default search action
Search dblp for Publications
export results for "Alvin Chan"
@article{DBLP:journals/npjdm/HuangCWDLWAL24, author = {Jane J. Huang and Roomasa Channa and Risa M. Wolf and Yiwen Dong and Mavis Liang and Jiangxia Wang and Michael D. Abr{\`{a}}moff and T. Y. Alvin Liu}, title = {Autonomous artificial intelligence for diabetic eye disease increases access and health equity in underserved populations}, journal = {npj Digit. Medicine}, volume = {7}, number = {1}, year = {2024}, url = {https://doi.org/10.1038/s41746-024-01197-3}, doi = {10.1038/S41746-024-01197-3}, timestamp = {Thu, 29 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/npjdm/HuangCWDLWAL24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/npjdm/HuangCWDLWAL24a, author = {Jane J. Huang and Roomasa Channa and Risa M. Wolf and Yiwen Dong and Mavis Liang and Jiangxia Wang and Michael D. Abr{\`{a}}moff and T. Y. Alvin Liu}, title = {Author Correction: Autonomous artificial intelligence for diabetic eye disease increases access and health equity in underserved populations}, journal = {npj Digit. Medicine}, volume = {7}, number = {1}, year = {2024}, url = {https://doi.org/10.1038/s41746-024-01229-y}, doi = {10.1038/S41746-024-01229-Y}, timestamp = {Fri, 20 Sep 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/npjdm/HuangCWDLWAL24a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pvldb/KittivorawongGHC24, author = {Chanwut Kittivorawong and Yongming Ge and Yousef Helal and Alvin Cheung}, title = {Spatialyze: {A} Geospatial Video Analytics System with Spatial-Aware Optimizations}, journal = {Proc. {VLDB} Endow.}, volume = {17}, number = {9}, pages = {2136--2148}, year = {2024}, url = {https://www.vldb.org/pvldb/vol17/p2136-kittivorawong.pdf}, timestamp = {Thu, 18 Jul 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pvldb/KittivorawongGHC24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cec/ChouLTYCWJK24, author = {Yao{-}Hsin Chou and Yun{-}Ting Lai and Yong Feng Tong and Alvin Young and Ming{-}Ho Chang and Kun{-}Min Wu and Yu{-}Chi Jiang and Shu{-}Yu Kuo}, title = {A Quantum-Inspired Multi-objective Portfolio Strategy Based on Trend Ratio Model in Global Financial Network}, booktitle = {{IEEE} Congress on Evolutionary Computation, {CEC} 2024, Yokohama, Japan, June 30 - July 5, 2024}, pages = {1--8}, year = {2024}, crossref = {DBLP:conf/cec/2024}, url = {https://doi.org/10.1109/CEC60901.2024.10611925}, doi = {10.1109/CEC60901.2024.10611925}, timestamp = {Tue, 20 Aug 2024 15:15:31 +0200}, biburl = {https://dblp.org/rec/conf/cec/ChouLTYCWJK24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ispd/HoCGHKLR24, author = {Chia{-}Tung Ho and Ajay Chandna and David Guan and Alvin Ho and Minsoo Kim and Yaguang Li and Haoxing Ren}, title = {Novel Transformer Model Based Clustering Method for Standard Cell Design Automation}, booktitle = {Proceedings of the 2024 International Symposium on Physical Design, {ISPD} 2024, Taipei, Taiwan, March 12-15, 2024}, pages = {195--203}, year = {2024}, crossref = {DBLP:conf/ispd/2024}, url = {https://doi.org/10.1145/3626184.3633314}, doi = {10.1145/3626184.3633314}, timestamp = {Mon, 01 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ispd/HoCGHKLR24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2408-00118, author = {Morgane Rivi{\`{e}}re and Shreya Pathak and Pier Giuseppe Sessa and Cassidy Hardin and Surya Bhupatiraju and L{\'{e}}onard Hussenot and Thomas Mesnard and Bobak Shahriari and Alexandre Ram{\'{e}} and Johan Ferret and Peter Liu and Pouya Tafti and Abe Friesen and Michelle Casbon and Sabela Ramos and Ravin Kumar and Charline Le Lan and Sammy Jerome and Anton Tsitsulin and Nino Vieillard and Piotr Stanczyk and Sertan Girgin and Nikola Momchev and Matt Hoffman and Shantanu Thakoor and Jean{-}Bastien Grill and Behnam Neyshabur and Olivier Bachem and Alanna Walton and Aliaksei Severyn and Alicia Parrish and Aliya Ahmad and Allen Hutchison and Alvin Abdagic and Amanda Carl and Amy Shen and Andy Brock and Andy Coenen and Anthony Laforge and Antonia Paterson and Ben Bastian and Bilal Piot and Bo Wu and Brandon Royal and Charlie Chen and Chintu Kumar and Chris Perry and Chris Welty and Christopher A. Choquette{-}Choo and Danila Sinopalnikov and David Weinberger and Dimple Vijaykumar and Dominika Rogozinska and Dustin Herbison and Elisa Bandy and Emma Wang and Eric Noland and Erica Moreira and Evan Senter and Evgenii Eltyshev and Francesco Visin and Gabriel Rasskin and Gary Wei and Glenn Cameron and Gus Martins and Hadi Hashemi and Hanna Klimczak{-}Plucinska and Harleen Batra and Harsh Dhand and Ivan Nardini and Jacinda Mein and Jack Zhou and James Svensson and Jeff Stanway and Jetha Chan and Jin Peng Zhou and Joana Carrasqueira and Joana Iljazi and Jocelyn Becker and Joe Fernandez and Joost van Amersfoort and Josh Gordon and Josh Lipschultz and Josh Newlan and Ju{-}yeong Ji and Kareem Mohamed and Kartikeya Badola and Kat Black and Katie Millican and Keelin McDonell and Kelvin Nguyen and Kiranbir Sodhia and Kish Greene and Lars Lowe Sj{\"{o}}sund and Lauren Usui and Laurent Sifre and Lena Heuermann and Leticia Lago and Lilly McNealus}, title = {Gemma 2: Improving Open Language Models at a Practical Size}, journal = {CoRR}, volume = {abs/2408.00118}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2408.00118}, doi = {10.48550/ARXIV.2408.00118}, eprinttype = {arXiv}, eprint = {2408.00118}, timestamp = {Mon, 30 Sep 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2408-00118.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cim/ChenWCLO23, author = {Zhenghua Chen and Min Wu and Alvin Chan and Xiaoli Li and Yew{-}Soon Ong}, title = {Survey on {AI} Sustainability: Emerging Trends on Learning Algorithms and Research Challenges [Review Article]}, journal = {{IEEE} Comput. Intell. Mag.}, volume = {18}, number = {2}, pages = {60--77}, year = {2023}, url = {https://doi.org/10.1109/MCI.2023.3245733}, doi = {10.1109/MCI.2023.3245733}, timestamp = {Sat, 29 Apr 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cim/ChenWCLO23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijbi/TanSBCLLECLTKCBG23, author = {Hong Chang Tan and Elizabeth Shumbayawonda and Cayden Beyer and Lionel Tim{-}Ee Cheng and Albert Low and Chin Hong Lim and Alvin Eng and Weng Hoong Chan and Phong Ching Lee and Mei Fang Tay and Stella Kin and Jason Pik Eu Chang and Yong Mong Bee and George Boon Bee Goh}, title = {Multiparametric Magnetic Resonance Imaging and Magnetic Resonance Elastography to Evaluate the Early Effects of Bariatric Surgery on Nonalcoholic Fatty Liver Disease}, journal = {Int. J. Biomed. Imaging}, volume = {2023}, pages = {4228321:1--4228321:8}, year = {2023}, url = {https://doi.org/10.1155/2023/4228321}, doi = {10.1155/2023/4228321}, timestamp = {Fri, 27 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijbi/TanSBCLLECLTKCBG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jossw/ScheidgenHLSNFCGMBBGDLDANSDKMRDPK23, author = {Markus Scheidgen and Lauri Himanen and Alvin N. Ladines and David Sikter and Mohammad Nakhaee and {\'{A}}d{\'{a}}m Fekete and Theodore Chang and Amir Golparvar and Jos{\'{e}} A. M{\'{a}}rquez and Sandor Brockhauser and Sebastian Br{\"{u}}ckner and Luca M. Ghiringhelli and Felix Dietrich and Daniel Lehmberg and Thea Denell and Andrea Albino and Hampus N{\"{a}}sstr{\"{o}}m and Sherjeel Shabih and Florian Dobener and Markus K{\"{u}}hbach and Rubel Mozumder and Joseph F. Rudzinski and Nathan Daelman and Jos{\'{e}} M. Pizarro and Martin Kuban and Cuauhtemoc Salazar and Pavel Ondracka and Hans{-}Joachim Bungartz and Claudia Draxl}, title = {{NOMAD:} {A} distributed web-based platform for managing materials science research data}, journal = {J. Open Source Softw.}, volume = {8}, number = {90}, pages = {5388}, year = {2023}, url = {https://doi.org/10.21105/joss.05388}, doi = {10.21105/JOSS.05388}, timestamp = {Tue, 28 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jossw/ScheidgenHLSNFCGMBBGDLDANSDKMRDPK23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pvldb/CheungAHKLLWY23, author = {Alvin Cheung and Maaz Bin Safeer Ahmad and Brandon Haynes and Chanwut Kittivorawong and Shadaj Laddad and Xiaoxuan Liu and Chenglong Wang and Cong Yan}, title = {Towards Auto-Generated Data Systems}, journal = {Proc. {VLDB} Endow.}, volume = {16}, number = {12}, pages = {4116--4129}, year = {2023}, url = {https://www.vldb.org/pvldb/vol16/p4116-cheung.pdf}, doi = {10.14778/3611540.3611635}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pvldb/CheungAHKLLWY23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ral/ChenSL23, author = {Rui Chen and Alvin Shek and Changliu Liu}, title = {Robust and Context-Aware Real-Time Collaborative Robot Handling via Dynamic Gesture Commands}, journal = {{IEEE} Robotics Autom. Lett.}, volume = {8}, number = {6}, pages = {3510--3517}, year = {2023}, url = {https://doi.org/10.1109/LRA.2023.3268586}, doi = {10.1109/LRA.2023.3268586}, timestamp = {Tue, 19 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ral/ChenSL23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/csedu/ChanWGSL23, author = {Alvin Toong Shoon Chan and Peng{-}Cheng Wang and Frank Guan and Saw Han Soo and Haris Lim Hao Li}, title = {Integration of Virtual Reality with Intelligent Tutoring for High Fidelity Air Traffic Control Training}, booktitle = {Proceedings of the 15th International Conference on Computer Supported Education, {CSEDU} 2023, Prague, Czech Republic, April 21-23, 2023, Volume 2}, pages = {199--206}, year = {2023}, crossref = {DBLP:conf/csedu/2023-2}, url = {https://doi.org/10.5220/0011732200003470}, doi = {10.5220/0011732200003470}, timestamp = {Wed, 29 May 2024 11:49:33 +0200}, biburl = {https://dblp.org/rec/conf/csedu/ChanWGSL23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/WanHPXHGRS23, author = {Alvin Wan and Hanxiang Hao and Kaushik Patnaik and Yueyang Xu and Omer Hadad and David G{\"{u}}era and Zhile Ren and Qi Shan}, title = {{UPSCALE:} Unconstrained Channel Pruning}, booktitle = {International Conference on Machine Learning, {ICML} 2023, 23-29 July 2023, Honolulu, Hawaii, {USA}}, pages = {35384--35412}, year = {2023}, crossref = {DBLP:conf/icml/2023}, url = {https://proceedings.mlr.press/v202/wan23a.html}, timestamp = {Mon, 28 Aug 2023 17:23:08 +0200}, biburl = {https://dblp.org/rec/conf/icml/WanHPXHGRS23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/ShekSCL23, author = {Alvin Shek and Bo Ying Su and Rui Chen and Changliu Liu}, title = {Learning from Physical Human Feedback: An Object-Centric One-Shot Adaptation Method}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2023, London, UK, May 29 - June 2, 2023}, pages = {9910--9916}, year = {2023}, crossref = {DBLP:conf/icra/2023}, url = {https://doi.org/10.1109/ICRA48891.2023.10161416}, doi = {10.1109/ICRA48891.2023.10161416}, timestamp = {Tue, 19 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icra/ShekSCL23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/vr/YeoXCLCQG23, author = {Jin Qi Yeo and Xinxing Xia and Kan Chen and Malcolm Y. H. Low and Alvin Toong Shoon Chan and Dongyu Qiu and Frank Guan}, title = {{SPAT-VR:} {A} Holistic and Extensible Framework for {VR} Project Management}, booktitle = {{IEEE} Conference on Virtual Reality and 3D User Interfaces Abstracts and Workshops, {VR} Workshops 2023, Shanghai, China, March 25-29, 2023}, pages = {619--620}, year = {2023}, crossref = {DBLP:conf/vr/2023w}, url = {https://doi.org/10.1109/VRW58643.2023.00152}, doi = {10.1109/VRW58643.2023.00152}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/vr/YeoXCLCQG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2304-06175, author = {Rui Chen and Alvin Shek and Changliu Liu}, title = {Robust and Context-Aware Real-Time Collaborative Robot Handling via Dynamic Gesture Commands}, journal = {CoRR}, volume = {abs/2304.06175}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2304.06175}, doi = {10.48550/ARXIV.2304.06175}, eprinttype = {arXiv}, eprint = {2304.06175}, timestamp = {Tue, 19 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2304-06175.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2307-08771, author = {Alvin Wan and Hanxiang Hao and Kaushik Patnaik and Yueyang Xu and Omer Hadad and David G{\"{u}}era and Zhile Ren and Qi Shan}, title = {{UPSCALE:} Unconstrained Channel Pruning}, journal = {CoRR}, volume = {abs/2307.08771}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2307.08771}, doi = {10.48550/ARXIV.2307.08771}, eprinttype = {arXiv}, eprint = {2307.08771}, timestamp = {Tue, 25 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2307-08771.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2308-03276, author = {Chanwut Kittivorawong and Yongming Ge and Yousef Helal and Alvin Cheung}, title = {Spatialyze: {A} Geospatial Video Analytics System with Spatial-Aware Optimizations}, journal = {CoRR}, volume = {abs/2308.03276}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2308.03276}, doi = {10.48550/ARXIV.2308.03276}, eprinttype = {arXiv}, eprint = {2308.03276}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2308-03276.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cacm/AbadiAABBBBCCDD22, author = {Daniel Abadi and Anastasia Ailamaki and David G. Andersen and Peter Bailis and Magdalena Balazinska and Philip A. Bernstein and Peter A. Boncz and Surajit Chaudhuri and Alvin Cheung and AnHai Doan and Luna Dong and Michael J. Franklin and Juliana Freire and Alon Y. Halevy and Joseph M. Hellerstein and Stratos Idreos and Donald Kossmann and Tim Kraska and Sailesh Krishnamurthy and Volker Markl and Sergey Melnik and Tova Milo and C. Mohan and Thomas Neumann and Beng Chin Ooi and Fatma Ozcan and Jignesh M. Patel and Andrew Pavlo and Raluca A. Popa and Raghu Ramakrishnan and Christopher R{\'{e}} and Michael Stonebraker and Dan Suciu}, title = {The Seattle report on database research}, journal = {Commun. {ACM}}, volume = {65}, number = {8}, pages = {72--79}, year = {2022}, url = {https://doi.org/10.1145/3524284}, doi = {10.1145/3524284}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cacm/AbadiAABBBBCCDD22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/ChanMJOXXL22, author = {Alvin Chan and Lei Ma and Felix Juefei{-}Xu and Yew{-}Soon Ong and Xiaofei Xie and Minhui Xue and Yang Liu}, title = {Breaking Neural Reasoning Architectures With Metamorphic Relation-Based Adversarial Examples}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {33}, number = {11}, pages = {6976--6982}, year = {2022}, url = {https://doi.org/10.1109/TNNLS.2021.3072166}, doi = {10.1109/TNNLS.2021.3072166}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnn/ChanMJOXXL22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/embc/SahroniMW22, author = {Alvin Sahroni and Isnatin Miladiyah and Nur Widiasmara}, title = {Short-term Pulse Rate Variability to Assess Psychophysiological Changes during Online Trier Social Stress Test {(TSST)}}, booktitle = {44th Annual International Conference of the {IEEE} Engineering in Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland, United Kingdom, July 11-15, 2022}, pages = {1082--1085}, year = {2022}, crossref = {DBLP:conf/embc/2022}, url = {https://doi.org/10.1109/EMBC48229.2022.9871398}, doi = {10.1109/EMBC48229.2022.9871398}, timestamp = {Thu, 22 Sep 2022 19:31:35 +0200}, biburl = {https://dblp.org/rec/conf/embc/SahroniMW22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/AhmadIS22, author = {Siti Sarah Farhana Ahmad and Nurul Hazrina Idris and Alvin Lau Meng Shin}, title = {Coastline Changes Over Mangrove Forest in Setiu Malaysia Using a Long-Term Landsat Satellite Data}, booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS} 2022, Kuala Lumpur, Malaysia, July 17-22, 2022}, pages = {6809--6812}, year = {2022}, crossref = {DBLP:conf/igarss/2022}, url = {https://doi.org/10.1109/IGARSS46834.2022.9883142}, doi = {10.1109/IGARSS46834.2022.9883142}, timestamp = {Tue, 04 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/igarss/AhmadIS22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcai/ChanOT22, author = {Alvin Chan and Yew Soon Ong and Clement Tan}, title = {How Does Frequency Bias Affect the Robustness of Neural Image Classifiers against Common Corruption and Adversarial Perturbations?}, booktitle = {Proceedings of the Thirty-First International Joint Conference on Artificial Intelligence, {IJCAI} 2022, Vienna, Austria, 23-29 July 2022}, pages = {659--665}, year = {2022}, crossref = {DBLP:conf/ijcai/2022}, url = {https://doi.org/10.24963/ijcai.2022/93}, doi = {10.24963/IJCAI.2022/93}, timestamp = {Wed, 27 Jul 2022 16:43:00 +0200}, biburl = {https://dblp.org/rec/conf/ijcai/ChanOT22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcnn/NgocCBO22, author = {Nguyen Hong Ngoc and Alvin Chan and Huynh Thi Thanh Binh and Yew Soon Ong}, title = {Anti-Forensic Deepfake Personas and How To Spot Them}, booktitle = {International Joint Conference on Neural Networks, {IJCNN} 2022, Padua, Italy, July 18-23, 2022}, pages = {1--8}, year = {2022}, crossref = {DBLP:conf/ijcnn/2022}, url = {https://doi.org/10.1109/IJCNN55064.2022.9892357}, doi = {10.1109/IJCNN55064.2022.9892357}, timestamp = {Mon, 10 Oct 2022 17:40:09 +0200}, biburl = {https://dblp.org/rec/conf/ijcnn/NgocCBO22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ismar/ChanLC22, author = {Alvin Chan and Jeannie Su Ann Lee and Renjie Chen}, title = {Message from the {ISMAR} 2022 Demos Chairs}, booktitle = {2022 {IEEE} International Symposium on Mixed and Augmented Reality Adjunct (ISMAR-Adjunct), Singapore, Singapore, October 17-21, 2022}, pages = {xix}, year = {2022}, crossref = {DBLP:conf/ismar/2022a}, url = {https://doi.org/10.1109/ISMAR-Adjunct57072.2022.00007}, doi = {10.1109/ISMAR-ADJUNCT57072.2022.00007}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ismar/ChanLC22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ismar/QiuOXYXLWCG22, author = {Dongyu Qiu and Clemen Yu Da Ow and Xinxing Xia and Jin Qi Yeo and Jiazhi Xia and Malcolm Yoke Hean Low and Zhengkui Wang and Alvin Toong Shoon Chan and Frank Yunqing Guan}, title = {ViCollAR: {A} Novel System for 3D Data Visualization using Collaborative Augmented Reality}, booktitle = {2022 {IEEE} International Symposium on Mixed and Augmented Reality Adjunct (ISMAR-Adjunct), Singapore, Singapore, October 17-21, 2022}, pages = {907--908}, year = {2022}, crossref = {DBLP:conf/ismar/2022a}, url = {https://doi.org/10.1109/ISMAR-Adjunct57072.2022.00199}, doi = {10.1109/ISMAR-ADJUNCT57072.2022.00199}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ismar/QiuOXYXLWCG22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2203-04951, author = {Alvin Shek and Rui Chen and Changliu Liu}, title = {Learning from Physical Human Feedback: An Object-Centric One-Shot Adaptation Method}, journal = {CoRR}, volume = {abs/2203.04951}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2203.04951}, doi = {10.48550/ARXIV.2203.04951}, eprinttype = {arXiv}, eprint = {2203.04951}, timestamp = {Tue, 19 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2203-04951.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2205-03824, author = {Zhenghua Chen and Min Wu and Alvin Chan and Xiaoli Li and Yew{-}Soon Ong}, title = {A Survey on {AI} Sustainability: Emerging Trends on Learning Algorithms and Research Challenges}, journal = {CoRR}, volume = {abs/2205.03824}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2205.03824}, doi = {10.48550/ARXIV.2205.03824}, eprinttype = {arXiv}, eprint = {2205.03824}, timestamp = {Wed, 11 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2205-03824.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2205-04533, author = {Alvin Chan and Yew{-}Soon Ong and Clement Tan}, title = {How Does Frequency Bias Affect the Robustness of Neural Image Classifiers against Common Corruption and Adversarial Perturbations?}, journal = {CoRR}, volume = {abs/2205.04533}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2205.04533}, doi = {10.48550/ARXIV.2205.04533}, eprinttype = {arXiv}, eprint = {2205.04533}, timestamp = {Wed, 11 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2205-04533.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2211-07889, author = {Jessica Y. Bo and Hen{-}Wei Huang and Alvin Chan and Giovanni Traverso}, title = {Pretraining {ECG} Data with Adversarial Masking Improves Model Generalizability for Data-Scarce Tasks}, journal = {CoRR}, volume = {abs/2211.07889}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2211.07889}, doi = {10.48550/ARXIV.2211.07889}, eprinttype = {arXiv}, eprint = {2211.07889}, timestamp = {Wed, 23 Nov 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2211-07889.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@phdthesis{DBLP:phd/sg/Chan21, author = {Alvin Chan}, title = {Defences and threats in safe deep learning}, school = {Nanyang Technological University, Singapore}, year = {2021}, url = {https://doi.org/10.32657/10356/152976}, doi = {10.32657/10356/152976}, timestamp = {Thu, 27 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/phd/sg/Chan21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/ChanLJ21, author = {Alvin Chan and Martin D. Levine and Mehrsan Javan}, title = {Player Identification in Hockey Broadcast Videos}, journal = {Expert Syst. Appl.}, volume = {165}, pages = {113891}, year = {2021}, url = {https://doi.org/10.1016/j.eswa.2020.113891}, doi = {10.1016/J.ESWA.2020.113891}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eswa/ChanLJ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/midm/LaiCPKBSNDSGNCF21, author = {Alvina Grace Lai and Wai Hoong Chang and Constantinos A. Parisinos and Michail Katsoulis and Ruth M. Blackburn and Anoop D. Shah and Vincent Nguyen and Spiros C. Denaxas and George Davey Smith and Tom R. Gaunt and Krishnarajah Nirantharakumar and Murray P. Cox and Donall Forde and Folkert W. Asselbergs and Steve K. Harris and Sylvia Richardson and Reecha Sofat and Richard J. B. Dobson and Aroon D. Hingorani and Riyaz Patel and Jonathan Sterne and Amitava Banerjee and Alastair K. Denniston and Simon Ball and Neil J. Sebire and Nigam H. Shah and Graham R. Foster and Bryan Williams and Harry Hemingway}, title = {An informatics consult approach for generating clinical evidence for treatment decisions}, journal = {{BMC} Medical Informatics Decis. Mak.}, volume = {21}, number = {1}, pages = {281}, year = {2021}, url = {https://doi.org/10.1186/s12911-021-01638-z}, doi = {10.1186/S12911-021-01638-Z}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/midm/LaiCPKBSNDSGNCF21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tele/Zhou21, author = {Alvin Zhou}, title = {Causal effects of affordance change on communication behavior: Empirical evidence from organizational and leadership social media use}, journal = {Telematics Informatics}, volume = {59}, pages = {101549}, year = {2021}, url = {https://doi.org/10.1016/j.tele.2020.101549}, doi = {10.1016/J.TELE.2020.101549}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tele/Zhou21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/ZhangCTFW0SYL20, author = {Aston Zhang and Alvin Chan and Yi Tay and Jie Fu and Shuohang Wang and Shuai Zhang and Huajie Shao and Shuochao Yao and Roy Ka{-}Wei Lee}, title = {On Orthogonality Constraints for Transformers}, booktitle = {Proceedings of the 59th Annual Meeting of the Association for Computational Linguistics and the 11th International Joint Conference on Natural Language Processing, {ACL/IJCNLP} 2021, (Volume 2: Short Papers), Virtual Event, August 1-6, 2021}, pages = {375--382}, year = {2021}, crossref = {DBLP:conf/acl/2021-2}, url = {https://doi.org/10.18653/v1/2021.acl-short.48}, doi = {10.18653/V1/2021.ACL-SHORT.48}, timestamp = {Mon, 30 Sep 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/ZhangCTFW0SYL20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/chil/ChanKOWLP21, author = {Alvin Chan and Anna Korsakova and Yew{-}Soon Ong and Fernaldo Richtia Winnerdy and Kah Wai Lim and Anh Tuan Phan}, title = {{RNA} alternative splicing prediction with discrete compositional energy network}, booktitle = {{ACM} {CHIL} '21: {ACM} Conference on Health, Inference, and Learning, Virtual Event, USA, April 8-9, 2021}, pages = {193--203}, year = {2021}, crossref = {DBLP:conf/chil/2021}, url = {https://doi.org/10.1145/3450439.3451857}, doi = {10.1145/3450439.3451857}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/chil/ChanKOWLP21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/globecom/ZhengIPMALYYACP21, author = {Yao Zheng and Shekh Md Mahmudul Islam and Yanjun Pan and Marionne Millan and Samson Aggelopoulos and Brian Lu and Alvin Yang and Thomas Yang and Stephanie Aelmore and Willy Chang and Alana Power and Ming Li and Olga Boric{-}Lubecke and Victor Lubecke and Wenhai Sun}, title = {Insider-Resistant Context-Based Pairing for Multimodality Sleep Apnea Test}, booktitle = {{IEEE} Global Communications Conference, {GLOBECOM} 2021, Madrid, Spain, December 7-11, 2021}, pages = {1--6}, year = {2021}, crossref = {DBLP:conf/globecom/2021}, url = {https://doi.org/10.1109/GLOBECOM46510.2021.9685852}, doi = {10.1109/GLOBECOM46510.2021.9685852}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/globecom/ZhengIPMALYYACP21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/ChanOPZF21, author = {Alvin Chan and Yew{-}Soon Ong and Bill Pung and Aston Zhang and Jie Fu}, title = {CoCon: {A} Self-Supervised Approach for Controlled Text Generation}, booktitle = {9th International Conference on Learning Representations, {ICLR} 2021, Virtual Event, Austria, May 3-7, 2021}, year = {2021}, crossref = {DBLP:conf/iclr/2021}, url = {https://openreview.net/forum?id=VD\_ozqvBy4W}, timestamp = {Wed, 23 Jun 2021 17:36:39 +0200}, biburl = {https://dblp.org/rec/conf/iclr/ChanOPZF21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/ZhangT0CLHF21, author = {Aston Zhang and Yi Tay and Shuai Zhang and Alvin Chan and Anh Tuan Luu and Siu Cheung Hui and Jie Fu}, title = {Beyond Fully-Connected Layers with Quaternions: Parameterization of Hypercomplex Multiplications with 1/n Parameters}, booktitle = {9th International Conference on Learning Representations, {ICLR} 2021, Virtual Event, Austria, May 3-7, 2021}, year = {2021}, crossref = {DBLP:conf/iclr/2021}, url = {https://openreview.net/forum?id=rcQdycl0zyk}, timestamp = {Tue, 24 Sep 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iclr/ZhangT0CLHF21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/ChanMKN21, author = {Alvin Chan and Ali Madani and Ben Krause and Nikhil Naik}, title = {Deep Extrapolation for Attribute-Enhanced Generation}, booktitle = {Advances in Neural Information Processing Systems 34: Annual Conference on Neural Information Processing Systems 2021, NeurIPS 2021, December 6-14, 2021, virtual}, pages = {14084--14096}, year = {2021}, crossref = {DBLP:conf/nips/2021}, url = {https://proceedings.neurips.cc/paper/2021/hash/75da5036f659fe64b53f3d9b39412967-Abstract.html}, timestamp = {Tue, 03 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/nips/ChanMKN21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/ZhangTSCZ21, author = {Aston Zhang and Yi Tay and Yikang Shen and Alvin Chan and Shuai Zhang}, title = {Self-Instantiated Recurrent Units with Dynamic Soft Recursion}, booktitle = {Advances in Neural Information Processing Systems 34: Annual Conference on Neural Information Processing Systems 2021, NeurIPS 2021, December 6-14, 2021, virtual}, pages = {6503--6514}, year = {2021}, crossref = {DBLP:conf/nips/2021}, url = {https://proceedings.neurips.cc/paper/2021/hash/3341f6f048384ec73a7ba2e77d2db48b-Abstract.html}, timestamp = {Tue, 03 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/nips/ZhangTSCZ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2102-08597, author = {Aston Zhang and Yi Tay and Shuai Zhang and Alvin Chan and Anh Tuan Luu and Siu Cheung Hui and Jie Fu}, title = {Beyond Fully-Connected Layers with Quaternions: Parameterization of Hypercomplex Multiplications with 1/n Parameters}, journal = {CoRR}, volume = {abs/2102.08597}, year = {2021}, url = {https://arxiv.org/abs/2102.08597}, eprinttype = {arXiv}, eprint = {2102.08597}, timestamp = {Tue, 24 Sep 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2102-08597.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2103-04246, author = {Alvin Chan and Anna Korsakova and Yew{-}Soon Ong and Fernaldo Richtia Winnerdy and Kah Wai Lim and Anh Tuan Phan}, title = {{RNA} Alternative Splicing Prediction with Discrete Compositional Energy Network}, journal = {CoRR}, volume = {abs/2103.04246}, year = {2021}, url = {https://arxiv.org/abs/2103.04246}, eprinttype = {arXiv}, eprint = {2103.04246}, timestamp = {Tue, 16 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2103-04246.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2105-00314, author = {Yao Zheng and Shekh Md Mahmudul Islam and Yanjun Pan and Marionne Millan and Samson Aggelopoulos and Brian Lu and Alvin Yang and Thomas Yang and Stephanie Aelmore and Willy Chang and Alana Power and Ming Li and Olga Boric{-}Lubecke and Victor Lubecke and Wenhai Sun}, title = {Technical Report: Insider-Resistant Context-Based Pairing for Multimodality Sleep Apnea Test}, journal = {CoRR}, volume = {abs/2105.00314}, year = {2021}, url = {https://arxiv.org/abs/2105.00314}, eprinttype = {arXiv}, eprint = {2105.00314}, timestamp = {Mon, 30 Oct 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2105-00314.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2107-02968, author = {Alvin Chan and Ali Madani and Ben Krause and Nikhil Naik}, title = {Deep Extrapolation for Attribute-Enhanced Generation}, journal = {CoRR}, volume = {abs/2107.02968}, year = {2021}, url = {https://arxiv.org/abs/2107.02968}, eprinttype = {arXiv}, eprint = {2107.02968}, timestamp = {Tue, 20 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2107-02968.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2107-06747, author = {Arkadiusz Sitek and Sangtae Ahn and Evren Asma and Adam Chandler and Alvin Ihsani and Sven Prevrhal and Arman Rahmim and Babak Saboury and Kris Thielemans}, title = {Artificial Intelligence in {PET:} an Industry Perspective}, journal = {CoRR}, volume = {abs/2107.06747}, year = {2021}, url = {https://arxiv.org/abs/2107.06747}, eprinttype = {arXiv}, eprint = {2107.06747}, timestamp = {Wed, 21 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2107-06747.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2111-06046, author = {Chih{-}Pin Tan and Chin{-}Jui Chang and Alvin W. Y. Su and Yi{-}Hsuan Yang}, title = {Music Score Expansion with Variable-Length Infilling}, journal = {CoRR}, volume = {abs/2111.06046}, year = {2021}, url = {https://arxiv.org/abs/2111.06046}, eprinttype = {arXiv}, eprint = {2111.06046}, timestamp = {Tue, 16 Nov 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2111-06046.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2111-14031, author = {Bill Tuck Weng Pung and Alvin Chan}, title = {FastTrees: Parallel Latent Tree-Induction for Faster Sequence Encoding}, journal = {CoRR}, volume = {abs/2111.14031}, year = {2021}, url = {https://arxiv.org/abs/2111.14031}, eprinttype = {arXiv}, eprint = {2111.14031}, timestamp = {Wed, 01 Dec 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2111-14031.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2111-14034, author = {Bill Tuck Weng Pung and Alvin Chan}, title = {{ORCHARD:} {A} Benchmark For Measuring Systematic Generalization of Multi-Hierarchical Reasoning}, journal = {CoRR}, volume = {abs/2111.14034}, year = {2021}, url = {https://arxiv.org/abs/2111.14034}, eprinttype = {arXiv}, eprint = {2111.14034}, timestamp = {Wed, 01 Dec 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2111-14034.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2112-06020, author = {Rui Chen and Alvin Shek and Changliu Liu}, title = {Learn from Human Teams: a Probabilistic Solution to Real-Time Collaborative Robot Handling with Dynamic Gesture Commands}, journal = {CoRR}, volume = {abs/2112.06020}, year = {2021}, url = {https://arxiv.org/abs/2112.06020}, eprinttype = {arXiv}, eprint = {2112.06020}, timestamp = {Tue, 19 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2112-06020.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cga/HanCLJTCH20, author = {Ping{-}Hsuan Han and Yang{-}Sheng Chen and Iou{-}Shiuan Liu and Yu{-}Ping Jang and Ling Tsai and Alvin Chang and Yi{-}Ping Hung}, title = {A Compelling Virtual Tour of the Dunhuang Cave With an Immersive Head-Mounted Display}, journal = {{IEEE} Computer Graphics and Applications}, volume = {40}, number = {1}, pages = {40--55}, year = {2020}, url = {https://doi.org/10.1109/MCG.2019.2936753}, doi = {10.1109/MCG.2019.2936753}, timestamp = {Sat, 30 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cga/HanCLJTCH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijisscm/PhamTA20, author = {Thi{-}Ngan Pham and Albert Tan and Alvin Ang}, title = {Determining Safety Stock for an Omni-Channel Environment}, journal = {Int. J. Inf. Syst. Supply Chain Manag.}, volume = {13}, number = {2}, pages = {59--76}, year = {2020}, url = {https://doi.org/10.4018/IJISSCM.2020040104}, doi = {10.4018/IJISSCM.2020040104}, timestamp = {Tue, 08 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijisscm/PhamTA20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/TayOFCCLP20, author = {Yi Tay and Donovan Ong and Jie Fu and Alvin Chan and Nancy Chen and Anh Tuan Luu and Chris Pal}, title = {Would you Rather? {A} New Benchmark for Learning Machine Alignment with Cultural Values and Social Preferences}, booktitle = {Proceedings of the 58th Annual Meeting of the Association for Computational Linguistics, {ACL} 2020, Online, July 5-10, 2020}, pages = {5369--5373}, year = {2020}, crossref = {DBLP:conf/acl/2020}, url = {https://doi.org/10.18653/v1/2020.acl-main.477}, doi = {10.18653/V1/2020.ACL-MAIN.477}, timestamp = {Thu, 19 Sep 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/TayOFCCLP20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/ChanTO20, author = {Alvin Chan and Yi Tay and Yew{-}Soon Ong}, title = {What It Thinks Is Important Is Important: Robustness Transfers Through Input Gradients}, booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2020, Seattle, WA, USA, June 13-19, 2020}, pages = {329--338}, year = {2020}, crossref = {DBLP:conf/cvpr/2020}, url = {https://openaccess.thecvf.com/content\_CVPR\_2020/html/Chan\_What\_It\_Thinks\_Is\_Important\_Is\_Important\_Robustness\_Transfers\_Through\_CVPR\_2020\_paper.html}, doi = {10.1109/CVPR42600.2020.00041}, timestamp = {Tue, 31 Aug 2021 14:00:04 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/ChanTO20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/WanDZHTXWYXCVG20, author = {Alvin Wan and Xiaoliang Dai and Peizhao Zhang and Zijian He and Yuandong Tian and Saining Xie and Bichen Wu and Matthew Yu and Tao Xu and Kan Chen and Peter Vajda and Joseph E. Gonzalez}, title = {FBNetV2: Differentiable Neural Architecture Search for Spatial and Channel Dimensions}, booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2020, Seattle, WA, USA, June 13-19, 2020}, pages = {12962--12971}, year = {2020}, crossref = {DBLP:conf/cvpr/2020}, url = {https://openaccess.thecvf.com/content\_CVPR\_2020/html/Wan\_FBNetV2\_Differentiable\_Neural\_Architecture\_Search\_for\_Spatial\_and\_Channel\_Dimensions\_CVPR\_2020\_paper.html}, doi = {10.1109/CVPR42600.2020.01298}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/WanDZHTXWYXCVG20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/ChanTOZ20, author = {Alvin Chan and Yi Tay and Yew{-}Soon Ong and Aston Zhang}, title = {Poison Attacks against Text Datasets with Conditional Adversarially Regularized Autoencoder}, booktitle = {Findings of the Association for Computational Linguistics: {EMNLP} 2020, Online Event, 16-20 November 2020}, pages = {4175--4189}, year = {2020}, crossref = {DBLP:conf/emnlp/2020f}, url = {https://doi.org/10.18653/v1/2020.findings-emnlp.373}, doi = {10.18653/V1/2020.FINDINGS-EMNLP.373}, timestamp = {Tue, 20 Aug 2024 07:54:42 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/ChanTOZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hicss/LaiKRLLZWL20, author = {Gabriel Chun{-}Hei Lai and Ron Chi{-}Wai Kwok and Tina Rochelle and Alvin Chung{-}Man Leung and Yanyan Li and Shanshan Zhang and George Yui{-}Lam Wong and Angel Lu}, title = {The Moderating Effect of Different Types of Internet Use on the Relationship between Transitional Aging Changes and Self-esteem of Older Adults}, booktitle = {53rd Hawaii International Conference on System Sciences, {HICSS} 2020, Maui, Hawaii, USA, January 7-10, 2020}, pages = {1--10}, year = {2020}, crossref = {DBLP:conf/hicss/2020}, url = {https://hdl.handle.net/10125/64206}, timestamp = {Wed, 04 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/hicss/LaiKRLLZWL20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/ChanTOF20, author = {Alvin Chan and Yi Tay and Yew{-}Soon Ong and Jie Fu}, title = {Jacobian Adversarially Regularized Networks for Robustness}, booktitle = {8th International Conference on Learning Representations, {ICLR} 2020, Addis Ababa, Ethiopia, April 26-30, 2020}, year = {2020}, crossref = {DBLP:conf/iclr/2020}, url = {https://openreview.net/forum?id=Hke0V1rKPS}, timestamp = {Thu, 07 May 2020 17:11:47 +0200}, biburl = {https://dblp.org/rec/conf/iclr/ChanTOF20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/miccai/RothCSNLGGQIBWB20, author = {Holger R. Roth and Ken Chang and Praveer Singh and Nir Neumark and Wenqi Li and Vikash Gupta and Sharut Gupta and Liangqiong Qu and Alvin Ihsani and Bernardo C. Bizzo and Yuhong Wen and Varun Buch and Meesam Shah and Felipe Kitamura and Matheus Mendon{\c{c}}a and Vitor Lavor and Ahmed Harouni and Colin Compas and Jesse Tetreault and Prerna Dogra and Yan Cheng and Selnur Erdal and Richard D. White and Behrooz Hashemian and Thomas J. Schultz and Miao Zhang and Adam McCarthy and B. Min Yun and Elshaimaa Sharaf and Katharina Viktoria Hoebel and Jay B. Patel and Bryan Chen and Sean Ko and Evan Leibovitz and Etta D. Pisano and Laura Coombs and Daguang Xu and Keith J. Dreyer and Ittai Dayan and Ram C. Naidu and Mona Flores and Daniel L. Rubin and Jayashree Kalpathy{-}Cramer}, title = {Federated Learning for Breast Density Classification: {A} Real-World Implementation}, booktitle = {Domain Adaptation and Representation Transfer, and Distributed and Collaborative Learning - Second {MICCAI} Workshop, {DART} 2020, and First {MICCAI} Workshop, {DCL} 2020, Held in Conjunction with {MICCAI} 2020, Lima, Peru, October 4-8, 2020, Proceedings}, pages = {181--191}, year = {2020}, crossref = {DBLP:conf/miccai/2020dart}, url = {https://doi.org/10.1007/978-3-030-60548-3\_18}, doi = {10.1007/978-3-030-60548-3\_18}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miccai/RothCSNLGGQIBWB20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/miccai/ShinIXMSFC20, author = {Hoo{-}Chang Shin and Alvin Ihsani and Ziyue Xu and Swetha Mandava and Sharath Turuvekere Sreenivas and Christopher Forster and Jiook Cha}, title = {{GANDALF:} Generative Adversarial Networks with Discriminator-Adaptive Loss Fine-Tuning for Alzheimer's Disease Diagnosis from {MRI}}, booktitle = {Medical Image Computing and Computer Assisted Intervention - {MICCAI} 2020 - 23rd International Conference, Lima, Peru, October 4-8, 2020, Proceedings, Part {II}}, pages = {688--697}, year = {2020}, crossref = {DBLP:conf/miccai/2020-2}, url = {https://doi.org/10.1007/978-3-030-59713-9\_66}, doi = {10.1007/978-3-030-59713-9\_66}, timestamp = {Mon, 05 Oct 2020 18:46:15 +0200}, biburl = {https://dblp.org/rec/conf/miccai/ShinIXMSFC20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/vlsic/ChouCTLLKSCHL020, author = {Mao{-}Hsuan Chou and Ya{-}Tin Chang and Tsung{-}Hsien Tsai and Tsung{-}Che Lu and Chia{-}Chun Liao and Hung{-}Yi Kuo and Ruey{-}Bin Sheen and Chih{-}Hsien Chang and Kenny C.{-}H. Hsieh and Alvin Leng Sun Loke and Mark Chen}, title = {Embedded {PLL} Phase Noise Measurement Based on a {PFD/CP} {MASH} 1-1-1 {\(\Delta\)}{\(\Sigma\)} Time-to-Digital Converter in 7nm {CMOS}}, booktitle = {{IEEE} Symposium on {VLSI} Circuits, {VLSI} Circuits 2020, Honolulu, HI, USA, June 16-19, 2020}, pages = {1--2}, year = {2020}, crossref = {DBLP:conf/vlsic/2020}, url = {https://doi.org/10.1109/VLSICircuits18222.2020.9162789}, doi = {10.1109/VLSICIRCUITS18222.2020.9162789}, timestamp = {Fri, 01 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/vlsic/ChouCTLLKSCHL020.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2004-05565, author = {Alvin Wan and Xiaoliang Dai and Peizhao Zhang and Zijian He and Yuandong Tian and Saining Xie and Bichen Wu and Matthew Yu and Tao Xu and Kan Chen and Peter Vajda and Joseph E. Gonzalez}, title = {FBNetV2: Differentiable Neural Architecture Search for Spatial and Channel Dimensions}, journal = {CoRR}, volume = {abs/2004.05565}, year = {2020}, url = {https://arxiv.org/abs/2004.05565}, eprinttype = {arXiv}, eprint = {2004.05565}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2004-05565.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2006-03535, author = {Alvin Chan and Yew{-}Soon Ong and Bill Pung and Aston Zhang and Jie Fu}, title = {CoCon: {A} Self-Supervised Approach for Controlled Text Generation}, journal = {CoRR}, volume = {abs/2006.03535}, year = {2020}, url = {https://arxiv.org/abs/2006.03535}, eprinttype = {arXiv}, eprint = {2006.03535}, timestamp = {Tue, 09 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2006-03535.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2007-03201, author = {Jordan L. Melcher and Yao Zheng and Dylan Anthony and Matthew Troglia and Yanjun Pan and Ming Li and Thomas Yang and Alvin Yang and Samson Aggelopoulos}, title = {Demo: iJam with Channel Randomization}, journal = {CoRR}, volume = {abs/2007.03201}, year = {2020}, url = {https://arxiv.org/abs/2007.03201}, eprinttype = {arXiv}, eprint = {2007.03201}, timestamp = {Mon, 30 Oct 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2007-03201.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2008-04393, author = {Hoo{-}Chang Shin and Alvin Ihsani and Swetha Mandava and Sharath Turuvekere Sreenivas and Christopher Forster and Jiook Cha and Alzheimer's Disease Neuroimaging Initiative}, title = {{GANBERT:} Generative Adversarial Networks with Bidirectional Encoder Representations from Transformers for {MRI} to {PET} synthesis}, journal = {CoRR}, volume = {abs/2008.04393}, year = {2020}, url = {https://arxiv.org/abs/2008.04393}, eprinttype = {arXiv}, eprint = {2008.04393}, timestamp = {Mon, 17 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2008-04393.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2008-04396, author = {Hoo{-}Chang Shin and Alvin Ihsani and Ziyue Xu and Swetha Mandava and Sharath Turuvekere Sreenivas and Christopher Forster and Jiook Cha and Alzheimer's Disease Neuroimaging Initiative}, title = {{GANDALF:} Generative Adversarial Networks with Discriminator-Adaptive Loss Fine-tuning for Alzheimer's Disease Diagnosis from {MRI}}, journal = {CoRR}, volume = {abs/2008.04396}, year = {2020}, url = {https://arxiv.org/abs/2008.04396}, eprinttype = {arXiv}, eprint = {2008.04396}, timestamp = {Mon, 17 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2008-04396.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2009-01871, author = {Holger R. Roth and Ken Chang and Praveer Singh and Nir Neumark and Wenqi Li and Vikash Gupta and Sharut Gupta and Liangqiong Qu and Alvin Ihsani and Bernardo C. Bizzo and Yuhong Wen and Varun Buch and Meesam Shah and Felipe Kitamura and Matheus Mendon{\c{c}}a and Vitor Lavor and Ahmed Harouni and Colin Compas and Jesse Tetreault and Prerna Dogra and Yan Cheng and Selnur Erdal and Richard D. White and Behrooz Hashemian and Thomas J. Schultz and Miao Zhang and Adam McCarthy and B. Min Yun and Elshaimaa Sharaf and Katharina Viktoria Hoebel and Jay B. Patel and Bryan Chen and Sean Ko and Evan Leibovitz and Etta D. Pisano and Laura Coombs and Daguang Xu and Keith J. Dreyer and Ittai Dayan and Ram C. Naidu and Mona Flores and Daniel L. Rubin and Jayashree Kalpathy{-}Cramer}, title = {Federated Learning for Breast Density Classification: {A} Real-World Implementation}, journal = {CoRR}, volume = {abs/2009.01871}, year = {2020}, url = {https://arxiv.org/abs/2009.01871}, eprinttype = {arXiv}, eprint = {2009.01871}, timestamp = {Fri, 11 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2009-01871.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2009-02429, author = {Alvin Chan and Martin D. Levine and Mehrsan Javan}, title = {Player Identification in Hockey Broadcast Videos}, journal = {CoRR}, volume = {abs/2009.02429}, year = {2020}, url = {https://arxiv.org/abs/2009.02429}, eprinttype = {arXiv}, eprint = {2009.02429}, timestamp = {Wed, 16 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2009-02429.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2010-02684, author = {Alvin Chan and Yi Tay and Yew{-}Soon Ong and Aston Zhang}, title = {Poison Attacks against Text Datasets with Conditional Adversarially Regularized Autoencoder}, journal = {CoRR}, volume = {abs/2010.02684}, year = {2020}, url = {https://arxiv.org/abs/2010.02684}, eprinttype = {arXiv}, eprint = {2010.02684}, timestamp = {Mon, 12 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2010-02684.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/envsoft/RoyGANDS19, author = {Proteek Chandan Roy and Andrey K. Guber and Mohammad Abouali and A. Pouyan Nejadhashemi and Kalyanmoy Deb and Alvin J. M. Smucker}, title = {Crop yield simulation optimization using precision irrigation and subsurface water retention technology}, journal = {Environ. Model. Softw.}, volume = {119}, pages = {433--444}, year = {2019}, url = {https://doi.org/10.1016/j.envsoft.2019.07.006}, doi = {10.1016/J.ENVSOFT.2019.07.006}, timestamp = {Wed, 10 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/envsoft/RoyGANDS19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigmod/AbadiAABBBBCCDD19, author = {Daniel Abadi and Anastasia Ailamaki and David G. Andersen and Peter Bailis and Magdalena Balazinska and Philip A. Bernstein and Peter A. Boncz and Surajit Chaudhuri and Alvin Cheung and AnHai Doan and Luna Dong and Michael J. Franklin and Juliana Freire and Alon Y. Halevy and Joseph M. Hellerstein and Stratos Idreos and Donald Kossmann and Tim Kraska and Sailesh Krishnamurthy and Volker Markl and Sergey Melnik and Tova Milo and C. Mohan and Thomas Neumann and Beng Chin Ooi and Fatma Ozcan and Jignesh M. Patel and Andrew Pavlo and Raluca A. Popa and Raghu Ramakrishnan and Christopher R{\'{e}} and Michael Stonebraker and Dan Suciu}, title = {The Seattle Report on Database Research}, journal = {{SIGMOD} Rec.}, volume = {48}, number = {4}, pages = {44--53}, year = {2019}, url = {https://doi.org/10.1145/3385658.3385668}, doi = {10.1145/3385658.3385668}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigmod/AbadiAABBBBCCDD19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tifs/XueQZLZSC19, author = {Lei Xue and Chenxiong Qian and Hao Zhou and Xiapu Luo and Yajin Zhou and Yuru Shao and Alvin T. S. Chan}, title = {NDroid: Toward Tracking Information Flows Across Multiple Android Contexts}, journal = {{IEEE} Trans. Inf. Forensics Secur.}, volume = {14}, number = {3}, pages = {814--828}, year = {2019}, url = {https://doi.org/10.1109/TIFS.2018.2866347}, doi = {10.1109/TIFS.2018.2866347}, timestamp = {Mon, 05 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tifs/XueQZLZSC19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cascon/ChangTLJSK19, author = {Yee{-}Kang Chang and Patrick Tiu and Eric Lau and Leo Christy Jesuraj and Alvin So and Gilbert Kwan}, title = {Hands-on workshop on fast, efficient {\&} seriously open cloud-native Java}, booktitle = {Proceedings of the 29th Annual International Conference on Computer Science and Software Engineering, {CASCON} 2019, Markham, Ontario, Canada, November 4-6, 2019}, pages = {373--375}, year = {2019}, crossref = {DBLP:conf/cascon/2019}, url = {https://dl.acm.org/doi/10.5555/3370272.3370322}, doi = {10.5555/3370272.3370322}, timestamp = {Wed, 04 May 2022 13:02:28 +0200}, biburl = {https://dblp.org/rec/conf/cascon/ChangTLJSK19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emo/RoyGANDS19, author = {Proteek Chandan Roy and Andrey K. Guber and Mohammad Abouali and A. Pouyan Nejadhashemi and Kalyanmoy Deb and Alvin J. M. Smucker}, title = {Simulation Optimization of Water Usage and Crop Yield Using Precision Irrigation}, booktitle = {Evolutionary Multi-Criterion Optimization - 10th International Conference, {EMO} 2019, East Lansing, MI, USA, March 10-13, 2019, Proceedings}, pages = {695--706}, year = {2019}, crossref = {DBLP:conf/emo/2019}, url = {https://doi.org/10.1007/978-3-030-12598-1\_55}, doi = {10.1007/978-3-030-12598-1\_55}, timestamp = {Wed, 10 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emo/RoyGANDS19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccsci/DewiMC19, author = {Lusiana Citra Dewi and Meiliana and Alvin Chandra}, title = {Social Media Web Scraping using Social Media Developers {API} and Regex}, booktitle = {Enabling Collaboration to Escalate Impact of Research Results for Society: The 4th International Conference on Computer Science and Computational Intelligence, {ICCSCI} 2019, 12-13 September 2019, Yogyakarta, Indonesia}, pages = {444--449}, year = {2019}, crossref = {DBLP:conf/iccsci/2019}, url = {https://doi.org/10.1016/j.procs.2019.08.237}, doi = {10.1016/J.PROCS.2019.08.237}, timestamp = {Fri, 19 Apr 2024 13:31:15 +0200}, biburl = {https://dblp.org/rec/conf/iccsci/DewiMC19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tale/KwanTC19, author = {Alvin C. M. Kwan and Kenny C. W. Tang and Karie Chan}, title = {Impacts of Online Academic Help-Seeking Behaviors on Undergraduate Student Self-Learning}, booktitle = {{IEEE} International Conference on Engineering, Technology and Education, {TALE} 2019, Yogyakarta, Indonesia, December 10-13, 2019}, pages = {1--7}, year = {2019}, crossref = {DBLP:conf/tale/2019}, url = {https://doi.org/10.1109/TALE48000.2019.9226027}, doi = {10.1109/TALE48000.2019.9226027}, timestamp = {Tue, 10 Nov 2020 09:31:22 +0100}, biburl = {https://dblp.org/rec/conf/tale/KwanTC19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1911-08040, author = {Alvin Chan and Yew{-}Soon Ong}, title = {Poison as a Cure: Detecting {\&} Neutralizing Variable-Sized Backdoor Attacks in Deep Neural Networks}, journal = {CoRR}, volume = {abs/1911.08040}, year = {2019}, url = {http://arxiv.org/abs/1911.08040}, eprinttype = {arXiv}, eprint = {1911.08040}, timestamp = {Tue, 03 Dec 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1911-08040.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1912-05699, author = {Alvin Chan and Yi Tay and Yew{-}Soon Ong}, title = {What it Thinks is Important is Important: Robustness Transfers through Input Gradients}, journal = {CoRR}, volume = {abs/1912.05699}, year = {2019}, url = {http://arxiv.org/abs/1912.05699}, eprinttype = {arXiv}, eprint = {1912.05699}, timestamp = {Thu, 02 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1912-05699.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1912-10185, author = {Alvin Chan and Yi Tay and Yew{-}Soon Ong and Jie Fu}, title = {Jacobian Adversarially Regularized Networks for Robustness}, journal = {CoRR}, volume = {abs/1912.10185}, year = {2019}, url = {http://arxiv.org/abs/1912.10185}, eprinttype = {arXiv}, eprint = {1912.10185}, timestamp = {Fri, 03 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1912-10185.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcai/ChienSCL18, author = {Isabel Chien and Alvin Shi and Alex Chan and Charlotta Lindvall}, title = {Identification of serious illness conversations in unstructured clinical notes using deep neural networks}, booktitle = {Proceedings of the First Joint Workshop on {AI} in Health organized as part of the Federated {AI} Meeting {(FAIM} 2018), co-located with {AAMAS} 2018, {ICML} 2018, {IJCAI} 2018 and {ICCBR} 2018, Stockholm, Sweden, July 13-14, 2018}, pages = {125--139}, year = {2018}, crossref = {DBLP:conf/ijcai/2018aih}, url = {https://ceur-ws.org/Vol-2142/paper8.pdf}, timestamp = {Fri, 10 Mar 2023 16:23:31 +0100}, biburl = {https://dblp.org/rec/conf/ijcai/ChienSCL18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcai/ChienSCL18a, author = {Isabel Chien and Alvin Shi and Alex Chan and Charlotta Lindvall}, title = {Identification of Serious Illness Conversations in Unstructured Clinical Notes Using Deep Neural Networks}, booktitle = {Artificial Intelligence in Health - First International Workshop, AIH@IJCAI 2018, Stockholm, Sweden, July 13-14, 2018, Revised Selected Papers}, pages = {199--212}, year = {2018}, crossref = {DBLP:conf/ijcai/2018aih-s}, url = {https://doi.org/10.1007/978-3-030-12738-1\_15}, doi = {10.1007/978-3-030-12738-1\_15}, timestamp = {Wed, 12 Jan 2022 09:08:26 +0100}, biburl = {https://dblp.org/rec/conf/ijcai/ChienSCL18a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/intcompsymp/MuchtarRMDDNC18, author = {Kahlil Muchtar and Faris Rahman and Muhammad Rizky Munggaran and Alvin Prayuda Juniarta Dwiyantoro and Richard Dharmadi and Indra Nugraha and Chuan{-}Yu Chang}, title = {An Efficient Event Detection Through Background Subtraction and Deep Convolutional Nets}, booktitle = {New Trends in Computer Technologies and Applications - 23rd International Computer Symposium, {ICS} 2018, Yunlin, Taiwan, December 20-22, 2018, Revised Selected Papers}, pages = {163--167}, year = {2018}, crossref = {DBLP:conf/intcompsymp/2018}, url = {https://doi.org/10.1007/978-981-13-9190-3\_16}, doi = {10.1007/978-981-13-9190-3\_16}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/intcompsymp/MuchtarRMDDNC18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1809-02444, author = {Alvin Chan and Lei Ma and Felix Juefei{-}Xu and Xiaofei Xie and Yang Liu and Yew{-}Soon Ong}, title = {Metamorphic Relation Based Adversarial Attacks on Differentiable Neural Computer}, journal = {CoRR}, volume = {abs/1809.02444}, year = {2018}, url = {http://arxiv.org/abs/1809.02444}, eprinttype = {arXiv}, eprint = {1809.02444}, timestamp = {Tue, 03 Dec 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1809-02444.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/chi/BeirlZCLZ17, author = {Diana Beirl and Anya Zeitlin and Jerald Chan and Kai Ip Alvin Loh and Xiaodi Zhong}, title = {GotYourBack: An Internet of Toilets for the Trans* Community}, booktitle = {Proceedings of the 2017 {CHI} Conference on Human Factors in Computing Systems, Denver, CO, USA, May 06-11, 2017, Extended Abstracts}, pages = {39--45}, year = {2017}, crossref = {DBLP:conf/chi/2017a}, url = {https://doi.org/10.1145/3027063.3049272}, doi = {10.1145/3027063.3049272}, timestamp = {Tue, 06 Nov 2018 16:58:46 +0100}, biburl = {https://dblp.org/rec/conf/chi/BeirlZCLZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccad/ChangWGZZ0Z17, author = {Liang Chang and Zhaohao Wang and Alvin Oliver Glova and Jishen Zhao and Youguang Zhang and Yuan Xie and Weisheng Zhao}, title = {{PRESCOTT:} Preset-based cross-point architecture for spin-orbit-torque magnetic random access memory}, booktitle = {2017 {IEEE/ACM} International Conference on Computer-Aided Design, {ICCAD} 2017, Irvine, CA, USA, November 13-16, 2017}, pages = {245--252}, year = {2017}, crossref = {DBLP:conf/iccad/2017}, url = {https://doi.org/10.1109/ICCAD.2017.8203785}, doi = {10.1109/ICCAD.2017.8203785}, timestamp = {Tue, 07 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iccad/ChangWGZZ0Z17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccsce/BalbinVAACI17, author = {Jessie R. Balbin and Leonardo D. Valiente and Danielle Jaye S. Agron and Alvin Vincent R. Antioquia and Glenn D. Cua and John Clement S. Ibo}, title = {Assessment of the standard level of oreochromis niloticus and chanos chanos located in fish pen and wet market storage based on viola-jones, thresholding and L{\({_\ast}\)}a{\({_\ast}\)}b color space}, booktitle = {7th {IEEE} International Conference on Control System, Computing and Engineering, {ICCSCE} 2017, Penang, Malaysia, November 24-26, 2017}, pages = {258--262}, year = {2017}, crossref = {DBLP:conf/iccsce/2017}, url = {https://doi.org/10.1109/ICCSCE.2017.8284415}, doi = {10.1109/ICCSCE.2017.8284415}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iccsce/BalbinVAACI17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cj/ZhangJLC16, author = {Tao Zhang and He Jiang and Xiapu Luo and Alvin T. S. Chan}, title = {A Literature Review of Research in Bug Resolution: Tasks, Challenges and Future Directions}, journal = {Comput. J.}, volume = {59}, number = {5}, pages = {741--773}, year = {2016}, url = {https://doi.org/10.1093/comjnl/bxv114}, doi = {10.1093/COMJNL/BXV114}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cj/ZhangJLC16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijseke/ZhangYLC16, author = {Tao Zhang and Geunseok Yang and Byungjeong Lee and Alvin T. S. Chan}, title = {Guiding Bug Triage through Developer Analysis in Bug Reports}, journal = {Int. J. Softw. Eng. Knowl. Eng.}, volume = {26}, number = {3}, pages = {405--432}, year = {2016}, url = {https://doi.org/10.1142/S0218194016500170}, doi = {10.1142/S0218194016500170}, timestamp = {Wed, 22 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijseke/ZhangYLC16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iiaiaai/ChenLCLC16, author = {Der{-}Fa Chen and Chun Hsu Lu and Alvin Chang and Hsieh His Liu and Kuo Chih Cheng}, title = {The Relationships among Budgetary Slack, Customers' Relationship Quality and Organizational Performance}, booktitle = {5th {IIAI} International Congress on Advanced Applied Informatics, {IIAI-AAI} 2016, Kumamoto, Japan, July 10-14, 2016}, pages = {1157--1161}, year = {2016}, crossref = {DBLP:conf/iiaiaai/2016}, url = {https://doi.org/10.1109/IIAI-AAI.2016.24}, doi = {10.1109/IIAI-AAI.2016.24}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iiaiaai/ChenLCLC16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/qtna/TamVTK16, author = {La Thanh Tam and Alvin C. Valera and Hwee{-}Pink Tan and Cheryl Koh}, title = {Online Detection of Behavioral Change Using Unobtrusive Eldercare Monitoring System}, booktitle = {Proceedings of the 11th International Conference on Queueing Theory and Network Applications, {QTNA} 2016, Wellington, New Zealand, December 13-15, 2016}, pages = {16}, year = {2016}, crossref = {DBLP:conf/qtna/2016}, url = {http://dl.acm.org/citation.cfm?id=3016053}, timestamp = {Tue, 06 Nov 2018 16:57:05 +0100}, biburl = {https://dblp.org/rec/conf/qtna/TamVTK16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigcomm/SivaramanCBKABV16, author = {Anirudh Sivaraman and Alvin Cheung and Mihai Budiu and Changhoon Kim and Mohammad Alizadeh and Hari Balakrishnan and George Varghese and Nick McKeown and Steve Licking}, title = {Packet Transactions: High-Level Programming for Line-Rate Switches}, booktitle = {Proceedings of the {ACM} {SIGCOMM} 2016 Conference, Florianopolis, Brazil, August 22-26, 2016}, pages = {15--28}, year = {2016}, crossref = {DBLP:conf/sigcomm/2016}, url = {https://doi.org/10.1145/2934872.2934900}, doi = {10.1145/2934872.2934900}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sigcomm/SivaramanCBKABV16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ahswn/ShiWC15, author = {Peizhong Shi and Yun Wang and Alvin T. S. Chan}, title = {{ECA-CTP:} An Enhanced Congestion Avoidance Mechanism for the {CTP} Protocol in Wireless Sensor Networks}, journal = {Ad Hoc Sens. Wirel. Networks}, volume = {28}, number = {3-4}, pages = {289--317}, year = {2015}, url = {http://www.oldcitypublishing.com/journals/ahswn-home/ahswn-issue-contents/ahswn-volume-28-number-3-4-2015/ahswn-28-3-4-p-289-317/}, timestamp = {Sat, 25 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ahswn/ShiWC15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/chinaf/WangDSCC15, author = {Huaimin Wang and Bo Ding and Dian{-}xi Shi and Jiannong Cao and Alvin T. S. Chan}, title = {Auxo: an architecture-centric framework supporting the online tuning of software adaptivity}, journal = {Sci. China Inf. Sci.}, volume = {58}, number = {9}, pages = {1--15}, year = {2015}, url = {https://doi.org/10.1007/s11432-015-5307-9}, doi = {10.1007/S11432-015-5307-9}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/chinaf/WangDSCC15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/interfaces/AndersonAGRRSU15, author = {Ross Anderson and Itai Ashlagi and David Gamarnik and Michael Rees and Alvin E. Roth and Tayfun S{\"{o}}nmez and M. Utku {\"{U}}nver}, title = {Kidney Exchange and the Alliance for Paired Donation: Operations Research Changes the Way Kidneys Are Transplanted}, journal = {Interfaces}, volume = {45}, number = {1}, pages = {26--42}, year = {2015}, url = {https://doi.org/10.1287/inte.2014.0766}, doi = {10.1287/INTE.2014.0766}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/interfaces/AndersonAGRRSU15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcsci/AdriantoYC15, author = {Dennise Adrianto and Violitta Yesmaya and Alvin Chandra}, title = {Increasing Learning Frequency through Education Based Game}, journal = {J. Comput. Sci.}, volume = {11}, number = {3}, pages = {567--572}, year = {2015}, url = {https://doi.org/10.3844/jcssp.2015.567.572}, doi = {10.3844/JCSSP.2015.567.572}, timestamp = {Sat, 25 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jcsci/AdriantoYC15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jsac/ChanZNNVTG15, author = {Wai Hong Ronald Chan and Pengfei Zhang and Ido Nevat and Sai Ganesh Nagarajan and Alvin C. Valera and Hwee{-}Xian Tan and Natarajan Gautam}, title = {Adaptive Duty Cycling in Sensor Networks With Energy Harvesting Using Continuous-Time Markov Chain and Fluid Models}, journal = {{IEEE} J. Sel. Areas Commun.}, volume = {33}, number = {12}, pages = {2687--2700}, year = {2015}, url = {https://doi.org/10.1109/JSAC.2015.2478717}, doi = {10.1109/JSAC.2015.2478717}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jsac/ChanZNNVTG15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jss/HuangCTCL15, author = {Rubing Huang and Jinfu Chen and Dave Towey and Alvin T. S. Chan and Yansheng Lu}, title = {Aggregate-strength interaction test suite prioritization}, journal = {J. Syst. Softw.}, volume = {99}, pages = {36--51}, year = {2015}, url = {https://doi.org/10.1016/j.jss.2014.09.002}, doi = {10.1016/J.JSS.2014.09.002}, timestamp = {Tue, 18 May 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jss/HuangCTCL15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/mr/SethuNCOC15, author = {Raj Sekar Sethu and Hong Seng Ng and Alvin Chan and Cheng Nee Ong and Sieng Fong Chan}, title = {Characterization of copper precipitates on aluminum copper bond pads formed after plasma clean and de-ionized water exposure}, journal = {Microelectron. Reliab.}, volume = {55}, number = {7}, pages = {1101--1108}, year = {2015}, url = {https://doi.org/10.1016/j.microrel.2015.03.018}, doi = {10.1016/J.MICROREL.2015.03.018}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/mr/SethuNCOC15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tc/LiuXZBC15, author = {Xuan Liu and Bin Xiao and Shigeng Zhang and Kai Bu and Alvin Chan}, title = {{STEP:} {A} Time-Efficient Tag Searching Protocol in Large {RFID} Systems}, journal = {{IEEE} Trans. Computers}, volume = {64}, number = {11}, pages = {3265--3277}, year = {2015}, url = {https://doi.org/10.1109/TC.2015.2394461}, doi = {10.1109/TC.2015.2394461}, timestamp = {Wed, 23 Aug 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tc/LiuXZBC15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amcis/ChangHLL15, author = {Alvin Chang and Ting{-}Kai Hwang and Yung{-}Ming Li and Lien{-}Fa Lin}, title = {A Contextual Group Recommender Mechanism for Location-based Service}, booktitle = {21st Americas Conference on Information Systems, {AMCIS} 2015, Puerto Rico, August 13-15, 2015}, year = {2015}, crossref = {DBLP:conf/amcis/2015}, url = {http://aisel.aisnet.org/amcis2015/e-Biz/GeneralPresentations/2}, timestamp = {Sun, 13 Dec 2015 13:10:52 +0100}, biburl = {https://dblp.org/rec/conf/amcis/ChangHLL15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/compsac/LeongCN15, author = {Hong Va Leong and Alvin T. S. Chan and Grace Ngai}, title = {Approximate Web Database Snapshots}, booktitle = {39th {IEEE} Annual Computer Software and Applications Conference, {COMPSAC} 2015, Taichung, Taiwan, July 1-5, 2015. Volume 2}, pages = {367--376}, year = {2015}, crossref = {DBLP:conf/compsac/2015}, url = {https://doi.org/10.1109/COMPSAC.2015.144}, doi = {10.1109/COMPSAC.2015.144}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/compsac/LeongCN15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icc/ChanZZNVTG15, author = {Wai Hong Ronald Chan and Pengfei Zhang and Wenyu Zhang and Ido Nevat and Alvin C. Valera and Hwee{-}Xian Tan and Natarajan Gautam}, title = {Adaptive duty cycling in sensor networks via Continuous Time Markov Chain modelling}, booktitle = {2015 {IEEE} International Conference on Communications, {ICC} 2015, London, United Kingdom, June 8-12, 2015}, pages = {6669--6674}, year = {2015}, crossref = {DBLP:conf/icc/2015}, url = {https://doi.org/10.1109/ICC.2015.7249388}, doi = {10.1109/ICC.2015.7249388}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icc/ChanZZNVTG15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sac/ZhangYLC15, author = {Tao Zhang and Geunseok Yang and Byungjeong Lee and Alvin T. S. Chan}, title = {Predicting severity of bug report by mining bug repository with concept profile}, booktitle = {Proceedings of the 30th Annual {ACM} Symposium on Applied Computing, Salamanca, Spain, April 13-17, 2015}, pages = {1553--1558}, year = {2015}, crossref = {DBLP:conf/sac/2015}, url = {https://doi.org/10.1145/2695664.2695872}, doi = {10.1145/2695664.2695872}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sac/ZhangYLC15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/SivaramanBCKLVB15, author = {Anirudh Sivaraman and Mihai Budiu and Alvin Cheung and Changhoon Kim and Steve Licking and George Varghese and Hari Balakrishnan and Mohammad Alizadeh and Nick McKeown}, title = {Packet Transactions: {A} Programming Model for Data-Plane Algorithms at Hardware Speed}, journal = {CoRR}, volume = {abs/1512.05023}, year = {2015}, url = {http://arxiv.org/abs/1512.05023}, eprinttype = {arXiv}, eprint = {1512.05023}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/SivaramanBCKLVB15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ejasmp/LinWCCCS14, author = {Yi{-}Ju Lin and Tien{-}Ming Wang and Ta{-}Chun Chen and Yin{-}Lin Chen and Wei{-}Chen Chang and Alvin Wen{-}Yu Su}, title = {Musical note analysis of solo violin recordings using recursive regularization}, journal = {{EURASIP} J. Audio Speech Music. Process.}, volume = {2014}, pages = {25}, year = {2014}, url = {https://doi.org/10.1186/s13636-014-0025-6}, doi = {10.1186/S13636-014-0025-6}, timestamp = {Tue, 29 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ejasmp/LinWCCCS14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jssc/BoersAVSNAPCKSCYPNYBKZCSRR14, author = {Michael Boers and Bagher Afshar and Iason Vassiliou and Saikat Sarkar and Sean T. Nicolson and Ehsan Adabi and Bevin George Perumana and Theodoros Chalvatzis and Spyros Kavvadias and Padmanava Sen and Wei Liat Chan and Alvin Hsing{-}Ting Yu and Ali Parsa and Med Nariman and Seunghwan Yoon and Alfred Grau Besoli and Chryssoula A. Kyriazidou and Gerasimos Zochios and Jesus A. Castaneda and Tirdad Sowlati and Maryam Rofougaran and Ahmadreza Rofougaran}, title = {A 16TX/16RX 60 GHz 802.11ad Chipset With Single Coaxial Interface and Polarization Diversity}, journal = {{IEEE} J. Solid State Circuits}, volume = {49}, number = {12}, pages = {3031--3045}, year = {2014}, url = {https://doi.org/10.1109/JSSC.2014.2356462}, doi = {10.1109/JSSC.2014.2356462}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jssc/BoersAVSNAPCKSCYPNYBKZCSRR14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jssc/WangWLZDWMSWCWJY14, author = {X. Shawn Wang and Xin Wang and Fei Lu and Chen Zhang and Zongyu Dong and Li Wang and Rui Ma and Zitao Shi and Albert Z. Wang and Mau{-}Chung Frank Chang and Dawn Wang and Alvin J. Joseph and C. Patrick Yue}, title = {Concurrent Design Analysis of High-Linearity {SP10T} Switch With 8.5 kV {ESD} Protection}, journal = {{IEEE} J. Solid State Circuits}, volume = {49}, number = {9}, pages = {1927--1941}, year = {2014}, url = {https://doi.org/10.1109/JSSC.2014.2331956}, doi = {10.1109/JSSC.2014.2331956}, timestamp = {Mon, 08 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jssc/WangWLZDWMSWCWJY14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcad/ChangLCLSY14, author = {Da{-}Wei Chang and Ing{-}Chao Lin and Yu{-}Shiang Chien and Ching{-}Lun Lin and Alvin W. Y. Su and Chung{-}Ping Young}, title = {{CASA:} Contention-Aware Scratchpad Memory Allocation for Online Hybrid On-Chip Memory Management}, journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.}, volume = {33}, number = {12}, pages = {1806--1817}, year = {2014}, url = {https://doi.org/10.1109/TCAD.2014.2363385}, doi = {10.1109/TCAD.2014.2363385}, timestamp = {Thu, 24 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcad/ChangLCLSY14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsn/QianLSC14, author = {Chenxiong Qian and Xiapu Luo and Yuru Shao and Alvin T. S. Chan}, title = {On Tracking Information Flows through {JNI} in Android Applications}, booktitle = {44th Annual {IEEE/IFIP} International Conference on Dependable Systems and Networks, {DSN} 2014, Atlanta, GA, USA, June 23-26, 2014}, pages = {180--191}, year = {2014}, crossref = {DBLP:conf/dsn/2014}, url = {https://doi.org/10.1109/DSN.2014.30}, doi = {10.1109/DSN.2014.30}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dsn/QianLSC14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ismir/HsuWLMS14, author = {Ling{-}Chi Hsu and Yu{-}Lin Wang and Yi{-}Ju Lin and Cheryl D. Metcalf and Alvin W. Y. Su}, title = {Detection of Motor Changes in Violin Playing by {EMG} Signals}, booktitle = {Proceedings of the 15th International Society for Music Information Retrieval Conference, {ISMIR} 2014, Taipei, Taiwan, October 27-31, 2014}, pages = {495--500}, year = {2014}, crossref = {DBLP:conf/ismir/2014}, url = {http://www.terasoft.com.tw/conf/ismir2014/proceedings/T090\_227\_Paper.pdf}, timestamp = {Tue, 04 Jan 2022 10:38:12 +0100}, biburl = {https://dblp.org/rec/conf/ismir/HsuWLMS14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isscc/BoersVSNAAPCKSC14, author = {Michael Boers and Iason Vassiliou and Saikat Sarkar and Sean T. Nicolson and Ehsan Adabi and Bagher Afshar and Bevin G. Perumana and Theodoros Chalvatzis and Spyros Kavadias and Padmanava Sen and Wei Liat Chan and Alvin Hsing{-}Ting Yu and Ali Parsa and Med Nariman and Seunghwan Yoon and Alfred Grau Besoli and Chryssoula A. Kyriazidou and Gerasimos Zochios and Namik Kocaman and Adesh Garg and Hans Eberhart and Phil Yang and Hongyu Xie and Hea Joung Kim and Alireza Tarighat Mehrabani and David Garrett and Andrew J. Blanksby and Mong Kuan Wong and Durai Pandian Thirupathi and Siukai Mak and Radha Srinivasan and Amir Ibrahim and Ersin Sengul and Vincent Roussel and Po{-}Chao Huang and Tsuifang Yeh and Murat Mese and Jesus A. Castaneda and Brima Ibrahim and Tirdad Sowlati and Maryam Rofougaran and Ahmadreza Rofougaran}, title = {20.2 {A} 16TX/16RX 60GHz 802.11ad chipset with single coaxial interface and polarization diversity}, booktitle = {2014 {IEEE} International Conference on Solid-State Circuits Conference, {ISSCC} 2014, Digest of Technical Papers, San Francisco, CA, USA, February 9-13, 2014}, pages = {344--345}, year = {2014}, crossref = {DBLP:conf/isscc/2014}, url = {https://doi.org/10.1109/ISSCC.2014.6757462}, doi = {10.1109/ISSCC.2014.6757462}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/isscc/BoersVSNAAPCKSC14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mm/LiNCHLC14, author = {Jiajia Li and Grace Ngai and Stephen Chi{-}fai Chan and Kien A. Hua and Hong Va Leong and Alvin T. S. Chan}, title = {From Writing to Painting: {A} Kinect-Based Cross-Modal Chinese Painting Generation System}, booktitle = {Proceedings of the {ACM} International Conference on Multimedia, {MM} '14, Orlando, FL, USA, November 03 - 07, 2014}, pages = {57--66}, year = {2014}, crossref = {DBLP:conf/mm/2014}, url = {https://doi.org/10.1145/2647868.2654911}, doi = {10.1145/2647868.2654911}, timestamp = {Sun, 02 Jun 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mm/LiNCHLC14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/percom/WeiC13, author = {Edwin J. Y. Wei and Alvin T. S. Chan}, title = {{CAMPUS:} {A} middleware for automated context-aware adaptation decision making at run time}, journal = {Pervasive Mob. Comput.}, volume = {9}, number = {1}, pages = {35--56}, year = {2013}, url = {https://doi.org/10.1016/j.pmcj.2011.10.002}, doi = {10.1016/J.PMCJ.2011.10.002}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/percom/WeiC13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigmetrics/YangCYLHC13, author = {Lei Yang and Jiannong Cao and Yin Yuan and Tao Li and Andy Han and Alvin T. S. Chan}, title = {A framework for partitioning and execution of data stream applications in mobile cloud computing}, journal = {{SIGMETRICS} Perform. Evaluation Rev.}, volume = {40}, number = {4}, pages = {23--32}, year = {2013}, url = {https://doi.org/10.1145/2479942.2479946}, doi = {10.1145/2479942.2479946}, timestamp = {Sat, 25 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigmetrics/YangCYLHC13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tist/ChinXWCWZ13, author = {Alvin Chin and Bin Xu and Hao Wang and Lele Chang and Hao Wang and Lijun Zhu}, title = {Connecting people through physical proximity and physical resources at a conference}, journal = {{ACM} Trans. Intell. Syst. Technol.}, volume = {4}, number = {3}, pages = {50:1--50:21}, year = {2013}, url = {https://doi.org/10.1145/2483669.2483683}, doi = {10.1145/2483669.2483683}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tist/ChinXWCWZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/apsipa/LinCS13, author = {Yi{-}Ju Lin and Wei{-}Chen Chang and Alvin W. Y. Su}, title = {Quantitative evaluation of violin solo performance}, booktitle = {Asia-Pacific Signal and Information Processing Association Annual Summit and Conference, {APSIPA} 2013, Kaohsiung, Taiwan, October 29 - November 1, 2013}, pages = {1--6}, year = {2013}, crossref = {DBLP:conf/apsipa/2013}, url = {https://doi.org/10.1109/APSIPA.2013.6694296}, doi = {10.1109/APSIPA.2013.6694296}, timestamp = {Wed, 16 Oct 2019 14:14:55 +0200}, biburl = {https://dblp.org/rec/conf/apsipa/LinCS13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cogsci/ChukNCCH13, author = {Tim Chuk and Alvin C. W. Ng and Emanuele Coviello and Antoni B. Chan and Janet H. Hsiao}, title = {Understanding eye movements in face recognition with hidden Markov model}, booktitle = {Proceedings of the 35th Annual Meeting of the Cognitive Science Society, CogSci 2013, Berlin, Germany, July 31 - August 3, 2013}, year = {2013}, crossref = {DBLP:conf/cogsci/2013}, url = {https://escholarship.org/uc/item/1197p8wz}, timestamp = {Tue, 30 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cogsci/ChukNCCH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpca/ShiWLC13, author = {Peizhong Shi and Yun Wang and Kai Li and Alvin T. S. Chan}, title = {Cross-Layer Adaptive End-to-End Delay Control for Asynchronous Duty-Cycle Wireless Sensor Networks}, booktitle = {Pervasive Computing and the Networked World - Joint International Conference, {ICPCA/SWS} 2013, Vina del Mar, Chile, December 5-7, 2013. Revised Selected Papers}, pages = {520--531}, year = {2013}, crossref = {DBLP:conf/icpca/2013}, url = {https://doi.org/10.1007/978-3-319-09265-2\_53}, doi = {10.1007/978-3-319-09265-2\_53}, timestamp = {Tue, 14 May 2019 10:00:51 +0200}, biburl = {https://dblp.org/rec/conf/icpca/ShiWLC13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icst/NiuNLC13, author = {Xintao Niu and Changhai Nie and Yu Lei and Alvin T. S. Chan}, title = {Identifying Failure-Inducing Combinations Using Tuple Relationship}, booktitle = {Sixth {IEEE} International Conference on Software Testing, Verification and Validation, {ICST} 2013 Workshops Proceedings, Luxembourg, Luxembourg, March 18-22, 2013}, pages = {271--280}, year = {2013}, crossref = {DBLP:conf/icst/2013w}, url = {https://doi.org/10.1109/ICSTW.2013.38}, doi = {10.1109/ICSTW.2013.38}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icst/NiuNLC13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lcn/ShiWLC13, author = {Peizhong Shi and Yun Wang and Kai Li and Alvin T. S. Chan}, title = {Delay-Constrained and Energy-Balanced broadcasts for low duty-cycled wireless sensor networks}, booktitle = {38th Annual {IEEE} Conference on Local Computer Networks, Sydney, Australia, October 21-24, 2013}, pages = {284--287}, year = {2013}, crossref = {DBLP:conf/lcn/2013}, url = {https://doi.org/10.1109/LCN.2013.6761250}, doi = {10.1109/LCN.2013.6761250}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/lcn/ShiWLC13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sac/LoTNCLC13, author = {Kenneth W. K. Lo and Will W. W. Tang and Grace Ngai and Alvin T. S. Chan and Hong Va Leong and Stephen C. F. Chan}, title = {i*Chameleon: a platform for developing multimodal application with comprehensive development cycle}, booktitle = {Proceedings of the 28th Annual {ACM} Symposium on Applied Computing, {SAC} '13, Coimbra, Portugal, March 18-22, 2013}, pages = {1103--1108}, year = {2013}, crossref = {DBLP:conf/sac/2013}, url = {https://doi.org/10.1145/2480362.2480570}, doi = {10.1145/2480362.2480570}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sac/LoTNCLC13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/trustcom/YuC13, author = {Xiaochuan Yu and Alvin Chan Toong Shoon}, title = {A Hypercubic Overlay Using Bloom-Filter Based Addressing for a Non-dedicated Distributed Tag-Based Pub/Sub System}, booktitle = {12th {IEEE} International Conference on Trust, Security and Privacy in Computing and Communications, TrustCom 2013 / 11th {IEEE} International Symposium on Parallel and Distributed Processing with Applications, {ISPA-13} / 12th {IEEE} International Conference on Ubiquitous Computing and Communications, IUCC-2013, Melbourne, Australia, July 16-18, 2013}, pages = {1008--1015}, year = {2013}, crossref = {DBLP:conf/trustcom/2013}, url = {https://doi.org/10.1109/TrustCom.2013.123}, doi = {10.1109/TRUSTCOM.2013.123}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/trustcom/YuC13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/trustcom/YuC13a, author = {Xiaochuan Yu and Alvin Chan Toong Shoon}, title = {Hope: {A} Fault-Tolerant Distributed Pub/Sub Architecture for Large-Scale Dynamic Network Environment}, booktitle = {12th {IEEE} International Conference on Trust, Security and Privacy in Computing and Communications, TrustCom 2013 / 11th {IEEE} International Symposium on Parallel and Distributed Processing with Applications, {ISPA-13} / 12th {IEEE} International Conference on Ubiquitous Computing and Communications, IUCC-2013, Melbourne, Australia, July 16-18, 2013}, pages = {1399--1406}, year = {2013}, crossref = {DBLP:conf/trustcom/2013}, url = {https://doi.org/10.1109/TrustCom.2013.169}, doi = {10.1109/TRUSTCOM.2013.169}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/trustcom/YuC13a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/IEEEcloud/YangCTLC12, author = {Lei Yang and Jiannong Cao and Shaojie Tang and Tao Li and Alvin T. S. Chan}, title = {A Framework for Partitioning and Execution of Data Stream Applications in Mobile Cloud Computing}, booktitle = {2012 {IEEE} Fifth International Conference on Cloud Computing, Honolulu, HI, USA, June 24-29, 2012}, pages = {794--802}, year = {2012}, crossref = {DBLP:conf/IEEEcloud/2012}, url = {https://doi.org/10.1109/CLOUD.2012.97}, doi = {10.1109/CLOUD.2012.97}, timestamp = {Tue, 02 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/IEEEcloud/YangCTLC12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bhi/MaLLGWKL12, author = {Heather Ting Ma and Haiyan Lv and Alvin F. W. Li and James F. Griffith and Yixiang Wang and Anthony Wai Leung Kwok and Ping Chung Leung}, title = {Perfusion study on Modic changes of spine based on {DCE-MRI}}, booktitle = {Proceedings of 2012 {IEEE-EMBS} International Conference on Biomedical and Health Informatics, Hong Kong, China, January 5-7, 2012}, pages = {365--367}, year = {2012}, crossref = {DBLP:conf/bhi/2012}, url = {https://doi.org/10.1109/BHI.2012.6211589}, doi = {10.1109/BHI.2012.6211589}, timestamp = {Sat, 19 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/bhi/MaLLGWKL12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12, author = {Socrates D. Vamvakos and Bendik Kleveland and Dipak K. Sikdar and B. K. Ahuja and Haidang Lin and Jayaprakash Balachandran and Wignes Balakrishnan and Aldo Bottelli and Jawji Chen and Xiaole Chen and Jae Choi and Jeong Choi and Rajesh Chopra and Sanjay Dabral and Kalyan Dasari and Ronald B. David and Shaishav Desai and Claude R. Gauthier and Mahmudul Hassan and Kuo{-}Chiang Hsieh and Ramosan Canagasaby and Jeff Kumala and E. P. Kwon and Ben Lee and Ming Liu and Gurupada Mandal and Sundari Mitra and Byeong Cheol Na and Siddharth Panwar and Jay Patel and Chethan Rao and Vithal Rao and Richard Rouse and Ritesh Saraf and Subramanian Seshadri and Jae{-}K. Sim and Clement Szeto and Alvin Wang and Jason Yeung}, title = {A 576 Mb {DRAM} with 16-channel 10.3125Gbps serial {I/O} and 14.5 ns latency}, booktitle = {Proceedings of the 38th European Solid-State Circuit conference, {ESSCIRC} 2012, Bordeaux, France, September 17-21, 2012}, pages = {458--461}, year = {2012}, crossref = {DBLP:conf/esscirc/2012}, url = {https://doi.org/10.1109/ESSCIRC.2012.6341354}, doi = {10.1109/ESSCIRC.2012.6341354}, timestamp = {Thu, 26 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hpca/LimTSACRW12, author = {Kevin T. Lim and Yoshio Turner and Jose Renato Santos and Alvin AuYoung and Jichuan Chang and Parthasarathy Ranganathan and Thomas F. Wenisch}, title = {System-level implications of disaggregated memory}, booktitle = {18th {IEEE} International Symposium on High Performance Computer Architecture, {HPCA} 2012, New Orleans, LA, USA, 25-29 February, 2012}, pages = {189--200}, year = {2012}, crossref = {DBLP:conf/hpca/2012}, url = {https://doi.org/10.1109/HPCA.2012.6168955}, doi = {10.1109/HPCA.2012.6168955}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/hpca/LimTSACRW12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hpcc/XiaochuanS12, author = {Xiaochuan Yu and Alvin Chan Toong Shoon}, title = {A Hypercubic Event-dissemination Overlay Using Structure-aware Addressing for Distributed XML-based Pub/sub System}, booktitle = {14th {IEEE} International Conference on High Performance Computing and Communication {\&} 9th {IEEE} International Conference on Embedded Software and Systems, {HPCC-ICESS} 2012, Liverpool, United Kingdom, June 25-27, 2012}, pages = {179--186}, year = {2012}, crossref = {DBLP:conf/hpcc/2012}, url = {https://doi.org/10.1109/HPCC.2012.32}, doi = {10.1109/HPCC.2012.32}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/hpcc/XiaochuanS12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccel/LinLCHL12, author = {Chih{-}Lung Lin and Chia{-}Sheng Li and Yi{-}Ming Chang and Chia{-}Che Hung and Alvin Lin}, title = {3D stylus and pressure sensing system for capacitive touch panel}, booktitle = {{IEEE} International Conference on Consumer Electronics, {ICCE} 2012, Las Vegas, NV, USA, January 13-16, 2012}, pages = {215--216}, year = {2012}, crossref = {DBLP:conf/iccel/2012}, url = {https://doi.org/10.1109/ICCE.2012.6161835}, doi = {10.1109/ICCE.2012.6161835}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccel/LinLCHL12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/percom/LoTLCCN12, author = {Kenneth W. K. Lo and Wai Wa Tang and Hong Va Leong and Alvin T. S. Chan and Stephen Chi{-}fai Chan and Grace Ngai}, title = {i{\({_\ast}\)}Chameleon: {A} unified web service framework for integrating multimodal interaction devices}, booktitle = {Tenth Annual {IEEE} International Conference on Pervasive Computing and Communications, PerCom 2012, March 19-23, 2012, Lugano, Switzerland, Workshop Proceedings}, pages = {106--111}, year = {2012}, crossref = {DBLP:conf/percom/2012w}, url = {https://doi.org/10.1109/PerComW.2012.6197460}, doi = {10.1109/PERCOMW.2012.6197460}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/percom/LoTLCCN12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sin/PohYL12, author = {Geong Sen Poh and Kok{-}Lim Alvin Yau and Mee Hong Ling}, title = {Analysis of a secure cooperative channel sensing protocol for cognitive radio networks}, booktitle = {5th International Conference of Security of Information and Networks, {SIN} '12, Jaipur, India, October 22 - 26, 2012}, pages = {41--46}, year = {2012}, crossref = {DBLP:conf/sin/2012}, url = {https://doi.org/10.1145/2388576.2388581}, doi = {10.1145/2388576.2388581}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sin/PohYL12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bmcbi/VeronikaWNMR11, author = {Merlin Veronika and Roy E. Welsch and Alvin Ng and Paul Matsudaira and Jagath C. Rajapakse}, title = {Correlation of cell membrane dynamics and cell motility}, journal = {{BMC} Bioinform.}, volume = {12}, number = {{S-13}}, pages = {S19}, year = {2011}, url = {https://doi.org/10.1186/1471-2105-12-S13-S19}, doi = {10.1186/1471-2105-12-S13-S19}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bmcbi/VeronikaWNMR11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/esticas/ChangLYSSLWLCC11, author = {Da{-}Wei Chang and Sheng{-}Fu Liang and Chung{-}Ping Young and Fu{-}Zen Shaw and Alvin W. Y. Su and You{-}De Liu and Yu{-}Lin Wang and Yi{-}Che Liu and Jing{-}Jhong Chen and Chun{-}Yu Chen}, title = {A Versatile Wireless Portable Monitoring System for Brain-Behavior Approaches}, journal = {{IEEE} J. Emerg. Sel. Topics Circuits Syst.}, volume = {1}, number = {4}, pages = {440--450}, year = {2011}, url = {https://doi.org/10.1109/JETCAS.2011.2181454}, doi = {10.1109/JETCAS.2011.2181454}, timestamp = {Sat, 20 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/esticas/ChangLYSSLWLCC11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/chi/TangLCCLN11, author = {Wai Wa Tang and Kenneth W. K. Lo and Alvin T. S. Chan and Stephen Chi{-}fai Chan and Hong Va Leong and Grace Ngai}, title = {i*Chameleon: a scalable and extensible framework for multimodal interaction}, booktitle = {Proceedings of the International Conference on Human Factors in Computing Systems, {CHI} 2011, Extended Abstracts Volume, Vancouver, BC, Canada, May 7-12, 2011}, pages = {305--310}, year = {2011}, crossref = {DBLP:conf/chi/2011a}, url = {https://doi.org/10.1145/1979742.1979703}, doi = {10.1145/1979742.1979703}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/chi/TangLCCLN11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ithings/XuCWCZYWZ11, author = {Bin Xu and Alvin Chin and Hao Wang and Lele Chang and Ke Zhang and Fangxi Yin and Hao Wang and Li Zhang}, title = {Physical Proximity and Online User Behaviour in an Indoor Mobile Social Networking Application}, booktitle = {2011 {IEEE} International Conference on Internet of Things (iThings) {\&} 4th {IEEE} International Conference on Cyber, Physical and Social Computing (CPSCom), Dalian, China, October 19-22, 2011}, pages = {273--282}, year = {2011}, crossref = {DBLP:conf/ithings/2011}, url = {https://doi.org/10.1109/iThings/CPSCom.2011.74}, doi = {10.1109/ITHINGS/CPSCOM.2011.74}, timestamp = {Wed, 17 Jul 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ithings/XuCWCZYWZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mdm/XiaochuanA11, author = {Xiaochuan Yu and Alvin Chan Toong Shoon}, title = {A Time/Space Efficient {XML} Filtering System for Mobile Environment}, booktitle = {12th {IEEE} International Conference on Mobile Data Management, {MDM} 2011, Lule{\aa}, Sweden, June 6-9, 2011, Volume 1}, pages = {184--193}, year = {2011}, crossref = {DBLP:conf/mdm/2011-1}, url = {https://doi.org/10.1109/MDM.2011.78}, doi = {10.1109/MDM.2011.78}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/mdm/XiaochuanA11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sies/LinCSCC11, author = {Yi{-}Li Lin and Wei{-}Tso Chen and Alvin W. Y. Su and Da{-}Wei Chang and Chung{-}Ho Chen}, title = {A low cost, low power, high scalability and dependability processor-cluster platform}, booktitle = {Industrial Embedded Systems (SIES), 2011 6th {IEEE} International Symposium on, {SIES} 2011. Vasteras, Sweden, June 15-17, 2011}, pages = {95--98}, year = {2011}, crossref = {DBLP:conf/sies/2011}, url = {https://doi.org/10.1109/SIES.2011.5953689}, doi = {10.1109/SIES.2011.5953689}, timestamp = {Wed, 16 Oct 2019 14:14:53 +0200}, biburl = {https://dblp.org/rec/conf/sies/LinCSCC11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:series/hci/YeoCLTLH11, author = {Alvin W. Yeo and Po{-}Chan Chiu and Tek Yong Lim and Ping{-}Ping Tan and Terrin Lim and Idyawati Hussein}, title = {Usability in Malaysia}, booktitle = {Global Usability}, pages = {211--222}, year = {2011}, crossref = {DBLP:series/hci/DouglasL11}, url = {https://doi.org/10.1007/978-0-85729-304-6\_12}, doi = {10.1007/978-0-85729-304-6\_12}, timestamp = {Wed, 14 Jun 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/series/hci/YeoCLTLH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jise/WangCSS10, author = {Jing{-}Xin Wang and Yung{-}Chang Chiu and Alvin Wen{-}Yu Su and Ce{-}Kuen Shieh}, title = {On Parallelizing {H.264/AVC} Rate-Distortion Optimization Baseline Profile Encoder}, journal = {J. Inf. Sci. Eng.}, volume = {26}, number = {2}, pages = {409--426}, year = {2010}, url = {http://www.iis.sinica.edu.tw/page/jise/2010/201003\_06.html}, timestamp = {Fri, 16 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jise/WangCSS10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hipc/WangWCC10, author = {Yinfeng Wang and Cho{-}Li Wang and Jiannong Cao and Alvin T. S. Chan}, title = {Optimizing data acquisition by sensor-channel co-allocation in wireless sensor networks}, booktitle = {2010 International Conference on High Performance Computing, HiPC 2010, Dona Paula, Goa, India, December 19-22, 2010}, pages = {1--10}, year = {2010}, crossref = {DBLP:conf/hipc/2010}, url = {https://doi.org/10.1109/HIPC.2010.5713167}, doi = {10.1109/HIPC.2010.5713167}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/hipc/WangWCC10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sac/WeiC10, author = {Edwin J. Y. Wei and Alvin T. S. Chan}, title = {Towards semantic-based adaptation decisions for context-aware mobile computing}, booktitle = {Proceedings of the 2010 {ACM} Symposium on Applied Computing (SAC), Sierre, Switzerland, March 22-26, 2010}, pages = {563--567}, year = {2010}, crossref = {DBLP:conf/sac/2010}, url = {https://doi.org/10.1145/1774088.1774205}, doi = {10.1145/1774088.1774205}, timestamp = {Sun, 02 Jun 2019 21:18:37 +0200}, biburl = {https://dblp.org/rec/conf/sac/WeiC10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jise/SiaoCS09, author = {Yi{-}Song Siao and Wei{-}Chen Chang and Alvin Wen{-}Yu Su}, title = {Pitch Detection/Tracking Strategy for Musical Recordings of Solo Bowed-String and Wind Instruments}, journal = {J. Inf. Sci. Eng.}, volume = {25}, number = {4}, pages = {1239--1253}, year = {2009}, url = {http://www.iis.sinica.edu.tw/page/jise/2009/200907\_17.html}, timestamp = {Fri, 16 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jise/SiaoCS09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/crowncom/YauKT09, author = {Kok{-}Lim Alvin Yau and Peter Komisarczuk and Paul D. Teal}, title = {A context-aware and Intelligent Dynamic Channel Selection scheme for cognitive radio networks}, booktitle = {4th International {ICST} Conference on Cognitive Radio Oriented Wireless Networks and Communications, {CROWNCOM} 2009, Hannover, Germany, June 22-24, 2009}, pages = {1--6}, year = {2009}, crossref = {DBLP:conf/crowncom/2009}, url = {https://doi.org/10.1109/CROWNCOM.2009.5189427}, doi = {10.1109/CROWNCOM.2009.5189427}, timestamp = {Wed, 16 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/crowncom/YauKT09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cse/HuangCCSSL09, author = {Sheng{-}Wei Huang and Yung{-}Chang Chiu and Zhong{-}Ho Chen and Ce{-}Kuen Shieh and Alvin Wen{-}Yu Su and Tyng{-}Yeu Liang}, title = {A Region-Based Allocation Approach for Page-Based Scratch-Pad Memory in Embedded Systems}, booktitle = {Proceedings of the 12th {IEEE} International Conference on Computational Science and Engineering, {CSE} 2009, Vancouver, BC, Canada, August 29-31, 2009}, pages = {9--16}, year = {2009}, crossref = {DBLP:conf/cse/2009}, url = {https://doi.org/10.1109/CSE.2009.350}, doi = {10.1109/CSE.2009.350}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cse/HuangCCSSL09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/interspeech/MartinG09, author = {Alvin F. Martin and Craig S. Greenberg}, title = {{NIST} 2008 speaker recognition evaluation: performance across telephone and room microphone channels}, booktitle = {10th Annual Conference of the International Speech Communication Association, {INTERSPEECH} 2009, Brighton, United Kingdom, September 6-10, 2009}, pages = {2579--2582}, year = {2009}, crossref = {DBLP:conf/interspeech/2009}, url = {https://doi.org/10.21437/Interspeech.2009-679}, doi = {10.21437/INTERSPEECH.2009-679}, timestamp = {Tue, 11 Jun 2024 16:45:43 +0200}, biburl = {https://dblp.org/rec/conf/interspeech/MartinG09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijpcc/CheungYCC08, author = {Ronnie Cheung and Gang Yao and Jiannong Cao and Alvin T. S. Chan}, title = {A fuzzy service adaptation engine for context-aware mobile computing middleware}, journal = {Int. J. Pervasive Comput. Commun.}, volume = {4}, number = {2}, pages = {147--165}, year = {2008}, url = {https://doi.org/10.1108/17427370810890256}, doi = {10.1108/17427370810890256}, timestamp = {Thu, 16 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijpcc/CheungYCC08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ivs/ChangLGKRYSZKS08, author = {Remco Chang and Alvin Lee and Mohammad Ghoniem and Robert Kosara and William Ribarsky and Jing Yang and Evan A. Suma and Caroline Ziemkiewicz and Daniel A. Kern and Agus Sudjianto}, title = {Scalable and interactive visual analysis of financial wire transactions for fraud detection}, journal = {Inf. Vis.}, volume = {7}, number = {1}, pages = {63--76}, year = {2008}, url = {https://doi.org/10.1057/palgrave.ivs.9500172}, doi = {10.1057/PALGRAVE.IVS.9500172}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ivs/ChangLGKRYSZKS08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tse/ChuangC08, author = {Siu Nam Chuang and Alvin T. S. Chan}, title = {Dynamic QoS Adaptation for Mobile Middleware}, journal = {{IEEE} Trans. Software Eng.}, volume = {34}, number = {6}, pages = {738--752}, year = {2008}, url = {https://doi.org/10.1109/TSE.2008.44}, doi = {10.1109/TSE.2008.44}, timestamp = {Wed, 17 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tse/ChuangC08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/twc/YuCZWCCL08, author = {Wanrong Yu and Jiannong Cao and Xingming Zhou and Xiaodong Wang and Keith C. C. Chan and Alvin T. S. Chan and Hong Va Leong}, title = {A High-Throughput {MAC} Protocol for Wireless Ad Hoc Networks}, journal = {{IEEE} Trans. Wirel. Commun.}, volume = {7}, number = {1}, pages = {135--145}, year = {2008}, url = {https://doi.org/10.1109/TWC.2008.06094}, doi = {10.1109/TWC.2008.06094}, timestamp = {Sun, 06 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/twc/YuCZWCCL08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sac/LeongC08, author = {Hong Va Leong and Alvin T. S. Chan}, title = {Special track on Mobile Computing and Applications: editorial message}, booktitle = {Proceedings of the 2008 {ACM} Symposium on Applied Computing (SAC), Fortaleza, Ceara, Brazil, March 16-20, 2008}, pages = {1876--1877}, year = {2008}, crossref = {DBLP:conf/sac/2008}, url = {https://doi.org/10.1145/1363686.1364142}, doi = {10.1145/1363686.1364142}, timestamp = {Tue, 06 Nov 2018 11:06:48 +0100}, biburl = {https://dblp.org/rec/conf/sac/LeongC08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/semco/WeiC08, author = {Edwin J. Y. Wei and Alvin T. S. Chan}, title = {Semantic Approach to Middleware-Driven Run-Time Context-Aware Adaptation Decision}, booktitle = {Proceedings of the 2th {IEEE} International Conference on Semantic Computing {(ICSC} 2008), August 4-7, 2008, Santa Clara, California, {USA}}, pages = {440--447}, year = {2008}, crossref = {DBLP:conf/semco/2008}, url = {https://doi.org/10.1109/ICSC.2008.49}, doi = {10.1109/ICSC.2008.49}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/semco/WeiC08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ejwcn/ChenXWLCCC07, author = {Yingwen Chen and Ming Xu and Huaimin Wang and Hong Va Leong and Jiannong Cao and Keith C. C. Chan and Alvin T. S. Chan}, title = {An Energy-Efficient Framework for Multirate Query in Wireless Sensor Networks}, journal = {{EURASIP} J. Wirel. Commun. Netw.}, volume = {2007}, year = {2007}, url = {https://doi.org/10.1155/2007/48984}, doi = {10.1155/2007/48984}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ejwcn/ChenXWLCCC07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jsac/ChowLC07, author = {Chi{-}Yin Chow and Hong Va Leong and Alvin T. S. Chan}, title = {GroCoca: group-based peer-to-peer cooperative caching in mobile environment}, journal = {{IEEE} J. Sel. Areas Commun.}, volume = {25}, number = {1}, pages = {179--191}, year = {2007}, url = {https://doi.org/10.1109/JSAC.2007.070118}, doi = {10.1109/JSAC.2007.070118}, timestamp = {Thu, 02 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jsac/ChowLC07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/euc/WeiC07, author = {Edwin J. Y. Wei and Alvin T. S. Chan}, title = {Towards Context-Awareness in Ubiquitous Computing}, booktitle = {Embedded and Ubiquitous Computing, International Conference, {EUC} 2007, Taipei, Taiwan, December 17-20, 2007, Proceedings}, pages = {706--717}, year = {2007}, crossref = {DBLP:conf/euc/2007}, url = {https://doi.org/10.1007/978-3-540-77092-3\_61}, doi = {10.1007/978-3-540-77092-3\_61}, timestamp = {Tue, 14 May 2019 10:00:47 +0200}, biburl = {https://dblp.org/rec/conf/euc/WeiC07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cluster/CaoCSDG06, author = {Jiannong Cao and Alvin T. S. Chan and Yudong Sun and Sajal K. Das and Minyi Guo}, title = {A taxonomy of application scheduling tools for high performance cluster computing}, journal = {Clust. Comput.}, volume = {9}, number = {3}, pages = {355--371}, year = {2006}, url = {https://doi.org/10.1007/s10586-006-9747-2}, doi = {10.1007/S10586-006-9747-2}, timestamp = {Tue, 29 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cluster/CaoCSDG06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/concurrency/CaoCCC06, author = {Jiannong Cao and Alvin T. S. Chan and Stephen C. F. Chan and Nick K. C. Cheung}, title = {A robust monitor construct with runtime fault detection}, journal = {Concurr. Comput. Pract. Exp.}, volume = {18}, number = {5}, pages = {471--500}, year = {2006}, url = {https://doi.org/10.1002/cpe.934}, doi = {10.1002/CPE.934}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/concurrency/CaoCCC06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/internet/ZhengCN06, author = {Yongjie Zheng and Alvin T. S. Chan and Grace Ngai}, title = {Applying Coordination for Service Adaptation in Mobile Computing}, journal = {{IEEE} Internet Comput.}, volume = {10}, number = {5}, pages = {61--67}, year = {2006}, url = {https://doi.org/10.1109/MIC.2006.93}, doi = {10.1109/MIC.2006.93}, timestamp = {Fri, 13 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/internet/ZhengCN06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/spe/ZhengCN06, author = {Yongjie Zheng and Alvin T. S. Chan and Grace Ngai}, title = {{MCL:} a MobiGATE coordination language for highly adaptive and reconfigurable mobile middleware}, journal = {Softw. Pract. Exp.}, volume = {36}, number = {11-12}, pages = {1355--1380}, year = {2006}, url = {https://doi.org/10.1002/spe.757}, doi = {10.1002/SPE.757}, timestamp = {Thu, 09 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/spe/ZhengCN06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/taslp/ChangS06, author = {Wei{-}Chen Chang and Alvin Wen{-}Yu Su}, title = {A Multichannel Recurrent Network Analysis/Synthesis Model for Coupled-String Instruments}, journal = {{IEEE} Trans. Speech Audio Process.}, volume = {14}, number = {6}, pages = {2233--2241}, year = {2006}, url = {https://doi.org/10.1109/TASL.2006.872610}, doi = {10.1109/TASL.2006.872610}, timestamp = {Sun, 17 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/taslp/ChangS06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tse/ZhengC06, author = {Yongjie Zheng and Alvin T. S. Chan}, title = {MobiGATE: {A} Mobile Computing Middleware for the Active Deployment of Transport Services}, journal = {{IEEE} Trans. Software Eng.}, volume = {32}, number = {1}, pages = {35--50}, year = {2006}, url = {https://doi.org/10.1109/TSE.2006.11}, doi = {10.1109/TSE.2006.11}, timestamp = {Wed, 17 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tse/ZhengC06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/twc/FuMT06, author = {Alvin Fu and Eytan H. Modiano and John N. Tsitsiklis}, title = {Optimal transmission scheduling over a fading channel with energy and deadline constraints}, journal = {{IEEE} Trans. Wirel. Commun.}, volume = {5}, number = {3}, pages = {630--641}, year = {2006}, url = {https://doi.org/10.1109/TWC.2006.1611093}, doi = {10.1109/TWC.2006.1611093}, timestamp = {Mon, 22 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/twc/FuMT06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/chi/YeoC06, author = {Alvin W. Yeo and Po{-}Chan Chiu}, title = {Gaze estimation model for eye drawing}, booktitle = {Extended Abstracts Proceedings of the 2006 Conference on Human Factors in Computing Systems, {CHI} 2006, Montr{\'{e}}al, Qu{\'{e}}bec, Canada, April 22-27, 2006}, pages = {1559--1564}, year = {2006}, crossref = {DBLP:conf/chi/2006a}, url = {https://doi.org/10.1145/1125451.1125736}, doi = {10.1145/1125451.1125736}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/chi/YeoC06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/etra/ChanY06, author = {Po{-}Chan Chiu and Alvin W. Yeo}, title = {Eye drawing with gaze estimation model}, booktitle = {Proceedings of the Eye Tracking Research {\&} Application Symposium, {ETRA} 2006, San Diego, California, USA, March 27-29, 2006}, pages = {57}, year = {2006}, crossref = {DBLP:conf/etra/2006}, url = {https://doi.org/10.1145/1117309.1117342}, doi = {10.1145/1117309.1117342}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/etra/ChanY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/euc/CheungCYC06, author = {Ronnie Cheung and Jiannong Cao and Gang Yao and Alvin T. S. Chan}, title = {A Fuzzy-Based Service Adaptation Middleware for Context-Aware Computing}, booktitle = {Embedded and Ubiquitous Computing, International Conference, {EUC} 2006, Seoul, Korea, August 1-4, 2006, Proceedings}, pages = {580--590}, year = {2006}, crossref = {DBLP:conf/euc/2006}, url = {https://doi.org/10.1007/11802167\_59}, doi = {10.1007/11802167\_59}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/euc/CheungCYC06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/fuzzIEEE/ChuangC06, author = {Siu{-}Nam Chuang and Alvin T. S. Chan}, title = {MobiPADS++: {A} Mobile QoS Middleware based on Hierarchical Fuzzy Control}, booktitle = {{IEEE} International Conference on Fuzzy Systems, {FUZZ-IEEE} 2006, Vancouver, BC, Canada, July 16-21, 2006}, pages = {2223--2230}, year = {2006}, crossref = {DBLP:conf/fuzzIEEE/2006}, url = {https://doi.org/10.1109/FUZZY.2006.1682009}, doi = {10.1109/FUZZY.2006.1682009}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/fuzzIEEE/ChuangC06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/gpc/YuCZWCCL06, author = {Wanrong Yu and Jiannong Cao and Xingming Zhou and Xiaodong Wang and Keith C. C. Chan and Alvin T. S. Chan and Hong Va Leong}, title = {{VWMAC:} An Efficient {MAC} Protocol for Resolving Intra-flow Contention in Wireless Ad Hoc Networks}, booktitle = {Advances in Grid and Pervasive Computing, First International Conference, {GPC} 2006, Taichung, Taiwan, May 3-5, 2006, Proceedings}, pages = {498--508}, year = {2006}, crossref = {DBLP:conf/gpc/2006}, url = {https://doi.org/10.1007/11745693\_49}, doi = {10.1007/11745693\_49}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/gpc/YuCZWCCL06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscc/ZhengC06, author = {Yongjie Zheng and Alvin T. S. Chan}, title = {Coordinated Composition of Services for Adaptive Mobile Middleware}, booktitle = {Proceedings of the 11th {IEEE} Symposium on Computers and Communications {(ISCC} 2006), 26-29 June 2006, Cagliari, Sardinia, Italy}, pages = {789--794}, year = {2006}, crossref = {DBLP:conf/iscc/2006}, url = {https://doi.org/10.1109/ISCC.2006.55}, doi = {10.1109/ISCC.2006.55}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iscc/ZhengC06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mdm/ChenLXCCC06, author = {Yingwen Chen and Hong Va Leong and Ming Xu and Jiannong Cao and Keith C. C. Chan and Alvin T. S. Chan}, title = {In-Network Data Processing forWireless Sensor Networks}, booktitle = {7th International Conference on Mobile Data Management {(MDM} 2006), Nara, Japan, May 9-13, 2006}, pages = {26}, year = {2006}, crossref = {DBLP:conf/mdm/2006}, url = {https://doi.org/10.1109/MDM.2006.96}, doi = {10.1109/MDM.2006.96}, timestamp = {Wed, 14 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mdm/ChenLXCCC06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sac/LeongC06, author = {Hong Va Leong and Alvin T. S. Chan}, title = {Editorial message: special track on mobile computing and applications}, booktitle = {Proceedings of the 2006 {ACM} Symposium on Applied Computing (SAC), Dijon, France, April 23-27, 2006}, pages = {1120--1121}, year = {2006}, crossref = {DBLP:conf/sac/2006}, url = {https://doi.org/10.1145/1141277.1141544}, doi = {10.1145/1141277.1141544}, timestamp = {Tue, 06 Nov 2018 11:06:49 +0100}, biburl = {https://dblp.org/rec/conf/sac/LeongC06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cacm/Chan05, author = {Alvin T. S. Chan}, title = {Mobile cookies management on a smart card}, journal = {Commun. {ACM}}, volume = {48}, number = {11}, pages = {38--43}, year = {2005}, url = {https://doi.org/10.1145/1096000.1096002}, doi = {10.1145/1096000.1096002}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cacm/Chan05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/spe/ChanCCZ05, author = {Fan Chan and Jiannong Cao and Alvin T. S. Chan and Kang Zhang}, title = {Visual programming support for graph-oriented parallel/distributed processing}, journal = {Softw. Pract. Exp.}, volume = {35}, number = {15}, pages = {1409--1439}, year = {2005}, url = {https://doi.org/10.1002/spe.676}, doi = {10.1002/SPE.676}, timestamp = {Tue, 29 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/spe/ChanCCZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/ChanCC05, author = {Alvin T. S. Chan and Jiannong Cao and C. K. Chan}, title = {{WEBGOP:} collaborative web services based on graph-oriented programming}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {A}}, volume = {35}, number = {6}, pages = {811--830}, year = {2005}, url = {https://doi.org/10.1109/TSMCA.2005.851342}, doi = {10.1109/TSMCA.2005.851342}, timestamp = {Mon, 25 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/ChanCC05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/www/ChuangC05, author = {Siu Nam Chuang and Alvin T. S. Chan}, title = {Active Service for Mobile Middleware}, journal = {World Wide Web}, volume = {8}, number = {2}, pages = {127--157}, year = {2005}, url = {https://doi.org/10.1007/s11280-004-4871-5}, doi = {10.1007/S11280-004-4871-5}, timestamp = {Sat, 20 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/www/ChuangC05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icws/ChanW05, author = {Alvin T. S. Chan and Dick K. T. Wan}, title = {Web Services Mobility in a Pocket}, booktitle = {2005 {IEEE} International Conference on Web Services {(ICWS} 2005), 11-15 July 2005, Orlando, FL, {USA}}, pages = {159--166}, year = {2005}, crossref = {DBLP:conf/icws/2005}, url = {https://doi.org/10.1109/ICWS.2005.134}, doi = {10.1109/ICWS.2005.134}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icws/ChanW05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isads/CaoXCL05, author = {Jiannong Cao and Wei Xu and Alvin T. S. Chan and Jing Li}, title = {A reliable multicast protocol for mailbox-based mobile agent communications}, booktitle = {2005 International Symposium on Autonomous Decentralized Systems, {ISADS} 2005, Chengdu, China, April 4-8, 2005, Proceedings}, pages = {74--81}, year = {2005}, crossref = {DBLP:conf/isads/2005}, url = {https://doi.org/10.1109/ISADS.2005.1452023}, doi = {10.1109/ISADS.2005.1452023}, timestamp = {Tue, 06 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/isads/CaoXCL05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mdm/ChowLC05, author = {Chi{-}Yin Chow and Hong Va Leong and Alvin T. S. Chan}, title = {Distributed group-based cooperative caching in a mobile broadcast environment}, booktitle = {6th International Conference on Mobile Data Management {(MDM} 2005), Ayia Napa, Cyprus, May 9-13, 2005}, pages = {97--106}, year = {2005}, crossref = {DBLP:conf/mdm/2005}, url = {https://doi.org/10.1145/1071246.1071261}, doi = {10.1145/1071246.1071261}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/mdm/ChowLC05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rtcsa/CaoXCFJ05, author = {Jiannong Cao and Na Xing and Alvin T. S. Chan and Yulin Feng and Beihong Jin}, title = {Service Adaptation Using Fuzzy Theory in Context-Aware Mobile Computing Middleware}, booktitle = {11th {IEEE} International Conference on Embedded and Real-Time Computing Systems and Applications {(RTCSA} 2005), 17-19 August 2005, Hong Kong, China}, pages = {496--501}, year = {2005}, crossref = {DBLP:conf/rtcsa/2005}, url = {https://doi.org/10.1109/RTCSA.2005.93}, doi = {10.1109/RTCSA.2005.93}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/rtcsa/CaoXCFJ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sac/LeongC05, author = {Hong Va Leong and Alvin T. S. Chan}, title = {Editorial message: special track on mobile computing and applications}, booktitle = {Proceedings of the 2005 {ACM} Symposium on Applied Computing (SAC), Santa Fe, New Mexico, USA, March 13-17, 2005}, pages = {1118--1119}, year = {2005}, crossref = {DBLP:conf/sac/2005}, url = {https://doi.org/10.1145/1066677.1066930}, doi = {10.1145/1066677.1066930}, timestamp = {Tue, 06 Nov 2018 11:06:45 +0100}, biburl = {https://dblp.org/rec/conf/sac/LeongC05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cera/ChanCLN04, author = {Alvin T. S. Chan and Stephen Chi{-}fai Chan and Hong Va Leong and Vincent Ng}, title = {Advancement in Co-Operative Internet Computing Research and Applications}, journal = {Concurr. Eng. Res. Appl.}, volume = {12}, number = {3}, pages = {171--173}, year = {2004}, url = {https://doi.org/10.1177/1063293X04047007}, doi = {10.1177/1063293X04047007}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cera/ChanCLN04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cj/ChanCL04, author = {Alvin T. S. Chan and Siu Nam Chuang and Jiannong Cao and Hong Va Leong}, title = {An Event-Driven Middleware for Mobile Context Awareness}, journal = {Comput. J.}, volume = {47}, number = {3}, pages = {278--288}, year = {2004}, url = {https://doi.org/10.1093/comjnl/47.3.278}, doi = {10.1093/COMJNL/47.3.278}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cj/ChanCL04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ida/PampalkWC04, author = {Elias Pampalk and Gerhard Widmer and Alvin T. S. Chan}, title = {A new approach to hierarchical clustering and structuring of data with Self-Organizing Maps}, journal = {Intell. Data Anal.}, volume = {8}, number = {2}, pages = {131--149}, year = {2004}, url = {http://content.iospress.com/articles/intelligent-data-analysis/ida00158}, timestamp = {Mon, 18 May 2015 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ida/PampalkWC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ieicet/ChanCCG04, author = {Fan Chan and Jiannong Cao and Alvin T. S. Chan and Minyi Guo}, title = {Programming Support for {MPMD} Parallel Computing in ClusterGOP}, journal = {{IEICE} Trans. Inf. Syst.}, volume = {87-D}, number = {7}, pages = {1693--1702}, year = {2004}, url = {http://search.ieice.org/bin/summary.php?id=e87-d\_7\_1693}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ieicet/ChanCCG04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijcpol/ChanCLC04, author = {Alvin T. S. Chan and Jiannong Cao and Chi{-}Kin Liu and Weidong Cao}, title = {{VPL:} An Online Distance Learning Platform for Virtual Programming Laboratory}, journal = {Int. J. Comput. Process. Orient. Lang.}, volume = {17}, number = {1}, pages = {41--59}, year = {2004}, url = {https://doi.org/10.1142/S0219427904000973}, doi = {10.1142/S0219427904000973}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijcpol/ChanCLC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/internet/ChuangCCC04, author = {Siu Nam Chuang and Alvin T. S. Chan and Jiannong Cao and Ronnie Cheung}, title = {Actively Deployable Mobile Services for Adaptive Web Access}, journal = {{IEEE} Internet Comput.}, volume = {8}, number = {2}, pages = {26--33}, year = {2004}, url = {https://doi.org/10.1109/MIC.2004.1273483}, doi = {10.1109/MIC.2004.1273483}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/internet/ChuangCCC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jpdc/CaoCCWD04, author = {Jiannong Cao and Min Cao and Alvin T. S. Chan and Gengfeng Wu and Sajal K. Das}, title = {A framework for architecting and high-level programming support of {CORBA} applications}, journal = {J. Parallel Distributed Comput.}, volume = {64}, number = {6}, pages = {725--739}, year = {2004}, url = {https://doi.org/10.1016/j.jpdc.2003.10.006}, doi = {10.1016/J.JPDC.2003.10.006}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jpdc/CaoCCWD04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tse/WongCL04, author = {Eugene Y. C. Wong and Alvin T. S. Chan and Hong Va Leong}, title = {Xstream: {A} Middleware for Streaming {XML} Contents over Wireless Environments}, journal = {{IEEE} Trans. Software Eng.}, volume = {30}, number = {12}, pages = {918--935}, year = {2004}, url = {https://doi.org/10.1109/TSE.2004.108}, doi = {10.1109/TSE.2004.108}, timestamp = {Thu, 15 Jun 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tse/WongCL04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aina/ChowLC04, author = {Chi{-}Yin Chow and Hong Va Leong and Alvin T. S. Chan}, title = {Cache Signatures for Peer-to-Peer Cooperative Caching in Mobile Environments}, booktitle = {18th International Conference on Advanced Information Networking and Applications {(AINA} 2004), 29-31 March 2004, Fukuoka, Japan}, pages = {96--101}, year = {2004}, crossref = {DBLP:conf/aina/2004}, url = {https://doi.org/10.1109/AINA.2004.1283894}, doi = {10.1109/AINA.2004.1283894}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/aina/ChowLC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/compsac/ZhengC04, author = {Yongjie Zheng and Alvin T. S. Chan}, title = {Stream Composition for Highly Adaptive and Reconfigurable Mobile Middleware}, booktitle = {28th International Computer Software and Applications Conference {(COMPSAC} 2004), Design and Assessment of Trustworthy Software-Based Systems, 27-30 September 2004, Hong Kong, China, Proceedings}, pages = {122--127}, year = {2004}, crossref = {DBLP:conf/compsac/2004}, url = {https://doi.org/10.1109/CMPSAC.2004.1342815}, doi = {10.1109/CMPSAC.2004.1342815}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/compsac/ZhengC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icdcsw/ChowLC04, author = {Chi{-}Yin Chow and Hong Va Leong and Alvin T. S. Chan}, title = {Peer-to-Peer Cooperative Caching in Mobile Environments}, booktitle = {24th International Conference on Distributed Computing Systems Workshops {(ICDCS} 2004 Workshops), 23-24 March 2004, Hachioji, Tokyo, Japan}, pages = {528--533}, year = {2004}, crossref = {DBLP:conf/icdcsw/2004}, url = {https://doi.org/10.1109/ICDCSW.2004.1284083}, doi = {10.1109/ICDCSW.2004.1284083}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icdcsw/ChowLC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/HuangCLSK04, author = {Win{-}Bin Huang and Wei{-}Chen Chang and Yen{-}Wei Lu and Alvin Wen{-}Yu Su and Yau{-}Hwang Kuo}, title = {Halftone/contone conversion using neural networks}, booktitle = {Proceedings of the 2004 International Conference on Image Processing, {ICIP} 2004, Singapore, October 24-27, 2004}, pages = {3547--3550}, year = {2004}, crossref = {DBLP:conf/icip/2004}, url = {https://doi.org/10.1109/ICIP.2004.1421882}, doi = {10.1109/ICIP.2004.1421882}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/icip/HuangCLSK04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpp/CaoTC04, author = {Jiannong Cao and Daniel C. K. Tse and Alvin T. S. Chan}, title = {PDAgent: {A} Platform for Developing and Deploying Mobile Agent-Enabled Applications for Wireless Devices}, booktitle = {33rd International Conference on Parallel Processing {(ICPP} 2004), 15-18 August 2004, Montreal, Quebec, Canada}, pages = {510--517}, year = {2004}, crossref = {DBLP:conf/icpp/2004}, url = {https://doi.org/10.1109/ICPP.2004.1327961}, doi = {10.1109/ICPP.2004.1327961}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpp/CaoTC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpp/ChowLC04, author = {Chi{-}Yin Chow and Hong Va Leong and Alvin T. S. Chan}, title = {Group-Based Cooperative Cache Management for Mobile Clients in a Mobile Environment}, booktitle = {33rd International Conference on Parallel Processing {(ICPP} 2004), 15-18 August 2004, Montreal, Quebec, Canada}, pages = {83--90}, year = {2004}, crossref = {DBLP:conf/icpp/2004}, url = {https://doi.org/10.1109/ICPP.2004.1327907}, doi = {10.1109/ICPP.2004.1327907}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpp/ChowLC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpp/ZhengC04, author = {Yongjie Zheng and Alvin T. S. Chan}, title = {MobiGATE: {A} Mobile Gateway Proxy for the Active Deployment of Transport Entities}, booktitle = {33rd International Conference on Parallel Processing {(ICPP} 2004), 15-18 August 2004, Montreal, Quebec, Canada}, pages = {566--573}, year = {2004}, crossref = {DBLP:conf/icpp/2004}, url = {https://doi.org/10.1109/ICPP.2004.1327967}, doi = {10.1109/ICPP.2004.1327967}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpp/ZhengC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ispa/ChanWC04, author = {Alvin T. S. Chan and Peter Y. H. Wong and Siu Nam Chuang}, title = {{CRL:} {A} Context-Aware Request Language for Mobile Computing}, booktitle = {Parallel and Distributed Processing and Applications, Second InternationalSymposium, {ISPA} 2004, Hong Kong, China, December 13-15, 2004, Proceedings}, pages = {529--533}, year = {2004}, crossref = {DBLP:conf/ispa/2004}, url = {https://doi.org/10.1007/978-3-540-30566-8\_63}, doi = {10.1007/978-3-540-30566-8\_63}, timestamp = {Tue, 14 Apr 2020 13:23:10 +0200}, biburl = {https://dblp.org/rec/conf/ispa/ChanWC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ispa/ChiuSWSL04, author = {Yung{-}Chang Chiu and Ce{-}Kuen Shieh and Jing{-}Xin Wang and Alvin Wen{-}Yu Su and Tyng{-}Yeu Liang}, title = {A Real Time {MPEG-4} Parallel Encoder on Software Distributed Shared Memory Systems}, booktitle = {Parallel and Distributed Processing and Applications, Second InternationalSymposium, {ISPA} 2004, Hong Kong, China, December 13-15, 2004, Proceedings}, pages = {965--974}, year = {2004}, crossref = {DBLP:conf/ispa/2004}, url = {https://doi.org/10.1007/978-3-540-30566-8\_110}, doi = {10.1007/978-3-540-30566-8\_110}, timestamp = {Sun, 21 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ispa/ChiuSWSL04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ispan/ChowLC04, author = {Chi{-}Yin Chow and Hong Va Leong and Alvin T. S. Chan}, title = {Peer-to-Peer Cooperative Caching in a Hybrid Data Delivery Environment}, booktitle = {7th International Symposium on Parallel Architectures, Algorithms, and Networks {(I-SPAN} 2004), 10-12 May 2004, Hong Kong, SAR, China}, pages = {79--85}, year = {2004}, crossref = {DBLP:conf/ispan/2004}, url = {https://doi.org/10.1109/ISPAN.2004.1300461}, doi = {10.1109/ISPAN.2004.1300461}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ispan/ChowLC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sac/Chan04, author = {Alvin T. S. Chan}, title = {Cookies on-the-move: managing cookies on a smart card}, booktitle = {Proceedings of the 2004 {ACM} Symposium on Applied Computing (SAC), Nicosia, Cyprus, March 14-17, 2004}, pages = {1693--1697}, year = {2004}, crossref = {DBLP:conf/sac/2004}, url = {https://doi.org/10.1145/967900.968236}, doi = {10.1145/967900.968236}, timestamp = {Tue, 06 Nov 2018 11:06:44 +0100}, biburl = {https://dblp.org/rec/conf/sac/Chan04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sac/LeongC04, author = {Hong Va Leong and Alvin T. S. Chan}, title = {Editorial message: special track on mobile computing and applications}, booktitle = {Proceedings of the 2004 {ACM} Symposium on Applied Computing (SAC), Nicosia, Cyprus, March 14-17, 2004}, pages = {1149--1150}, year = {2004}, crossref = {DBLP:conf/sac/2004}, url = {https://doi.org/10.1145/967900.968134}, doi = {10.1145/967900.968134}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sac/LeongC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sac/WongCL04, author = {Eugene Y. C. Wong and Alvin T. S. Chan and Hong Va Leong}, title = {Efficient management of {XML} contents over wireless environment by Xstream}, booktitle = {Proceedings of the 2004 {ACM} Symposium on Applied Computing (SAC), Nicosia, Cyprus, March 14-17, 2004}, pages = {1122--1127}, year = {2004}, crossref = {DBLP:conf/sac/2004}, url = {https://doi.org/10.1145/967900.968128}, doi = {10.1145/967900.968128}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sac/WongCL04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/scp/CaoCSZ03, author = {Jiannong Cao and Alvin T. S. Chan and Yudong Sun and Kang Zhang}, title = {Dynamic configuration management in a graph-oriented Distributed Programming Environment}, journal = {Sci. Comput. Program.}, volume = {48}, number = {1}, pages = {43--65}, year = {2003}, url = {https://doi.org/10.1016/S0167-6423(02)00168-5}, doi = {10.1016/S0167-6423(02)00168-5}, timestamp = {Wed, 17 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/scp/CaoCSZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/spe/CaoMCL03, author = {Jiannong Cao and Xiaoxing Ma and Alvin T. S. Chan and Jian Lu}, title = {Architecting and implementing distributed Web applications using the graph-oriented approach}, journal = {Softw. Pract. Exp.}, volume = {33}, number = {9}, pages = {799--820}, year = {2003}, url = {https://doi.org/10.1002/spe.526}, doi = {10.1002/SPE.526}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/spe/CaoMCL03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tse/ChanC03, author = {Alvin T. S. Chan and Siu Nam Chuang}, title = {MobiPADS: {A} Reflective Middleware for Context-Aware Mobile Computing}, journal = {{IEEE} Trans. Software Eng.}, volume = {29}, number = {12}, pages = {1072--1085}, year = {2003}, url = {https://doi.org/10.1109/TSE.2003.1265522}, doi = {10.1109/TSE.2003.1265522}, timestamp = {Wed, 17 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tse/ChanC03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/appt/RenCCL03, author = {Zhihong Ren and Jiannong Cao and Alvin T. S. Chan and Jing Li}, title = {Composition and Automation of Grid Services}, booktitle = {Advanced Parallel Programming Technologies, 5th International Workshop, {APPT} 2003, Xiamen, China, September 17-19, 2003, Proceedings}, pages = {352--362}, year = {2003}, crossref = {DBLP:conf/appt/2003}, url = {https://doi.org/10.1007/978-3-540-39425-9\_42}, doi = {10.1007/978-3-540-39425-9\_42}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/appt/RenCCL03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/compsac/WongCL03, author = {Eugene Y. C. Wong and Alvin T. S. Chan and Hong Va Leong}, title = {Semantic-based Approach to Streaming {XML} Contents using Xstream}, booktitle = {27th International Computer Software and Applications Conference {(COMPSAC} 2003): Design and Assessment of Trustworthy Software-Based Systems, 3-6 November 2003, Dallas, TX, USA, Proceedings}, pages = {91}, year = {2003}, crossref = {DBLP:conf/compsac/2003}, url = {https://doi.org/10.1109/CMPSAC.2003.1245326}, doi = {10.1109/CMPSAC.2003.1245326}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/compsac/WongCL03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpp/RenCCL03, author = {Zhihong Ren and Jiannong Cao and Alvin T. S. Chan and Jing Li}, title = {Toward a Formal Approach to Composite Web Service Construction and Automation}, booktitle = {32nd International Conference on Parallel Processing {(ICPP} 2003), 6-9 October 2003, Kaohsiung, Taiwan}, pages = {436}, year = {2003}, crossref = {DBLP:conf/icpp/2003}, url = {https://doi.org/10.1109/ICPP.2003.1240608}, doi = {10.1109/ICPP.2003.1240608}, timestamp = {Wed, 07 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icpp/RenCCL03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icwl/ChanCLC03, author = {Alvin T. S. Chan and Jiannong Cao and Chi{-}Kin Liu and Weidong Cao}, title = {Design and Implementation of {VPL:} {A} Virtual Programming Laboratory for Online Distance Learning}, booktitle = {Advances in Web-Based Learning - {ICWL} 2003, Second International Conference, Melbourne, Australia, August 18-20, 2003, Proceedings}, pages = {509--519}, year = {2003}, crossref = {DBLP:conf/icwl/2003}, url = {https://doi.org/10.1007/978-3-540-45200-3\_47}, doi = {10.1007/978-3-540-45200-3\_47}, timestamp = {Fri, 22 Apr 2022 17:07:03 +0200}, biburl = {https://dblp.org/rec/conf/icwl/ChanCLC03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/infocom/FuMT03, author = {Alvin Fu and Eytan H. Modiano and John N. Tsitsiklis}, title = {Optimal Energy Allocation for Delay-Constrained Data Transmission over a Time-Varying Channel}, booktitle = {Proceedings {IEEE} {INFOCOM} 2003, The 22nd Annual Joint Conference of the {IEEE} Computer and Communications Societies, San Franciso, CA, USA, March 30 - April 3, 2003}, pages = {1095--1105}, year = {2003}, crossref = {DBLP:conf/infocom/2003}, url = {https://doi.org/10.1109/INFCOM.2003.1208946}, doi = {10.1109/INFCOM.2003.1208946}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/infocom/FuMT03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscc/ChanCC03, author = {Alvin T. S. Chan and C. K. Chan and Jiannong Cao}, title = {Programming Distributed Web Services Using WebGOP: {A} Graph-Oriented Approach}, booktitle = {Proceedings of the Eighth {IEEE} Symposium on Computers and Communications {(ISCC} 2003), 30 June - 3 July 2003, Kiris-Kemer, Turkey}, pages = {413--418}, year = {2003}, crossref = {DBLP:conf/iscc/2003}, url = {https://doi.org/10.1109/ISCC.2003.1214154}, doi = {10.1109/ISCC.2003.1214154}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iscc/ChanCC03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sac/Chan03, author = {Alvin T. S. Chan}, title = {Integrating Smart Card Access to Web-Based Medical Information System}, booktitle = {Proceedings of the 2003 {ACM} Symposium on Applied Computing (SAC), March 9-12, 2003, Melbourne, FL, {USA}}, pages = {246--250}, year = {2003}, crossref = {DBLP:conf/sac/2003}, url = {https://doi.org/10.1145/952532.952583}, doi = {10.1145/952532.952583}, timestamp = {Tue, 06 Nov 2018 11:06:45 +0100}, biburl = {https://dblp.org/rec/conf/sac/Chan03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sac/ChanLCHLL03, author = {Alvin T. S. Chan and Hong Va Leong and Joseph Chan and Alan Hon and Larry Lau and Leo Li}, title = {Bluepoint: {A} Bluetooth-based Architecture for Location-Positioning Services}, booktitle = {Proceedings of the 2003 {ACM} Symposium on Applied Computing (SAC), March 9-12, 2003, Melbourne, FL, {USA}}, pages = {990--995}, year = {2003}, crossref = {DBLP:conf/sac/2003}, url = {https://doi.org/10.1145/952532.952727}, doi = {10.1145/952532.952727}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sac/ChanLCHLL03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sac/LeongC03, author = {Hong Va Leong and Alvin T. S. Chan}, title = {Mobile Computing and Applications Track Editorial}, booktitle = {Proceedings of the 2003 {ACM} Symposium on Applied Computing (SAC), March 9-12, 2003, Melbourne, FL, {USA}}, pages = {853--854}, year = {2003}, crossref = {DBLP:conf/sac/2003}, url = {https://doi.org/10.1145/952532.952701}, doi = {10.1145/952532.952701}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sac/LeongC03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/seke/MaLCCZ03, author = {Xiaoxing Ma and Jian Lu and Jiannong Cao and Alvin T. S. Chan and Kang Zhang}, title = {A Graph-Oriented Approach to the Description and Implementation of Distributed and Dynamic Software Architecture}, booktitle = {Proceedings of the Fifteenth International Conference on Software Engineering {\&} Knowledge Engineering (SEKE'2003), Hotel Sofitel, San Francisco Bay, CA, USA, July 1-3, 2003}, pages = {518--525}, year = {2003}, crossref = {DBLP:conf/seke/2003}, timestamp = {Tue, 29 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/seke/MaLCCZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/www/ChuangCCC03, author = {Siu Nam Chuang and Alvin T. S. Chan and Jiannong Cao and Ronnie Cheung}, title = {Dynamic service reconfiguration for wireless web access}, booktitle = {Proceedings of the Twelfth International World Wide Web Conference, {WWW} 2003, Budapest, Hungary, May 20-24, 2003}, pages = {58--67}, year = {2003}, crossref = {DBLP:conf/www/2003}, url = {https://doi.org/10.1145/775152.775162}, doi = {10.1145/775152.775162}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/www/ChuangCCC03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/www/WongCL03, author = {Eugene Y. C. Wong and Alvin T. S. Chan and Hong Va Leong}, title = {Xstream: {A} Framework for the Efficient Streaming of {XML} Documents over a Wireless Environment}, booktitle = {Proceedings of the Twelfth International World Wide Web Conference - Posters, {WWW} 2003, Budapest, Hungary, May 20-24, 2003}, year = {2003}, crossref = {DBLP:conf/www/2003p}, url = {http://www2003.org/cdrom/papers/poster/p317/p317-wong.html}, timestamp = {Wed, 17 Jul 2013 16:59:51 +0200}, biburl = {https://dblp.org/rec/conf/www/WongCL03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bmcbi/MutchBMRR02, author = {David M. Mutch and Alvin Berger and Robert Mansourian and Andreas Rytz and Matthew{-}Alan Roberts}, title = {The limit fold change model: {A} practical approach for selecting differentially expressed genes from microarray data}, journal = {{BMC} Bioinform.}, volume = {3}, pages = {17}, year = {2002}, url = {https://doi.org/10.1186/1471-2105-3-17}, doi = {10.1186/1471-2105-3-17}, timestamp = {Sun, 15 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/bmcbi/MutchBMRR02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/internet/ChanTCL02, author = {Alvin T. S. Chan and Florine Tse and Jiannong Cao and Hong Va Leong}, title = {Enabling Distributed Corba Access to Smart Card Applications}, journal = {{IEEE} Internet Comput.}, volume = {6}, number = {3}, pages = {27--36}, year = {2002}, url = {https://doi.org/10.1109/MIC.2002.1003127}, doi = {10.1109/MIC.2002.1003127}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/internet/ChanTCL02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jasis/LukLDCCA02, author = {Robert W. P. Luk and Hong Va Leong and Tharam S. Dillon and Alvin T. S. Chan and W. Bruce Croft and James Allan}, title = {A survey in indexing and searching {XML} documents}, journal = {J. Assoc. Inf. Sci. Technol.}, volume = {53}, number = {6}, pages = {415--437}, year = {2002}, url = {https://doi.org/10.1002/asi.10056}, doi = {10.1002/ASI.10056}, timestamp = {Mon, 02 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jasis/LukLDCCA02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpads/CaoCCW02, author = {Jiannong Cao and Min Cao and Alvin T. S. Chan and Gengfeng Wu}, title = {Architectural Level support for Dynamic Reconfiguration and Fault Tolerance in Component-Based Distributed Software}, booktitle = {9th International Conference on Parallel and Distributed Systems, {ICPADS} 2002, Taiwan, ROC, December 17-20, 2002}, pages = {251--256}, year = {2002}, crossref = {DBLP:conf/icpads/2002}, url = {https://doi.org/10.1109/ICPADS.2002.1183408}, doi = {10.1109/ICPADS.2002.1183408}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpads/CaoCCW02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpp/ChuangCC02, author = {Siu Nam Chuang and Alvin T. S. Chan and Jiannong Cao}, title = {Dynamic Service Composition for Wireless Web Access}, booktitle = {31st International Conference on Parallel Processing {(ICPP} 2002), 20-23 August 2002, Vancouver, BC, Canada}, pages = {429--436}, year = {2002}, crossref = {DBLP:conf/icpp/2002}, url = {https://doi.org/10.1109/ICPP.2002.1040899}, doi = {10.1109/ICPP.2002.1040899}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpp/ChuangCC02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpp/MaCL02, author = {Xiaoxing Ma and Alvin T. S. Chan and Jian Lu}, title = {WebGOP: {A} Framework for Architecting and Programming Dynamic Distributed Web Applications}, booktitle = {31st International Conference on Parallel Processing {(ICPP} 2002), 20-23 August 2002, Vancouver, BC, Canada}, pages = {266--275}, year = {2002}, crossref = {DBLP:conf/icpp/2002}, url = {https://doi.org/10.1109/ICPP.2002.1040882}, doi = {10.1109/ICPP.2002.1040882}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpp/MaCL02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icwl/CaoCCY02, author = {Jiannong Cao and Alvin T. S. Chan and Weidong Cao and Cassidy Yeung}, title = {Virtual Programming Lab for Online Distance Learning}, booktitle = {Advances in Web-Based Learning, First International Conference, {ICWL} 2002, Hong Kong, China, August 17-19, 2002, Proceedings}, pages = {216--227}, year = {2002}, crossref = {DBLP:conf/icwl/2002}, url = {https://doi.org/10.1007/3-540-45689-9\_18}, doi = {10.1007/3-540-45689-9\_18}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icwl/CaoCCY02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ipps/CaoLC02, author = {Jiannong Cao and Patrick Leung and Alvin T. S. Chan}, title = {A Scalable and Reliable Multicast Communiction Service in Java}, booktitle = {16th International Parallel and Distributed Processing Symposium {(IPDPS} 2002), 15-19 April 2002, Fort Lauderdale, FL, USA, CD-ROM/Abstracts Proceedings}, year = {2002}, crossref = {DBLP:conf/ipps/2002}, url = {https://doi.org/10.1109/IPDPS.2002.1016501}, doi = {10.1109/IPDPS.2002.1016501}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ipps/CaoLC02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nnsp/ChangS02, author = {Wei{-}Chen Chang and Alvin Wen{-}Yu Su}, title = {A multi-channel recurrent network for synthesizing struck coupled-string musical instruments}, booktitle = {Proceedings of the 12th {IEEE} Workshop on Neural Networks for Signal Processing, {NNSP} 2002, Martigny, Valais, Switzerland, September 4-6, 2002}, pages = {677--686}, year = {2002}, crossref = {DBLP:conf/nnsp/2002}, url = {https://doi.org/10.1109/NNSP.2002.1030079}, doi = {10.1109/NNSP.2002.1030079}, timestamp = {Wed, 16 Oct 2019 14:14:54 +0200}, biburl = {https://dblp.org/rec/conf/nnsp/ChangS02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sac/MakLC02, author = {Jess Y. S. Mak and Hong Va Leong and Alvin T. S. Chan}, title = {Dynamic structuring of web information for access visualization}, booktitle = {Proceedings of the 2002 {ACM} Symposium on Applied Computing (SAC), March 10-14, 2002, Madrid, Spain}, pages = {778--784}, year = {2002}, crossref = {DBLP:conf/sac/2002}, url = {https://doi.org/10.1145/508791.508942}, doi = {10.1145/508791.508942}, timestamp = {Tue, 06 Nov 2018 11:06:47 +0100}, biburl = {https://dblp.org/rec/conf/sac/MakLC02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wcnc/ChuangCC02, author = {Siu{-}Nam Chuang and Alvin T. S. Chan and Jiannong Cao}, title = {An active service framework supporting wireless Web access}, booktitle = {2002 {IEEE} Wireless Communications and Networking Conference Record, {WCNC} 2002, Orlando, Florida, USA, MArch 17-21, 2002}, pages = {630--634}, year = {2002}, crossref = {DBLP:conf/wcnc/2002}, url = {https://doi.org/10.1109/WCNC.2002.993341}, doi = {10.1109/WCNC.2002.993341}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wcnc/ChuangCC02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cacm/ChanCCY01, author = {Alvin T. S. Chan and Jiannong Cao and Henry C. B. Chan and Gilbert H. Young}, title = {A web-enabled framework for smart card applications in health services}, journal = {Commun. {ACM}}, volume = {44}, number = {9}, pages = {76--82}, year = {2001}, url = {https://doi.org/10.1145/383694.383710}, doi = {10.1145/383694.383710}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cacm/ChanCCY01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cera/ChanLNC01, author = {Stephen C. F. Chan and Paul S. H. Lee and Vincent T. Y. Ng and Alvin T. S. Chan}, title = {Synchronous Collaborative Development of {UML} Models on the Internet}, journal = {Concurr. Eng. Res. Appl.}, volume = {9}, number = {2}, pages = {111--119}, year = {2001}, url = {https://doi.org/10.1177/1063293X0100900204}, doi = {10.1177/1063293X0100900204}, timestamp = {Thu, 18 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cera/ChanLNC01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/join/CaoCC01, author = {Jiannong Cao and Nick K. C. Cheung and Alvin T. S. Chan}, title = {{JDM:} Building Distributed Synchronization Support into Java}, journal = {J. Interconnect. Networks}, volume = {2}, number = {3}, pages = {269--282}, year = {2001}, url = {https://doi.org/10.1142/S0219265901000373}, doi = {10.1142/S0219265901000373}, timestamp = {Fri, 05 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/join/CaoCC01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/doa/ChanTCL01, author = {Alvin T. S. Chan and Florine Tse and Jiannong Cao and Hong Va Leong}, title = {Distributed Object Programming Environment for Smart Card Application Development}, booktitle = {3rd International Symposium on Distributed Objects and Applications, {DOA} 2001, Rome, Italy, September 17-20, 2001}, pages = {251--259}, year = {2001}, crossref = {DBLP:conf/doa/2001}, url = {https://doi.org/10.1109/DOA.2001.954090}, doi = {10.1109/DOA.2001.954090}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/doa/ChanTCL01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsn/CaoCC01, author = {Jiannong Cao and Nick K. C. Cheung and Alvin T. S. Chan}, title = {Run-Time Fault Detection in Monitor Based Concurrent Programming}, booktitle = {2001 International Conference on Dependable Systems and Networks {(DSN} 2001) (formerly: FTCS), 1-4 July 2001, G{\"{o}}teborg, Sweden, Proceedings}, pages = {357--368}, year = {2001}, crossref = {DBLP:conf/dsn/2001}, url = {https://doi.org/10.1109/DSN.2001.941420}, doi = {10.1109/DSN.2001.941420}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dsn/CaoCC01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icalt/ChanCC01, author = {Alvin T. S. Chan and Steven Y. C. Chan and Jiannong Cao}, title = {{SAC:} {A} Self-Paced and Adaptive Courseware System}, booktitle = {Proceedings {IEEE} International Conference on Advanced Learning Technology: Issues, Achievements and Challenges, Madison, WI, USA, August 6-8, 2001}, pages = {78--81}, year = {2001}, crossref = {DBLP:conf/icalt/2001}, url = {https://doi.org/10.1109/ICALT.2001.943860}, doi = {10.1109/ICALT.2001.943860}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icalt/ChanCC01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icppw/CaoCW01, author = {Jiannong Cao and Alvin T. S. Chan and Jie Wu}, title = {Achieving Replication Consistency Using Cooperating Mobile Agents}, booktitle = {30th International Workshops on Parallel Processing {(ICPP} 2001 Workshops), 3-7 September 2001, Valencia, Spain}, pages = {453--458}, year = {2001}, crossref = {DBLP:conf/icppw/2001}, url = {https://doi.org/10.1109/ICPPW.2001.951986}, doi = {10.1109/ICPPW.2001.951986}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icppw/CaoCW01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ipps/CheungCC01, author = {Nick K. C. Cheung and Jiannong Cao and Alvin T. S. Chan}, title = {Analysis and Evaluation of a Distributed Monitor Construct in Java}, booktitle = {Proceedings of the 15th International Parallel {\&} Distributed Processing Symposium (IPDPS-01), San Francisco, CA, USA, April 23-27, 2001}, pages = {108}, year = {2001}, crossref = {DBLP:conf/ipps/2001}, url = {https://doi.org/10.1109/IPDPS.2001.925078}, doi = {10.1109/IPDPS.2001.925078}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ipps/CheungCC01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mdm/ChanHCC01, author = {Alvin T. S. Chan and Dan He and Siu Nam Chuang and Jiannong Cao}, title = {Towards a Programmable Mobile {IP}}, booktitle = {Mobile Data Management, Second International Conference, {MDM} 2001, Hong Kong, China, January 8-10, 2001, Proceedings}, pages = {210--221}, year = {2001}, crossref = {DBLP:conf/mdm/2001}, url = {https://doi.org/10.1007/3-540-44498-X\_17}, doi = {10.1007/3-540-44498-X\_17}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mdm/ChanHCC01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijmi/Chan00, author = {Alvin T. S. Chan}, title = {WWW+smart card: towards a mobile health care management system}, journal = {Int. J. Medical Informatics}, volume = {57}, number = {2-3}, pages = {127--137}, year = {2000}, url = {https://doi.org/10.1016/S1386-5056(00)00061-7}, doi = {10.1016/S1386-5056(00)00061-7}, timestamp = {Fri, 21 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijmi/Chan00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cifer/Kuruc00, author = {Alvin Kuruc}, title = {Apples to oranges: reconciling "vegas" from inconsistent valuation models by a stochastic change of coordinates}, booktitle = {Proceedings of the {IEEE/IAFE/INFORMS} 2000 Conference on Computational Intelligence for Financial Engineering, CIFEr 2000, New York City, USA, March 28, 2000}, pages = {143--146}, year = {2000}, crossref = {DBLP:conf/cifer/2000}, url = {https://doi.org/10.1109/CIFER.2000.844612}, doi = {10.1109/CIFER.2000.844612}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/cifer/Kuruc00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cn/Chan99, author = {Alvin T. S. Chan}, title = {Web-Enabled Smart Card for Ubiquitous Access of Patient's Medical Record}, journal = {Comput. Networks}, volume = {31}, number = {11-16}, pages = {1591--1598}, year = {1999}, url = {https://doi.org/10.1016/S1389-1286(99)00056-0}, doi = {10.1016/S1389-1286(99)00056-0}, timestamp = {Wed, 19 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cn/Chan99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/GarciaM99, author = {Alvin Garcia and Richard J. Mammone}, title = {Channel-robust speaker identification using modified-mean cepstral mean normalization with frequency warping}, booktitle = {Proceedings of the 1999 {IEEE} International Conference on Acoustics, Speech, and Signal Processing, {ICASSP} '99, Phoenix, Arizona, USA, March 15-19, 1999}, pages = {325--328}, year = {1999}, crossref = {DBLP:conf/icassp/1999}, url = {https://doi.org/10.1109/ICASSP.1999.758128}, doi = {10.1109/ICASSP.1999.758128}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icassp/GarciaM99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/interspeech/PrzybockiM99, author = {Mark A. Przybocki and Alvin F. Martin}, title = {The 1999 {NIST} speaker recognition evaluation, using summed two-channel telephone data for speaker detection and speaker tracking}, booktitle = {Sixth European Conference on Speech Communication and Technology, {EUROSPEECH} 1999, Budapest, Hungary, September 5-9, 1999}, pages = {2215--2218}, year = {1999}, crossref = {DBLP:conf/interspeech/1999}, url = {https://doi.org/10.21437/Eurospeech.1999-558}, doi = {10.21437/EUROSPEECH.1999-558}, timestamp = {Wed, 18 Sep 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/interspeech/PrzybockiM99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wcnc/ChanC99, author = {Alvin T. S. Chan and Jiannong Cao}, title = {{PANTA:} {A} graph-oriented programmable active network transport architecture}, booktitle = {1999 {IEEE} Wireless Communications and Networking Conference, {WCNC} 1999, September 21-24, 1999, New Orleans, Louisiana, {USA}}, pages = {1293--1297}, year = {1999}, crossref = {DBLP:conf/wcnc/1999}, url = {https://doi.org/10.1109/WCNC.1999.796946}, doi = {10.1109/WCNC.1999.796946}, timestamp = {Tue, 14 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wcnc/ChanC99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tse/McLellanRFCS98, author = {Samuel G. McLellan and Alvin W. Roesler and Zongming Fei and Savita Chandran and Clay Spinuzzi}, title = {Experience Using Web-Based Shotgun Measures for Large-System Characterization and Improvement}, journal = {{IEEE} Trans. Software Eng.}, volume = {24}, number = {4}, pages = {268--277}, year = {1998}, url = {https://doi.org/10.1109/32.677184}, doi = {10.1109/32.677184}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tse/McLellanRFCS98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isca/WoodCFHLLLMPR93, author = {David A. Wood and Satish Chandra and Babak Falsafi and Mark D. Hill and James R. Larus and Alvin R. Lebeck and James C. Lewis and Shubhendu S. Mukherjee and Subbarao Palacharla and Steven K. Reinhardt}, title = {Mechanisms for Cooperative Shared Memory}, booktitle = {Proceedings of the 20th Annual International Symposium on Computer Architecture, San Diego, CA, USA, May 1993}, pages = {156--167}, year = {1993}, crossref = {DBLP:conf/isca/1993}, url = {https://doi.org/10.1145/165123.165151}, doi = {10.1145/165123.165151}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/isca/WoodCFHLLLMPR93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/compcon/DespainPDCC86, author = {Alvin M. Despain and Yale N. Patt and Tep P. Dobry and Jung{-}Herng Chang and Wayne Citrin}, title = {High Performance Prolog, The Multiplicative Effect of Several Levels of Implementation}, booktitle = {Spring COMPCON'86, Digest of Papers, Thirty-First {IEEE} Computer Society International Conference, San Francisco, California, USA, March 3-6, 1986}, pages = {178--185}, year = {1986}, crossref = {DBLP:conf/compcon/1986}, timestamp = {Wed, 28 Jun 2006 09:47:20 +0200}, biburl = {https://dblp.org/rec/conf/compcon/DespainPDCC86.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/compcon/ChangDD85, author = {Jung{-}Herng Chang and Alvin M. Despain and Doug DeGroot}, title = {AND-Parallelism of Logic Programs Based on a Static Data Dependency Analysis}, booktitle = {Spring COMPCON'85, Digest of Papers, Thirtieth {IEEE} Computer Society International Conference, San Francisco, California, USA, February 25-28, 1985}, pages = {218--226}, year = {1985}, crossref = {DBLP:conf/compcon/1985}, timestamp = {Wed, 28 Jun 2006 12:59:39 +0200}, biburl = {https://dblp.org/rec/conf/compcon/ChangDD85.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/slp/ChangD85, author = {Jung{-}Herng Chang and Alvin M. Despain}, title = {Semi-Intelligent Backtracking of Prolog Based on Static Data Dependency Analysis}, booktitle = {Proceedings of the 1985 Symposium on Logic Programming, Boston, Massachusetts, USA, July 15-18, 1985}, pages = {10--21}, year = {1985}, crossref = {DBLP:conf/slp/1985}, timestamp = {Wed, 04 Dec 2013 14:42:59 +0100}, biburl = {https://dblp.org/rec/conf/slp/ChangD85.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/mss/RothM82, author = {Alvin E. Roth and Michael W. K. Malouf}, title = {Scale changes and shared information in bargaining: An experimental study}, journal = {Math. Soc. Sci.}, volume = {3}, number = {2}, pages = {157--177}, year = {1982}, url = {https://doi.org/10.1016/0165-4896(82)90054-3}, doi = {10.1016/0165-4896(82)90054-3}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/mss/RothM82.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/cec/2024, title = {{IEEE} Congress on Evolutionary Computation, {CEC} 2024, Yokohama, Japan, June 30 - July 5, 2024}, publisher = {{IEEE}}, year = {2024}, url = {https://doi.org/10.1109/CEC60901.2024}, doi = {10.1109/CEC60901.2024}, isbn = {979-8-3503-0836-5}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/cec/2024.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ispd/2024, editor = {Iris Hui{-}Ru Jiang and Gracieli Posser}, title = {Proceedings of the 2024 International Symposium on Physical Design, {ISPD} 2024, Taipei, Taiwan, March 12-15, 2024}, publisher = {{ACM}}, year = {2024}, url = {https://doi.org/10.1145/3626184}, doi = {10.1145/3626184}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/ispd/2024.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/csedu/2023-2, editor = {Jelena Jovanovic and Irene{-}Angelica Chounta and James Uhomoibhi and Bruce M. McLaren}, title = {Proceedings of the 15th International Conference on Computer Supported Education, {CSEDU} 2023, Prague, Czech Republic, April 21-23, 2023, Volume 2}, publisher = {{SCITEPRESS}}, year = {2023}, url = {https://www.scitepress.org/ProceedingsDetails.aspx?ID=o8Aty+lZ2xk=}, isbn = {978-989-758-641-5}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/csedu/2023-2.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icml/2023, editor = {Andreas Krause and Emma Brunskill and Kyunghyun Cho and Barbara Engelhardt and Sivan Sabato and Jonathan Scarlett}, title = {International Conference on Machine Learning, {ICML} 2023, 23-29 July 2023, Honolulu, Hawaii, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {202}, publisher = {{PMLR}}, year = {2023}, url = {http://proceedings.mlr.press/v202/}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/icml/2023.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icra/2023, title = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2023, London, UK, May 29 - June 2, 2023}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/ICRA48891.2023}, doi = {10.1109/ICRA48891.2023}, isbn = {979-8-3503-2365-8}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/icra/2023.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/vr/2023w, title = {{IEEE} Conference on Virtual Reality and 3D User Interfaces Abstracts and Workshops, {VR} Workshops 2023, Shanghai, China, March 25-29, 2023}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/VRW58643.2023}, doi = {10.1109/VRW58643.2023}, isbn = {979-8-3503-4839-2}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/vr/2023w.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/embc/2022, title = {44th Annual International Conference of the {IEEE} Engineering in Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland, United Kingdom, July 11-15, 2022}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/EMBC48229.2022}, doi = {10.1109/EMBC48229.2022}, isbn = {978-1-7281-2782-8}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/embc/2022.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/igarss/2022, title = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS} 2022, Kuala Lumpur, Malaysia, July 17-22, 2022}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/IGARSS46834.2022}, doi = {10.1109/IGARSS46834.2022}, isbn = {978-1-6654-2792-0}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/igarss/2022.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ijcai/2022, editor = {Luc De Raedt}, title = {Proceedings of the Thirty-First International Joint Conference on Artificial Intelligence, {IJCAI} 2022, Vienna, Austria, 23-29 July 2022}, publisher = {ijcai.org}, year = {2022}, url = {https://www.ijcai.org/proceedings/2022/}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/ijcai/2022.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ijcnn/2022, title = {International Joint Conference on Neural Networks, {IJCNN} 2022, Padua, Italy, July 18-23, 2022}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/IJCNN55064.2022}, doi = {10.1109/IJCNN55064.2022}, isbn = {978-1-7281-8671-9}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/ijcnn/2022.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ismar/2022a, title = {2022 {IEEE} International Symposium on Mixed and Augmented Reality Adjunct (ISMAR-Adjunct), Singapore, Singapore, October 17-21, 2022}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/ISMAR-Adjunct57072.2022}, doi = {10.1109/ISMAR-ADJUNCT57072.2022}, isbn = {978-1-6654-5365-3}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/ismar/2022a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/acl/2021-2, editor = {Chengqing Zong and Fei Xia and Wenjie Li and Roberto Navigli}, title = {Proceedings of the 59th Annual Meeting of the Association for Computational Linguistics and the 11th International Joint Conference on Natural Language Processing, {ACL/IJCNLP} 2021, (Volume 2: Short Papers), Virtual Event, August 1-6, 2021}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://aclanthology.org/volumes/2021.acl-short/}, isbn = {978-1-954085-53-4}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/acl/2021-2.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/chil/2021, editor = {Marzyeh Ghassemi and Tristan Naumann and Emma Pierson}, title = {{ACM} {CHIL} '21: {ACM} Conference on Health, Inference, and Learning, Virtual Event, USA, April 8-9, 2021}, publisher = {{ACM}}, year = {2021}, url = {https://doi.org/10.1145/3450439}, doi = {10.1145/3450439}, isbn = {978-1-4503-8359-2}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/chil/2021.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/globecom/2021, title = {{IEEE} Global Communications Conference, {GLOBECOM} 2021, Madrid, Spain, December 7-11, 2021}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/GLOBECOM46510.2021}, doi = {10.1109/GLOBECOM46510.2021}, isbn = {978-1-7281-8104-2}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/globecom/2021.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/iclr/2021, title = {9th International Conference on Learning Representations, {ICLR} 2021, Virtual Event, Austria, May 3-7, 2021}, publisher = {OpenReview.net}, year = {2021}, url = {https://openreview.net/group?id=ICLR.cc/2021/Conference}, timestamp = {Thu, 10 Oct 2024 19:37:07 +0200}, biburl = {https://dblp.org/rec/conf/iclr/2021.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/nips/2021, editor = {Marc'Aurelio Ranzato and Alina Beygelzimer and Yann N. Dauphin and Percy Liang and Jennifer Wortman Vaughan}, title = {Advances in Neural Information Processing Systems 34: Annual Conference on Neural Information Processing Systems 2021, NeurIPS 2021, December 6-14, 2021, virtual}, year = {2021}, url = {https://proceedings.neurips.cc/paper/2021}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/nips/2021.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/acl/2020, editor = {Dan Jurafsky and Joyce Chai and Natalie Schluter and Joel R. Tetreault}, title = {Proceedings of the 58th Annual Meeting of the Association for Computational Linguistics, {ACL} 2020, Online, July 5-10, 2020}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://aclanthology.org/volumes/2020.acl-main/}, isbn = {978-1-952148-25-5}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/acl/2020.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/cvpr/2020, title = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2020, Seattle, WA, USA, June 13-19, 2020}, publisher = {Computer Vision Foundation / {IEEE}}, year = {2020}, url = {https://openaccess.thecvf.com/CVPR2020}, isbn = {978-1-7281-7168-5}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/2020.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/emnlp/2020f, editor = {Trevor Cohn and Yulan He and Yang Liu}, title = {Findings of the Association for Computational Linguistics: {EMNLP} 2020, Online Event, 16-20 November 2020}, series = {Findings of {ACL}}, volume = {{EMNLP} 2020}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://aclanthology.org/volumes/2020.findings-emnlp/}, isbn = {978-1-952148-90-3}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/2020f.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/hicss/2020, title = {53rd Hawaii International Conference on System Sciences, {HICSS} 2020, Maui, Hawaii, USA, January 7-10, 2020}, publisher = {ScholarSpace}, year = {2020}, url = {https://scholarspace.manoa.hawaii.edu/handle/10125/63576}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/hicss/2020.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/iclr/2020, title = {8th International Conference on Learning Representations, {ICLR} 2020, Addis Ababa, Ethiopia, April 26-30, 2020}, publisher = {OpenReview.net}, year = {2020}, url = {https://openreview.net/group?id=ICLR.cc/2020/Conference}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/iclr/2020.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/miccai/2020dart, editor = {Shadi Albarqouni and Spyridon Bakas and Konstantinos Kamnitsas and M. Jorge Cardoso and Bennett A. Landman and Wenqi Li and Fausto Milletari and Nicola Rieke and Holger Roth and Daguang Xu and Ziyue Xu}, title = {Domain Adaptation and Representation Transfer, and Distributed and Collaborative Learning - Second {MICCAI} Workshop, {DART} 2020, and First {MICCAI} Workshop, {DCL} 2020, Held in Conjunction with {MICCAI} 2020, Lima, Peru, October 4-8, 2020, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {12444}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-3-030-60548-3}, doi = {10.1007/978-3-030-60548-3}, isbn = {978-3-030-60547-6}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/miccai/2020dart.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/miccai/2020-2, editor = {Anne L. Martel and Purang Abolmaesumi and Danail Stoyanov and Diana Mateus and Maria A. Zuluaga and S. Kevin Zhou and Daniel Racoceanu and Leo Joskowicz}, title = {Medical Image Computing and Computer Assisted Intervention - {MICCAI} 2020 - 23rd International Conference, Lima, Peru, October 4-8, 2020, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {12262}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-3-030-59713-9}, doi = {10.1007/978-3-030-59713-9}, isbn = {978-3-030-59712-2}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/miccai/2020-2.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/vlsic/2020, title = {{IEEE} Symposium on {VLSI} Circuits, {VLSI} Circuits 2020, Honolulu, HI, USA, June 16-19, 2020}, publisher = {{IEEE}}, year = {2020}, url = {https://ieeexplore.ieee.org/xpl/conhome/9146894/proceeding}, isbn = {978-1-7281-9942-9}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/vlsic/2020.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/cascon/2019, editor = {Tima Pakfetrat and Guy{-}Vincent Jourdan and Kostas Kontogiannis and Robert F. Enenkel}, title = {Proceedings of the 29th Annual International Conference on Computer Science and Software Engineering, {CASCON} 2019, Markham, Ontario, Canada, November 4-6, 2019}, publisher = {{ACM}}, year = {2019}, url = {https://dl.acm.org/doi/10.5555/3370272}, doi = {10.5555/3370272}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/cascon/2019.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/emo/2019, editor = {Kalyanmoy Deb and Erik D. Goodman and Carlos A. Coello Coello and Kathrin Klamroth and Kaisa Miettinen and Sanaz Mostaghim and Patrick M. Reed}, title = {Evolutionary Multi-Criterion Optimization - 10th International Conference, {EMO} 2019, East Lansing, MI, USA, March 10-13, 2019, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {11411}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-12598-1}, doi = {10.1007/978-3-030-12598-1}, isbn = {978-3-030-12597-4}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/emo/2019.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/iccsci/2019, editor = {Widodo Budiharto}, title = {Enabling Collaboration to Escalate Impact of Research Results for Society: The 4th International Conference on Computer Science and Computational Intelligence, {ICCSCI} 2019, 12-13 September 2019, Yogyakarta, Indonesia}, series = {Procedia Computer Science}, volume = {157}, publisher = {Elsevier}, year = {2019}, url = {https://www.sciencedirect.com/science/journal/18770509/157}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/iccsci/2019.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/tale/2019, title = {{IEEE} International Conference on Engineering, Technology and Education, {TALE} 2019, Yogyakarta, Indonesia, December 10-13, 2019}, publisher = {{IEEE}}, year = {2019}, url = {https://ieeexplore.ieee.org/xpl/conhome/9220968/proceeding}, isbn = {978-1-7281-2665-4}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/tale/2019.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ijcai/2018aih, editor = {Isabelle Bichindaritz and Christian Guttmann and Pau Herrero and Fernando Koch and Andrew Koster and Richard Lenz and Beatriz L{\'{o}}pez Ib{\'{a}}{\~{n}}ez and Cindy Marling and Clare Martin and Sara Montagna and Stefania Montani and Manfred Reichert and David Ria{\~{n}}o and Michael Ignaz Schumacher and Annette ten Teije and Nirmalie Wiratunga}, title = {Proceedings of the First Joint Workshop on {AI} in Health organized as part of the Federated {AI} Meeting {(FAIM} 2018), co-located with {AAMAS} 2018, {ICML} 2018, {IJCAI} 2018 and {ICCBR} 2018, Stockholm, Sweden, July 13-14, 2018}, series = {{CEUR} Workshop Proceedings}, volume = {2142}, publisher = {CEUR-WS.org}, year = {2018}, url = {https://ceur-ws.org/Vol-2142}, urn = {urn:nbn:de:0074-2142-7}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/ijcai/2018aih.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ijcai/2018aih-s, editor = {Fernando Koch and Andrew Koster and David Ria{\~{n}}o and Sara Montagna and Michael Schumacher and Annette ten Teije and Christian Guttmann and Manfred Reichert and Isabelle Bichindaritz and Pau Herrero and Richard Lenz and Beatriz L{\'{o}}pez and Cindy Marling and Clare Martin and Stefania Montani and Nirmalie Wiratunga}, title = {Artificial Intelligence in Health - First International Workshop, AIH@IJCAI 2018, Stockholm, Sweden, July 13-14, 2018, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {11326}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-12738-1}, doi = {10.1007/978-3-030-12738-1}, isbn = {978-3-030-12737-4}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/ijcai/2018aih-s.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/intcompsymp/2018, editor = {Chuan{-}Yu Chang and Chien{-}Chou Lin and Horng{-}Horng Lin}, title = {New Trends in Computer Technologies and Applications - 23rd International Computer Symposium, {ICS} 2018, Yunlin, Taiwan, December 20-22, 2018, Revised Selected Papers}, series = {Communications in Computer and Information Science}, volume = {1013}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-981-13-9190-3}, doi = {10.1007/978-981-13-9190-3}, isbn = {978-981-13-9189-7}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/intcompsymp/2018.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/chi/2017a, editor = {Gloria Mark and Susan R. Fussell and Cliff Lampe and m. c. schraefel and Juan Pablo Hourcade and Caroline Appert and Daniel Wigdor}, title = {Proceedings of the 2017 {CHI} Conference on Human Factors in Computing Systems, Denver, CO, USA, May 06-11, 2017, Extended Abstracts}, publisher = {{ACM}}, year = {2017}, url = {https://doi.org/10.1145/3027063}, doi = {10.1145/3027063}, isbn = {978-1-4503-4656-6}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/chi/2017a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/iccad/2017, editor = {Sri Parameswaran}, title = {2017 {IEEE/ACM} International Conference on Computer-Aided Design, {ICCAD} 2017, Irvine, CA, USA, November 13-16, 2017}, publisher = {{IEEE}}, year = {2017}, url = {https://ieeexplore.ieee.org/xpl/conhome/8167715/proceeding}, isbn = {978-1-5386-3093-8}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/iccad/2017.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/iccsce/2017, title = {7th {IEEE} International Conference on Control System, Computing and Engineering, {ICCSCE} 2017, Penang, Malaysia, November 24-26, 2017}, publisher = {{IEEE}}, year = {2017}, url = {https://ieeexplore.ieee.org/xpl/conhome/8275422/proceeding}, isbn = {978-1-5386-3897-2}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/iccsce/2017.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/iiaiaai/2016, title = {5th {IIAI} International Congress on Advanced Applied Informatics, {IIAI-AAI} 2016, Kumamoto, Japan, July 10-14, 2016}, publisher = {{IEEE} Computer Society}, year = {2016}, url = {https://ieeexplore.ieee.org/xpl/conhome/7557346/proceeding}, isbn = {978-1-4673-8985-3}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/iiaiaai/2016.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/qtna/2016, editor = {Winston Seah and Yutaka Takahashi}, title = {Proceedings of the 11th International Conference on Queueing Theory and Network Applications, {QTNA} 2016, Wellington, New Zealand, December 13-15, 2016}, publisher = {{ACM}}, year = {2016}, url = {https://doi.org/10.1145/3016032}, doi = {10.1145/3016032}, isbn = {978-1-4503-4842-3}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/qtna/2016.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/sigcomm/2016, editor = {Marinho P. Barcellos and Jon Crowcroft and Amin Vahdat and Sachin Katti}, title = {Proceedings of the {ACM} {SIGCOMM} 2016 Conference, Florianopolis, Brazil, August 22-26, 2016}, publisher = {{ACM}}, year = {2016}, url = {https://doi.org/10.1145/2934872}, doi = {10.1145/2934872}, isbn = {978-1-4503-4193-6}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/sigcomm/2016.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/amcis/2015, title = {21st Americas Conference on Information Systems, {AMCIS} 2015, Puerto Rico, August 13-15, 2015}, publisher = {Association for Information Systems}, year = {2015}, url = {http://aisel.aisnet.org/amcis2015/}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/amcis/2015.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/compsac/2015, editor = {Sheikh Iqbal Ahamed and Carl K. Chang and William C. Chu and Ivica Crnkovic and Pao{-}Ann Hsiung and Gang Huang and Jingwei Yang}, title = {39th {IEEE} Annual Computer Software and Applications Conference, {COMPSAC} 2015, Taichung, Taiwan, July 1-5, 2015. Volume 2}, publisher = {{IEEE} Computer Society}, year = {2015}, url = {https://ieeexplore.ieee.org/xpl/conhome/7271781/proceeding}, isbn = {978-1-4673-6563-5}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/compsac/2015.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icc/2015, title = {2015 {IEEE} International Conference on Communications, {ICC} 2015, London, United Kingdom, June 8-12, 2015}, publisher = {{IEEE}}, year = {2015}, url = {https://ieeexplore.ieee.org/xpl/conhome/7225357/proceeding}, isbn = {978-1-4673-6432-4}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icc/2015.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/sac/2015, editor = {Roger L. Wainwright and Juan Manuel Corchado and Alessio Bechini and Jiman Hong}, title = {Proceedings of the 30th Annual {ACM} Symposium on Applied Computing, Salamanca, Spain, April 13-17, 2015}, publisher = {{ACM}}, year = {2015}, url = {http://dl.acm.org/citation.cfm?id=2695664}, isbn = {978-1-4503-3196-8}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/sac/2015.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/dsn/2014, title = {44th Annual {IEEE/IFIP} International Conference on Dependable Systems and Networks, {DSN} 2014, Atlanta, GA, USA, June 23-26, 2014}, publisher = {{IEEE} Computer Society}, year = {2014}, url = {https://ieeexplore.ieee.org/xpl/conhome/6900116/proceeding}, isbn = {978-1-4799-2233-8}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/dsn/2014.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ismir/2014, editor = {Hsin{-}Min Wang and Yi{-}Hsuan Yang and Jin Ha Lee}, title = {Proceedings of the 15th International Society for Music Information Retrieval Conference, {ISMIR} 2014, Taipei, Taiwan, October 27-31, 2014}, year = {2014}, url = {http://www.terasoft.com.tw/conf/ismir2014/}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/ismir/2014.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/isscc/2014, title = {2014 {IEEE} International Conference on Solid-State Circuits Conference, {ISSCC} 2014, Digest of Technical Papers, San Francisco, CA, USA, February 9-13, 2014}, publisher = {{IEEE}}, year = {2014}, url = {https://ieeexplore.ieee.org/xpl/conhome/6747109/proceeding}, isbn = {978-1-4799-0918-6}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/isscc/2014.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/mm/2014, editor = {Kien A. Hua and Yong Rui and Ralf Steinmetz and Alan Hanjalic and Apostol Natsev and Wenwu Zhu}, title = {Proceedings of the {ACM} International Conference on Multimedia, {MM} '14, Orlando, FL, USA, November 03 - 07, 2014}, publisher = {{ACM}}, year = {2014}, url = {http://dl.acm.org/citation.cfm?id=2647868}, isbn = {978-1-4503-3063-3}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/mm/2014.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/apsipa/2013, title = {Asia-Pacific Signal and Information Processing Association Annual Summit and Conference, {APSIPA} 2013, Kaohsiung, Taiwan, October 29 - November 1, 2013}, publisher = {{IEEE}}, year = {2013}, url = {https://ieeexplore.ieee.org/xpl/conhome/6682637/proceeding}, isbn = {978-1-4799-2794-4}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/apsipa/2013.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/cogsci/2013, editor = {Markus Knauff and Michael Pauen and Natalie Sebanz and Ipke Wachsmuth}, title = {Proceedings of the 35th Annual Meeting of the Cognitive Science Society, CogSci 2013, Berlin, Germany, July 31 - August 3, 2013}, publisher = {cognitivesciencesociety.org}, year = {2013}, url = {https://mindmodeling.org/cogsci2013/}, isbn = {978-0-9768318-9-1}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/cogsci/2013.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icpca/2013, editor = {Qiaohong Zu and Maria Vargas{-}Vera and Bo Hu}, title = {Pervasive Computing and the Networked World - Joint International Conference, {ICPCA/SWS} 2013, Vina del Mar, Chile, December 5-7, 2013. Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {8351}, publisher = {Springer}, year = {2014}, url = {https://doi.org/10.1007/978-3-319-09265-2}, doi = {10.1007/978-3-319-09265-2}, isbn = {978-3-319-09264-5}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icpca/2013.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icst/2013w, title = {Sixth {IEEE} International Conference on Software Testing, Verification and Validation, {ICST} 2013 Workshops Proceedings, Luxembourg, Luxembourg, March 18-22, 2013}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://ieeexplore.ieee.org/xpl/conhome/6570842/proceeding}, isbn = {978-1-4799-1324-4}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icst/2013w.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/lcn/2013, title = {38th Annual {IEEE} Conference on Local Computer Networks, Sydney, Australia, October 21-24, 2013}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://ieeexplore.ieee.org/xpl/conhome/6745315/proceeding}, isbn = {978-1-4799-0537-9}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/lcn/2013.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/sac/2013, editor = {Sung Y. Shin and Jos{\'{e}} Carlos Maldonado}, title = {Proceedings of the 28th Annual {ACM} Symposium on Applied Computing, {SAC} '13, Coimbra, Portugal, March 18-22, 2013}, publisher = {{ACM}}, year = {2013}, url = {http://dl.acm.org/citation.cfm?id=2480362}, isbn = {978-1-4503-1656-9}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/sac/2013.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/trustcom/2013, title = {12th {IEEE} International Conference on Trust, Security and Privacy in Computing and Communications, TrustCom 2013 / 11th {IEEE} International Symposium on Parallel and Distributed Processing with Applications, {ISPA-13} / 12th {IEEE} International Conference on Ubiquitous Computing and Communications, IUCC-2013, Melbourne, Australia, July 16-18, 2013}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://ieeexplore.ieee.org/xpl/conhome/6679587/proceeding}, isbn = {978-0-7695-5022-0}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/trustcom/2013.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/IEEEcloud/2012, editor = {Rong Chang}, title = {2012 {IEEE} Fifth International Conference on Cloud Computing, Honolulu, HI, USA, June 24-29, 2012}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://ieeexplore.ieee.org/xpl/conhome/6253102/proceeding}, isbn = {978-1-4673-2892-0}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/IEEEcloud/2012.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/bhi/2012, title = {Proceedings of 2012 {IEEE-EMBS} International Conference on Biomedical and Health Informatics, Hong Kong, China, January 5-7, 2012}, publisher = {{IEEE}}, year = {2012}, url = {https://ieeexplore.ieee.org/xpl/conhome/6204368/proceeding}, isbn = {978-1-4577-2176-2}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/bhi/2012.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/esscirc/2012, title = {Proceedings of the 38th European Solid-State Circuit conference, {ESSCIRC} 2012, Bordeaux, France, September 17-21, 2012}, publisher = {{IEEE}}, year = {2012}, url = {https://ieeexplore.ieee.org/xpl/conhome/6331297/proceeding}, isbn = {978-1-4673-2212-6}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/esscirc/2012.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/hpca/2012, title = {18th {IEEE} International Symposium on High Performance Computer Architecture, {HPCA} 2012, New Orleans, LA, USA, 25-29 February, 2012}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://ieeexplore.ieee.org/xpl/conhome/6165554/proceeding}, isbn = {978-1-4673-0827-4}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/hpca/2012.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/hpcc/2012, editor = {Geyong Min and Jia Hu and Lei (Chris) Liu and Laurence Tianruo Yang and Seetharami Seelam and Laurent Lef{\`{e}}vre}, title = {14th {IEEE} International Conference on High Performance Computing and Communication {\&} 9th {IEEE} International Conference on Embedded Software and Systems, {HPCC-ICESS} 2012, Liverpool, United Kingdom, June 25-27, 2012}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://ieeexplore.ieee.org/xpl/conhome/6331801/proceeding}, isbn = {978-1-4673-2164-8}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/hpcc/2012.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/iccel/2012, title = {{IEEE} International Conference on Consumer Electronics, {ICCE} 2012, Las Vegas, NV, USA, January 13-16, 2012}, publisher = {{IEEE}}, year = {2012}, url = {https://ieeexplore.ieee.org/xpl/conhome/6153584/proceeding}, isbn = {978-1-4577-0230-3}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/iccel/2012.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/percom/2012w, title = {Tenth Annual {IEEE} International Conference on Pervasive Computing and Communications, PerCom 2012, March 19-23, 2012, Lugano, Switzerland, Workshop Proceedings}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://ieeexplore.ieee.org/xpl/conhome/6192378/proceeding}, isbn = {978-1-4673-0905-9}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/percom/2012w.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/sin/2012, editor = {Manoj Singh Gaur and Atilla El{\c{c}}i and Oleg B. Makarevich and Mehmet A. Orgun and Virendra Singh}, title = {5th International Conference of Security of Information and Networks, {SIN} '12, Jaipur, India, October 22 - 26, 2012}, publisher = {{ACM}}, year = {2012}, url = {http://dl.acm.org/citation.cfm?id=2388576}, isbn = {978-1-4503-1668-2}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/sin/2012.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/chi/2011a, editor = {Desney S. Tan and Saleema Amershi and Bo Begole and Wendy A. Kellogg and Manas Tungare}, title = {Proceedings of the International Conference on Human Factors in Computing Systems, {CHI} 2011, Extended Abstracts Volume, Vancouver, BC, Canada, May 7-12, 2011}, publisher = {{ACM}}, year = {2011}, url = {https://doi.org/10.1145/1979742}, doi = {10.1145/1979742}, isbn = {978-1-4503-0268-5}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/chi/2011a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ithings/2011, title = {2011 {IEEE} International Conference on Internet of Things (iThings) {\&} 4th {IEEE} International Conference on Cyber, Physical and Social Computing (CPSCom), Dalian, China, October 19-22, 2011}, publisher = {{IEEE} Computer Society}, year = {2011}, url = {https://ieeexplore.ieee.org/xpl/conhome/6142151/proceeding}, isbn = {978-1-4577-1976-9}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/ithings/2011.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/mdm/2011-1, editor = {Arkady B. Zaslavsky and Panos K. Chrysanthis and Dik Lun Lee and Dipanjan Chakraborty and Vana Kalogeraki and Mohamed F. Mokbel and Chi{-}Yin Chow}, title = {12th {IEEE} International Conference on Mobile Data Management, {MDM} 2011, Lule{\aa}, Sweden, June 6-9, 2011, Volume 1}, publisher = {{IEEE} Computer Society}, year = {2011}, url = {https://ieeexplore.ieee.org/xpl/mostRecentIssue.jsp?isnumber=6068399}, isbn = {978-1-4577-0581-6}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/mdm/2011-1.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/sies/2011, title = {Industrial Embedded Systems (SIES), 2011 6th {IEEE} International Symposium on, {SIES} 2011. Vasteras, Sweden, June 15-17, 2011}, publisher = {{IEEE}}, year = {2011}, url = {https://ieeexplore.ieee.org/xpl/conhome/5937480/proceeding}, isbn = {978-1-61284-818-1}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/sies/2011.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@book{DBLP:series/hci/DouglasL11, editor = {Ian Douglas and Zhengjie Liu}, title = {Global Usability}, series = {Human-Computer Interaction Series}, publisher = {Springer}, year = {2011}, url = {https://doi.org/10.1007/978-0-85729-304-6}, doi = {10.1007/978-0-85729-304-6}, isbn = {978-0-85729-303-9}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/series/hci/DouglasL11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/hipc/2010, title = {2010 International Conference on High Performance Computing, HiPC 2010, Dona Paula, Goa, India, December 19-22, 2010}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://ieeexplore.ieee.org/xpl/conhome/5708271/proceeding}, isbn = {978-1-4244-8518-5}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/hipc/2010.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/sac/2010, editor = {Sung Y. Shin and Sascha Ossowski and Michael Schumacher and Mathew J. Palakal and Chih{-}Cheng Hung}, title = {Proceedings of the 2010 {ACM} Symposium on Applied Computing (SAC), Sierre, Switzerland, March 22-26, 2010}, publisher = {{ACM}}, year = {2010}, url = {https://doi.org/10.1145/1774088}, doi = {10.1145/1774088}, isbn = {978-1-60558-639-7}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/sac/2010.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/crowncom/2009, editor = {Thomas Kaiser and Markus Fidler}, title = {4th International {ICST} Conference on Cognitive Radio Oriented Wireless Networks and Communications, {CROWNCOM} 2009, Hannover, Germany, June 22-24, 2009}, publisher = {{IEEE}}, year = {2009}, url = {https://ieeexplore.ieee.org/xpl/conhome/5173448/proceeding}, isbn = {978-1-4244-3423-7}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/crowncom/2009.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/cse/2009, title = {Proceedings of the 12th {IEEE} International Conference on Computational Science and Engineering, {CSE} 2009, Vancouver, BC, Canada, August 29-31, 2009}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://ieeexplore.ieee.org/xpl/conhome/5282954/proceeding}, isbn = {978-1-4244-5334-4}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/cse/2009.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/interspeech/2009, title = {10th Annual Conference of the International Speech Communication Association, {INTERSPEECH} 2009, Brighton, United Kingdom, September 6-10, 2009}, publisher = {{ISCA}}, year = {2009}, url = {https://doi.org/10.21437/Interspeech.2009}, doi = {10.21437/INTERSPEECH.2009}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/interspeech/2009.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/sac/2008, editor = {Roger L. Wainwright and Hisham Haddad}, title = {Proceedings of the 2008 {ACM} Symposium on Applied Computing (SAC), Fortaleza, Ceara, Brazil, March 16-20, 2008}, publisher = {{ACM}}, year = {2008}, url = {https://doi.org/10.1145/1363686}, doi = {10.1145/1363686}, isbn = {978-1-59593-753-7}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/sac/2008.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/semco/2008, title = {Proceedings of the 2th {IEEE} International Conference on Semantic Computing {(ICSC} 2008), August 4-7, 2008, Santa Clara, California, {USA}}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://ieeexplore.ieee.org/xpl/conhome/4597156/proceeding}, isbn = {978-0-7695-3279-0}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/semco/2008.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/euc/2007, editor = {Tei{-}Wei Kuo and Edwin Hsing{-}Mean Sha and Minyi Guo and Laurence Tianruo Yang and Zili Shao}, title = {Embedded and Ubiquitous Computing, International Conference, {EUC} 2007, Taipei, Taiwan, December 17-20, 2007, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4808}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-77092-3}, doi = {10.1007/978-3-540-77092-3}, isbn = {978-3-540-77091-6}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/euc/2007.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/chi/2006a, editor = {Gary M. Olson and Robin Jeffries}, title = {Extended Abstracts Proceedings of the 2006 Conference on Human Factors in Computing Systems, {CHI} 2006, Montr{\'{e}}al, Qu{\'{e}}bec, Canada, April 22-27, 2006}, publisher = {{ACM}}, year = {2006}, url = {https://doi.org/10.1145/1125451}, doi = {10.1145/1125451}, isbn = {978-1-59593-298-3}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/chi/2006a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/etra/2006, editor = {Kari{-}Jouko R{\"{a}}ih{\"{a}} and Andrew T. Duchowski}, title = {Proceedings of the Eye Tracking Research {\&} Application Symposium, {ETRA} 2006, San Diego, California, USA, March 27-29, 2006}, publisher = {{ACM}}, year = {2006}, isbn = {1-59593-305-0}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/etra/2006.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/euc/2006, editor = {Edwin Hsing{-}Mean Sha and Sung{-}Kook Han and Cheng{-}Zhong Xu and Moon{-}hae Kim and Laurence Tianruo Yang and Bin Xiao}, title = {Embedded and Ubiquitous Computing, International Conference, {EUC} 2006, Seoul, Korea, August 1-4, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4096}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11802167}, doi = {10.1007/11802167}, isbn = {3-540-36679-2}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/euc/2006.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/fuzzIEEE/2006, title = {{IEEE} International Conference on Fuzzy Systems, {FUZZ-IEEE} 2006, Vancouver, BC, Canada, July 16-21, 2006}, publisher = {{IEEE}}, year = {2006}, url = {https://ieeexplore.ieee.org/xpl/conhome/11093/proceeding}, isbn = {0-7803-9488-7}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/fuzzIEEE/2006.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/gpc/2006, editor = {Yeh{-}Ching Chung and Jos{\'{e}} E. Moreira}, title = {Advances in Grid and Pervasive Computing, First International Conference, {GPC} 2006, Taichung, Taiwan, May 3-5, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3947}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11745693}, doi = {10.1007/11745693}, isbn = {3-540-33809-8}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/gpc/2006.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/iscc/2006, editor = {Paolo Bellavista and Chi{-}Ming Chen and Antonio Corradi and Mahmoud Daneshmand}, title = {Proceedings of the 11th {IEEE} Symposium on Computers and Communications {(ISCC} 2006), 26-29 June 2006, Cagliari, Sardinia, Italy}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://ieeexplore.ieee.org/xpl/conhome/11130/proceeding}, isbn = {0-7695-2588-1}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/iscc/2006.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/mdm/2006, title = {7th International Conference on Mobile Data Management {(MDM} 2006), Nara, Japan, May 9-13, 2006}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://ieeexplore.ieee.org/xpl/conhome/10853/proceeding}, isbn = {0-7695-2526-1}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/mdm/2006.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/sac/2006, editor = {Hisham Haddad}, title = {Proceedings of the 2006 {ACM} Symposium on Applied Computing (SAC), Dijon, France, April 23-27, 2006}, publisher = {{ACM}}, year = {2006}, url = {https://doi.org/10.1145/1141277}, doi = {10.1145/1141277}, isbn = {1-59593-108-2}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/sac/2006.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icws/2005, title = {2005 {IEEE} International Conference on Web Services {(ICWS} 2005), 11-15 July 2005, Orlando, FL, {USA}}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://ieeexplore.ieee.org/xpl/conhome/10245/proceeding}, isbn = {0-7695-2409-5}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icws/2005.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/isads/2005, editor = {Qingquan Qian}, title = {2005 International Symposium on Autonomous Decentralized Systems, {ISADS} 2005, Chengdu, China, April 4-8, 2005, Proceedings}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://ieeexplore.ieee.org/xpl/conhome/9846/proceeding}, isbn = {0-7803-8963-8}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/isads/2005.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/mdm/2005, editor = {Panos K. Chrysanthis and George Samaras}, title = {6th International Conference on Mobile Data Management {(MDM} 2005), Ayia Napa, Cyprus, May 9-13, 2005}, publisher = {{ACM}}, year = {2005}, isbn = {1-59593-041-8}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/mdm/2005.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/rtcsa/2005, title = {11th {IEEE} International Conference on Embedded and Real-Time Computing Systems and Applications {(RTCSA} 2005), 17-19 August 2005, Hong Kong, China}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://ieeexplore.ieee.org/xpl/conhome/10343/proceeding}, isbn = {0-7695-2346-3}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/rtcsa/2005.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/sac/2005, editor = {Hisham Haddad and Lorie M. Liebrock and Andrea Omicini and Roger L. Wainwright}, title = {Proceedings of the 2005 {ACM} Symposium on Applied Computing (SAC), Santa Fe, New Mexico, USA, March 13-17, 2005}, publisher = {{ACM}}, year = {2005}, url = {https://doi.org/10.1145/1066677}, doi = {10.1145/1066677}, isbn = {1-58113-964-0}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/sac/2005.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/aina/2004, title = {18th International Conference on Advanced Information Networking and Applications {(AINA} 2004), 29-31 March 2004, Fukuoka, Japan}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://ieeexplore.ieee.org/xpl/conhome/9028/proceeding}, isbn = {0-7695-2051-0}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/aina/2004.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/compsac/2004, title = {28th International Computer Software and Applications Conference {(COMPSAC} 2004), Design and Assessment of Trustworthy Software-Based Systems, 27-30 September 2004, Hong Kong, China, Proceedings}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://ieeexplore.ieee.org/xpl/tocresult.jsp?isnumber=29570}, isbn = {0-7695-2209-2}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/compsac/2004.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icdcsw/2004, title = {24th International Conference on Distributed Computing Systems Workshops {(ICDCS} 2004 Workshops), 23-24 March 2004, Hachioji, Tokyo, Japan}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://ieeexplore.ieee.org/xpl/conhome/9027/proceeding}, isbn = {0-7695-2087-1}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icdcsw/2004.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icip/2004, title = {Proceedings of the 2004 International Conference on Image Processing, {ICIP} 2004, Singapore, October 24-27, 2004}, publisher = {{IEEE}}, year = {2004}, url = {https://ieeexplore.ieee.org/xpl/conhome/9716/proceeding}, isbn = {0-7803-8554-3}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icip/2004.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icpp/2004, title = {33rd International Conference on Parallel Processing {(ICPP} 2004), 15-18 August 2004, Montreal, Quebec, Canada}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://ieeexplore.ieee.org/xpl/conhome/9250/proceeding}, isbn = {0-7695-2197-5}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icpp/2004.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ispa/2004, editor = {Jiannong Cao and Laurence Tianruo Yang and Minyi Guo and Francis Chi{-}Moon Lau}, title = {Parallel and Distributed Processing and Applications, Second InternationalSymposium, {ISPA} 2004, Hong Kong, China, December 13-15, 2004, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3358}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/b104574}, doi = {10.1007/B104574}, isbn = {3-540-24128-0}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/ispa/2004.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ispan/2004, title = {7th International Symposium on Parallel Architectures, Algorithms, and Networks {(I-SPAN} 2004), 10-12 May 2004, Hong Kong, SAR, China}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://ieeexplore.ieee.org/xpl/conhome/9103/proceeding}, isbn = {0-7695-2135-5}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/ispan/2004.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/sac/2004, editor = {Hisham Haddad and Andrea Omicini and Roger L. Wainwright and Lorie M. Liebrock}, title = {Proceedings of the 2004 {ACM} Symposium on Applied Computing (SAC), Nicosia, Cyprus, March 14-17, 2004}, publisher = {{ACM}}, year = {2004}, url = {https://doi.org/10.1145/967900}, doi = {10.1145/967900}, isbn = {1-58113-812-1}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/sac/2004.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/appt/2003, editor = {Xingming Zhou and Stefan J{\"{a}}hnichen and Ming Xu and Jiannong Cao}, title = {Advanced Parallel Programming Technologies, 5th International Workshop, {APPT} 2003, Xiamen, China, September 17-19, 2003, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {2834}, publisher = {Springer}, year = {2003}, url = {https://doi.org/10.1007/b13582}, doi = {10.1007/B13582}, isbn = {3-540-20054-1}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/appt/2003.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/compsac/2003, title = {27th International Computer Software and Applications Conference {(COMPSAC} 2003): Design and Assessment of Trustworthy Software-Based Systems, 3-6 November 2003, Dallas, TX, USA, Proceedings}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://ieeexplore.ieee.org/xpl/conhome/8813/proceeding}, isbn = {0-7695-2020-0}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/compsac/2003.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icpp/2003, title = {32nd International Conference on Parallel Processing {(ICPP} 2003), 6-9 October 2003, Kaohsiung, Taiwan}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://ieeexplore.ieee.org/xpl/conhome/8782/proceeding}, isbn = {0-7695-2017-0}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icpp/2003.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icwl/2003, editor = {Wanlei Zhou and Paul Nicholson and Brian J. Corbitt and Joseph Fong}, title = {Advances in Web-Based Learning - {ICWL} 2003, Second International Conference, Melbourne, Australia, August 18-20, 2003, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {2783}, publisher = {Springer}, year = {2003}, url = {https://doi.org/10.1007/b12012}, doi = {10.1007/B12012}, isbn = {3-540-40772-3}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icwl/2003.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/infocom/2003, title = {Proceedings {IEEE} {INFOCOM} 2003, The 22nd Annual Joint Conference of the {IEEE} Computer and Communications Societies, San Franciso, CA, USA, March 30 - April 3, 2003}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://ieeexplore.ieee.org/xpl/conhome/8585/proceeding}, isbn = {0-7803-7752-4}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/infocom/2003.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/iscc/2003, title = {Proceedings of the Eighth {IEEE} Symposium on Computers and Communications {(ISCC} 2003), 30 June - 3 July 2003, Kiris-Kemer, Turkey}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://ieeexplore.ieee.org/xpl/conhome/8616/proceeding}, isbn = {0-7695-1961-X}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/iscc/2003.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/sac/2003, editor = {Gary B. Lamont and Hisham Haddad and George A. Papadopoulos and Brajendra Panda}, title = {Proceedings of the 2003 {ACM} Symposium on Applied Computing (SAC), March 9-12, 2003, Melbourne, FL, {USA}}, publisher = {{ACM}}, year = {2003}, url = {https://doi.org/10.1145/952532}, doi = {10.1145/952532}, isbn = {1-58113-624-2}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/sac/2003.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/seke/2003, title = {Proceedings of the Fifteenth International Conference on Software Engineering {\&} Knowledge Engineering (SEKE'2003), Hotel Sofitel, San Francisco Bay, CA, USA, July 1-3, 2003}, year = {2003}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/seke/2003.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/www/2003, editor = {Guszt{\'{a}}v Hencsey and Bebo White and Yih{-}Farn Robin Chen and L{\'{a}}szl{\'{o}} Kov{\'{a}}cs and Steve Lawrence}, title = {Proceedings of the Twelfth International World Wide Web Conference, {WWW} 2003, Budapest, Hungary, May 20-24, 2003}, publisher = {{ACM}}, year = {2003}, isbn = {1-58113-680-3}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/www/2003.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/www/2003p, editor = {Irwin King and Tam{\'{a}}s M{\'{a}}ray}, title = {Proceedings of the Twelfth International World Wide Web Conference - Posters, {WWW} 2003, Budapest, Hungary, May 20-24, 2003}, year = {2003}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/www/2003p.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icpads/2002, title = {9th International Conference on Parallel and Distributed Systems, {ICPADS} 2002, Taiwan, ROC, December 17-20, 2002}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://ieeexplore.ieee.org/xpl/conhome/8425/proceeding}, isbn = {0-7695-1760-9}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icpads/2002.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icpp/2002, title = {31st International Conference on Parallel Processing {(ICPP} 2002), 20-23 August 2002, Vancouver, BC, Canada}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://ieeexplore.ieee.org/xpl/conhome/8068/proceeding}, isbn = {0-7695-1677-7}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icpp/2002.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icwl/2002, editor = {Joseph Fong and Ronnie Chu Ting Cheung and Hong Va Leong and Qing Li}, title = {Advances in Web-Based Learning, First International Conference, {ICWL} 2002, Hong Kong, China, August 17-19, 2002, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {2436}, publisher = {Springer}, year = {2002}, url = {https://doi.org/10.1007/3-540-45689-9}, doi = {10.1007/3-540-45689-9}, isbn = {3-540-44041-0}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icwl/2002.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ipps/2002, title = {16th International Parallel and Distributed Processing Symposium {(IPDPS} 2002), 15-19 April 2002, Fort Lauderdale, FL, USA, CD-ROM/Abstracts Proceedings}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://ieeexplore.ieee.org/xpl/conhome/7926/proceeding}, isbn = {0-7695-1573-8}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/ipps/2002.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/nnsp/2002, title = {Proceedings of the 12th {IEEE} Workshop on Neural Networks for Signal Processing, {NNSP} 2002, Martigny, Valais, Switzerland, September 4-6, 2002}, publisher = {{IEEE}}, year = {2002}, url = {https://ieeexplore.ieee.org/xpl/conhome/8007/proceeding}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/nnsp/2002.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/sac/2002, editor = {Gary B. Lamont and Hisham Haddad and George A. Papadopoulos and Brajendra Panda}, title = {Proceedings of the 2002 {ACM} Symposium on Applied Computing (SAC), March 10-14, 2002, Madrid, Spain}, publisher = {{ACM}}, year = {2002}, url = {https://doi.org/10.1145/508791}, doi = {10.1145/508791}, isbn = {1-58113-445-2}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/sac/2002.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/wcnc/2002, title = {2002 {IEEE} Wireless Communications and Networking Conference Record, {WCNC} 2002, Orlando, Florida, USA, MArch 17-21, 2002}, publisher = {{IEEE}}, year = {2002}, url = {https://ieeexplore.ieee.org/xpl/conhome/7793/proceeding}, isbn = {0-7803-7376-6}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/wcnc/2002.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/doa/2001, title = {3rd International Symposium on Distributed Objects and Applications, {DOA} 2001, Rome, Italy, September 17-20, 2001}, publisher = {{IEEE} Computer Society}, year = {2001}, url = {https://ieeexplore.ieee.org/xpl/conhome/7570/proceeding}, isbn = {0-7695-1300-X}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/doa/2001.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/dsn/2001, title = {2001 International Conference on Dependable Systems and Networks {(DSN} 2001) (formerly: FTCS), 1-4 July 2001, G{\"{o}}teborg, Sweden, Proceedings}, publisher = {{IEEE} Computer Society}, year = {2001}, url = {https://ieeexplore.ieee.org/xpl/conhome/7490/proceeding}, isbn = {0-7695-1101-5}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/dsn/2001.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icalt/2001, editor = {Toshio Okamoto and Roger Hartley and Kinshuk and John P. Klus}, title = {Proceedings {IEEE} International Conference on Advanced Learning Technology: Issues, Achievements and Challenges, Madison, WI, USA, August 6-8, 2001}, publisher = {{IEEE} Computer Society}, year = {2001}, url = {https://ieeexplore.ieee.org/xpl/conhome/7507/proceeding}, isbn = {0-7695-1013-2}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icalt/2001.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icppw/2001, title = {30th International Workshops on Parallel Processing {(ICPP} 2001 Workshops), 3-7 September 2001, Valencia, Spain}, publisher = {{IEEE} Computer Society}, year = {2001}, url = {https://ieeexplore.ieee.org/xpl/conhome/7556/proceeding}, isbn = {0-7695-1260-7}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icppw/2001.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ipps/2001, title = {Proceedings of the 15th International Parallel {\&} Distributed Processing Symposium (IPDPS-01), San Francisco, CA, USA, April 23-27, 2001}, publisher = {{IEEE} Computer Society}, year = {2001}, url = {https://ieeexplore.ieee.org/xpl/conhome/7373/proceeding}, isbn = {0-7695-0990-8}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/ipps/2001.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/mdm/2001, editor = {Kian{-}Lee Tan and Michael J. Franklin and John C. S. Lui}, title = {Mobile Data Management, Second International Conference, {MDM} 2001, Hong Kong, China, January 8-10, 2001, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {1987}, publisher = {Springer}, year = {2001}, url = {https://doi.org/10.1007/3-540-44498-X}, doi = {10.1007/3-540-44498-X}, isbn = {3-540-41454-1}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/mdm/2001.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/cifer/2000, title = {Proceedings of the {IEEE/IAFE/INFORMS} 2000 Conference on Computational Intelligence for Financial Engineering, CIFEr 2000, New York City, USA, March 28, 2000}, publisher = {{IEEE}}, year = {2000}, url = {https://ieeexplore.ieee.org/xpl/conhome/6797/proceeding}, isbn = {0-7803-6429-5}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/cifer/2000.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icassp/1999, title = {Proceedings of the 1999 {IEEE} International Conference on Acoustics, Speech, and Signal Processing, {ICASSP} '99, Phoenix, Arizona, USA, March 15-19, 1999}, publisher = {{IEEE} Computer Society}, year = {1999}, url = {https://ieeexplore.ieee.org/xpl/conhome/6110/proceeding}, isbn = {0-7803-5041-3}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/icassp/1999.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/interspeech/1999, title = {Sixth European Conference on Speech Communication and Technology, {EUROSPEECH} 1999, Budapest, Hungary, September 5-9, 1999}, publisher = {{ISCA}}, year = {1999}, url = {https://doi.org/10.21437/Eurospeech.1999}, doi = {10.21437/EUROSPEECH.1999}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/interspeech/1999.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/wcnc/1999, title = {1999 {IEEE} Wireless Communications and Networking Conference, {WCNC} 1999, September 21-24, 1999, New Orleans, Louisiana, {USA}}, publisher = {{IEEE}}, year = {1999}, url = {https://ieeexplore.ieee.org/xpl/conhome/6459/proceeding}, isbn = {0-7803-5668-3}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/wcnc/1999.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/isca/1993, editor = {Alan Jay Smith}, title = {Proceedings of the 20th Annual International Symposium on Computer Architecture, San Diego, CA, USA, May 1993}, publisher = {{ACM}}, year = {1993}, url = {https://doi.org/10.1145/165123}, doi = {10.1145/165123}, isbn = {0-8186-3810-9}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/isca/1993.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/compcon/1986, title = {Spring COMPCON'86, Digest of Papers, Thirty-First {IEEE} Computer Society International Conference, San Francisco, California, USA, March 3-6, 1986}, publisher = {{IEEE} Computer Society}, year = {1986}, isbn = {0-8186-0692-4}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/compcon/1986.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/compcon/1985, title = {Spring COMPCON'85, Digest of Papers, Thirtieth {IEEE} Computer Society International Conference, San Francisco, California, USA, February 25-28, 1985}, publisher = {{IEEE} Computer Society}, year = {1985}, isbn = {0-8186-0613-4}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/compcon/1985.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/slp/1985, title = {Proceedings of the 1985 Symposium on Logic Programming, Boston, Massachusetts, USA, July 15-18, 1985}, publisher = {{IEEE-CS}}, year = {1985}, isbn = {0-8186-0636-3}, timestamp = {Thu, 10 Oct 2024 19:37:08 +0200}, biburl = {https://dblp.org/rec/conf/slp/1985.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.