. Das and
                  Minyi Guo},
  title        = {A taxonomy of application scheduling tools for high performance cluster
                  computing},
  journal      = {Clust. Comput.},
  volume       = {9},
  number       = {3},
  pages        = {355--371},
  year         = {2006},
  url          = {https://doi.org/10.1007/s10586-006-9747-2},
  doi          = {10.1007/S10586-006-9747-2},
  timestamp    = {Tue, 29 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cluster/CaoCSDG06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/concurrency/CaoCCC06,
  author       = {Jiannong Cao and
                  Alvin T. S. Chan and
                  Stephen C. F. Chan and
                  Nick K. C. Cheung},
  title        = {A robust monitor construct with runtime fault detection},
  journal      = {Concurr. Comput. Pract. Exp.},
  volume       = {18},
  number       = {5},
  pages        = {471--500},
  year         = {2006},
  url          = {https://doi.org/10.1002/cpe.934},
  doi          = {10.1002/CPE.934},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/concurrency/CaoCCC06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/internet/ZhengCN06,
  author       = {Yongjie Zheng and
                  Alvin T. S. Chan and
                  Grace Ngai},
  title        = {Applying Coordination for Service Adaptation in Mobile Computing},
  journal      = {{IEEE} Internet Comput.},
  volume       = {10},
  number       = {5},
  pages        = {61--67},
  year         = {2006},
  url          = {https://doi.org/10.1109/MIC.2006.93},
  doi          = {10.1109/MIC.2006.93},
  timestamp    = {Fri, 13 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/internet/ZhengCN06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spe/ZhengCN06,
  author       = {Yongjie Zheng and
                  Alvin T. S. Chan and
                  Grace Ngai},
  title        = {{MCL:} a MobiGATE coordination language for highly adaptive and reconfigurable
                  mobile middleware},
  journal      = {Softw. Pract. Exp.},
  volume       = {36},
  number       = {11-12},
  pages        = {1355--1380},
  year         = {2006},
  url          = {https://doi.org/10.1002/spe.757},
  doi          = {10.1002/SPE.757},
  timestamp    = {Thu, 09 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/spe/ZhengCN06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/ChangS06,
  author       = {Wei{-}Chen Chang and
                  Alvin Wen{-}Yu Su},
  title        = {A Multichannel Recurrent Network Analysis/Synthesis Model for Coupled-String
                  Instruments},
  journal      = {{IEEE} Trans. Speech Audio Process.},
  volume       = {14},
  number       = {6},
  pages        = {2233--2241},
  year         = {2006},
  url          = {https://doi.org/10.1109/TASL.2006.872610},
  doi          = {10.1109/TASL.2006.872610},
  timestamp    = {Sun, 17 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/taslp/ChangS06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/ZhengC06,
  author       = {Yongjie Zheng and
                  Alvin T. S. Chan},
  title        = {MobiGATE: {A} Mobile Computing Middleware for the Active Deployment
                  of Transport Services},
  journal      = {{IEEE} Trans. Software Eng.},
  volume       = {32},
  number       = {1},
  pages        = {35--50},
  year         = {2006},
  url          = {https://doi.org/10.1109/TSE.2006.11},
  doi          = {10.1109/TSE.2006.11},
  timestamp    = {Wed, 17 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tse/ZhengC06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/twc/FuMT06,
  author       = {Alvin Fu and
                  Eytan H. Modiano and
                  John N. Tsitsiklis},
  title        = {Optimal transmission scheduling over a fading channel with energy
                  and deadline constraints},
  journal      = {{IEEE} Trans. Wirel. Commun.},
  volume       = {5},
  number       = {3},
  pages        = {630--641},
  year         = {2006},
  url          = {https://doi.org/10.1109/TWC.2006.1611093},
  doi          = {10.1109/TWC.2006.1611093},
  timestamp    = {Mon, 22 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/twc/FuMT06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/YeoC06,
  author       = {Alvin W. Yeo and
                  Po{-}Chan Chiu},
  title        = {Gaze estimation model for eye drawing},
  booktitle    = {Extended Abstracts Proceedings of the 2006 Conference on Human Factors
                  in Computing Systems, {CHI} 2006, Montr{\'{e}}al, Qu{\'{e}}bec,
                  Canada, April 22-27, 2006},
  pages        = {1559--1564},
  year         = {2006},
  crossref     = {DBLP:conf/chi/2006a},
  url          = {https://doi.org/10.1145/1125451.1125736},
  doi          = {10.1145/1125451.1125736},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/chi/YeoC06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/etra/ChanY06,
  author       = {Po{-}Chan Chiu and
                  Alvin W. Yeo},
  title        = {Eye drawing with gaze estimation model},
  booktitle    = {Proceedings of the Eye Tracking Research {\&} Application Symposium,
                  {ETRA} 2006, San Diego, California, USA, March 27-29, 2006},
  pages        = {57},
  year         = {2006},
  crossref     = {DBLP:conf/etra/2006},
  url          = {https://doi.org/10.1145/1117309.1117342},
  doi          = {10.1145/1117309.1117342},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/etra/ChanY06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euc/CheungCYC06,
  author       = {Ronnie Cheung and
                  Jiannong Cao and
                  Gang Yao and
                  Alvin T. S. Chan},
  title        = {A Fuzzy-Based Service Adaptation Middleware for Context-Aware Computing},
  booktitle    = {Embedded and Ubiquitous Computing, International Conference, {EUC}
                  2006, Seoul, Korea, August 1-4, 2006, Proceedings},
  pages        = {580--590},
  year         = {2006},
  crossref     = {DBLP:conf/euc/2006},
  url          = {https://doi.org/10.1007/11802167\_59},
  doi          = {10.1007/11802167\_59},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/euc/CheungCYC06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fuzzIEEE/ChuangC06,
  author       = {Siu{-}Nam Chuang and
                  Alvin T. S. Chan},
  title        = {MobiPADS++: {A} Mobile QoS Middleware based on Hierarchical Fuzzy
                  Control},
  booktitle    = {{IEEE} International Conference on Fuzzy Systems, {FUZZ-IEEE} 2006,
                  Vancouver, BC, Canada, July 16-21, 2006},
  pages        = {2223--2230},
  year         = {2006},
  crossref     = {DBLP:conf/fuzzIEEE/2006},
  url          = {https://doi.org/10.1109/FUZZY.2006.1682009},
  doi          = {10.1109/FUZZY.2006.1682009},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/fuzzIEEE/ChuangC06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gpc/YuCZWCCL06,
  author       = {Wanrong Yu and
                  Jiannong Cao and
                  Xingming Zhou and
                  Xiaodong Wang and
                  Keith C. C. Chan and
                  Alvin T. S. Chan and
                  Hong Va Leong},
  title        = {{VWMAC:} An Efficient {MAC} Protocol for Resolving Intra-flow Contention
                  in Wireless Ad Hoc Networks},
  booktitle    = {Advances in Grid and Pervasive Computing, First International Conference,
                  {GPC} 2006, Taichung, Taiwan, May 3-5, 2006, Proceedings},
  pages        = {498--508},
  year         = {2006},
  crossref     = {DBLP:conf/gpc/2006},
  url          = {https://doi.org/10.1007/11745693\_49},
  doi          = {10.1007/11745693\_49},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/gpc/YuCZWCCL06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscc/ZhengC06,
  author       = {Yongjie Zheng and
                  Alvin T. S. Chan},
  title        = {Coordinated Composition of Services for Adaptive Mobile Middleware},
  booktitle    = {Proceedings of the 11th {IEEE} Symposium on Computers and Communications
                  {(ISCC} 2006), 26-29 June 2006, Cagliari, Sardinia, Italy},
  pages        = {789--794},
  year         = {2006},
  crossref     = {DBLP:conf/iscc/2006},
  url          = {https://doi.org/10.1109/ISCC.2006.55},
  doi          = {10.1109/ISCC.2006.55},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iscc/ZhengC06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mdm/ChenLXCCC06,
  author       = {Yingwen Chen and
                  Hong Va Leong and
                  Ming Xu and
                  Jiannong Cao and
                  Keith C. C. Chan and
                  Alvin T. S. Chan},
  title        = {In-Network Data Processing forWireless Sensor Networks},
  booktitle    = {7th International Conference on Mobile Data Management {(MDM} 2006),
                  Nara, Japan, May 9-13, 2006},
  pages        = {26},
  year         = {2006},
  crossref     = {DBLP:conf/mdm/2006},
  url          = {https://doi.org/10.1109/MDM.2006.96},
  doi          = {10.1109/MDM.2006.96},
  timestamp    = {Wed, 14 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/mdm/ChenLXCCC06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/LeongC06,
  author       = {Hong Va Leong and
                  Alvin T. S. Chan},
  title        = {Editorial message: special track on mobile computing and applications},
  booktitle    = {Proceedings of the 2006 {ACM} Symposium on Applied Computing (SAC),
                  Dijon, France, April 23-27, 2006},
  pages        = {1120--1121},
  year         = {2006},
  crossref     = {DBLP:conf/sac/2006},
  url          = {https://doi.org/10.1145/1141277.1141544},
  doi          = {10.1145/1141277.1141544},
  timestamp    = {Tue, 06 Nov 2018 11:06:49 +0100},
  biburl       = {https://dblp.org/rec/conf/sac/LeongC06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/Chan05,
  author       = {Alvin T. S. Chan},
  title        = {Mobile cookies management on a smart card},
  journal      = {Commun. {ACM}},
  volume       = {48},
  number       = {11},
  pages        = {38--43},
  year         = {2005},
  url          = {https://doi.org/10.1145/1096000.1096002},
  doi          = {10.1145/1096000.1096002},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cacm/Chan05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spe/ChanCCZ05,
  author       = {Fan Chan and
                  Jiannong Cao and
                  Alvin T. S. Chan and
                  Kang Zhang},
  title        = {Visual programming support for graph-oriented parallel/distributed
                  processing},
  journal      = {Softw. Pract. Exp.},
  volume       = {35},
  number       = {15},
  pages        = {1409--1439},
  year         = {2005},
  url          = {https://doi.org/10.1002/spe.676},
  doi          = {10.1002/SPE.676},
  timestamp    = {Tue, 29 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/spe/ChanCCZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/ChanCC05,
  author       = {Alvin T. S. Chan and
                  Jiannong Cao and
                  C. K. Chan},
  title        = {{WEBGOP:} collaborative web services based on graph-oriented programming},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {A}},
  volume       = {35},
  number       = {6},
  pages        = {811--830},
  year         = {2005},
  url          = {https://doi.org/10.1109/TSMCA.2005.851342},
  doi          = {10.1109/TSMCA.2005.851342},
  timestamp    = {Mon, 25 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/ChanCC05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/www/ChuangC05,
  author       = {Siu Nam Chuang and
                  Alvin T. S. Chan},
  title        = {Active Service for Mobile Middleware},
  journal      = {World Wide Web},
  volume       = {8},
  number       = {2},
  pages        = {127--157},
  year         = {2005},
  url          = {https://doi.org/10.1007/s11280-004-4871-5},
  doi          = {10.1007/S11280-004-4871-5},
  timestamp    = {Sat, 20 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/www/ChuangC05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icws/ChanW05,
  author       = {Alvin T. S. Chan and
                  Dick K. T. Wan},
  title        = {Web Services Mobility in a Pocket},
  booktitle    = {2005 {IEEE} International Conference on Web Services {(ICWS} 2005),
                  11-15 July 2005, Orlando, FL, {USA}},
  pages        = {159--166},
  year         = {2005},
  crossref     = {DBLP:conf/icws/2005},
  url          = {https://doi.org/10.1109/ICWS.2005.134},
  doi          = {10.1109/ICWS.2005.134},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icws/ChanW05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isads/CaoXCL05,
  author       = {Jiannong Cao and
                  Wei Xu and
                  Alvin T. S. Chan and
                  Jing Li},
  title        = {A reliable multicast protocol for mailbox-based mobile agent communications},
  booktitle    = {2005 International Symposium on Autonomous Decentralized Systems,
                  {ISADS} 2005, Chengdu, China, April 4-8, 2005, Proceedings},
  pages        = {74--81},
  year         = {2005},
  crossref     = {DBLP:conf/isads/2005},
  url          = {https://doi.org/10.1109/ISADS.2005.1452023},
  doi          = {10.1109/ISADS.2005.1452023},
  timestamp    = {Tue, 06 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/isads/CaoXCL05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mdm/ChowLC05,
  author       = {Chi{-}Yin Chow and
                  Hong Va Leong and
                  Alvin T. S. Chan},
  title        = {Distributed group-based cooperative caching in a mobile broadcast
                  environment},
  booktitle    = {6th International Conference on Mobile Data Management {(MDM} 2005),
                  Ayia Napa, Cyprus, May 9-13, 2005},
  pages        = {97--106},
  year         = {2005},
  crossref     = {DBLP:conf/mdm/2005},
  url          = {https://doi.org/10.1145/1071246.1071261},
  doi          = {10.1145/1071246.1071261},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/mdm/ChowLC05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rtcsa/CaoXCFJ05,
  author       = {Jiannong Cao and
                  Na Xing and
                  Alvin T. S. Chan and
                  Yulin Feng and
                  Beihong Jin},
  title        = {Service Adaptation Using Fuzzy Theory in Context-Aware Mobile Computing
                  Middleware},
  booktitle    = {11th {IEEE} International Conference on Embedded and Real-Time Computing
                  Systems and Applications {(RTCSA} 2005), 17-19 August 2005, Hong Kong,
                  China},
  pages        = {496--501},
  year         = {2005},
  crossref     = {DBLP:conf/rtcsa/2005},
  url          = {https://doi.org/10.1109/RTCSA.2005.93},
  doi          = {10.1109/RTCSA.2005.93},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/rtcsa/CaoXCFJ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/LeongC05,
  author       = {Hong Va Leong and
                  Alvin T. S. Chan},
  title        = {Editorial message: special track on mobile computing and applications},
  booktitle    = {Proceedings of the 2005 {ACM} Symposium on Applied Computing (SAC),
                  Santa Fe, New Mexico, USA, March 13-17, 2005},
  pages        = {1118--1119},
  year         = {2005},
  crossref     = {DBLP:conf/sac/2005},
  url          = {https://doi.org/10.1145/1066677.1066930},
  doi          = {10.1145/1066677.1066930},
  timestamp    = {Tue, 06 Nov 2018 11:06:45 +0100},
  biburl       = {https://dblp.org/rec/conf/sac/LeongC05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cera/ChanCLN04,
  author       = {Alvin T. S. Chan and
                  Stephen Chi{-}fai Chan and
                  Hong Va Leong and
                  Vincent Ng},
  title        = {Advancement in Co-Operative Internet Computing Research and Applications},
  journal      = {Concurr. Eng. Res. Appl.},
  volume       = {12},
  number       = {3},
  pages        = {171--173},
  year         = {2004},
  url          = {https://doi.org/10.1177/1063293X04047007},
  doi          = {10.1177/1063293X04047007},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cera/ChanCLN04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/ChanCL04,
  author       = {Alvin T. S. Chan and
                  Siu Nam Chuang and
                  Jiannong Cao and
                  Hong Va Leong},
  title        = {An Event-Driven Middleware for Mobile Context Awareness},
  journal      = {Comput. J.},
  volume       = {47},
  number       = {3},
  pages        = {278--288},
  year         = {2004},
  url          = {https://doi.org/10.1093/comjnl/47.3.278},
  doi          = {10.1093/COMJNL/47.3.278},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cj/ChanCL04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ida/PampalkWC04,
  author       = {Elias Pampalk and
                  Gerhard Widmer and
                  Alvin T. S. Chan},
  title        = {A new approach to hierarchical clustering and structuring of data
                  with Self-Organizing Maps},
  journal      = {Intell. Data Anal.},
  volume       = {8},
  number       = {2},
  pages        = {131--149},
  year         = {2004},
  url          = {http://content.iospress.com/articles/intelligent-data-analysis/ida00158},
  timestamp    = {Mon, 18 May 2015 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ida/PampalkWC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/ChanCCG04,
  author       = {Fan Chan and
                  Jiannong Cao and
                  Alvin T. S. Chan and
                  Minyi Guo},
  title        = {Programming Support for {MPMD} Parallel Computing in ClusterGOP},
  journal      = {{IEICE} Trans. Inf. Syst.},
  volume       = {87-D},
  number       = {7},
  pages        = {1693--1702},
  year         = {2004},
  url          = {http://search.ieice.org/bin/summary.php?id=e87-d\_7\_1693},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ieicet/ChanCCG04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcpol/ChanCLC04,
  author       = {Alvin T. S. Chan and
                  Jiannong Cao and
                  Chi{-}Kin Liu and
                  Weidong Cao},
  title        = {{VPL:} An Online Distance Learning Platform for Virtual Programming
                  Laboratory},
  journal      = {Int. J. Comput. Process. Orient. Lang.},
  volume       = {17},
  number       = {1},
  pages        = {41--59},
  year         = {2004},
  url          = {https://doi.org/10.1142/S0219427904000973},
  doi          = {10.1142/S0219427904000973},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijcpol/ChanCLC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/internet/ChuangCCC04,
  author       = {Siu Nam Chuang and
                  Alvin T. S. Chan and
                  Jiannong Cao and
                  Ronnie Cheung},
  title        = {Actively Deployable Mobile Services for Adaptive Web Access},
  journal      = {{IEEE} Internet Comput.},
  volume       = {8},
  number       = {2},
  pages        = {26--33},
  year         = {2004},
  url          = {https://doi.org/10.1109/MIC.2004.1273483},
  doi          = {10.1109/MIC.2004.1273483},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/internet/ChuangCCC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/CaoCCWD04,
  author       = {Jiannong Cao and
                  Min Cao and
                  Alvin T. S. Chan and
                  Gengfeng Wu and
                  Sajal K. Das},
  title        = {A framework for architecting and high-level programming support of
                  {CORBA} applications},
  journal      = {J. Parallel Distributed Comput.},
  volume       = {64},
  number       = {6},
  pages        = {725--739},
  year         = {2004},
  url          = {https://doi.org/10.1016/j.jpdc.2003.10.006},
  doi          = {10.1016/J.JPDC.2003.10.006},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jpdc/CaoCCWD04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/WongCL04,
  author       = {Eugene Y. C. Wong and
                  Alvin T. S. Chan and
                  Hong Va Leong},
  title        = {Xstream: {A} Middleware for Streaming {XML} Contents over Wireless
                  Environments},
  journal      = {{IEEE} Trans. Software Eng.},
  volume       = {30},
  number       = {12},
  pages        = {918--935},
  year         = {2004},
  url          = {https://doi.org/10.1109/TSE.2004.108},
  doi          = {10.1109/TSE.2004.108},
  timestamp    = {Thu, 15 Jun 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tse/WongCL04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aina/ChowLC04,
  author       = {Chi{-}Yin Chow and
                  Hong Va Leong and
                  Alvin T. S. Chan},
  title        = {Cache Signatures for Peer-to-Peer Cooperative Caching in Mobile Environments},
  booktitle    = {18th International Conference on Advanced Information Networking and
                  Applications {(AINA} 2004), 29-31 March 2004, Fukuoka, Japan},
  pages        = {96--101},
  year         = {2004},
  crossref     = {DBLP:conf/aina/2004},
  url          = {https://doi.org/10.1109/AINA.2004.1283894},
  doi          = {10.1109/AINA.2004.1283894},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/aina/ChowLC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compsac/ZhengC04,
  author       = {Yongjie Zheng and
                  Alvin T. S. Chan},
  title        = {Stream Composition for Highly Adaptive and Reconfigurable Mobile Middleware},
  booktitle    = {28th International Computer Software and Applications Conference {(COMPSAC}
                  2004), Design and Assessment of Trustworthy Software-Based Systems,
                  27-30 September 2004, Hong Kong, China, Proceedings},
  pages        = {122--127},
  year         = {2004},
  crossref     = {DBLP:conf/compsac/2004},
  url          = {https://doi.org/10.1109/CMPSAC.2004.1342815},
  doi          = {10.1109/CMPSAC.2004.1342815},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/compsac/ZhengC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdcsw/ChowLC04,
  author       = {Chi{-}Yin Chow and
                  Hong Va Leong and
                  Alvin T. S. Chan},
  title        = {Peer-to-Peer Cooperative Caching in Mobile Environments},
  booktitle    = {24th International Conference on Distributed Computing Systems Workshops
                  {(ICDCS} 2004 Workshops), 23-24 March 2004, Hachioji, Tokyo, Japan},
  pages        = {528--533},
  year         = {2004},
  crossref     = {DBLP:conf/icdcsw/2004},
  url          = {https://doi.org/10.1109/ICDCSW.2004.1284083},
  doi          = {10.1109/ICDCSW.2004.1284083},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icdcsw/ChowLC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/HuangCLSK04,
  author       = {Win{-}Bin Huang and
                  Wei{-}Chen Chang and
                  Yen{-}Wei Lu and
                  Alvin Wen{-}Yu Su and
                  Yau{-}Hwang Kuo},
  title        = {Halftone/contone conversion using neural networks},
  booktitle    = {Proceedings of the 2004 International Conference on Image Processing,
                  {ICIP} 2004, Singapore, October 24-27, 2004},
  pages        = {3547--3550},
  year         = {2004},
  crossref     = {DBLP:conf/icip/2004},
  url          = {https://doi.org/10.1109/ICIP.2004.1421882},
  doi          = {10.1109/ICIP.2004.1421882},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/HuangCLSK04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/CaoTC04,
  author       = {Jiannong Cao and
                  Daniel C. K. Tse and
                  Alvin T. S. Chan},
  title        = {PDAgent: {A} Platform for Developing and Deploying Mobile Agent-Enabled
                  Applications for Wireless Devices},
  booktitle    = {33rd International Conference on Parallel Processing {(ICPP} 2004),
                  15-18 August 2004, Montreal, Quebec, Canada},
  pages        = {510--517},
  year         = {2004},
  crossref     = {DBLP:conf/icpp/2004},
  url          = {https://doi.org/10.1109/ICPP.2004.1327961},
  doi          = {10.1109/ICPP.2004.1327961},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpp/CaoTC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/ChowLC04,
  author       = {Chi{-}Yin Chow and
                  Hong Va Leong and
                  Alvin T. S. Chan},
  title        = {Group-Based Cooperative Cache Management for Mobile Clients in a Mobile
                  Environment},
  booktitle    = {33rd International Conference on Parallel Processing {(ICPP} 2004),
                  15-18 August 2004, Montreal, Quebec, Canada},
  pages        = {83--90},
  year         = {2004},
  crossref     = {DBLP:conf/icpp/2004},
  url          = {https://doi.org/10.1109/ICPP.2004.1327907},
  doi          = {10.1109/ICPP.2004.1327907},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpp/ChowLC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/ZhengC04,
  author       = {Yongjie Zheng and
                  Alvin T. S. Chan},
  title        = {MobiGATE: {A} Mobile Gateway Proxy for the Active Deployment of Transport
                  Entities},
  booktitle    = {33rd International Conference on Parallel Processing {(ICPP} 2004),
                  15-18 August 2004, Montreal, Quebec, Canada},
  pages        = {566--573},
  year         = {2004},
  crossref     = {DBLP:conf/icpp/2004},
  url          = {https://doi.org/10.1109/ICPP.2004.1327967},
  doi          = {10.1109/ICPP.2004.1327967},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpp/ZhengC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispa/ChanWC04,
  author       = {Alvin T. S. Chan and
                  Peter Y. H. Wong and
                  Siu Nam Chuang},
  title        = {{CRL:} {A} Context-Aware Request Language for Mobile Computing},
  booktitle    = {Parallel and Distributed Processing and Applications, Second InternationalSymposium,
                  {ISPA} 2004, Hong Kong, China, December 13-15, 2004, Proceedings},
  pages        = {529--533},
  year         = {2004},
  crossref     = {DBLP:conf/ispa/2004},
  url          = {https://doi.org/10.1007/978-3-540-30566-8\_63},
  doi          = {10.1007/978-3-540-30566-8\_63},
  timestamp    = {Tue, 14 Apr 2020 13:23:10 +0200},
  biburl       = {https://dblp.org/rec/conf/ispa/ChanWC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispa/ChiuSWSL04,
  author       = {Yung{-}Chang Chiu and
                  Ce{-}Kuen Shieh and
                  Jing{-}Xin Wang and
                  Alvin Wen{-}Yu Su and
                  Tyng{-}Yeu Liang},
  title        = {A Real Time {MPEG-4} Parallel Encoder on Software Distributed Shared
                  Memory Systems},
  booktitle    = {Parallel and Distributed Processing and Applications, Second InternationalSymposium,
                  {ISPA} 2004, Hong Kong, China, December 13-15, 2004, Proceedings},
  pages        = {965--974},
  year         = {2004},
  crossref     = {DBLP:conf/ispa/2004},
  url          = {https://doi.org/10.1007/978-3-540-30566-8\_110},
  doi          = {10.1007/978-3-540-30566-8\_110},
  timestamp    = {Sun, 21 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ispa/ChiuSWSL04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispan/ChowLC04,
  author       = {Chi{-}Yin Chow and
                  Hong Va Leong and
                  Alvin T. S. Chan},
  title        = {Peer-to-Peer Cooperative Caching in a Hybrid Data Delivery Environment},
  booktitle    = {7th International Symposium on Parallel Architectures, Algorithms,
                  and Networks {(I-SPAN} 2004), 10-12 May 2004, Hong Kong, SAR, China},
  pages        = {79--85},
  year         = {2004},
  crossref     = {DBLP:conf/ispan/2004},
  url          = {https://doi.org/10.1109/ISPAN.2004.1300461},
  doi          = {10.1109/ISPAN.2004.1300461},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ispan/ChowLC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/Chan04,
  author       = {Alvin T. S. Chan},
  title        = {Cookies on-the-move: managing cookies on a smart card},
  booktitle    = {Proceedings of the 2004 {ACM} Symposium on Applied Computing (SAC),
                  Nicosia, Cyprus, March 14-17, 2004},
  pages        = {1693--1697},
  year         = {2004},
  crossref     = {DBLP:conf/sac/2004},
  url          = {https://doi.org/10.1145/967900.968236},
  doi          = {10.1145/967900.968236},
  timestamp    = {Tue, 06 Nov 2018 11:06:44 +0100},
  biburl       = {https://dblp.org/rec/conf/sac/Chan04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/LeongC04,
  author       = {Hong Va Leong and
                  Alvin T. S. Chan},
  title        = {Editorial message: special track on mobile computing and applications},
  booktitle    = {Proceedings of the 2004 {ACM} Symposium on Applied Computing (SAC),
                  Nicosia, Cyprus, March 14-17, 2004},
  pages        = {1149--1150},
  year         = {2004},
  crossref     = {DBLP:conf/sac/2004},
  url          = {https://doi.org/10.1145/967900.968134},
  doi          = {10.1145/967900.968134},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sac/LeongC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/WongCL04,
  author       = {Eugene Y. C. Wong and
                  Alvin T. S. Chan and
                  Hong Va Leong},
  title        = {Efficient management of {XML} contents over wireless environment by
                  Xstream},
  booktitle    = {Proceedings of the 2004 {ACM} Symposium on Applied Computing (SAC),
                  Nicosia, Cyprus, March 14-17, 2004},
  pages        = {1122--1127},
  year         = {2004},
  crossref     = {DBLP:conf/sac/2004},
  url          = {https://doi.org/10.1145/967900.968128},
  doi          = {10.1145/967900.968128},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sac/WongCL04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scp/CaoCSZ03,
  author       = {Jiannong Cao and
                  Alvin T. S. Chan and
                  Yudong Sun and
                  Kang Zhang},
  title        = {Dynamic configuration management in a graph-oriented Distributed Programming
                  Environment},
  journal      = {Sci. Comput. Program.},
  volume       = {48},
  number       = {1},
  pages        = {43--65},
  year         = {2003},
  url          = {https://doi.org/10.1016/S0167-6423(02)00168-5},
  doi          = {10.1016/S0167-6423(02)00168-5},
  timestamp    = {Wed, 17 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/scp/CaoCSZ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spe/CaoMCL03,
  author       = {Jiannong Cao and
                  Xiaoxing Ma and
                  Alvin T. S. Chan and
                  Jian Lu},
  title        = {Architecting and implementing distributed Web applications using the
                  graph-oriented approach},
  journal      = {Softw. Pract. Exp.},
  volume       = {33},
  number       = {9},
  pages        = {799--820},
  year         = {2003},
  url          = {https://doi.org/10.1002/spe.526},
  doi          = {10.1002/SPE.526},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/spe/CaoMCL03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/ChanC03,
  author       = {Alvin T. S. Chan and
                  Siu Nam Chuang},
  title        = {MobiPADS: {A} Reflective Middleware for Context-Aware Mobile Computing},
  journal      = {{IEEE} Trans. Software Eng.},
  volume       = {29},
  number       = {12},
  pages        = {1072--1085},
  year         = {2003},
  url          = {https://doi.org/10.1109/TSE.2003.1265522},
  doi          = {10.1109/TSE.2003.1265522},
  timestamp    = {Wed, 17 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tse/ChanC03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/appt/RenCCL03,
  author       = {Zhihong Ren and
                  Jiannong Cao and
                  Alvin T. S. Chan and
                  Jing Li},
  title        = {Composition and Automation of Grid Services},
  booktitle    = {Advanced Parallel Programming Technologies, 5th International Workshop,
                  {APPT} 2003, Xiamen, China, September 17-19, 2003, Proceedings},
  pages        = {352--362},
  year         = {2003},
  crossref     = {DBLP:conf/appt/2003},
  url          = {https://doi.org/10.1007/978-3-540-39425-9\_42},
  doi          = {10.1007/978-3-540-39425-9\_42},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/appt/RenCCL03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compsac/WongCL03,
  author       = {Eugene Y. C. Wong and
                  Alvin T. S. Chan and
                  Hong Va Leong},
  title        = {Semantic-based Approach to Streaming {XML} Contents using Xstream},
  booktitle    = {27th International Computer Software and Applications Conference {(COMPSAC}
                  2003): Design and Assessment of Trustworthy Software-Based Systems,
                  3-6 November 2003, Dallas, TX, USA, Proceedings},
  pages        = {91},
  year         = {2003},
  crossref     = {DBLP:conf/compsac/2003},
  url          = {https://doi.org/10.1109/CMPSAC.2003.1245326},
  doi          = {10.1109/CMPSAC.2003.1245326},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/compsac/WongCL03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/RenCCL03,
  author       = {Zhihong Ren and
                  Jiannong Cao and
                  Alvin T. S. Chan and
                  Jing Li},
  title        = {Toward a Formal Approach to Composite Web Service Construction and
                  Automation},
  booktitle    = {32nd International Conference on Parallel Processing {(ICPP} 2003),
                  6-9 October 2003, Kaohsiung, Taiwan},
  pages        = {436},
  year         = {2003},
  crossref     = {DBLP:conf/icpp/2003},
  url          = {https://doi.org/10.1109/ICPP.2003.1240608},
  doi          = {10.1109/ICPP.2003.1240608},
  timestamp    = {Wed, 07 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icpp/RenCCL03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwl/ChanCLC03,
  author       = {Alvin T. S. Chan and
                  Jiannong Cao and
                  Chi{-}Kin Liu and
                  Weidong Cao},
  title        = {Design and Implementation of {VPL:} {A} Virtual Programming Laboratory
                  for Online Distance Learning},
  booktitle    = {Advances in Web-Based Learning - {ICWL} 2003, Second International
                  Conference, Melbourne, Australia, August 18-20, 2003, Proceedings},
  pages        = {509--519},
  year         = {2003},
  crossref     = {DBLP:conf/icwl/2003},
  url          = {https://doi.org/10.1007/978-3-540-45200-3\_47},
  doi          = {10.1007/978-3-540-45200-3\_47},
  timestamp    = {Fri, 22 Apr 2022 17:07:03 +0200},
  biburl       = {https://dblp.org/rec/conf/icwl/ChanCLC03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/FuMT03,
  author       = {Alvin Fu and
                  Eytan H. Modiano and
                  John N. Tsitsiklis},
  title        = {Optimal Energy Allocation for Delay-Constrained Data Transmission
                  over a Time-Varying Channel},
  booktitle    = {Proceedings {IEEE} {INFOCOM} 2003, The 22nd Annual Joint Conference
                  of the {IEEE} Computer and Communications Societies, San Franciso,
                  CA, USA, March 30 - April 3, 2003},
  pages        = {1095--1105},
  year         = {2003},
  crossref     = {DBLP:conf/infocom/2003},
  url          = {https://doi.org/10.1109/INFCOM.2003.1208946},
  doi          = {10.1109/INFCOM.2003.1208946},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/infocom/FuMT03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscc/ChanCC03,
  author       = {Alvin T. S. Chan and
                  C. K. Chan and
                  Jiannong Cao},
  title        = {Programming Distributed Web Services Using WebGOP: {A} Graph-Oriented
                  Approach},
  booktitle    = {Proceedings of the Eighth {IEEE} Symposium on Computers and Communications
                  {(ISCC} 2003), 30 June - 3 July 2003, Kiris-Kemer, Turkey},
  pages        = {413--418},
  year         = {2003},
  crossref     = {DBLP:conf/iscc/2003},
  url          = {https://doi.org/10.1109/ISCC.2003.1214154},
  doi          = {10.1109/ISCC.2003.1214154},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iscc/ChanCC03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/Chan03,
  author       = {Alvin T. S. Chan},
  title        = {Integrating Smart Card Access to Web-Based Medical Information System},
  booktitle    = {Proceedings of the 2003 {ACM} Symposium on Applied Computing (SAC),
                  March 9-12, 2003, Melbourne, FL, {USA}},
  pages        = {246--250},
  year         = {2003},
  crossref     = {DBLP:conf/sac/2003},
  url          = {https://doi.org/10.1145/952532.952583},
  doi          = {10.1145/952532.952583},
  timestamp    = {Tue, 06 Nov 2018 11:06:45 +0100},
  biburl       = {https://dblp.org/rec/conf/sac/Chan03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/ChanLCHLL03,
  author       = {Alvin T. S. Chan and
                  Hong Va Leong and
                  Joseph Chan and
                  Alan Hon and
                  Larry Lau and
                  Leo Li},
  title        = {Bluepoint: {A} Bluetooth-based Architecture for Location-Positioning
                  Services},
  booktitle    = {Proceedings of the 2003 {ACM} Symposium on Applied Computing (SAC),
                  March 9-12, 2003, Melbourne, FL, {USA}},
  pages        = {990--995},
  year         = {2003},
  crossref     = {DBLP:conf/sac/2003},
  url          = {https://doi.org/10.1145/952532.952727},
  doi          = {10.1145/952532.952727},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sac/ChanLCHLL03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/LeongC03,
  author       = {Hong Va Leong and
                  Alvin T. S. Chan},
  title        = {Mobile Computing and Applications Track Editorial},
  booktitle    = {Proceedings of the 2003 {ACM} Symposium on Applied Computing (SAC),
                  March 9-12, 2003, Melbourne, FL, {USA}},
  pages        = {853--854},
  year         = {2003},
  crossref     = {DBLP:conf/sac/2003},
  url          = {https://doi.org/10.1145/952532.952701},
  doi          = {10.1145/952532.952701},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sac/LeongC03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/seke/MaLCCZ03,
  author       = {Xiaoxing Ma and
                  Jian Lu and
                  Jiannong Cao and
                  Alvin T. S. Chan and
                  Kang Zhang},
  title        = {A Graph-Oriented Approach to the Description and Implementation of
                  Distributed and Dynamic Software Architecture},
  booktitle    = {Proceedings of the Fifteenth International Conference on Software
                  Engineering {\&} Knowledge Engineering (SEKE'2003), Hotel Sofitel,
                  San Francisco Bay, CA, USA, July 1-3, 2003},
  pages        = {518--525},
  year         = {2003},
  crossref     = {DBLP:conf/seke/2003},
  timestamp    = {Tue, 29 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/seke/MaLCCZ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/ChuangCCC03,
  author       = {Siu Nam Chuang and
                  Alvin T. S. Chan and
                  Jiannong Cao and
                  Ronnie Cheung},
  title        = {Dynamic service reconfiguration for wireless web access},
  booktitle    = {Proceedings of the Twelfth International World Wide Web Conference,
                  {WWW} 2003, Budapest, Hungary, May 20-24, 2003},
  pages        = {58--67},
  year         = {2003},
  crossref     = {DBLP:conf/www/2003},
  url          = {https://doi.org/10.1145/775152.775162},
  doi          = {10.1145/775152.775162},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/www/ChuangCCC03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/WongCL03,
  author       = {Eugene Y. C. Wong and
                  Alvin T. S. Chan and
                  Hong Va Leong},
  title        = {Xstream: {A} Framework for the Efficient Streaming of {XML} Documents
                  over a Wireless Environment},
  booktitle    = {Proceedings of the Twelfth International World Wide Web Conference
                  - Posters, {WWW} 2003, Budapest, Hungary, May 20-24, 2003},
  year         = {2003},
  crossref     = {DBLP:conf/www/2003p},
  url          = {http://www2003.org/cdrom/papers/poster/p317/p317-wong.html},
  timestamp    = {Wed, 17 Jul 2013 16:59:51 +0200},
  biburl       = {https://dblp.org/rec/conf/www/WongCL03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/MutchBMRR02,
  author       = {David M. Mutch and
                  Alvin Berger and
                  Robert Mansourian and
                  Andreas Rytz and
                  Matthew{-}Alan Roberts},
  title        = {The limit fold change model: {A} practical approach for selecting
                  differentially expressed genes from microarray data},
  journal      = {{BMC} Bioinform.},
  volume       = {3},
  pages        = {17},
  year         = {2002},
  url          = {https://doi.org/10.1186/1471-2105-3-17},
  doi          = {10.1186/1471-2105-3-17},
  timestamp    = {Sun, 15 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/bmcbi/MutchBMRR02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/internet/ChanTCL02,
  author       = {Alvin T. S. Chan and
                  Florine Tse and
                  Jiannong Cao and
                  Hong Va Leong},
  title        = {Enabling Distributed Corba Access to Smart Card Applications},
  journal      = {{IEEE} Internet Comput.},
  volume       = {6},
  number       = {3},
  pages        = {27--36},
  year         = {2002},
  url          = {https://doi.org/10.1109/MIC.2002.1003127},
  doi          = {10.1109/MIC.2002.1003127},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/internet/ChanTCL02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/LukLDCCA02,
  author       = {Robert W. P. Luk and
                  Hong Va Leong and
                  Tharam S. Dillon and
                  Alvin T. S. Chan and
                  W. Bruce Croft and
                  James Allan},
  title        = {A survey in indexing and searching {XML} documents},
  journal      = {J. Assoc. Inf. Sci. Technol.},
  volume       = {53},
  number       = {6},
  pages        = {415--437},
  year         = {2002},
  url          = {https://doi.org/10.1002/asi.10056},
  doi          = {10.1002/ASI.10056},
  timestamp    = {Mon, 02 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jasis/LukLDCCA02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpads/CaoCCW02,
  author       = {Jiannong Cao and
                  Min Cao and
                  Alvin T. S. Chan and
                  Gengfeng Wu},
  title        = {Architectural Level support for Dynamic Reconfiguration and Fault
                  Tolerance in Component-Based Distributed Software},
  booktitle    = {9th International Conference on Parallel and Distributed Systems,
                  {ICPADS} 2002, Taiwan, ROC, December 17-20, 2002},
  pages        = {251--256},
  year         = {2002},
  crossref     = {DBLP:conf/icpads/2002},
  url          = {https://doi.org/10.1109/ICPADS.2002.1183408},
  doi          = {10.1109/ICPADS.2002.1183408},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpads/CaoCCW02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/ChuangCC02,
  author       = {Siu Nam Chuang and
                  Alvin T. S. Chan and
                  Jiannong Cao},
  title        = {Dynamic Service Composition for Wireless Web Access},
  booktitle    = {31st International Conference on Parallel Processing {(ICPP} 2002),
                  20-23 August 2002, Vancouver, BC, Canada},
  pages        = {429--436},
  year         = {2002},
  crossref     = {DBLP:conf/icpp/2002},
  url          = {https://doi.org/10.1109/ICPP.2002.1040899},
  doi          = {10.1109/ICPP.2002.1040899},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpp/ChuangCC02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/MaCL02,
  author       = {Xiaoxing Ma and
                  Alvin T. S. Chan and
                  Jian Lu},
  title        = {WebGOP: {A} Framework for Architecting and Programming Dynamic Distributed
                  Web Applications},
  booktitle    = {31st International Conference on Parallel Processing {(ICPP} 2002),
                  20-23 August 2002, Vancouver, BC, Canada},
  pages        = {266--275},
  year         = {2002},
  crossref     = {DBLP:conf/icpp/2002},
  url          = {https://doi.org/10.1109/ICPP.2002.1040882},
  doi          = {10.1109/ICPP.2002.1040882},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpp/MaCL02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwl/CaoCCY02,
  author       = {Jiannong Cao and
                  Alvin T. S. Chan and
                  Weidong Cao and
                  Cassidy Yeung},
  title        = {Virtual Programming Lab for Online Distance Learning},
  booktitle    = {Advances in Web-Based Learning, First International Conference, {ICWL}
                  2002, Hong Kong, China, August 17-19, 2002, Proceedings},
  pages        = {216--227},
  year         = {2002},
  crossref     = {DBLP:conf/icwl/2002},
  url          = {https://doi.org/10.1007/3-540-45689-9\_18},
  doi          = {10.1007/3-540-45689-9\_18},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icwl/CaoCCY02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/CaoLC02,
  author       = {Jiannong Cao and
                  Patrick Leung and
                  Alvin T. S. Chan},
  title        = {A Scalable and Reliable Multicast Communiction Service in Java},
  booktitle    = {16th International Parallel and Distributed Processing Symposium {(IPDPS}
                  2002), 15-19 April 2002, Fort Lauderdale, FL, USA, CD-ROM/Abstracts
                  Proceedings},
  year         = {2002},
  crossref     = {DBLP:conf/ipps/2002},
  url          = {https://doi.org/10.1109/IPDPS.2002.1016501},
  doi          = {10.1109/IPDPS.2002.1016501},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ipps/CaoLC02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nnsp/ChangS02,
  author       = {Wei{-}Chen Chang and
                  Alvin Wen{-}Yu Su},
  title        = {A multi-channel recurrent network for synthesizing struck coupled-string
                  musical instruments},
  booktitle    = {Proceedings of the 12th {IEEE} Workshop on Neural Networks for Signal
                  Processing, {NNSP} 2002, Martigny, Valais, Switzerland, September
                  4-6, 2002},
  pages        = {677--686},
  year         = {2002},
  crossref     = {DBLP:conf/nnsp/2002},
  url          = {https://doi.org/10.1109/NNSP.2002.1030079},
  doi          = {10.1109/NNSP.2002.1030079},
  timestamp    = {Wed, 16 Oct 2019 14:14:54 +0200},
  biburl       = {https://dblp.org/rec/conf/nnsp/ChangS02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/MakLC02,
  author       = {Jess Y. S. Mak and
                  Hong Va Leong and
                  Alvin T. S. Chan},
  title        = {Dynamic structuring of web information for access visualization},
  booktitle    = {Proceedings of the 2002 {ACM} Symposium on Applied Computing (SAC),
                  March 10-14, 2002, Madrid, Spain},
  pages        = {778--784},
  year         = {2002},
  crossref     = {DBLP:conf/sac/2002},
  url          = {https://doi.org/10.1145/508791.508942},
  doi          = {10.1145/508791.508942},
  timestamp    = {Tue, 06 Nov 2018 11:06:47 +0100},
  biburl       = {https://dblp.org/rec/conf/sac/MakLC02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/ChuangCC02,
  author       = {Siu{-}Nam Chuang and
                  Alvin T. S. Chan and
                  Jiannong Cao},
  title        = {An active service framework supporting wireless Web access},
  booktitle    = {2002 {IEEE} Wireless Communications and Networking Conference Record,
                  {WCNC} 2002, Orlando, Florida, USA, MArch 17-21, 2002},
  pages        = {630--634},
  year         = {2002},
  crossref     = {DBLP:conf/wcnc/2002},
  url          = {https://doi.org/10.1109/WCNC.2002.993341},
  doi          = {10.1109/WCNC.2002.993341},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wcnc/ChuangCC02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ChanCCY01,
  author       = {Alvin T. S. Chan and
                  Jiannong Cao and
                  Henry C. B. Chan and
                  Gilbert H. Young},
  title        = {A web-enabled framework for smart card applications in health services},
  journal      = {Commun. {ACM}},
  volume       = {44},
  number       = {9},
  pages        = {76--82},
  year         = {2001},
  url          = {https://doi.org/10.1145/383694.383710},
  doi          = {10.1145/383694.383710},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cacm/ChanCCY01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cera/ChanLNC01,
  author       = {Stephen C. F. Chan and
                  Paul S. H. Lee and
                  Vincent T. Y. Ng and
                  Alvin T. S. Chan},
  title        = {Synchronous Collaborative Development of {UML} Models on the Internet},
  journal      = {Concurr. Eng. Res. Appl.},
  volume       = {9},
  number       = {2},
  pages        = {111--119},
  year         = {2001},
  url          = {https://doi.org/10.1177/1063293X0100900204},
  doi          = {10.1177/1063293X0100900204},
  timestamp    = {Thu, 18 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cera/ChanLNC01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/join/CaoCC01,
  author       = {Jiannong Cao and
                  Nick K. C. Cheung and
                  Alvin T. S. Chan},
  title        = {{JDM:} Building Distributed Synchronization Support into Java},
  journal      = {J. Interconnect. Networks},
  volume       = {2},
  number       = {3},
  pages        = {269--282},
  year         = {2001},
  url          = {https://doi.org/10.1142/S0219265901000373},
  doi          = {10.1142/S0219265901000373},
  timestamp    = {Fri, 05 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/join/CaoCC01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/doa/ChanTCL01,
  author       = {Alvin T. S. Chan and
                  Florine Tse and
                  Jiannong Cao and
                  Hong Va Leong},
  title        = {Distributed Object Programming Environment for Smart Card Application
                  Development},
  booktitle    = {3rd International Symposium on Distributed Objects and Applications,
                  {DOA} 2001, Rome, Italy, September 17-20, 2001},
  pages        = {251--259},
  year         = {2001},
  crossref     = {DBLP:conf/doa/2001},
  url          = {https://doi.org/10.1109/DOA.2001.954090},
  doi          = {10.1109/DOA.2001.954090},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/doa/ChanTCL01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsn/CaoCC01,
  author       = {Jiannong Cao and
                  Nick K. C. Cheung and
                  Alvin T. S. Chan},
  title        = {Run-Time Fault Detection in Monitor Based Concurrent Programming},
  booktitle    = {2001 International Conference on Dependable Systems and Networks {(DSN}
                  2001) (formerly: FTCS), 1-4 July 2001, G{\"{o}}teborg, Sweden,
                  Proceedings},
  pages        = {357--368},
  year         = {2001},
  crossref     = {DBLP:conf/dsn/2001},
  url          = {https://doi.org/10.1109/DSN.2001.941420},
  doi          = {10.1109/DSN.2001.941420},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dsn/CaoCC01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/ChanCC01,
  author       = {Alvin T. S. Chan and
                  Steven Y. C. Chan and
                  Jiannong Cao},
  title        = {{SAC:} {A} Self-Paced and Adaptive Courseware System},
  booktitle    = {Proceedings {IEEE} International Conference on Advanced Learning Technology:
                  Issues, Achievements and Challenges, Madison, WI, USA, August 6-8,
                  2001},
  pages        = {78--81},
  year         = {2001},
  crossref     = {DBLP:conf/icalt/2001},
  url          = {https://doi.org/10.1109/ICALT.2001.943860},
  doi          = {10.1109/ICALT.2001.943860},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icalt/ChanCC01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icppw/CaoCW01,
  author       = {Jiannong Cao and
                  Alvin T. S. Chan and
                  Jie Wu},
  title        = {Achieving Replication Consistency Using Cooperating Mobile Agents},
  booktitle    = {30th International Workshops on Parallel Processing {(ICPP} 2001 Workshops),
                  3-7 September 2001, Valencia, Spain},
  pages        = {453--458},
  year         = {2001},
  crossref     = {DBLP:conf/icppw/2001},
  url          = {https://doi.org/10.1109/ICPPW.2001.951986},
  doi          = {10.1109/ICPPW.2001.951986},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icppw/CaoCW01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/CheungCC01,
  author       = {Nick K. C. Cheung and
                  Jiannong Cao and
                  Alvin T. S. Chan},
  title        = {Analysis and Evaluation of a Distributed Monitor Construct in Java},
  booktitle    = {Proceedings of the 15th International Parallel {\&} Distributed
                  Processing Symposium (IPDPS-01), San Francisco, CA, USA, April 23-27,
                  2001},
  pages        = {108},
  year         = {2001},
  crossref     = {DBLP:conf/ipps/2001},
  url          = {https://doi.org/10.1109/IPDPS.2001.925078},
  doi          = {10.1109/IPDPS.2001.925078},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ipps/CheungCC01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mdm/ChanHCC01,
  author       = {Alvin T. S. Chan and
                  Dan He and
                  Siu Nam Chuang and
                  Jiannong Cao},
  title        = {Towards a Programmable Mobile {IP}},
  booktitle    = {Mobile Data Management, Second International Conference, {MDM} 2001,
                  Hong Kong, China, January 8-10, 2001, Proceedings},
  pages        = {210--221},
  year         = {2001},
  crossref     = {DBLP:conf/mdm/2001},
  url          = {https://doi.org/10.1007/3-540-44498-X\_17},
  doi          = {10.1007/3-540-44498-X\_17},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/mdm/ChanHCC01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/Chan00,
  author       = {Alvin T. S. Chan},
  title        = {WWW+smart card: towards a mobile health care management system},
  journal      = {Int. J. Medical Informatics},
  volume       = {57},
  number       = {2-3},
  pages        = {127--137},
  year         = {2000},
  url          = {https://doi.org/10.1016/S1386-5056(00)00061-7},
  doi          = {10.1016/S1386-5056(00)00061-7},
  timestamp    = {Fri, 21 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijmi/Chan00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cifer/Kuruc00,
  author       = {Alvin Kuruc},
  title        = {Apples to oranges: reconciling "vegas" from inconsistent valuation
                  models by a stochastic change of coordinates},
  booktitle    = {Proceedings of the {IEEE/IAFE/INFORMS} 2000 Conference on Computational
                  Intelligence for Financial Engineering, CIFEr 2000, New York City,
                  USA, March 28, 2000},
  pages        = {143--146},
  year         = {2000},
  crossref     = {DBLP:conf/cifer/2000},
  url          = {https://doi.org/10.1109/CIFER.2000.844612},
  doi          = {10.1109/CIFER.2000.844612},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/cifer/Kuruc00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/Chan99,
  author       = {Alvin T. S. Chan},
  title        = {Web-Enabled Smart Card for Ubiquitous Access of Patient's Medical
                  Record},
  journal      = {Comput. Networks},
  volume       = {31},
  number       = {11-16},
  pages        = {1591--1598},
  year         = {1999},
  url          = {https://doi.org/10.1016/S1389-1286(99)00056-0},
  doi          = {10.1016/S1389-1286(99)00056-0},
  timestamp    = {Wed, 19 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cn/Chan99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/GarciaM99,
  author       = {Alvin Garcia and
                  Richard J. Mammone},
  title        = {Channel-robust speaker identification using modified-mean cepstral
                  mean normalization with frequency warping},
  booktitle    = {Proceedings of the 1999 {IEEE} International Conference on Acoustics,
                  Speech, and Signal Processing, {ICASSP} '99, Phoenix, Arizona, USA,
                  March 15-19, 1999},
  pages        = {325--328},
  year         = {1999},
  crossref     = {DBLP:conf/icassp/1999},
  url          = {https://doi.org/10.1109/ICASSP.1999.758128},
  doi          = {10.1109/ICASSP.1999.758128},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icassp/GarciaM99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/PrzybockiM99,
  author       = {Mark A. Przybocki and
                  Alvin F. Martin},
  title        = {The 1999 {NIST} speaker recognition evaluation, using summed two-channel
                  telephone data for speaker detection and speaker tracking},
  booktitle    = {Sixth European Conference on Speech Communication and Technology,
                  {EUROSPEECH} 1999, Budapest, Hungary, September 5-9, 1999},
  pages        = {2215--2218},
  year         = {1999},
  crossref     = {DBLP:conf/interspeech/1999},
  url          = {https://doi.org/10.21437/Eurospeech.1999-558},
  doi          = {10.21437/EUROSPEECH.1999-558},
  timestamp    = {Wed, 18 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/interspeech/PrzybockiM99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/ChanC99,
  author       = {Alvin T. S. Chan and
                  Jiannong Cao},
  title        = {{PANTA:} {A} graph-oriented programmable active network transport
                  architecture},
  booktitle    = {1999 {IEEE} Wireless Communications and Networking Conference, {WCNC}
                  1999, September 21-24, 1999, New Orleans, Louisiana, {USA}},
  pages        = {1293--1297},
  year         = {1999},
  crossref     = {DBLP:conf/wcnc/1999},
  url          = {https://doi.org/10.1109/WCNC.1999.796946},
  doi          = {10.1109/WCNC.1999.796946},
  timestamp    = {Tue, 14 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wcnc/ChanC99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/McLellanRFCS98,
  author       = {Samuel G. McLellan and
                  Alvin W. Roesler and
                  Zongming Fei and
                  Savita Chandran and
                  Clay Spinuzzi},
  title        = {Experience Using Web-Based Shotgun Measures for Large-System Characterization
                  and Improvement},
  journal      = {{IEEE} Trans. Software Eng.},
  volume       = {24},
  number       = {4},
  pages        = {268--277},
  year         = {1998},
  url          = {https://doi.org/10.1109/32.677184},
  doi          = {10.1109/32.677184},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tse/McLellanRFCS98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/WoodCFHLLLMPR93,
  author       = {David A. Wood and
                  Satish Chandra and
                  Babak Falsafi and
                  Mark D. Hill and
                  James R. Larus and
                  Alvin R. Lebeck and
                  James C. Lewis and
                  Shubhendu S. Mukherjee and
                  Subbarao Palacharla and
                  Steven K. Reinhardt},
  title        = {Mechanisms for Cooperative Shared Memory},
  booktitle    = {Proceedings of the 20th Annual International Symposium on Computer
                  Architecture, San Diego, CA, USA, May 1993},
  pages        = {156--167},
  year         = {1993},
  crossref     = {DBLP:conf/isca/1993},
  url          = {https://doi.org/10.1145/165123.165151},
  doi          = {10.1145/165123.165151},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/isca/WoodCFHLLLMPR93.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compcon/DespainPDCC86,
  author       = {Alvin M. Despain and
                  Yale N. Patt and
                  Tep P. Dobry and
                  Jung{-}Herng Chang and
                  Wayne Citrin},
  title        = {High Performance Prolog, The Multiplicative Effect of Several Levels
                  of Implementation},
  booktitle    = {Spring COMPCON'86, Digest of Papers, Thirty-First {IEEE} Computer
                  Society International Conference, San Francisco, California, USA,
                  March 3-6, 1986},
  pages        = {178--185},
  year         = {1986},
  crossref     = {DBLP:conf/compcon/1986},
  timestamp    = {Wed, 28 Jun 2006 09:47:20 +0200},
  biburl       = {https://dblp.org/rec/conf/compcon/DespainPDCC86.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compcon/ChangDD85,
  author       = {Jung{-}Herng Chang and
                  Alvin M. Despain and
                  Doug DeGroot},
  title        = {AND-Parallelism of Logic Programs Based on a Static Data Dependency
                  Analysis},
  booktitle    = {Spring COMPCON'85, Digest of Papers, Thirtieth {IEEE} Computer Society
                  International Conference, San Francisco, California, USA, February
                  25-28, 1985},
  pages        = {218--226},
  year         = {1985},
  crossref     = {DBLP:conf/compcon/1985},
  timestamp    = {Wed, 28 Jun 2006 12:59:39 +0200},
  biburl       = {https://dblp.org/rec/conf/compcon/ChangDD85.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/slp/ChangD85,
  author       = {Jung{-}Herng Chang and
                  Alvin M. Despain},
  title        = {Semi-Intelligent Backtracking of Prolog Based on Static Data Dependency
                  Analysis},
  booktitle    = {Proceedings of the 1985 Symposium on Logic Programming, Boston, Massachusetts,
                  USA, July 15-18, 1985},
  pages        = {10--21},
  year         = {1985},
  crossref     = {DBLP:conf/slp/1985},
  timestamp    = {Wed, 04 Dec 2013 14:42:59 +0100},
  biburl       = {https://dblp.org/rec/conf/slp/ChangD85.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mss/RothM82,
  author       = {Alvin E. Roth and
                  Michael W. K. Malouf},
  title        = {Scale changes and shared information in bargaining: An experimental
                  study},
  journal      = {Math. Soc. Sci.},
  volume       = {3},
  number       = {2},
  pages        = {157--177},
  year         = {1982},
  url          = {https://doi.org/10.1016/0165-4896(82)90054-3},
  doi          = {10.1016/0165-4896(82)90054-3},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/mss/RothM82.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cec/2024,
  title        = {{IEEE} Congress on Evolutionary Computation, {CEC} 2024, Yokohama,
                  Japan, June 30 - July 5, 2024},
  publisher    = {{IEEE}},
  year         = {2024},
  url          = {https://doi.org/10.1109/CEC60901.2024},
  doi          = {10.1109/CEC60901.2024},
  isbn         = {979-8-3503-0836-5},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/cec/2024.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ispd/2024,
  editor       = {Iris Hui{-}Ru Jiang and
                  Gracieli Posser},
  title        = {Proceedings of the 2024 International Symposium on Physical Design,
                  {ISPD} 2024, Taipei, Taiwan, March 12-15, 2024},
  publisher    = {{ACM}},
  year         = {2024},
  url          = {https://doi.org/10.1145/3626184},
  doi          = {10.1145/3626184},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/ispd/2024.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/csedu/2023-2,
  editor       = {Jelena Jovanovic and
                  Irene{-}Angelica Chounta and
                  James Uhomoibhi and
                  Bruce M. McLaren},
  title        = {Proceedings of the 15th International Conference on Computer Supported
                  Education, {CSEDU} 2023, Prague, Czech Republic, April 21-23, 2023,
                  Volume 2},
  publisher    = {{SCITEPRESS}},
  year         = {2023},
  url          = {https://www.scitepress.org/ProceedingsDetails.aspx?ID=o8Aty+lZ2xk=},
  isbn         = {978-989-758-641-5},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/csedu/2023-2.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icml/2023,
  editor       = {Andreas Krause and
                  Emma Brunskill and
                  Kyunghyun Cho and
                  Barbara Engelhardt and
                  Sivan Sabato and
                  Jonathan Scarlett},
  title        = {International Conference on Machine Learning, {ICML} 2023, 23-29 July
                  2023, Honolulu, Hawaii, {USA}},
  series       = {Proceedings of Machine Learning Research},
  volume       = {202},
  publisher    = {{PMLR}},
  year         = {2023},
  url          = {http://proceedings.mlr.press/v202/},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/icml/2023.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icra/2023,
  title        = {{IEEE} International Conference on Robotics and Automation, {ICRA}
                  2023, London, UK, May 29 - June 2, 2023},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/ICRA48891.2023},
  doi          = {10.1109/ICRA48891.2023},
  isbn         = {979-8-3503-2365-8},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/icra/2023.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/vr/2023w,
  title        = {{IEEE} Conference on Virtual Reality and 3D User Interfaces Abstracts
                  and Workshops, {VR} Workshops 2023, Shanghai, China, March 25-29,
                  2023},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/VRW58643.2023},
  doi          = {10.1109/VRW58643.2023},
  isbn         = {979-8-3503-4839-2},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/vr/2023w.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/embc/2022,
  title        = {44th Annual International Conference of the {IEEE} Engineering in
                  Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland,
                  United Kingdom, July 11-15, 2022},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/EMBC48229.2022},
  doi          = {10.1109/EMBC48229.2022},
  isbn         = {978-1-7281-2782-8},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/embc/2022.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/igarss/2022,
  title        = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
                  2022, Kuala Lumpur, Malaysia, July 17-22, 2022},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/IGARSS46834.2022},
  doi          = {10.1109/IGARSS46834.2022},
  isbn         = {978-1-6654-2792-0},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/igarss/2022.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ijcai/2022,
  editor       = {Luc De Raedt},
  title        = {Proceedings of the Thirty-First International Joint Conference on
                  Artificial Intelligence, {IJCAI} 2022, Vienna, Austria, 23-29 July
                  2022},
  publisher    = {ijcai.org},
  year         = {2022},
  url          = {https://www.ijcai.org/proceedings/2022/},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/ijcai/2022.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ijcnn/2022,
  title        = {International Joint Conference on Neural Networks, {IJCNN} 2022, Padua,
                  Italy, July 18-23, 2022},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/IJCNN55064.2022},
  doi          = {10.1109/IJCNN55064.2022},
  isbn         = {978-1-7281-8671-9},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/ijcnn/2022.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ismar/2022a,
  title        = {2022 {IEEE} International Symposium on Mixed and Augmented Reality
                  Adjunct (ISMAR-Adjunct), Singapore, Singapore, October 17-21, 2022},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/ISMAR-Adjunct57072.2022},
  doi          = {10.1109/ISMAR-ADJUNCT57072.2022},
  isbn         = {978-1-6654-5365-3},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/ismar/2022a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/acl/2021-2,
  editor       = {Chengqing Zong and
                  Fei Xia and
                  Wenjie Li and
                  Roberto Navigli},
  title        = {Proceedings of the 59th Annual Meeting of the Association for Computational
                  Linguistics and the 11th International Joint Conference on Natural
                  Language Processing, {ACL/IJCNLP} 2021, (Volume 2: Short Papers),
                  Virtual Event, August 1-6, 2021},
  publisher    = {Association for Computational Linguistics},
  year         = {2021},
  url          = {https://aclanthology.org/volumes/2021.acl-short/},
  isbn         = {978-1-954085-53-4},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/acl/2021-2.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/chil/2021,
  editor       = {Marzyeh Ghassemi and
                  Tristan Naumann and
                  Emma Pierson},
  title        = {{ACM} {CHIL} '21: {ACM} Conference on Health, Inference, and Learning,
                  Virtual Event, USA, April 8-9, 2021},
  publisher    = {{ACM}},
  year         = {2021},
  url          = {https://doi.org/10.1145/3450439},
  doi          = {10.1145/3450439},
  isbn         = {978-1-4503-8359-2},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/chil/2021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/globecom/2021,
  title        = {{IEEE} Global Communications Conference, {GLOBECOM} 2021, Madrid,
                  Spain, December 7-11, 2021},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/GLOBECOM46510.2021},
  doi          = {10.1109/GLOBECOM46510.2021},
  isbn         = {978-1-7281-8104-2},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/globecom/2021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iclr/2021,
  title        = {9th International Conference on Learning Representations, {ICLR} 2021,
                  Virtual Event, Austria, May 3-7, 2021},
  publisher    = {OpenReview.net},
  year         = {2021},
  url          = {https://openreview.net/group?id=ICLR.cc/2021/Conference},
  timestamp    = {Thu, 10 Oct 2024 19:37:07 +0200},
  biburl       = {https://dblp.org/rec/conf/iclr/2021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/nips/2021,
  editor       = {Marc'Aurelio Ranzato and
                  Alina Beygelzimer and
                  Yann N. Dauphin and
                  Percy Liang and
                  Jennifer Wortman Vaughan},
  title        = {Advances in Neural Information Processing Systems 34: Annual Conference
                  on Neural Information Processing Systems 2021, NeurIPS 2021, December
                  6-14, 2021, virtual},
  year         = {2021},
  url          = {https://proceedings.neurips.cc/paper/2021},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/nips/2021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/acl/2020,
  editor       = {Dan Jurafsky and
                  Joyce Chai and
                  Natalie Schluter and
                  Joel R. Tetreault},
  title        = {Proceedings of the 58th Annual Meeting of the Association for Computational
                  Linguistics, {ACL} 2020, Online, July 5-10, 2020},
  publisher    = {Association for Computational Linguistics},
  year         = {2020},
  url          = {https://aclanthology.org/volumes/2020.acl-main/},
  isbn         = {978-1-952148-25-5},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/acl/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cvpr/2020,
  title        = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2020, Seattle, WA, USA, June 13-19, 2020},
  publisher    = {Computer Vision Foundation / {IEEE}},
  year         = {2020},
  url          = {https://openaccess.thecvf.com/CVPR2020},
  isbn         = {978-1-7281-7168-5},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/emnlp/2020f,
  editor       = {Trevor Cohn and
                  Yulan He and
                  Yang Liu},
  title        = {Findings of the Association for Computational Linguistics: {EMNLP}
                  2020, Online Event, 16-20 November 2020},
  series       = {Findings of {ACL}},
  volume       = {{EMNLP} 2020},
  publisher    = {Association for Computational Linguistics},
  year         = {2020},
  url          = {https://aclanthology.org/volumes/2020.findings-emnlp/},
  isbn         = {978-1-952148-90-3},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/emnlp/2020f.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/hicss/2020,
  title        = {53rd Hawaii International Conference on System Sciences, {HICSS} 2020,
                  Maui, Hawaii, USA, January 7-10, 2020},
  publisher    = {ScholarSpace},
  year         = {2020},
  url          = {https://scholarspace.manoa.hawaii.edu/handle/10125/63576},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/hicss/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iclr/2020,
  title        = {8th International Conference on Learning Representations, {ICLR} 2020,
                  Addis Ababa, Ethiopia, April 26-30, 2020},
  publisher    = {OpenReview.net},
  year         = {2020},
  url          = {https://openreview.net/group?id=ICLR.cc/2020/Conference},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/iclr/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/miccai/2020dart,
  editor       = {Shadi Albarqouni and
                  Spyridon Bakas and
                  Konstantinos Kamnitsas and
                  M. Jorge Cardoso and
                  Bennett A. Landman and
                  Wenqi Li and
                  Fausto Milletari and
                  Nicola Rieke and
                  Holger Roth and
                  Daguang Xu and
                  Ziyue Xu},
  title        = {Domain Adaptation and Representation Transfer, and Distributed and
                  Collaborative Learning - Second {MICCAI} Workshop, {DART} 2020, and
                  First {MICCAI} Workshop, {DCL} 2020, Held in Conjunction with {MICCAI}
                  2020, Lima, Peru, October 4-8, 2020, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {12444},
  publisher    = {Springer},
  year         = {2020},
  url          = {https://doi.org/10.1007/978-3-030-60548-3},
  doi          = {10.1007/978-3-030-60548-3},
  isbn         = {978-3-030-60547-6},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/miccai/2020dart.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/miccai/2020-2,
  editor       = {Anne L. Martel and
                  Purang Abolmaesumi and
                  Danail Stoyanov and
                  Diana Mateus and
                  Maria A. Zuluaga and
                  S. Kevin Zhou and
                  Daniel Racoceanu and
                  Leo Joskowicz},
  title        = {Medical Image Computing and Computer Assisted Intervention - {MICCAI}
                  2020 - 23rd International Conference, Lima, Peru, October 4-8, 2020,
                  Proceedings, Part {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {12262},
  publisher    = {Springer},
  year         = {2020},
  url          = {https://doi.org/10.1007/978-3-030-59713-9},
  doi          = {10.1007/978-3-030-59713-9},
  isbn         = {978-3-030-59712-2},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/miccai/2020-2.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/vlsic/2020,
  title        = {{IEEE} Symposium on {VLSI} Circuits, {VLSI} Circuits 2020, Honolulu,
                  HI, USA, June 16-19, 2020},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9146894/proceeding},
  isbn         = {978-1-7281-9942-9},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/vlsic/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cascon/2019,
  editor       = {Tima Pakfetrat and
                  Guy{-}Vincent Jourdan and
                  Kostas Kontogiannis and
                  Robert F. Enenkel},
  title        = {Proceedings of the 29th Annual International Conference on Computer
                  Science and Software Engineering, {CASCON} 2019, Markham, Ontario,
                  Canada, November 4-6, 2019},
  publisher    = {{ACM}},
  year         = {2019},
  url          = {https://dl.acm.org/doi/10.5555/3370272},
  doi          = {10.5555/3370272},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/cascon/2019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/emo/2019,
  editor       = {Kalyanmoy Deb and
                  Erik D. Goodman and
                  Carlos A. Coello Coello and
                  Kathrin Klamroth and
                  Kaisa Miettinen and
                  Sanaz Mostaghim and
                  Patrick M. Reed},
  title        = {Evolutionary Multi-Criterion Optimization - 10th International Conference,
                  {EMO} 2019, East Lansing, MI, USA, March 10-13, 2019, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {11411},
  publisher    = {Springer},
  year         = {2019},
  url          = {https://doi.org/10.1007/978-3-030-12598-1},
  doi          = {10.1007/978-3-030-12598-1},
  isbn         = {978-3-030-12597-4},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/emo/2019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iccsci/2019,
  editor       = {Widodo Budiharto},
  title        = {Enabling Collaboration to Escalate Impact of Research Results for
                  Society: The 4th International Conference on Computer Science and
                  Computational Intelligence, {ICCSCI} 2019, 12-13 September 2019, Yogyakarta,
                  Indonesia},
  series       = {Procedia Computer Science},
  volume       = {157},
  publisher    = {Elsevier},
  year         = {2019},
  url          = {https://www.sciencedirect.com/science/journal/18770509/157},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/iccsci/2019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/tale/2019,
  title        = {{IEEE} International Conference on Engineering, Technology and Education,
                  {TALE} 2019, Yogyakarta, Indonesia, December 10-13, 2019},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9220968/proceeding},
  isbn         = {978-1-7281-2665-4},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/tale/2019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ijcai/2018aih,
  editor       = {Isabelle Bichindaritz and
                  Christian Guttmann and
                  Pau Herrero and
                  Fernando Koch and
                  Andrew Koster and
                  Richard Lenz and
                  Beatriz L{\'{o}}pez Ib{\'{a}}{\~{n}}ez and
                  Cindy Marling and
                  Clare Martin and
                  Sara Montagna and
                  Stefania Montani and
                  Manfred Reichert and
                  David Ria{\~{n}}o and
                  Michael Ignaz Schumacher and
                  Annette ten Teije and
                  Nirmalie Wiratunga},
  title        = {Proceedings of the First Joint Workshop on {AI} in Health organized
                  as part of the Federated {AI} Meeting {(FAIM} 2018), co-located with
                  {AAMAS} 2018, {ICML} 2018, {IJCAI} 2018 and {ICCBR} 2018, Stockholm,
                  Sweden, July 13-14, 2018},
  series       = {{CEUR} Workshop Proceedings},
  volume       = {2142},
  publisher    = {CEUR-WS.org},
  year         = {2018},
  url          = {https://ceur-ws.org/Vol-2142},
  urn          = {urn:nbn:de:0074-2142-7},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/ijcai/2018aih.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ijcai/2018aih-s,
  editor       = {Fernando Koch and
                  Andrew Koster and
                  David Ria{\~{n}}o and
                  Sara Montagna and
                  Michael Schumacher and
                  Annette ten Teije and
                  Christian Guttmann and
                  Manfred Reichert and
                  Isabelle Bichindaritz and
                  Pau Herrero and
                  Richard Lenz and
                  Beatriz L{\'{o}}pez and
                  Cindy Marling and
                  Clare Martin and
                  Stefania Montani and
                  Nirmalie Wiratunga},
  title        = {Artificial Intelligence in Health - First International Workshop,
                  AIH@IJCAI 2018, Stockholm, Sweden, July 13-14, 2018, Revised Selected
                  Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {11326},
  publisher    = {Springer},
  year         = {2019},
  url          = {https://doi.org/10.1007/978-3-030-12738-1},
  doi          = {10.1007/978-3-030-12738-1},
  isbn         = {978-3-030-12737-4},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/ijcai/2018aih-s.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/intcompsymp/2018,
  editor       = {Chuan{-}Yu Chang and
                  Chien{-}Chou Lin and
                  Horng{-}Horng Lin},
  title        = {New Trends in Computer Technologies and Applications - 23rd International
                  Computer Symposium, {ICS} 2018, Yunlin, Taiwan, December 20-22, 2018,
                  Revised Selected Papers},
  series       = {Communications in Computer and Information Science},
  volume       = {1013},
  publisher    = {Springer},
  year         = {2019},
  url          = {https://doi.org/10.1007/978-981-13-9190-3},
  doi          = {10.1007/978-981-13-9190-3},
  isbn         = {978-981-13-9189-7},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/intcompsymp/2018.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/chi/2017a,
  editor       = {Gloria Mark and
                  Susan R. Fussell and
                  Cliff Lampe and
                  m. c. schraefel and
                  Juan Pablo Hourcade and
                  Caroline Appert and
                  Daniel Wigdor},
  title        = {Proceedings of the 2017 {CHI} Conference on Human Factors in Computing
                  Systems, Denver, CO, USA, May 06-11, 2017, Extended Abstracts},
  publisher    = {{ACM}},
  year         = {2017},
  url          = {https://doi.org/10.1145/3027063},
  doi          = {10.1145/3027063},
  isbn         = {978-1-4503-4656-6},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/chi/2017a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iccad/2017,
  editor       = {Sri Parameswaran},
  title        = {2017 {IEEE/ACM} International Conference on Computer-Aided Design,
                  {ICCAD} 2017, Irvine, CA, USA, November 13-16, 2017},
  publisher    = {{IEEE}},
  year         = {2017},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8167715/proceeding},
  isbn         = {978-1-5386-3093-8},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/iccad/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iccsce/2017,
  title        = {7th {IEEE} International Conference on Control System, Computing and
                  Engineering, {ICCSCE} 2017, Penang, Malaysia, November 24-26, 2017},
  publisher    = {{IEEE}},
  year         = {2017},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8275422/proceeding},
  isbn         = {978-1-5386-3897-2},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/iccsce/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iiaiaai/2016,
  title        = {5th {IIAI} International Congress on Advanced Applied Informatics,
                  {IIAI-AAI} 2016, Kumamoto, Japan, July 10-14, 2016},
  publisher    = {{IEEE} Computer Society},
  year         = {2016},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7557346/proceeding},
  isbn         = {978-1-4673-8985-3},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/iiaiaai/2016.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/qtna/2016,
  editor       = {Winston Seah and
                  Yutaka Takahashi},
  title        = {Proceedings of the 11th International Conference on Queueing Theory
                  and Network Applications, {QTNA} 2016, Wellington, New Zealand, December
                  13-15, 2016},
  publisher    = {{ACM}},
  year         = {2016},
  url          = {https://doi.org/10.1145/3016032},
  doi          = {10.1145/3016032},
  isbn         = {978-1-4503-4842-3},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/qtna/2016.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sigcomm/2016,
  editor       = {Marinho P. Barcellos and
                  Jon Crowcroft and
                  Amin Vahdat and
                  Sachin Katti},
  title        = {Proceedings of the {ACM} {SIGCOMM} 2016 Conference, Florianopolis,
                  Brazil, August 22-26, 2016},
  publisher    = {{ACM}},
  year         = {2016},
  url          = {https://doi.org/10.1145/2934872},
  doi          = {10.1145/2934872},
  isbn         = {978-1-4503-4193-6},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/sigcomm/2016.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/amcis/2015,
  title        = {21st Americas Conference on Information Systems, {AMCIS} 2015, Puerto
                  Rico, August 13-15, 2015},
  publisher    = {Association for Information Systems},
  year         = {2015},
  url          = {http://aisel.aisnet.org/amcis2015/},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/amcis/2015.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/compsac/2015,
  editor       = {Sheikh Iqbal Ahamed and
                  Carl K. Chang and
                  William C. Chu and
                  Ivica Crnkovic and
                  Pao{-}Ann Hsiung and
                  Gang Huang and
                  Jingwei Yang},
  title        = {39th {IEEE} Annual Computer Software and Applications Conference,
                  {COMPSAC} 2015, Taichung, Taiwan, July 1-5, 2015. Volume 2},
  publisher    = {{IEEE} Computer Society},
  year         = {2015},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7271781/proceeding},
  isbn         = {978-1-4673-6563-5},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/compsac/2015.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icc/2015,
  title        = {2015 {IEEE} International Conference on Communications, {ICC} 2015,
                  London, United Kingdom, June 8-12, 2015},
  publisher    = {{IEEE}},
  year         = {2015},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7225357/proceeding},
  isbn         = {978-1-4673-6432-4},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icc/2015.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sac/2015,
  editor       = {Roger L. Wainwright and
                  Juan Manuel Corchado and
                  Alessio Bechini and
                  Jiman Hong},
  title        = {Proceedings of the 30th Annual {ACM} Symposium on Applied Computing,
                  Salamanca, Spain, April 13-17, 2015},
  publisher    = {{ACM}},
  year         = {2015},
  url          = {http://dl.acm.org/citation.cfm?id=2695664},
  isbn         = {978-1-4503-3196-8},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/sac/2015.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/dsn/2014,
  title        = {44th Annual {IEEE/IFIP} International Conference on Dependable Systems
                  and Networks, {DSN} 2014, Atlanta, GA, USA, June 23-26, 2014},
  publisher    = {{IEEE} Computer Society},
  year         = {2014},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6900116/proceeding},
  isbn         = {978-1-4799-2233-8},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/dsn/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ismir/2014,
  editor       = {Hsin{-}Min Wang and
                  Yi{-}Hsuan Yang and
                  Jin Ha Lee},
  title        = {Proceedings of the 15th International Society for Music Information
                  Retrieval Conference, {ISMIR} 2014, Taipei, Taiwan, October 27-31,
                  2014},
  year         = {2014},
  url          = {http://www.terasoft.com.tw/conf/ismir2014/},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/ismir/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/isscc/2014,
  title        = {2014 {IEEE} International Conference on Solid-State Circuits Conference,
                  {ISSCC} 2014, Digest of Technical Papers, San Francisco, CA, USA,
                  February 9-13, 2014},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6747109/proceeding},
  isbn         = {978-1-4799-0918-6},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/isscc/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/mm/2014,
  editor       = {Kien A. Hua and
                  Yong Rui and
                  Ralf Steinmetz and
                  Alan Hanjalic and
                  Apostol Natsev and
                  Wenwu Zhu},
  title        = {Proceedings of the {ACM} International Conference on Multimedia, {MM}
                  '14, Orlando, FL, USA, November 03 - 07, 2014},
  publisher    = {{ACM}},
  year         = {2014},
  url          = {http://dl.acm.org/citation.cfm?id=2647868},
  isbn         = {978-1-4503-3063-3},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/mm/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/apsipa/2013,
  title        = {Asia-Pacific Signal and Information Processing Association Annual
                  Summit and Conference, {APSIPA} 2013, Kaohsiung, Taiwan, October 29
                  - November 1, 2013},
  publisher    = {{IEEE}},
  year         = {2013},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6682637/proceeding},
  isbn         = {978-1-4799-2794-4},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/apsipa/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cogsci/2013,
  editor       = {Markus Knauff and
                  Michael Pauen and
                  Natalie Sebanz and
                  Ipke Wachsmuth},
  title        = {Proceedings of the 35th Annual Meeting of the Cognitive Science Society,
                  CogSci 2013, Berlin, Germany, July 31 - August 3, 2013},
  publisher    = {cognitivesciencesociety.org},
  year         = {2013},
  url          = {https://mindmodeling.org/cogsci2013/},
  isbn         = {978-0-9768318-9-1},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/cogsci/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icpca/2013,
  editor       = {Qiaohong Zu and
                  Maria Vargas{-}Vera and
                  Bo Hu},
  title        = {Pervasive Computing and the Networked World - Joint International
                  Conference, {ICPCA/SWS} 2013, Vina del Mar, Chile, December 5-7, 2013.
                  Revised Selected Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {8351},
  publisher    = {Springer},
  year         = {2014},
  url          = {https://doi.org/10.1007/978-3-319-09265-2},
  doi          = {10.1007/978-3-319-09265-2},
  isbn         = {978-3-319-09264-5},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icpca/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icst/2013w,
  title        = {Sixth {IEEE} International Conference on Software Testing, Verification
                  and Validation, {ICST} 2013 Workshops Proceedings, Luxembourg, Luxembourg,
                  March 18-22, 2013},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6570842/proceeding},
  isbn         = {978-1-4799-1324-4},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icst/2013w.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/lcn/2013,
  title        = {38th Annual {IEEE} Conference on Local Computer Networks, Sydney,
                  Australia, October 21-24, 2013},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6745315/proceeding},
  isbn         = {978-1-4799-0537-9},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/lcn/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sac/2013,
  editor       = {Sung Y. Shin and
                  Jos{\'{e}} Carlos Maldonado},
  title        = {Proceedings of the 28th Annual {ACM} Symposium on Applied Computing,
                  {SAC} '13, Coimbra, Portugal, March 18-22, 2013},
  publisher    = {{ACM}},
  year         = {2013},
  url          = {http://dl.acm.org/citation.cfm?id=2480362},
  isbn         = {978-1-4503-1656-9},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/sac/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/trustcom/2013,
  title        = {12th {IEEE} International Conference on Trust, Security and Privacy
                  in Computing and Communications, TrustCom 2013 / 11th {IEEE} International
                  Symposium on Parallel and Distributed Processing with Applications,
                  {ISPA-13} / 12th {IEEE} International Conference on Ubiquitous Computing
                  and Communications, IUCC-2013, Melbourne, Australia, July 16-18, 2013},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6679587/proceeding},
  isbn         = {978-0-7695-5022-0},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/trustcom/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/IEEEcloud/2012,
  editor       = {Rong Chang},
  title        = {2012 {IEEE} Fifth International Conference on Cloud Computing, Honolulu,
                  HI, USA, June 24-29, 2012},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6253102/proceeding},
  isbn         = {978-1-4673-2892-0},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/IEEEcloud/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/bhi/2012,
  title        = {Proceedings of 2012 {IEEE-EMBS} International Conference on Biomedical
                  and Health Informatics, Hong Kong, China, January 5-7, 2012},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6204368/proceeding},
  isbn         = {978-1-4577-2176-2},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/bhi/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/esscirc/2012,
  title        = {Proceedings of the 38th European Solid-State Circuit conference, {ESSCIRC}
                  2012, Bordeaux, France, September 17-21, 2012},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6331297/proceeding},
  isbn         = {978-1-4673-2212-6},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/esscirc/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/hpca/2012,
  title        = {18th {IEEE} International Symposium on High Performance Computer Architecture,
                  {HPCA} 2012, New Orleans, LA, USA, 25-29 February, 2012},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6165554/proceeding},
  isbn         = {978-1-4673-0827-4},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/hpca/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/hpcc/2012,
  editor       = {Geyong Min and
                  Jia Hu and
                  Lei (Chris) Liu and
                  Laurence Tianruo Yang and
                  Seetharami Seelam and
                  Laurent Lef{\`{e}}vre},
  title        = {14th {IEEE} International Conference on High Performance Computing
                  and Communication {\&} 9th {IEEE} International Conference on
                  Embedded Software and Systems, {HPCC-ICESS} 2012, Liverpool, United
                  Kingdom, June 25-27, 2012},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6331801/proceeding},
  isbn         = {978-1-4673-2164-8},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/hpcc/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iccel/2012,
  title        = {{IEEE} International Conference on Consumer Electronics, {ICCE} 2012,
                  Las Vegas, NV, USA, January 13-16, 2012},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6153584/proceeding},
  isbn         = {978-1-4577-0230-3},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/iccel/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/percom/2012w,
  title        = {Tenth Annual {IEEE} International Conference on Pervasive Computing
                  and Communications, PerCom 2012, March 19-23, 2012, Lugano, Switzerland,
                  Workshop Proceedings},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6192378/proceeding},
  isbn         = {978-1-4673-0905-9},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/percom/2012w.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sin/2012,
  editor       = {Manoj Singh Gaur and
                  Atilla El{\c{c}}i and
                  Oleg B. Makarevich and
                  Mehmet A. Orgun and
                  Virendra Singh},
  title        = {5th International Conference of Security of Information and Networks,
                  {SIN} '12, Jaipur, India, October 22 - 26, 2012},
  publisher    = {{ACM}},
  year         = {2012},
  url          = {http://dl.acm.org/citation.cfm?id=2388576},
  isbn         = {978-1-4503-1668-2},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/sin/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/chi/2011a,
  editor       = {Desney S. Tan and
                  Saleema Amershi and
                  Bo Begole and
                  Wendy A. Kellogg and
                  Manas Tungare},
  title        = {Proceedings of the International Conference on Human Factors in Computing
                  Systems, {CHI} 2011, Extended Abstracts Volume, Vancouver, BC, Canada,
                  May 7-12, 2011},
  publisher    = {{ACM}},
  year         = {2011},
  url          = {https://doi.org/10.1145/1979742},
  doi          = {10.1145/1979742},
  isbn         = {978-1-4503-0268-5},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/chi/2011a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ithings/2011,
  title        = {2011 {IEEE} International Conference on Internet of Things (iThings)
                  {\&} 4th {IEEE} International Conference on Cyber, Physical and
                  Social Computing (CPSCom), Dalian, China, October 19-22, 2011},
  publisher    = {{IEEE} Computer Society},
  year         = {2011},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6142151/proceeding},
  isbn         = {978-1-4577-1976-9},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/ithings/2011.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/mdm/2011-1,
  editor       = {Arkady B. Zaslavsky and
                  Panos K. Chrysanthis and
                  Dik Lun Lee and
                  Dipanjan Chakraborty and
                  Vana Kalogeraki and
                  Mohamed F. Mokbel and
                  Chi{-}Yin Chow},
  title        = {12th {IEEE} International Conference on Mobile Data Management, {MDM}
                  2011, Lule{\aa}, Sweden, June 6-9, 2011, Volume 1},
  publisher    = {{IEEE} Computer Society},
  year         = {2011},
  url          = {https://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?isnumber=6068399},
  isbn         = {978-1-4577-0581-6},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/mdm/2011-1.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sies/2011,
  title        = {Industrial Embedded Systems (SIES), 2011 6th {IEEE} International
                  Symposium on, {SIES} 2011. Vasteras, Sweden, June 15-17, 2011},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/5937480/proceeding},
  isbn         = {978-1-61284-818-1},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/sies/2011.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:series/hci/DouglasL11,
  editor       = {Ian Douglas and
                  Zhengjie Liu},
  title        = {Global Usability},
  series       = {Human-Computer Interaction Series},
  publisher    = {Springer},
  year         = {2011},
  url          = {https://doi.org/10.1007/978-0-85729-304-6},
  doi          = {10.1007/978-0-85729-304-6},
  isbn         = {978-0-85729-303-9},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/series/hci/DouglasL11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/hipc/2010,
  title        = {2010 International Conference on High Performance Computing, HiPC
                  2010, Dona Paula, Goa, India, December 19-22, 2010},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/5708271/proceeding},
  isbn         = {978-1-4244-8518-5},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/hipc/2010.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sac/2010,
  editor       = {Sung Y. Shin and
                  Sascha Ossowski and
                  Michael Schumacher and
                  Mathew J. Palakal and
                  Chih{-}Cheng Hung},
  title        = {Proceedings of the 2010 {ACM} Symposium on Applied Computing (SAC),
                  Sierre, Switzerland, March 22-26, 2010},
  publisher    = {{ACM}},
  year         = {2010},
  url          = {https://doi.org/10.1145/1774088},
  doi          = {10.1145/1774088},
  isbn         = {978-1-60558-639-7},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/sac/2010.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/crowncom/2009,
  editor       = {Thomas Kaiser and
                  Markus Fidler},
  title        = {4th International {ICST} Conference on Cognitive Radio Oriented Wireless
                  Networks and Communications, {CROWNCOM} 2009, Hannover, Germany, June
                  22-24, 2009},
  publisher    = {{IEEE}},
  year         = {2009},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/5173448/proceeding},
  isbn         = {978-1-4244-3423-7},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/crowncom/2009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cse/2009,
  title        = {Proceedings of the 12th {IEEE} International Conference on Computational
                  Science and Engineering, {CSE} 2009, Vancouver, BC, Canada, August
                  29-31, 2009},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/5282954/proceeding},
  isbn         = {978-1-4244-5334-4},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/cse/2009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/interspeech/2009,
  title        = {10th Annual Conference of the International Speech Communication Association,
                  {INTERSPEECH} 2009, Brighton, United Kingdom, September 6-10, 2009},
  publisher    = {{ISCA}},
  year         = {2009},
  url          = {https://doi.org/10.21437/Interspeech.2009},
  doi          = {10.21437/INTERSPEECH.2009},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/interspeech/2009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sac/2008,
  editor       = {Roger L. Wainwright and
                  Hisham Haddad},
  title        = {Proceedings of the 2008 {ACM} Symposium on Applied Computing (SAC),
                  Fortaleza, Ceara, Brazil, March 16-20, 2008},
  publisher    = {{ACM}},
  year         = {2008},
  url          = {https://doi.org/10.1145/1363686},
  doi          = {10.1145/1363686},
  isbn         = {978-1-59593-753-7},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/sac/2008.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/semco/2008,
  title        = {Proceedings of the 2th {IEEE} International Conference on Semantic
                  Computing {(ICSC} 2008), August 4-7, 2008, Santa Clara, California,
                  {USA}},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/4597156/proceeding},
  isbn         = {978-0-7695-3279-0},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/semco/2008.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/euc/2007,
  editor       = {Tei{-}Wei Kuo and
                  Edwin Hsing{-}Mean Sha and
                  Minyi Guo and
                  Laurence Tianruo Yang and
                  Zili Shao},
  title        = {Embedded and Ubiquitous Computing, International Conference, {EUC}
                  2007, Taipei, Taiwan, December 17-20, 2007, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4808},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-77092-3},
  doi          = {10.1007/978-3-540-77092-3},
  isbn         = {978-3-540-77091-6},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/euc/2007.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/chi/2006a,
  editor       = {Gary M. Olson and
                  Robin Jeffries},
  title        = {Extended Abstracts Proceedings of the 2006 Conference on Human Factors
                  in Computing Systems, {CHI} 2006, Montr{\'{e}}al, Qu{\'{e}}bec,
                  Canada, April 22-27, 2006},
  publisher    = {{ACM}},
  year         = {2006},
  url          = {https://doi.org/10.1145/1125451},
  doi          = {10.1145/1125451},
  isbn         = {978-1-59593-298-3},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/chi/2006a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/etra/2006,
  editor       = {Kari{-}Jouko R{\"{a}}ih{\"{a}} and
                  Andrew T. Duchowski},
  title        = {Proceedings of the Eye Tracking Research {\&} Application Symposium,
                  {ETRA} 2006, San Diego, California, USA, March 27-29, 2006},
  publisher    = {{ACM}},
  year         = {2006},
  isbn         = {1-59593-305-0},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/etra/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/euc/2006,
  editor       = {Edwin Hsing{-}Mean Sha and
                  Sung{-}Kook Han and
                  Cheng{-}Zhong Xu and
                  Moon{-}hae Kim and
                  Laurence Tianruo Yang and
                  Bin Xiao},
  title        = {Embedded and Ubiquitous Computing, International Conference, {EUC}
                  2006, Seoul, Korea, August 1-4, 2006, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4096},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11802167},
  doi          = {10.1007/11802167},
  isbn         = {3-540-36679-2},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/euc/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/fuzzIEEE/2006,
  title        = {{IEEE} International Conference on Fuzzy Systems, {FUZZ-IEEE} 2006,
                  Vancouver, BC, Canada, July 16-21, 2006},
  publisher    = {{IEEE}},
  year         = {2006},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/11093/proceeding},
  isbn         = {0-7803-9488-7},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/fuzzIEEE/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/gpc/2006,
  editor       = {Yeh{-}Ching Chung and
                  Jos{\'{e}} E. Moreira},
  title        = {Advances in Grid and Pervasive Computing, First International Conference,
                  {GPC} 2006, Taichung, Taiwan, May 3-5, 2006, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3947},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11745693},
  doi          = {10.1007/11745693},
  isbn         = {3-540-33809-8},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/gpc/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iscc/2006,
  editor       = {Paolo Bellavista and
                  Chi{-}Ming Chen and
                  Antonio Corradi and
                  Mahmoud Daneshmand},
  title        = {Proceedings of the 11th {IEEE} Symposium on Computers and Communications
                  {(ISCC} 2006), 26-29 June 2006, Cagliari, Sardinia, Italy},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/11130/proceeding},
  isbn         = {0-7695-2588-1},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/iscc/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/mdm/2006,
  title        = {7th International Conference on Mobile Data Management {(MDM} 2006),
                  Nara, Japan, May 9-13, 2006},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/10853/proceeding},
  isbn         = {0-7695-2526-1},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/mdm/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sac/2006,
  editor       = {Hisham Haddad},
  title        = {Proceedings of the 2006 {ACM} Symposium on Applied Computing (SAC),
                  Dijon, France, April 23-27, 2006},
  publisher    = {{ACM}},
  year         = {2006},
  url          = {https://doi.org/10.1145/1141277},
  doi          = {10.1145/1141277},
  isbn         = {1-59593-108-2},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/sac/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icws/2005,
  title        = {2005 {IEEE} International Conference on Web Services {(ICWS} 2005),
                  11-15 July 2005, Orlando, FL, {USA}},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/10245/proceeding},
  isbn         = {0-7695-2409-5},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icws/2005.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/isads/2005,
  editor       = {Qingquan Qian},
  title        = {2005 International Symposium on Autonomous Decentralized Systems,
                  {ISADS} 2005, Chengdu, China, April 4-8, 2005, Proceedings},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9846/proceeding},
  isbn         = {0-7803-8963-8},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/isads/2005.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/mdm/2005,
  editor       = {Panos K. Chrysanthis and
                  George Samaras},
  title        = {6th International Conference on Mobile Data Management {(MDM} 2005),
                  Ayia Napa, Cyprus, May 9-13, 2005},
  publisher    = {{ACM}},
  year         = {2005},
  isbn         = {1-59593-041-8},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/mdm/2005.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/rtcsa/2005,
  title        = {11th {IEEE} International Conference on Embedded and Real-Time Computing
                  Systems and Applications {(RTCSA} 2005), 17-19 August 2005, Hong Kong,
                  China},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/10343/proceeding},
  isbn         = {0-7695-2346-3},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/rtcsa/2005.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sac/2005,
  editor       = {Hisham Haddad and
                  Lorie M. Liebrock and
                  Andrea Omicini and
                  Roger L. Wainwright},
  title        = {Proceedings of the 2005 {ACM} Symposium on Applied Computing (SAC),
                  Santa Fe, New Mexico, USA, March 13-17, 2005},
  publisher    = {{ACM}},
  year         = {2005},
  url          = {https://doi.org/10.1145/1066677},
  doi          = {10.1145/1066677},
  isbn         = {1-58113-964-0},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/sac/2005.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/aina/2004,
  title        = {18th International Conference on Advanced Information Networking and
                  Applications {(AINA} 2004), 29-31 March 2004, Fukuoka, Japan},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9028/proceeding},
  isbn         = {0-7695-2051-0},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/aina/2004.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/compsac/2004,
  title        = {28th International Computer Software and Applications Conference {(COMPSAC}
                  2004), Design and Assessment of Trustworthy Software-Based Systems,
                  27-30 September 2004, Hong Kong, China, Proceedings},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://ieeexplore.ieee.org/xpl/tocresult.jsp?isnumber=29570},
  isbn         = {0-7695-2209-2},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/compsac/2004.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icdcsw/2004,
  title        = {24th International Conference on Distributed Computing Systems Workshops
                  {(ICDCS} 2004 Workshops), 23-24 March 2004, Hachioji, Tokyo, Japan},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9027/proceeding},
  isbn         = {0-7695-2087-1},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icdcsw/2004.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icip/2004,
  title        = {Proceedings of the 2004 International Conference on Image Processing,
                  {ICIP} 2004, Singapore, October 24-27, 2004},
  publisher    = {{IEEE}},
  year         = {2004},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9716/proceeding},
  isbn         = {0-7803-8554-3},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/2004.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icpp/2004,
  title        = {33rd International Conference on Parallel Processing {(ICPP} 2004),
                  15-18 August 2004, Montreal, Quebec, Canada},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9250/proceeding},
  isbn         = {0-7695-2197-5},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icpp/2004.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ispa/2004,
  editor       = {Jiannong Cao and
                  Laurence Tianruo Yang and
                  Minyi Guo and
                  Francis Chi{-}Moon Lau},
  title        = {Parallel and Distributed Processing and Applications, Second InternationalSymposium,
                  {ISPA} 2004, Hong Kong, China, December 13-15, 2004, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3358},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/b104574},
  doi          = {10.1007/B104574},
  isbn         = {3-540-24128-0},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/ispa/2004.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ispan/2004,
  title        = {7th International Symposium on Parallel Architectures, Algorithms,
                  and Networks {(I-SPAN} 2004), 10-12 May 2004, Hong Kong, SAR, China},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9103/proceeding},
  isbn         = {0-7695-2135-5},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/ispan/2004.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sac/2004,
  editor       = {Hisham Haddad and
                  Andrea Omicini and
                  Roger L. Wainwright and
                  Lorie M. Liebrock},
  title        = {Proceedings of the 2004 {ACM} Symposium on Applied Computing (SAC),
                  Nicosia, Cyprus, March 14-17, 2004},
  publisher    = {{ACM}},
  year         = {2004},
  url          = {https://doi.org/10.1145/967900},
  doi          = {10.1145/967900},
  isbn         = {1-58113-812-1},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/sac/2004.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/appt/2003,
  editor       = {Xingming Zhou and
                  Stefan J{\"{a}}hnichen and
                  Ming Xu and
                  Jiannong Cao},
  title        = {Advanced Parallel Programming Technologies, 5th International Workshop,
                  {APPT} 2003, Xiamen, China, September 17-19, 2003, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {2834},
  publisher    = {Springer},
  year         = {2003},
  url          = {https://doi.org/10.1007/b13582},
  doi          = {10.1007/B13582},
  isbn         = {3-540-20054-1},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/appt/2003.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/compsac/2003,
  title        = {27th International Computer Software and Applications Conference {(COMPSAC}
                  2003): Design and Assessment of Trustworthy Software-Based Systems,
                  3-6 November 2003, Dallas, TX, USA, Proceedings},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8813/proceeding},
  isbn         = {0-7695-2020-0},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/compsac/2003.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icpp/2003,
  title        = {32nd International Conference on Parallel Processing {(ICPP} 2003),
                  6-9 October 2003, Kaohsiung, Taiwan},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8782/proceeding},
  isbn         = {0-7695-2017-0},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icpp/2003.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icwl/2003,
  editor       = {Wanlei Zhou and
                  Paul Nicholson and
                  Brian J. Corbitt and
                  Joseph Fong},
  title        = {Advances in Web-Based Learning - {ICWL} 2003, Second International
                  Conference, Melbourne, Australia, August 18-20, 2003, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {2783},
  publisher    = {Springer},
  year         = {2003},
  url          = {https://doi.org/10.1007/b12012},
  doi          = {10.1007/B12012},
  isbn         = {3-540-40772-3},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icwl/2003.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/infocom/2003,
  title        = {Proceedings {IEEE} {INFOCOM} 2003, The 22nd Annual Joint Conference
                  of the {IEEE} Computer and Communications Societies, San Franciso,
                  CA, USA, March 30 - April 3, 2003},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8585/proceeding},
  isbn         = {0-7803-7752-4},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/infocom/2003.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iscc/2003,
  title        = {Proceedings of the Eighth {IEEE} Symposium on Computers and Communications
                  {(ISCC} 2003), 30 June - 3 July 2003, Kiris-Kemer, Turkey},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8616/proceeding},
  isbn         = {0-7695-1961-X},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/iscc/2003.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sac/2003,
  editor       = {Gary B. Lamont and
                  Hisham Haddad and
                  George A. Papadopoulos and
                  Brajendra Panda},
  title        = {Proceedings of the 2003 {ACM} Symposium on Applied Computing (SAC),
                  March 9-12, 2003, Melbourne, FL, {USA}},
  publisher    = {{ACM}},
  year         = {2003},
  url          = {https://doi.org/10.1145/952532},
  doi          = {10.1145/952532},
  isbn         = {1-58113-624-2},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/sac/2003.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/seke/2003,
  title        = {Proceedings of the Fifteenth International Conference on Software
                  Engineering {\&} Knowledge Engineering (SEKE'2003), Hotel Sofitel,
                  San Francisco Bay, CA, USA, July 1-3, 2003},
  year         = {2003},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/seke/2003.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/www/2003,
  editor       = {Guszt{\'{a}}v Hencsey and
                  Bebo White and
                  Yih{-}Farn Robin Chen and
                  L{\'{a}}szl{\'{o}} Kov{\'{a}}cs and
                  Steve Lawrence},
  title        = {Proceedings of the Twelfth International World Wide Web Conference,
                  {WWW} 2003, Budapest, Hungary, May 20-24, 2003},
  publisher    = {{ACM}},
  year         = {2003},
  isbn         = {1-58113-680-3},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/www/2003.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/www/2003p,
  editor       = {Irwin King and
                  Tam{\'{a}}s M{\'{a}}ray},
  title        = {Proceedings of the Twelfth International World Wide Web Conference
                  - Posters, {WWW} 2003, Budapest, Hungary, May 20-24, 2003},
  year         = {2003},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/www/2003p.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icpads/2002,
  title        = {9th International Conference on Parallel and Distributed Systems,
                  {ICPADS} 2002, Taiwan, ROC, December 17-20, 2002},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8425/proceeding},
  isbn         = {0-7695-1760-9},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icpads/2002.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icpp/2002,
  title        = {31st International Conference on Parallel Processing {(ICPP} 2002),
                  20-23 August 2002, Vancouver, BC, Canada},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8068/proceeding},
  isbn         = {0-7695-1677-7},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icpp/2002.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icwl/2002,
  editor       = {Joseph Fong and
                  Ronnie Chu Ting Cheung and
                  Hong Va Leong and
                  Qing Li},
  title        = {Advances in Web-Based Learning, First International Conference, {ICWL}
                  2002, Hong Kong, China, August 17-19, 2002, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {2436},
  publisher    = {Springer},
  year         = {2002},
  url          = {https://doi.org/10.1007/3-540-45689-9},
  doi          = {10.1007/3-540-45689-9},
  isbn         = {3-540-44041-0},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icwl/2002.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ipps/2002,
  title        = {16th International Parallel and Distributed Processing Symposium {(IPDPS}
                  2002), 15-19 April 2002, Fort Lauderdale, FL, USA, CD-ROM/Abstracts
                  Proceedings},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7926/proceeding},
  isbn         = {0-7695-1573-8},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/ipps/2002.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/nnsp/2002,
  title        = {Proceedings of the 12th {IEEE} Workshop on Neural Networks for Signal
                  Processing, {NNSP} 2002, Martigny, Valais, Switzerland, September
                  4-6, 2002},
  publisher    = {{IEEE}},
  year         = {2002},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8007/proceeding},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/nnsp/2002.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sac/2002,
  editor       = {Gary B. Lamont and
                  Hisham Haddad and
                  George A. Papadopoulos and
                  Brajendra Panda},
  title        = {Proceedings of the 2002 {ACM} Symposium on Applied Computing (SAC),
                  March 10-14, 2002, Madrid, Spain},
  publisher    = {{ACM}},
  year         = {2002},
  url          = {https://doi.org/10.1145/508791},
  doi          = {10.1145/508791},
  isbn         = {1-58113-445-2},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/sac/2002.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/wcnc/2002,
  title        = {2002 {IEEE} Wireless Communications and Networking Conference Record,
                  {WCNC} 2002, Orlando, Florida, USA, MArch 17-21, 2002},
  publisher    = {{IEEE}},
  year         = {2002},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7793/proceeding},
  isbn         = {0-7803-7376-6},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/wcnc/2002.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/doa/2001,
  title        = {3rd International Symposium on Distributed Objects and Applications,
                  {DOA} 2001, Rome, Italy, September 17-20, 2001},
  publisher    = {{IEEE} Computer Society},
  year         = {2001},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7570/proceeding},
  isbn         = {0-7695-1300-X},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/doa/2001.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/dsn/2001,
  title        = {2001 International Conference on Dependable Systems and Networks {(DSN}
                  2001) (formerly: FTCS), 1-4 July 2001, G{\"{o}}teborg, Sweden,
                  Proceedings},
  publisher    = {{IEEE} Computer Society},
  year         = {2001},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7490/proceeding},
  isbn         = {0-7695-1101-5},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/dsn/2001.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icalt/2001,
  editor       = {Toshio Okamoto and
                  Roger Hartley and
                  Kinshuk and
                  John P. Klus},
  title        = {Proceedings {IEEE} International Conference on Advanced Learning Technology:
                  Issues, Achievements and Challenges, Madison, WI, USA, August 6-8,
                  2001},
  publisher    = {{IEEE} Computer Society},
  year         = {2001},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7507/proceeding},
  isbn         = {0-7695-1013-2},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icalt/2001.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icppw/2001,
  title        = {30th International Workshops on Parallel Processing {(ICPP} 2001 Workshops),
                  3-7 September 2001, Valencia, Spain},
  publisher    = {{IEEE} Computer Society},
  year         = {2001},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7556/proceeding},
  isbn         = {0-7695-1260-7},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icppw/2001.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ipps/2001,
  title        = {Proceedings of the 15th International Parallel {\&} Distributed
                  Processing Symposium (IPDPS-01), San Francisco, CA, USA, April 23-27,
                  2001},
  publisher    = {{IEEE} Computer Society},
  year         = {2001},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7373/proceeding},
  isbn         = {0-7695-0990-8},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/ipps/2001.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/mdm/2001,
  editor       = {Kian{-}Lee Tan and
                  Michael J. Franklin and
                  John C. S. Lui},
  title        = {Mobile Data Management, Second International Conference, {MDM} 2001,
                  Hong Kong, China, January 8-10, 2001, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {1987},
  publisher    = {Springer},
  year         = {2001},
  url          = {https://doi.org/10.1007/3-540-44498-X},
  doi          = {10.1007/3-540-44498-X},
  isbn         = {3-540-41454-1},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/mdm/2001.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cifer/2000,
  title        = {Proceedings of the {IEEE/IAFE/INFORMS} 2000 Conference on Computational
                  Intelligence for Financial Engineering, CIFEr 2000, New York City,
                  USA, March 28, 2000},
  publisher    = {{IEEE}},
  year         = {2000},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6797/proceeding},
  isbn         = {0-7803-6429-5},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/cifer/2000.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icassp/1999,
  title        = {Proceedings of the 1999 {IEEE} International Conference on Acoustics,
                  Speech, and Signal Processing, {ICASSP} '99, Phoenix, Arizona, USA,
                  March 15-19, 1999},
  publisher    = {{IEEE} Computer Society},
  year         = {1999},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6110/proceeding},
  isbn         = {0-7803-5041-3},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/1999.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/interspeech/1999,
  title        = {Sixth European Conference on Speech Communication and Technology,
                  {EUROSPEECH} 1999, Budapest, Hungary, September 5-9, 1999},
  publisher    = {{ISCA}},
  year         = {1999},
  url          = {https://doi.org/10.21437/Eurospeech.1999},
  doi          = {10.21437/EUROSPEECH.1999},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/interspeech/1999.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/wcnc/1999,
  title        = {1999 {IEEE} Wireless Communications and Networking Conference, {WCNC}
                  1999, September 21-24, 1999, New Orleans, Louisiana, {USA}},
  publisher    = {{IEEE}},
  year         = {1999},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6459/proceeding},
  isbn         = {0-7803-5668-3},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/wcnc/1999.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/isca/1993,
  editor       = {Alan Jay Smith},
  title        = {Proceedings of the 20th Annual International Symposium on Computer
                  Architecture, San Diego, CA, USA, May 1993},
  publisher    = {{ACM}},
  year         = {1993},
  url          = {https://doi.org/10.1145/165123},
  doi          = {10.1145/165123},
  isbn         = {0-8186-3810-9},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/isca/1993.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/compcon/1986,
  title        = {Spring COMPCON'86, Digest of Papers, Thirty-First {IEEE} Computer
                  Society International Conference, San Francisco, California, USA,
                  March 3-6, 1986},
  publisher    = {{IEEE} Computer Society},
  year         = {1986},
  isbn         = {0-8186-0692-4},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/compcon/1986.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/compcon/1985,
  title        = {Spring COMPCON'85, Digest of Papers, Thirtieth {IEEE} Computer Society
                  International Conference, San Francisco, California, USA, February
                  25-28, 1985},
  publisher    = {{IEEE} Computer Society},
  year         = {1985},
  isbn         = {0-8186-0613-4},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/compcon/1985.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/slp/1985,
  title        = {Proceedings of the 1985 Symposium on Logic Programming, Boston, Massachusetts,
                  USA, July 15-18, 1985},
  publisher    = {{IEEE-CS}},
  year         = {1985},
  isbn         = {0-8186-0636-3},
  timestamp    = {Thu, 10 Oct 2024 19:37:08 +0200},
  biburl       = {https://dblp.org/rec/conf/slp/1985.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}