default search action

combined dblp search
author search
venue search
publication search

ask others

Ernestina Menasalvas Ruiz

Ernestina Menasalva Ruiz – Ernestina Menasalvas

> Home > Persons

Person information

affiliation: Universidad Politécnica de Madrid, Spain

Refine list

refinements active!

zoomed in on ?? of ?? records

view refined list in

export refined list as

showing all ?? records

2020 – today

see FAQ

What is the meaning of the colors in the publication lists?

2024
[j50]
- view
  authority control:
- export record
  dblp key:
  - journals/cbm/MadridGarciaMFRRGP24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/cbm/MadridGarciaMFRRGP24
Alfredo Madrid-García, Beatriz Merino-Barbancho, Dalifer Freites-Núñez, Luis Rodríguez-Rodríguez, Ernestina Menasalvas Ruiz, Alejandro Rodríguez González, Anselmo Peñas:
From Web to RheumaLpack: Creating a Linguistic Corpus for Exploitation and Knowledge Discovery in Rheumatology. Comput. Biol. Medicine 179: 108920 (2024)
[j49]
- view
  authority control:
- export record
  dblp key:
  - journals/inffus/DiazHonrubiaRNMV24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/inffus/DiazHonrubiaRNMV24
Antonio Jesús Díaz-Honrubia, Philipp D. Rohde, Emetis Niazmand, Ernestina Menasalvas, Maria-Esther Vidal:
PALADIN: A process-based constraint language for data validation. Inf. Fusion 112: 102557 (2024)
[c98]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/Garcia-Barragan24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/Garcia-Barragan24
Alvaro Garcia-Barragán, Alberto González Calatayud, Lucía Prieto Santamaría, Víctor Robles, Ernestina Menasalvas, Alejandro Rodríguez:
Step-forward structuring disease phenotypic entities with LLMs for disease understanding. CBMS 2024: 213-218
[c97]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/CabreraSMPR24
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/CabreraSMPR24
Esteban Ricardo Salazar Cabrera, Alejandro Santos-Díaz, Ernestina Menasalvas, José Gerardo Tamez Pena, Victor Robles:
Named Entity Recognition in Mammography Radiology Reports using a Multilingual Transfer Learning Approach. CBMS 2024: 273-277
[i7]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2407-06748
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2407-06748
Anastasia Krithara, Fotis Aisopos, Vassiliki Rentoumi, Anastasios Nentidis, Konstantinos Bougiatiotis, Maria-Esther Vidal, Ernestina Menasalvas, Alejandro Rodríguez González, Eleftherios Samaras, Peter Garrard, Maria Torrente, Mariano Provencio Pulla, Nikos Dimakopoulos, Rui Mauricio, Jordi Rambla De Argila, Gian Gaetano Tartaglia, George Paliouras:
iASiS: Towards Heterogeneous Big Data Analysis for Personalized Medicine. CoRR abs/2407.06748 (2024)
2023
[j48]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/access/CaneteSifuentesRMB23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/access/CaneteSifuentesRMB23
Leonardo Cañete-Sifuentes, Victor Robles, Ernestina Menasalvas, Raúl Monroy Borja:
Comparing Automated Machine Learning Against an Off-the-Shelf Pattern-Based Classifier in a Class Imbalance Problem: Predicting University Dropout. IEEE Access 11: 139147-139156 (2023)
[j47]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/artmed/PabonMGTPMR23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/artmed/PabonMGTPMR23
Oswaldo Solarte Pabón, Orlando Montenegro, Alvaro Garcia-Barragán, Maria Torrente, Mariano Provencio, Ernestina Menasalvas, Víctor Robles:
Transformers for extracting breast cancer information from Spanish clinical narratives. Artif. Intell. Medicine 143: 102625 (2023)
[j46]
- view
  authority control:
- export record
  dblp key:
  - journals/semweb/AisoposJNPRSIVM23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/semweb/AisoposJNPRSIVM23
Fotis Aisopos, Samaneh Jozashoori, Emetis Niazmand, Disha Purohit, Ariam Rivas, Ahmad Sakor, Enrique Iglesias, Dimitrios Vogiatzis, Ernestina Menasalvas, Alejandro Rodríguez González, Guillermo Vigueras, Daniel Gómez-Bravo, Maria Torrente, Roberto Hernández López, Mariano Provencio Pulla, Athanasios Dalianis, Anna Triantafillou, Georgios Paliouras, Maria-Esther Vidal:
Knowledge graphs for enhancing transparency in health data ecosystems. Semantic Web 14(5): 943-976 (2023)
[c96]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/GarciaBarraganPNPMR23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/GarciaBarraganPNPMR23
Alvaro Garcia-Barragán, Oswaldo Solarte Pabón, Georgiy Nedostup, Mariano Provencio, Ernestina Menasalvas, Victor Robles:
Structuring Breast Cancer Spanish Electronic Health Records Using Deep Learning. CBMS 2023: 404-409
[c95]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/GomezBravoGVRPOTMPG23
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/GomezBravoGVRPOTMPG23
Daniel Gómez-Bravo, Aaron García, Guillermo Vigueras, Belén Ríos-Sánchez, Alejandra Pérez-García, Vanessa Ospina, María Torrente, Ernestina Menasalvas, Mariano Provencio, Alejandro Rodríguez González:
Clustering-based Pattern Discovery in Lung Cancer Treatments. CBMS 2023: 694-699
2022
[j45]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/istr/Diaz-HonrubiaBS22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/istr/Diaz-HonrubiaBS22
Antonio Jesús Díaz-Honrubia, Alberto Blázquez-Herranz, Lucía Prieto Santamaría, Ernestina Menasalvas Ruiz, Alejandro Rodríguez González, Gustavo Gonzalez Granadillo, Rodrigo Diaz, Emmanouil Panaousis, Christos Xenakis:
A Trusted Platform Module-based, Pre-emptive and Dynamic Asset Discovery Tool. J. Inf. Secur. Appl. 71: 103350 (2022)
[j44]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/peerj-cs/PabonMTGPM22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/peerj-cs/PabonMTGPM22
Oswaldo Solarte Pabón, Orlando Montenegro, Maria Torrente, Alejandro Rodríguez González, Mariano Provencio, Ernestina Menasalvas:
Negation and uncertainty detection in clinical texts written in Spanish: a deep learning-based approach. PeerJ Comput. Sci. 8: e913 (2022)
[c94]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/Gomez-BravoGVRO22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/Gomez-BravoGVRO22
Daniel Gómez-Bravo, Aaron García, Guillermo Vigueras, Belén Ríos-Sánchez, Belén Otero, Roberto Hernández López, María Torrente, Ernestina Menasalvas, Mariano Provencio, Alejandro Rodríguez González:
Subgroup Discovery Analysis of Treatment Patterns in Lung Cancer Patients. CBMS 2022: 1-7
[c93]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/MunozCSORPG22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/MunozCSORPG22
Adrián Ayuso Muñoz, Esther Ugarte Carro, Lucía Prieto Santamaría, Belén Otero-Carrasco, Ernestina Menasalvas Ruiz, Yuliana Pérez-Gallardo, Alejandro Rodríguez González:
REDIRECTION: Generating drug repurposing hypotheses using link prediction with DISNET data. CBMS 2022: 7-12
[c92]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/PabonTGPMR22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/PabonTGPMR22
Oswaldo Solarte Pabón, Maria Torrente, Alvaro Garcia-Barragán, Mariano Provencio, Ernestina Menasalvas, Victor Robles:
Deep learning to extract Breast Cancer diagnosis concepts. CBMS 2022: 13-18
[c91]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/Otero-CarrascoP22
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/Otero-CarrascoP22
Belén Otero-Carrasco, Aurora Pérez-Pérez, Ernestina Menasalvas Ruiz, Juan Pedro Caraça-Valente Hernández, Lucía Prieto Santamaría, Alejandro Rodríguez González:
Drug repositioning with gender perspective focused on Adverse Drug Reactions. CBMS 2022: 435-440
[i6]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/corr/abs-2211-09856
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-2211-09856
Adrianna Janik, Maria Torrente, Luca Costabello, Virginia Calvo, Brian Walsh, Carlos Camps, Sameh K. Mohamed, Ana L. Ortega, Vít Novácek, Bartomeu Massutí, Pasquale Minervini, M. Rosario Garcia Campelo, Edel del Barco, Joaquim Bosch-Barrera, Ernestina Menasalvas, Mohan Timilsina, Mariano Provencio:
Machine Learning-Assisted Recurrence Prediction for Early-Stage Non-Small-Cell Lung Cancer Patients. CoRR abs/2211.09856 (2022)
2021
[j43]
- view
  authority control:
- export record
  dblp key:
  - journals/bib/MadurgaGJCPHFPZ21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/bib/MadurgaGJCPHFPZ21
Rodrigo Madurga, Noemí García-Romero, Beatriz Jiménez, Ana Collazo, Francisco Pérez-Rodríguez, Aurelio Hernández-Laín, Carlos Fernández-Carballal, Ricardo Prat-Acín, Massimiliano Zanin, Ernestina Menasalvas, Ángel Ayuso-Sacido:
Normal tissue content impact on the GBM molecular classification. Briefings Bioinform. 22(3) (2021)
[j42]
- view
  authority control:
- export record
  dblp key:
  - journals/cmpb/ValleGSZRG21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/cmpb/ValleGSZRG21
Eduardo P. García del Valle, Gerardo Lagunes García, Lucía Prieto Santamaría, Massimiliano Zanin, Ernestina Menasalvas Ruiz, Alejandro Rodríguez González:
DisMaNET: A network-based tool to cross map disease vocabularies. Comput. Methods Programs Biomed. 207: 106233 (2021)
[c90]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/ValleSGZRG21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/ValleSGZRG21
Eduardo P. García del Valle, Lucía Prieto Santamaría, Gerardo Lagunes García, Massimiliano Zanin, Ernestina Menasalvas Ruiz, Alejandro Rodríguez González:
A Meta-Path-Based Prediction Method for Disease Comorbidities. CBMS 2021: 219-224
[c89]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/clef/PabonMBSGM21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/clef/PabonMBSGM21
Oswaldo Solarte Pabón, Orlando Montenegro, Alberto Blázquez-Herranz, Hadi Saputro, Alejandro Rodríguez González, Ernestina Menasalvas:
Information Extraction from Spanish Radiology Reports using multilingual BERT. CLEF (Working Notes) 2021: 834-845
[c88]
- view
  authority control:
- export record
  dblp key:
  - conf/dsaa/PabonBTGPM21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dsaa/PabonBTGPM21
Oswaldo Solarte Pabón, Alberto Blázquez-Herranz, Maria Torrente, Alejandro Rodríguez González, Mariano Provencio, Ernestina Menasalvas:
Extracting Cancer Treatments from Clinical Text written in Spanish: A Deep Learning Approach. DSAA 2021: 1-6
[c87]
- view
  authority control:
- export record
  dblp key:
  - conf/dsaa/RedondoRVOHTMPG21
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dsaa/RedondoRVOHTMPG21
Arturo Redondo, Belén Ríos-Sánchez, Guillermo Vigueras, Belén Otero, Roberto Hernández López, Maria Torrente, Ernestina Menasalvas, Mariano Provencio, Alejandro Rodríguez González:
Towards Treatment Patterns Validation in Lung Cancer Patients. DSAA 2021: 1-8
2020
[j41]
- view
  authority control:
- export record
  dblp key:
  - journals/artmed/NajafabadipourZ20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/artmed/NajafabadipourZ20
Marjan Najafabadipour, Massimiliano Zanin, Alejandro Rodríguez González, Maria Torrente, Beatriz Nuñez García, Juan Luis Cruz-Bermúdez, Mariano Provencio, Ernestina Menasalvas:
Reconstructing the patient's natural history from electronic health records. Artif. Intell. Medicine 105: 101860 (2020)
[j40]
- view
  authority control:
- export record
  dblp key:
  - journals/ipm/GarciaGSVZR20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ipm/GarciaGSVZR20
Gerardo Lagunes García, Alejandro Rodríguez González, Lucía Prieto Santamaría, Eduardo P. García del Valle, Massimiliano Zanin, Ernestina Menasalvas Ruiz:
How Wikipedia disease information evolve over time? An analysis of disease-based articles changes. Inf. Process. Manag. 57(3): 102225 (2020)
[j39]
- view
  authority control:
- export record
  dblp key:
  - journals/mssp/SealGBNLMG20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/mssp/SealGBNLMG20
Ayan Seal, Angel García-Pedrero, Debotosh Bhattacharjee, Mita Nasipuri, Mario Lillo-Saavedra, Ernestina Menasalvas, Consuelo Gonzalo-Martín:
Multi-scale RoIs selection for classifying multi-spectral images. Multidimens. Syst. Signal Process. 31(2): 745-769 (2020)
[c86]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/SantamariaVGZGR20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/SantamariaVGZGR20
Lucía Prieto Santamaría, Eduardo P. García del Valle, Gerardo Lagunes García, Massimiliano Zanin, Alejandro Rodríguez González, Ernestina Menasalvas Ruiz, Yuliana Pérez-Gallardo, Gandhi Hernández-Chan:
Analysis of New Nosological Models from Disease Similarities using Clustering. CBMS 2020: 183-188
[c85]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/ScurtiRVTVPPG20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/ScurtiRVTVPPG20
Manuel Scurti, Ernestina Menasalvas Ruiz, Maria-Esther Vidal, Maria Torrente, Dimitrios Vogiatzis, George Paliouras, Mariano Provencio, Alejandro Rodríguez González:
A Data-Driven Approach for Analyzing Healthcare Services Extracted from Clinical Records. CBMS 2020: 193-196
[c84]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/GonzalezTPRJCCA20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/GonzalezTPRJCCA20
Alejandro Rodríguez González, Juan Manuel Tuñas, Diego Fernandez Peces-Barba, Ernestina Menasalvas Ruiz, Almudena Jaramillo, Manuel Cotarelo, Antonio Conejo, Amalia Arce, Angel Gil:
Creating a Metamodel Based on Machine Learning to Identify the Sentiment of Vaccine and Disease-Related Messages in Twitter: the MAVIS Study. CBMS 2020: 245-250
[c83]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/PabonTGPMT20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/PabonTGPMT20
Oswaldo Solarte Pabón, Maria Torrente, Alejandro Rodríguez González, Mariano Provencio, Ernestina Menasalvas, Juan Manuel Tuñas:
Lung Cancer Diagnosis Extraction from Clinical Notes Written in Spanish. CBMS 2020: 492-497
[c82]
- view
  authority control:
- export record
  dblp key:
  - conf/iwbbio/PabonMG20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iwbbio/PabonMG20
Oswaldo Solarte Pabón, Ernestina Menasalvas, Alejandro Rodríguez González:
Spa-neg: An Approach for Negation Detection in Clinical Text Written in Spanish. IWBBIO 2020: 323-337
[c81]
- view
  authority control:
- export record
  dblp key:
  - conf/meco/ZaninRGWWHS20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/meco/ZaninRGWWHS20
Massimiliano Zanin, Ernestina Menasalvas Ruiz, Alejandro Rodríguez González, Christian Wolff, Juana Wendt, Elisa A. Herrmann, Pavel Smrz:
Developing a Data Analytics Toolbox to Support CPS-based Services. MECO 2020: 1-7
[c80]
- view
  authority control:
- export record
  dblp key:
  - conf/mipro/ZaninMGS20
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mipro/ZaninMGS20
Massimiliano Zanin, Ernestina Menasalvas, Alejandro Rodríguez González, Pavel Smrz:
An Analytics Toolbox for Cyber-Physical Systems Data Analysis: Requirements and Challenges. MIPRO 2020: 271-276

2010 – 2019

see FAQ

What is the meaning of the colors in the publication lists?

2019
[j38]
- view
  authority control:
- export record
  dblp key:
  - journals/ijdsa/GonzalezVMORS19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ijdsa/GonzalezVMORS19
Alejandro Rodríguez González, Athena Vakali, Miguel Angel Mayer, Takashi Okumura, Ernestina Menasalvas Ruiz, Myra Spiliopoulou:
Introduction to the special issue on social data analytics in medicine and healthcare. Int. J. Data Sci. Anal. 8(4): 325-326 (2019)
[j37]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/jbi/ValleGSZRG19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jbi/ValleGSZRG19
Eduardo P. García del Valle, Gerardo Lagunes García, Lucía Prieto Santamaría, Massimiliano Zanin, Ernestina Menasalvas Ruiz, Alejandro Rodríguez González:
Disease networks and their contribution to disease understanding: A review of their evolution, techniques and data sources. J. Biomed. Informatics 94 (2019)
[j36]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/midm/HasslerMGRH19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/midm/HasslerMGRH19
Andreas Philipp Hassler, Ernestina Menasalvas, Francisco Jose Garcia-Garcia, Leocadio Rodríguez-Mañas, Andreas Holzinger:
Importance of medical data preprocessing in predictive modeling and risk factor discovery for the frailty syndrome. BMC Medical Informatics Decis. Mak. 19(1): 33:1-33:17 (2019)
[c79]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/NajafabadipourZ19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/NajafabadipourZ19
Marjan Najafabadipour, Massimiliano Zanin, Alejandro Rodríguez González, Consuelo Gonzalo-Martín, Beatriz Nuñez García, Virginia Calvo, Juan Luis Cruz-Bermúdez, Mariano Provencio, Ernestina Menasalvas:
Recognition of Time Expressions in Spanish Electronic Health Records. CBMS 2019: 69-74
[c78]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/KritharaARNBVMG19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/KritharaARNBVMG19
Anastasia Krithara, Fotis Aisopos, Vassiliki Rentoumi, Anastasios Nentidis, Konstantinos Bougiatiotis, Maria-Esther Vidal, Ernestina Menasalvas, Alejandro Rodríguez González, Eleftherios Samaras, Peter Garrard, Maria Torrente, Mariano Provencio Pulla, Nikos Dimakopoulos, Rui Mauricio, Jordi Rambla De Argila, Gian Gaetano Tartaglia, George Paliouras:
iASiS: Towards Heterogeneous Big Data Analysis for Personalized Medicine. CBMS 2019: 106-111
[c77]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/ValleGRSZG19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/ValleGRSZG19
Eduardo P. García del Valle, Gerardo Lagunes García, Ernestina Menasalvas Ruiz, Lucía Prieto Santamaría, Massimiliano Zanin, Alejandro Rodríguez González:
Completing Missing MeSH Code Mappings in UMLS Through Alternative Expert-Curated Sources. CBMS 2019: 174-179
[c76]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/ToroSGGGR19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/ToroSGGGR19
César Antonio Ortiz Toro, Nuria Gutiérrez Sánchez, Consuelo Gonzalo-Martín, Roberto Garrido García, Alejandro Rodríguez González, Ernestina Menasalvas Ruiz:
Radiomics Textural Features Extracted from Subcortical Structures of Grey Matter Probability for Alzheimers Disease Detection. CBMS 2019: 391-397
[c75]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/GarciaSVZRG19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/GarciaSVZRG19
Gerardo Lagunes García, Lucía Prieto Santamaría, Eduardo P. García del Valle, Massimiliano Zanin, Ernestina Menasalvas Ruiz, Alejandro Rodríguez González:
Wikipedia Disease Articles: An Analysis of their Content and Evolution. CBMS 2019: 664-671
[c74]
- view
  - electronic edition @ ceur-ws.org (open access)
  - details & citations
- export record
  dblp key:
  - conf/iot/CorreiaWZMHCKDS19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iot/CorreiaWZMHCKDS19
Ana Correia, Christian Wolff, Massimiliano Zanin, Ernestina Menasalvas, Elisa A. Herrmann, Victor Corral, Miriam Kachelmann, Rance DeLong, Pavel Smrz:
Cross-CPP - An Ecosystem for Provisioning, Consolidating, and Analysing Big Data from Cyber-Physical Products. CPSS@IOT 2019: 1-8
[c73]
- view
  authority control:
- export record
  dblp key:
  - conf/iticse/MenasalvasMS19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iticse/MenasalvasMS19
Ernestina Menasalvas, Ana María Moreno, Nik Swoboda:
A Proposal for Recognizing Skills in Data Science Using Open Badges. ITiCSE 2019: 316
[c72]
- view
  authority control:
- export record
  dblp key:
  - conf/sgai/NajafabadipourT19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sgai/NajafabadipourT19
Marjan Najafabadipour, Juan Manuel Tuñas, Alejandro Rodríguez González, Ernestina Menasalvas:
Analysis of Electronic Health Records to Identify the Patient's Treatment Lines: Challenges and Opportunities. SGAI Conf. 2019: 437-442
[p9]
- view
  authority control:
- export record
  dblp key:
  - books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19
Ziawasch Abedjan, Nozha Boujemaa, Stuart Campbell, Patricia Casla, Supriyo Chatterjea, Sergio Consoli, Cristóbal Costa Soria, Paul Czech, Marija Despenic, Chiara Garattini, Dirk Hamelinck, Adrienne Heinrich, Wessel Kraaij, Jacek Kustra, Aizea Lojo, Marga Martin Sanchez, Miguel Angel Mayer, Matteo Melideo, Ernestina Menasalvas, Frank Møller Aarestrup, Elvira Narro Artigot, Milan Petkovic, Diego Reforgiato Recupero, Alejandro Rodríguez González, Gisele Roesems Kerremans, Roland Roller, Mário Romão, Stefan Rüping, Felix Sasaki, Wouter Spek, Nenad Stojanovic, Jack Thoms, Andrejs Vasiljevs, Wilfried Verachtert, Roel Wuyts:
Data Science in Healthcare: Benefits, Challenges and Opportunities. Data Science for Healthcare 2019: 3-38
2018
[j35]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/complexity/ZaninMSW18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/complexity/ZaninMSW18
Massimiliano Zanin, Ernestina Menasalvas, Xiaoqian Sun, Sebastian Wandelt:
From the Difference of Structures to the Structure of the Difference. Complex. 2018: 4326097:1-4326097:12 (2018)
[j34]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/entropy/ZaninGRP18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/entropy/ZaninGRP18
Massimiliano Zanin, Alejandro Rodríguez González, Ernestina Menasalvas Ruiz, David Papo:
Assessing Time Series Reversibility through Permutation Patterns. Entropy 20(9): 665 (2018)
[j33]
- view
  authority control:
- export record
  dblp key:
  - journals/es/SealBNGM18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/es/SealBNGM18
Ayan Seal, Debotosh Bhattacharjee, Mita Nasipuri, Consuelo Gonzalo-Martín, Ernestina Menasalvas:
À-trous wavelet transform-based hybrid image fusion for face recognition using region classifiers. Expert Syst. J. Knowl. Eng. 35(6) (2018)
[j32]
- view
  authority control:
- export record
  dblp key:
  - journals/jms/RuizTBGGZPMZRPB18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jms/RuizTBGGZPMZRPB18
Ernestina Menasalvas Ruiz, Juan Manuel Tuñas, Guzmán Bermejo, Consuelo Gonzalo-Martín, Alejandro Rodríguez González, Massimiliano Zanin, Cristina Gonzalez de Pedro, Marta Mendez, Olga Zaretskaia, Jesús Rey, Consuelo Parejo, Juan Luis Cruz-Bermúdez, Mariano Provencio:
Profiling Lung Cancer Patients Using Electronic Health Records. J. Medical Syst. 42(7): 126:1-126:10 (2018)
[j31]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/sensors/OrtizGGR18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sensors/OrtizGGR18
César Antonio Ortiz, Consuelo Gonzalo-Martín, Angel García-Pedrero, Ernestina Menasalvas Ruiz:
Supervoxels-Based Histon as a New Alzheimer's Disease Imaging Biomarker. Sensors 18(6): 1752 (2018)
[j30]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/sensors/Lima-MonteiroZR18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/sensors/Lima-MonteiroZR18
Pedro Lima-Monteiro, Massimiliano Zanin, Ernestina Menasalvas Ruiz, João Paulo Pimentão, Pedro Alexandre da Costa Sousa:
Indoor Temperature Prediction in an IoT Scenario. Sensors 18(11): 3610 (2018)
[c71]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/ValleGSZRG18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/ValleGSZRG18
Eduardo P. García del Valle, Gerardo Lagunes García, Lucía Prieto Santamaría, Massimiliano Zanin, Ernestina Menasalvas Ruiz, Alejandro Rodríguez González:
Evaluating Wikipedia as a Source of Information for Disease Understanding. CBMS 2018: 399-404
[c70]
- view
  authority control:
- export record
  dblp key:
  - conf/dils/NajafabadipourT18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dils/NajafabadipourT18
Marjan Najafabadipour, Juan Manuel Tuñas, Alejandro Rodríguez González, Ernestina Menasalvas:
Lung Cancer Concept Annotation from Spanish Clinical Narratives. DILS 2018: 153-163
[c69]
- view
  authority control:
- export record
  dblp key:
  - conf/sitis/GonzalezGM18
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sitis/GonzalezGM18
Alejandro Rodríguez González, Consuelo Gonzalo, Ernestina Menasalvas:
Mining Electronic Health Records: Challenges and Impact. SITIS 2018: 747-754
[i5]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1808-01459
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1808-01459
Eduardo P. García del Valle, Gerardo Lagunes García, Lucía Prieto Santamaría, Massimiliano Zanin, Alejandro Rodríguez González, Ernestina Menasalvas Ruiz:
Evaluating Wikipedia as a source of information for disease understanding. CoRR abs/1808.01459 (2018)
[i4]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1809-06639
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1809-06639
Marjan Najafabadipour, Juan Manuel Tuñas, Alejandro Rodríguez González, Ernestina Menasalvas:
Lung Cancer Concept Annotation from Spanish Clinical Narratives. CoRR abs/1809.06639 (2018)
[i3]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/abs-1809-07784
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/abs-1809-07784
Ernestina Menasalvas Ruiz, Alejandro Rodríguez González, Consuelo Gonzalo-Martín, Massimiliano Zanin, Juan Manuel Tuñas, Mariano Provencio, Maria Torrente, Fabio Franco, Virginia Calvo, Beatriz Nuñez:
IASIS and BigMedilytics: Towards personalized medicine in Europe. CoRR abs/1809.07784 (2018)
2017
[j29]
- view
  authority control:
- export record
  dblp key:
  - journals/ijprai/SealBNGM17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ijprai/SealBNGM17
Ayan Seal, Debotosh Bhattacharjee, Mita Nasipuri, Consuelo Gonzalo-Martín, Ernestina Menasalvas:
Fusion of Visible and Thermal Images Using a Directed Search Method for Face Recognition. Int. J. Pattern Recognit. Artif. Intell. 31(4): 1756005:1-1756005:17 (2017)
[j28]
- view
  authority control:
- export record
  dblp key:
  - journals/staeors/Gonzalo-MartinL17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/staeors/Gonzalo-MartinL17
Consuelo Gonzalo-Martín, Mario Lillo-Saavedra, Angel García-Pedrero, Octavio Lagos, Ernestina Menasalvas:
Daily Evapotranspiration Mapping Using Regression Random Forest Models. IEEE J. Sel. Top. Appl. Earth Obs. Remote. Sens. 10(12): 5359-5368 (2017)
[c68]
- view
  authority control:
- export record
  dblp key:
  - conf/cbms/RuizGTGPPMZCRP17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cbms/RuizGTGPPMZCRP17
Ernestina Menasalvas Ruiz, Consuelo Gonzalo, Juan Manuel Tuñas, Alejandro Rodríguez González, Mariano Provencio, Cristina Gonzalez de Pedro, Marta Mendez, Olga Zaretskaia, Juan Luis Cruz, Jesús Rey, Consuelo Parejo:
OncoCall: Analyzing the Outcomes of the Oncology Telephone Patient Assistance. CBMS 2017: 624-629
[c67]
- view
  authority control:
- export record
  dblp key:
  - conf/citi/Aparicio-Paniagua17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/citi/Aparicio-Paniagua17
Virginia Aparicio-Paniagua, Jorge Pérez-Muñoz, Alejandro Rodríguez González, Angel García-Pedrero, Juan Miguel Gómez-Berbís, Consuelo Gonzalo-Martín, Ernestina Menasalvas Ruiz, Giner Alor-Hernández:
Automatic Recording and Analysis of Somniloquy Through the Use of Mobile Devices to Support the Diagnosis of Psychological Pathologies. CITI 2017: 169-180
[c66]
- view
  authority control:
- export record
  dblp key:
  - conf/pacbb/ToroGGGM17
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pacbb/ToroGGGM17
César Antonio Ortiz Toro, Consuelo Gonzalo-Martín, Angel García-Pedrero, Alejandro Rodríguez González, Ernestina Menasalvas:
Mitosis Detection in Breast Cancer Using Superpixels and Ensemble Classifiers. PACBB 2017: 137-145
2016
[j27]
- view
  authority control:
- export record
  dblp key:
  - journals/cmpb/GonzalezRM16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/cmpb/GonzalezRM16
Alejandro Rodríguez González, Ernestina Menasalvas Ruiz, Miguel Angel Mayer:
Automatic extraction and identification of users' responses in Facebook medical quizzes. Comput. Methods Programs Biomed. 127: 197-203 (2016)
[j26]
- view
  authority control:
- export record
  dblp key:
  - journals/eswa/AbadGM16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/eswa/AbadGM16
Miguel Ángel Abad, João Bártolo Gomes, Ernestina Menasalvas:
Predicting recurring concepts on data-streams by means of a meta-model and a fuzzy similarity function. Expert Syst. Appl. 46: 87-105 (2016)
[j25]
- view
  authority control:
- export record
  dblp key:
  - journals/ivs/BernaGRRL16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ivs/BernaGRRL16
Antonio Gracia Berná, Santiago González, Víctor Robles, Ernestina Menasalvas Ruiz, Tatiana von Landesberger:
New insights into the suitability of the third dimension for visualizing multivariate/multidimensional data: A study based on loss of quality quantification. Inf. Vis. 15(1): 3-30 (2016)
[j24]
- view
  authority control:
- export record
  dblp key:
  - journals/jiis/Gonzalo-MartinL16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jiis/Gonzalo-MartinL16
Consuelo Gonzalo-Martín, Mario Lillo-Saavedra, Ernestina Menasalvas, David Fonseca-Luengo, Angel García-Pedrero, Roberto Costumero:
Local optimal scale in a hierarchical segmentation method for satellite images - An OBIA approach for the agricultural landscape. J. Intell. Inf. Syst. 46(3): 517-529 (2016)
[c65]
- view
  authority control:
- export record
  dblp key:
  - conf/rskt/MenasalvasGCAG16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rskt/MenasalvasGCAG16
Ernestina Menasalvas, Alejandro Rodríguez González, Roberto Costumero, Hector Ambit, Consuelo Gonzalo:
Clinical Narrative Analytics Challenges. IJCRS 2016: 23-32
[p8]
- view
  authority control:
- export record
  dblp key:
  - series/lncs/MenasalvasG16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/lncs/MenasalvasG16
Ernestina Menasalvas, Consuelo Gonzalo-Martín:
Challenges of Medical Text and Image Processing: Machine Learning Approaches. Machine Learning for Health Informatics 2016: 221-242
[i2]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/ZaninPSMNKB16
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/ZaninPSMNKB16
Massimiliano Zanin, David Papo, Pedro A. C. Sousa, Ernestina Menasalvas, Andrea Nicchi, Elaine Kubik, Stefano Boccaletti:
Combining complex networks and data mining: why and how. CoRR abs/1604.08816 (2016)
2015
[j23]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/remotesensing/ToroGGR15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/remotesensing/ToroGGR15
César Antonio Ortiz Toro, Consuelo Gonzalo-Martín, Angel García-Pedrero, Ernestina Menasalvas Ruiz:
Superpixel-Based Roughness Measure for Multispectral Satellite Image Segmentation. Remote. Sens. 7(11): 14620-14645 (2015)
[c64]
- view
  authority control:
- export record
  dblp key:
  - conf/fedcsis/AbadM15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/fedcsis/AbadM15
Miguel Ángel Abad, Ernestina Menasalvas:
Recurrent drifts: Aapplying fuzzy logic to concept similarity function. FedCSIS 2015: 19-29
[c63]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/SpiliopoulouRR15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/SpiliopoulouRR15
Myra Spiliopoulou, Pedro Pereira Rodrigues, Ernestina Menasalvas Ruiz:
Medical Mining: KDD 2015 Tutorial. KDD 2015: 2325
[c62]
- view
  authority control:
- export record
  dblp key:
  - conf/pacbb/GonzalezRCWR15
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pacbb/GonzalezRCWR15
Alejandro Rodríguez González, Marcos Martínez Romero, Roberto Costumero, Mark D. Wilkinson, Ernestina Menasalvas Ruiz:
Diagnostic Knowledge Extraction from MedlinePlus: An Application for Infectious Diseases. PACBB 2015: 79-87
[c61]
- view
  authority control:
- export record
  dblp key:
  - conf/pacbb/GonzalezRCWR15a
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pacbb/GonzalezRCWR15a
Alejandro Rodríguez González, Marcos Martínez Romero, Roberto Costumero, Mark D. Wilkinson, Ernestina Menasalvas Ruiz:
Erratum to: Diagnostic Knowledge Extraction from MedlinePlus: An Application for Infectious Diseases. PACBB 2015: E1
2014
[j22]
- view
  authority control:
- export record
  dblp key:
  - journals/isci/BernaGRR14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/isci/BernaGRR14
Antonio Gracia Berná, Santiago González, Victor Robles, Ernestina Menasalvas Ruiz:
A methodology to compare Dimensionality Reduction algorithms in terms of loss of quality. Inf. Sci. 270: 1-27 (2014)
[j21]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/midm/SolanaCGCORMTG14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/midm/SolanaCGCORMTG14
Javier Solana, César Cáceres, Alberto García-Molina, Paloma Chausa, Eloy Opisso, Teresa Roig-Rovira, Ernestina Menasalvas, Josep María Tormos Muñoz, Enrique J. Gómez:
Intelligent Therapy Assistant (ITA) for cognitive rehabilitation in patients with acquired brain injury. BMC Medical Informatics Decis. Mak. 14: 58 (2014)
[j20]
- view
  authority control:
- export record
  dblp key:
  - journals/tnn/GomesGSR14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/tnn/GomesGSR14
João Bártolo Gomes, Mohamed Medhat Gaber, Pedro A. C. Sousa, Ernestina Menasalvas Ruiz:
Mining Recurring Concepts in a Dynamic Feature Space. IEEE Trans. Neural Networks Learn. Syst. 25(1): 95-110 (2014)
[c60]
- view
  authority control:
- export record
  dblp key:
  - conf/brain/CostumeroGGMM14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/brain/CostumeroGGMM14
Roberto Costumero, Angel García-Pedrero, Consuelo Gonzalo-Martín, Ernestina Menasalvas, Socorro Millán:
Text Analysis and Information Extraction from Spanish Written Documents. Brain Informatics and Health 2014: 188-197
[c59]
- view
  authority control:
- export record
  dblp key:
  - conf/brain/CostumeroLGMM14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/brain/CostumeroLGMM14
Roberto Costumero, Federico López, Consuelo Gonzalo-Martín, Marta Millán, Ernestina Menasalvas:
An Approach to Detect Negation on Medical Documents in Spanish. Brain Informatics and Health 2014: 366-375
[c58]
- view
  - electronic edition @ ieee.org
  - details & citations
- export record
  dblp key:
  - conf/fusion/AbadGR14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/fusion/AbadGR14
Miguel Ángel Abad, João Bártolo Gomes, Ernestina Menasalvas Ruiz:
Recurring concept detection for spam filtering. FUSION 2014: 1-7
[c57]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - conf/ifip5-5/ZaninRBS14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ifip5-5/ZaninRBS14
Massimiliano Zanin, Ernestina Menasalvas Ruiz, Stefano Boccaletti, Pedro A. C. Sousa:
Analysis of Complex Data by Means of Complex Networks. DoCEIS 2014: 39-46
[c56]
- view
  authority control:
- export record
  dblp key:
  - conf/pacbb/CostumeroGM14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pacbb/CostumeroGM14
Roberto Costumero, Consuelo Gonzalo-Martín, Ernestina Menasalvas:
TIDA: A Spanish EHR Semantic Search Engine. PACBB 2014: 235-242
[c55]
- view
  authority control:
- export record
  dblp key:
  - conf/rseisp/Fonseca-LuengoGLCMG14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rseisp/Fonseca-LuengoGLCMG14
David Fonseca-Luengo, Angel García-Pedrero, Mario Lillo-Saavedra, Roberto Costumero, Ernestina Menasalvas, Consuelo Gonzalo-Martín:
Optimal Scale in a Hierarchical Segmentation Method for Satellite Images. RSEISP 2014: 351-358
[c54]
- view
  authority control:
- export record
  dblp key:
  - conf/rseisp/OrtizGPM14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rseisp/OrtizGPM14
César Antonio Ortiz, Consuelo Gonzalo-Martín, José María Peña Sánchez, Ernestina Menasalvas:
3D Dendrite Spine Detection - A Supervoxel Based Approach. RSEISP 2014: 359-366
[c53]
- view
  authority control:
- export record
  dblp key:
  - conf/rseisp/SealBNGM14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rseisp/SealBNGM14
Ayan Seal, Debotosh Bhattacharjee, Mita Nasipuri, Consuelo Gonzalo-Martín, Ernestina Menasalvas:
Histogram of Bunched Intensity Values Based Thermal Face Recognition. RSEISP 2014: 367-374
[e5]
- view
  authority control:
- export record
  dblp key:
  - conf/rsctc/2014
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rsctc/2014
Chris Cornelis, Marzena Kryszkiewicz, Dominik Slezak, Ernestina Menasalvas Ruiz, Rafael Bello, Lin Shang:
Rough Sets and Current Trends in Computing - 9th International Conference, RSCTC 2014, Granada and Madrid, Spain, July 9-13, 2014. Proceedings. Lecture Notes in Computer Science 8536, Springer 2014, ISBN 978-3-319-08643-9 [contents]
[i1]
- view
  - electronic edition @ arxiv.org (open access)
  - details & citations
- export record
  dblp key:
  - journals/corr/ZaninSR14
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/corr/ZaninSR14
Massimiliano Zanin, Pedro A. C. Sousa, Ernestina Menasalvas Ruiz:
Information content: beyond modularity in complex networks. CoRR abs/1401.5247 (2014)
2013
[j19]
- view
  authority control:
- export record
  dblp key:
  - journals/eswa/MengualMER13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/eswa/MengualMER13
Luis Mengual, Oscar Marbán, Santiago Eibe, Ernestina Menasalvas Ruiz:
Multi-agent location system in wireless networks. Expert Syst. Appl. 40(6): 2244-2262 (2013)
[j18]
- view
  authority control:
- export record
  dblp key:
  - journals/ijitdm/GomesGSR13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ijitdm/GomesGSR13
João Bártolo Gomes, Mohamed Medhat Gaber, Pedro A. C. Sousa, Ernestina Menasalvas Ruiz:
Collaborative Data Stream Mining in Ubiquitous Environments using Dynamic Classifier Selection. Int. J. Inf. Technol. Decis. Mak. 12(6): 1287-1308 (2013)
[j17]
- view
  authority control:
- export record
  dblp key:
  - journals/isci/CayciRSE13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/isci/CayciRSE13
Aysegul Cayci, Ernestina Menasalvas Ruiz, Yücel Saygin, Santiago Eibe:
Self-configuring data mining for ubiquitous computing. Inf. Sci. 246: 83-99 (2013)
[c52]
- view
  authority control:
- export record
  dblp key:
  - conf/cig/PenaRMLPO13
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cig/PenaRMLPO13
José María Peña Sánchez, Ernestina Menasalvas Ruiz, Santiago Muelas, Antonio LaTorre, Luís Peña, Sascha Ossowski:
Soft computing for content generation: Trading market in a basketball management video game. CIG 2013: 1-8
2012
[j16]
- view
  authority control:
- export record
  dblp key:
  - journals/eswa/ZandaER12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/eswa/ZandaER12
Andrea Zanda, Santiago Eibe, Ernestina Menasalvas Ruiz:
SOMAR: A SOcial Mobile Activity Recommender. Expert Syst. Appl. 39(9): 8423-8429 (2012)
[j15]
- view
  authority control:
- export record
  dblp key:
  - journals/eswa/TorresMMERM12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/eswa/TorresMMERM12
Rommel Torres Tandazo, Luis Mengual, Oscar Marbán, Santiago Eibe, Ernestina Menasalvas Ruiz, Byron Maza:
A management Ad Hoc networks model for rescue and emergency scenarios. Expert Syst. Appl. 39(10): 9554-9563 (2012)
[j14]
- view
  authority control:
- export record
  dblp key:
  - journals/ida/GomesSR12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ida/GomesSR12
João Bártolo Gomes, Pedro A. C. Sousa, Ernestina Menasalvas Ruiz:
Tracking recurrent concepts using context. Intell. Data Anal. 16(5): 803-825 (2012)
[j13]
- view
  authority control:
- export record
  dblp key:
  - journals/jms/Vargas-LombardoJVCAMR12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/jms/Vargas-LombardoJVCAMR12
Miguel Vargas-Lombardo, Armando Jipsion, Rafael Vejarano, Ismael Camargo, Humberto Alvarez, Elena Villalba Mora, Ernestina Menasalva Ruiz:
Technologies to Better Serve the Millions of Diabetic Patients: A Holistic, Interactive and Persuasive ICT Model to Facilitate Self Care, in Extremely Poor Rural Zones of Central America. J. Medical Syst. 36(2): 595-600 (2012)
[j12]
- view
  authority control:
- export record
  dblp key:
  - journals/nhm/ZaninRSB12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/nhm/ZaninRSB12
Massimiliano Zanin, Ernestina Menasalvas Ruiz, Pedro A. C. Sousa, Stefano Boccaletti:
Preprocessing and analyzing genetic data with complex networks: An application to Obstructive Nephropathy. Networks Heterog. Media 7(3): 473-481 (2012)
[c51]
- view
  authority control:
- export record
  dblp key:
  - conf/dawak/GomesKGSR12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dawak/GomesKGSR12
João Bártolo Gomes, Shonali Krishnaswamy, Mohamed Medhat Gaber, Pedro A. C. Sousa, Ernestina Menasalvas Ruiz:
Mobile Activity Recognition Using Ubiquitous Data Stream Mining. DaWaK 2012: 130-141
[c50]
- view
  authority control:
- export record
  dblp key:
  - conf/ipmu/AbadR12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ipmu/AbadR12
Miguel Ángel Abad, Ernestina Menasalvas Ruiz:
Framework for the Establishment of Resource-Aware Data Mining Techniques on Critical Infrastructures. IPMU (2) 2012: 560-569
[c49]
- view
  authority control:
- export record
  dblp key:
  - conf/mdm/GomesKGSR12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mdm/GomesKGSR12
João Bártolo Gomes, Shonali Krishnaswamy, Mohamed Medhat Gaber, Pedro A. C. Sousa, Ernestina Menasalvas Ruiz:
MARS: A Personalised Mobile Activity Recognition System. MDM 2012: 316-319
[c48]
- view
  authority control:
- export record
  dblp key:
  - conf/wise/ZandaRE12
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/wise/ZandaRE12
Andrea Zanda, Ernestina Menasalvas Ruiz, Santiago Eibe:
Dynamic Clustering Process to Calculate Affinity Degree of Users as Basis of a Social Network Recommender. WISE Workshops 2012: 215-225
[e4]
- view
- export record
  dblp key:
  - conf/pkdd/2012sdad
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pkdd/2012sdad
Mohamed Medhat Gaber, Mihaela Cocea, Stephan Weibelzahl, Ernestina Menasalvas, Cyril Labbé:
Proceedings of the 1st International Workshop on Sentiment Discovery from Affective Data, SDAD@ECML/PKDD 2012, Bristol, UK, September 28, 2012. CEUR Workshop Proceedings 917, CEUR-WS.org 2012 [contents]
2011
[c47]
- view
  authority control:
- export record
  dblp key:
  - conf/ida/GomesGSR11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ida/GomesGSR11
João Bártolo Gomes, Mohamed Medhat Gaber, Pedro A. C. Sousa, Ernestina Menasalvas Ruiz:
Context-Aware Collaborative Data Stream Mining in Ubiquitous Devices. IDA 2011: 22-33
[c46]
- view
  authority control:
- export record
  dblp key:
  - conf/isda/ZandaRE11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/isda/ZandaRE11
Andrea Zanda, Ernestina Menasalvas Ruiz, Santiago Eibe:
A social network activity recommender system for ubiquitous devices. ISDA 2011: 493-497
[c45]
- view
  authority control:
- export record
  dblp key:
  - conf/sac/GomesRS11
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/sac/GomesRS11
João Bártolo Gomes, Ernestina Menasalvas Ruiz, Pedro A. C. Sousa:
Learning recurring concepts from data streams with a context-aware ensemble. SAC 2011: 994-999
2010
[j11]
- view
  authority control:
- export record
  dblp key:
  - journals/datamine/RuizSR10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/datamine/RuizSR10
Carlos Ruiz, Myra Spiliopoulou, Ernestina Menasalvas Ruiz:
Density-based semi-supervised clustering. Data Min. Knowl. Discov. 21(3): 345-370 (2010)
[c44]
- no documents available
  - details & citations
- export record
  dblp key:
  - conf/biocomp/Vargas-LombardoJVCAMR10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/biocomp/Vargas-LombardoJVCAMR10
Miguel Vargas-Lombardo, Armando Jipsion, Rafael Vejarano, Ismael Camargo, Humberto Alvarez, Elena Villalba Mora, Ernestina Menasalva Ruiz:
A Holistic, Interactive and Persuasive Model to Facilitate Self-care of Patients with Diabetes in Latin America and the Caribbean. BIOCOMP 2010: 544-548
[c43]
- view
  authority control:
- export record
  dblp key:
  - conf/etelemed/Vargas-LombardoJVCAMR10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/etelemed/Vargas-LombardoJVCAMR10
Miguel Vargas-Lombardo, Armando Jipsion, Rafael Vejarano, Ismael Camargo, Humberto Alvarez, Elena Villalba Mora, Ernestina Menasalva Ruiz:
Implementation a Holistic Model, Interactive and Persuasive to Facilitate Self-Care of Patients with Diabetes (hIPAPD). eTELEMED 2010: 57-63
[c42]
- view
  authority control:
- export record
  dblp key:
  - conf/ht/CayciERS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ht/CayciERS10
Aysegul Cayci, Santiago Eibe, Ernestina Menasalvas Ruiz, Yücel Saygin:
Bayesian Networks to Predict Data Mining Algorithm Behavior in Ubiquitous Computing Environments. MSM/MUSE 2010: 119-141
[c41]
- view
  authority control:
- export record
  dblp key:
  - conf/kdd/GomesMS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/kdd/GomesMS10
João Bártolo Gomes, Ernestina Menasalvas, Pedro A. C. Sousa:
CALDS: context-aware learning from data streams. StreamKDD@KDD 2010: 16-24
[c40]
- view
  authority control:
- export record
  dblp key:
  - conf/mdm/ZandaER10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mdm/ZandaER10
Andrea Zanda, Santiago Eibe, Ernestina Menasalvas Ruiz:
Adapting Batch Learning Algorithms Execution in Ubiquitous Devices. Mobile Data Management 2010: 227-229
[c39]
- view
  authority control:
- export record
  dblp key:
  - conf/mdm/GomesRS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/mdm/GomesRS10
João Bártolo Gomes, Ernestina Menasalvas Ruiz, Pedro A. C. Sousa:
Situation-Aware Data Stream Mining Service for Ubiquitous Applications. Mobile Data Management 2010: 360-365
[c38]
- view
  authority control:
- export record
  dblp key:
  - conf/rsctc/GomesRS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rsctc/GomesRS10
João Bártolo Gomes, Ernestina Menasalvas Ruiz, Pedro A. C. Sousa:
Tracking Recurrent Concepts Using Context. RSCTC 2010: 168-177
[c37]
- view
  authority control:
- export record
  dblp key:
  - conf/rskt/GomesRS10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rskt/GomesRS10
João Bártolo Gomes, Ernestina Menasalvas Ruiz, Pedro A. C. Sousa:
Improving the Learning of Recurring Concepts through High-Level Fuzzy Contexts. RSKT 2010: 234-239
[c36]
- view
  authority control:
- export record
  dblp key:
  - conf/rskt/ZandaER10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rskt/ZandaER10
Andrea Zanda, Santiago Eibe, Ernestina Menasalvas Ruiz:
Autonomous Adaptive Data Mining for u-Healthcare. RSKT 2010: 433-438
[p7]
- view
  authority control:
- export record
  dblp key:
  - series/lncs/BerendtM10
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/lncs/BerendtM10
Bettina Berendt, Ernestina Menasalvas:
A Human-Centric Perspective on Ubiquitous Knowledge Discovery. Ubiquitous Knowledge Discovery 2010: 90-107

2000 – 2009

see FAQ

What is the meaning of the colors in the publication lists?

2009
[j10]
- view
  authority control:
- export record
  dblp key:
  - journals/ijufks/ValenciaLR09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ijufks/ValenciaLR09
Maria Valencia, Codrina Lauth, Ernestina Menasalvas Ruiz:
Emerging User Intentions: Matching User Queries with Topic Evolution in News Text Streams. Int. J. Uncertain. Fuzziness Knowl. Based Syst. 17(Supplement-1): 59-80 (2009)
[j9]
- view
  authority control:
- export record
  dblp key:
  - journals/is/MarbanSRF09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/is/MarbanSRF09
Oscar Marbán, Javier Segovia, Ernestina Menasalvas Ruiz, Covadonga Fernández-Baizán:
Toward data mining engineering: A software engineering approach. Inf. Syst. 34(1): 87-107 (2009)
[j8]
- view
  - electronic edition @ unal.edu.co (archived)
  - details & citations
- export record
  dblp key:
  - journals/rasi/ValenciaER09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/rasi/ValenciaER09
Maria Valencia, Santiago Eibe, Ernestina Menasalvas Ruiz:
Segmentación de consultas de usuario en un dispositivo móvil: Un enfoque basado en frecuencias. Rev. Avances en Sistemas Informática 6(2): 119-126 (2009)
[j7]
- view
  - electronic edition via DOI (open access)
  - details & citations
  authority control:
- export record
  dblp key:
  - journals/rcc/ValenciaER09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/rcc/ValenciaER09
Maria Valencia, Santiago Eibe, Ernestina Menasalvas Ruiz:
Proceso de Categorización de Consultas Basado en Visibilidad en un Dispositivo Móvil. Rev. Colomb. de Computación 10(2): 142-154 (2009)
[c35]
- view
  authority control:
- export record
  dblp key:
  - conf/caepia/RuizVSR09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/caepia/RuizVSR09
Carlos Ruiz, Carlos G. Vallejo, Myra Spiliopoulou, Ernestina Menasalvas Ruiz:
Automated Constraint Selection for Semi-supervised Clustering Algorithm. CAEPIA 2009: 151-160
[c34]
- view
  authority control:
- export record
  dblp key:
  - conf/cisse/Vargas-LombardoJVCAMR09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/cisse/Vargas-LombardoJVCAMR09
Miguel Vargas-Lombardo, Armando Jipsion, Rafael Vejarano, Ismael Camargo, Humberto Alvarez, Elena Villalba Mora, Ernestina Menasalva Ruiz:
The Holistic, Interactive and Persuasive Model to Facilitate Self-care of Patients with Diabetes. SCSS 2009: 325-330
[c33]
- view
  authority control:
- export record
  dblp key:
  - conf/dis/RuizRS09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/dis/RuizRS09
Carlos Ruiz, Ernestina Menasalvas Ruiz, Myra Spiliopoulou:
C-DenStream: Using Domain Knowledge on a Data Stream. Discovery Science 2009: 287-301
[c32]
- view
  authority control:
- export record
  dblp key:
  - conf/la-web/ValenciaRE09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/la-web/ValenciaRE09
Maria Valencia, Ernestina Menasalvas Ruiz, Santiago Eibe:
Approach for Discovering and Tracking Local Web Search Trends. LA-WEB/CLIHC 2009: 201-206
[r1]
- view
  authority control:
- export record
  dblp key:
  - reference/complexity/WasilewskaR09
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/reference/complexity/WasilewskaR09
Anita Wasilewska, Ernestina Menasalvas Ruiz:
Granular Model for Data Mining. Encyclopedia of Complexity and Systems Science 2009: 4392-4402
2008
[j6]
- view
  authority control:
- export record
  dblp key:
  - journals/is/MarbanRF08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/is/MarbanRF08
Oscar Marbán, Ernestina Menasalvas Ruiz, María C. Fernández-Baizán:
A cost model to estimate the effort of data mining projects (DMCoMo). Inf. Syst. 33(1): 133-150 (2008)
[p6]
- view
  authority control:
- export record
  dblp key:
  - books/tf/08/0001BCGGHMMMPSSSV08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/books/tf/08/0001BCGGHMMMPSSSV08
Michael May, Bettina Berendt, Antoine Cornuéjols, João Gama, Fosca Giannotti, Andreas Hotho, Donato Malerba, Ernestina Menasalvas, Katharina Morik, Rasmus Ulslev Pedersen, Lorenza Saitta, Yücel Saygin, Assaf Schuster, Koen Vanhoof:
Research Challenges in Ubiquitous Knowledge Discovery. Next Generation of Data Mining 2008
[p5]
- view
  authority control:
- export record
  dblp key:
  - series/sci/Gonzalez-ArandaRMRS08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/sci/Gonzalez-ArandaRMRS08
P. González-Aranda, Ernestina Menasalvas Ruiz, Socorro Millán, Carlos Ruiz, Javier Segovia:
Towards a Methodology for Data Mining Project Development: The Importance of Abstraction. Data Mining: Foundations and Practice 2008: 165-178
[p4]
- view
  authority control:
- export record
  dblp key:
  - series/sci/WasilewskaR08
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/sci/WasilewskaR08
Anita Wasilewska, Ernestina Menasalvas Ruiz:
Data Preprocessing and Data Mining as Generalization. Data Mining: Foundations and Practice 2008: 469-484
[e3]
- view
  authority control:
- export record
  dblp key:
  - conf/iticse/2008
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iticse/2008
June Amillo, Cary Laxer, Ernestina Menasalvas Ruiz, Alison Young:
Proceedings of the 13th Annual SIGCSE Conference on Innovation and Technology in Computer Science Education, ITiCSE 2008, Madrid, Spain, June 30 - July 2, 2008. ACM 2008, ISBN 978-1-60558-078-4 [contents]
2007
[j5]
- view
  authority control:
- export record
  dblp key:
  - journals/trs/WasilewskaRS07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/trs/WasilewskaRS07
Anita Wasilewska, Ernestina Menasalvas Ruiz, Christelle Scharff:
A Model PM for Preprocessing and Data Mining Proper Process. Trans. Rough Sets 6: 397-399 (2007)
[c31]
- view
  authority control:
- export record
  dblp key:
  - conf/awic/EibeVRSS07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/awic/EibeVRSS07
Santiago Eibe, Maria Valencia, Ernestina Menasalvas Ruiz, Javier Segovia, Pedro A. C. Sousa:
Towards User Context Enhance Search Engine Logs Mining. AWIC 2007: 94-99
[c30]
- view
  authority control:
- export record
  dblp key:
  - conf/awic/RuizRS07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/awic/RuizRS07
Carlos Ruiz, Ernestina Menasalvas Ruiz, Myra Spiliopoulou:
Constraint-Based Query Clustering. AWIC 2007: 304-309
[c29]
- view
  authority control:
- export record
  dblp key:
  - conf/ideal/MarbanMRS07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ideal/MarbanMRS07
Oscar Marbán, Gonzalo Mariscal, Ernestina Menasalvas Ruiz, Javier Segovia:
An Engineering Approach to Data Mining Projects. IDEAL 2007: 578-588
[c28]
- view
  authority control:
- export record
  dblp key:
  - conf/rsfdgrc/RuizSR07
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rsfdgrc/RuizSR07
Carlos Ruiz, Myra Spiliopoulou, Ernestina Menasalvas Ruiz:
C-DBSCAN: Density-Based Clustering with Constraints. RSFDGrC 2007: 216-223
2006
[p3]
- view
  authority control:
- export record
  dblp key:
  - series/sci/MenasalvasW06
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/sci/MenasalvasW06
Ernestina Menasalvas Ruiz, Anita Wasilewska:
Data Mining as Generalization: A Formal Model. Foundations and Novel Approaches in Data Mining 2006: 99-126
2005
[c27]
- view
  authority control:
- export record
  dblp key:
  - conf/eurocast/ZorrillaRMMS05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/eurocast/ZorrillaRMMS05
Marta E. Zorrilla, Ernestina Menasalvas Ruiz, D. Marín, Eduardo Mora, Javier Segovia:
Web Usage Mining Project for Improving Web-Based Learning Sites. EUROCAST 2005: 205-210
[c26]
- view
  authority control:
- export record
  dblp key:
  - conf/grc/ZorrillaMR05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/grc/ZorrillaMR05
Marta E. Zorrilla, Socorro Millán, Ernestina Menasalvas Ruiz:
Data Web house to support Web intelligence in e-learning environments. GrC 2005: 722-727
[c25]
- view
  authority control:
- export record
  dblp key:
  - conf/ida/CuboRSR05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ida/CuboRSR05
Óscar Cubo, Víctor Robles, Javier Segovia, Ernestina Menasalvas Ruiz:
Using Genetic Algorithms to Improve Accuracy of Economical Indexes Prediction. IDA 2005: 57-65
[c24]
- view
  authority control:
- export record
  dblp key:
  - conf/rsfdgrc/WasilewskaR05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rsfdgrc/WasilewskaR05
Anita Wasilewska, Ernestina Menasalvas Ruiz:
A Classification Model: Syntax and Semantics for Classification. RSFDGrC (2) 2005: 59-68
[c23]
- view
  authority control:
- export record
  dblp key:
  - conf/rsfdgrc/EibeSFMRP05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rsfdgrc/EibeSFMRP05
Santiago Eibe, Raquel Del Saz, Covadonga Fernández, Oscar Marbán, Ernestina Menasalvas Ruiz, Concepción Pérez:
Financial Risk Prediction Using Rough Sets Tools: A Case Study. RSFDGrC (2) 2005: 495-502
[p2]
- view
  authority control:
- export record
  dblp key:
  - series/sci/MillanRHH05
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/sci/MillanRHH05
Socorro Millán, Ernestina Menasalvas Ruiz, Michael Hadjimichael, Esther Hochsztain:
An Algorithm to Calculate the Expected Value of an Ongoing User Session. Foundations of Data Mining and knowledge Discovery 2005: 363-375
2004
[j4]
- view
  authority control:
- export record
  dblp key:
  - journals/artmed/RoblesLPMPHW04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/artmed/RoblesLPMPHW04
Víctor Robles, Pedro Larrañaga, José M. Peña, Ernestina Menasalvas Ruiz, María S. Pérez, Vanessa Herves, Anita Wasilewska:
Bayesian network multi-classifiers for protein secondary structure prediction. Artif. Intell. Medicine 31(2): 117-136 (2004)
[j3]
- view
  authority control:
- export record
  dblp key:
  - journals/ijis/RuizMPHM04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ijis/RuizMPHM04
Ernestina Menasalvas Ruiz, Socorro Millán, José M. Peña, Michael Hadjimichael, Oscar Marbán:
Subsessions: A granular approach to click path analysis. Int. J. Intell. Syst. 19(7): 619-637 (2004)
[c22]
- view
  authority control:
- export record
  dblp key:
  - conf/rsctc/RuizMG04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rsctc/RuizMG04
Ernestina Menasalvas Ruiz, Socorro Millán, P. Gonzalez:
Using Markov Models to Define Proactive Action Plans for Users at Multi-viewpoint Websites. Rough Sets and Current Trends in Computing 2004: 752-761
[c21]
- view
  authority control:
- export record
  dblp key:
  - conf/webi/HerreroPRS04
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/webi/HerreroPRS04
Pilar Herrero, María S. Pérez, Ernestina Menasalvas Ruiz, Javier Segovia:
A Report of Activities at the WIC-Spain Research Centre. Web Intelligence 2004: 805-806
[e2]
- view
  authority control:
- export record
  dblp key:
  - conf/awic/2004
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/awic/2004
Jesús Favela, Ernestina Menasalvas Ruiz, Edgar Chávez:
Advances in Web Intelligence, Second International Atlantic Web Intelligence Conference, AWIC 2004, Cancun, Mexico, May 16-19, 2004. Proceedings. Lecture Notes in Computer Science 3034, Springer 2004, ISBN 3-540-22009-7 [contents]
2003
[j2]
- view
  - electronic edition @ iospress.com
  - details & citations
- export record
  dblp key:
  - journals/ida/FrutosRMS03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/ida/FrutosRMS03
Sonia Frutos, Ernestina Menasalvas Ruiz, César Montes, Javier Segovia:
Calculating economic indexes per household and censal section from official Spanish databases. Intell. Data Anal. 7(6): 603-613 (2003)
[c20]
- view
  authority control:
- export record
  dblp key:
  - conf/awic/HochsztainMPSR03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/awic/HochsztainMPSR03
Esther Hochsztain, Socorro Millán, B. Pardo, José M. Peña, Ernestina Menasalvas Ruiz:
A Framework to Integrate Business Goals in Web Usage Mining. AWIC 2003: 28-36
[c19]
- view
  authority control:
- export record
  dblp key:
  - conf/epia/RoblesLSPRH03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/epia/RoblesLSPRH03
Víctor Robles, Pedro Larrañaga, José M. Peña, María S. Pérez, Ernestina Menasalvas Ruiz, Vanessa Herves:
Learning Semi Naïve Bayes Structures by Estimation of Distribution Algorithms. EPIA 2003: 244-258
[c18]
- view
  authority control:
- export record
  dblp key:
  - conf/ewmf/RuizMPHT03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ewmf/RuizMPHT03
Ernestina Menasalvas Ruiz, Socorro Millán, María S. Pérez, Esther Hochsztain, Andrómaca Tasistro:
An Approach to Estimate the Value of User Sessions Using Multiple Viewpoints and Goals. EWMF 2003: 164-180
[c17]
- view
  authority control:
- export record
  dblp key:
  - conf/iccS/LealHSM03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iccS/LealHSM03
Katia Leal Algara, José Herrera, José M. Peña, Ernestina Menasalvas Ruiz:
MOIRAE - An Innovative Component Architecture with Distributed Control Features. International Conference on Computational Science 2003: 1069-1078
[c16]
- view
  authority control:
- export record
  dblp key:
  - conf/ida/RoblesLSRP03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/ida/RoblesLSRP03
Víctor Robles, Pedro Larrañaga, José M. Peña, Ernestina Menasalvas Ruiz, María S. Pérez:
Interval Estimation Naïve Bayes. IDA 2003: 143-154
[c15]
- no documents available
  - details & citations
- export record
  dblp key:
  - conf/jisbd/EibeCRA03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/jisbd/EibeCRA03
Santiago Eibe, Carmen Costilla, Ernestina Menasalvas Ruiz, César J. Acuña:
DAWIS: Una arquitectura de integración Web para el acceso a archivos digitales. JISBD 2003: 583-592
[c14]
- view
  authority control:
- export record
  dblp key:
  - conf/webi/RoblesLRPH03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/webi/RoblesLRPH03
Víctor Robles, Pedro Larrañaga, Ernestina Menasalvas Ruiz, María S. Pérez, Vanessa Herves:
Improvement of Naïve Bayes Collaborative Filtering Using Interval Estimation. Web Intelligence 2003: 168-174
[c13]
- view
  authority control:
- export record
  dblp key:
  - conf/webi/RuizPMHS03
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/webi/RuizPMHS03
Ernestina Menasalvas Ruiz, B. Pardo, Socorro Millán, Esther Hochsztain, José M. Peña:
Expected Value of User Sessions: Limitations to the Non-Semantic Approach. Web Intelligence 2003: 562-565
[p1]
- view
  authority control:
- export record
  dblp key:
  - series/sfsc/MenasalvasMM003
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/series/sfsc/MenasalvasMM003
Ernestina Menasalvas, Oscar Marbán, Socorro Millán, José M. Peña:
Intelligent Web Mining. Intelligent Exploration of the Web 2003: 363-388
[e1]
- view
  authority control:
- export record
  dblp key:
  - conf/awic/2003
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/awic/2003
Ernestina Menasalvas Ruiz, Javier Segovia, Piotr S. Szczepaniak:
Web Intelligence, First International Atlantic Web Intelligence Conference, AWIC 2003, Madrid, Spain, May 5-6, 2003, Proceedings. Lecture Notes in Computer Science 2663, Springer 2003, ISBN 3-540-40124-5 [contents]
2002
[c12]
- view
  authority control:
- export record
  dblp key:
  - conf/fuzzIEEE/MenasalvasMPHM02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/fuzzIEEE/MenasalvasMPHM02
Ernestina Menasalvas, Socorro Millán, José M. Peña, Michael Hadjimichael, Oscar Marbán:
Subsessions: a granular approach to click path analysis. FUZZ-IEEE 2002: 878-883
[c11]
- view
  authority control:
- export record
  dblp key:
  - conf/fuzzIEEE/FernandezMWHM02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/fuzzIEEE/FernandezMWHM02
Covadonga Fernández, Juan F. Martínez, Anita Wasilewska, Mike Hadjimichael, Ernestina Menasalvas:
Data mining - a semantic model. FUZZ-IEEE 2002: 938-943
[c10]
- view
  authority control:
- export record
  dblp key:
  - conf/iscc/MengualBJRSY02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/iscc/MengualBJRSY02
Luis Mengual, Nicolás Barcia, Ernesto Jiménez, Ernestina Menasalvas Ruiz, Julio Setién, Javier Yágüez:
Automatic implementation system of security protocols based on formal description techniques. ISCC 2002: 355-360
[c9]
- no documents available
  - details & citations
- export record
  dblp key:
  - conf/jisbd/HochsztairMR02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/jisbd/HochsztairMR02
Esther Hochsztain, Socorro Millán, Ernestina Menasalvas Ruiz:
Algoritmo de evaluación de los logros de un sitio web mediante el cómputo del valor de las sesiones de usuarios. JISBD 2002: 223-232
[c8]
- view
  authority control:
- export record
  dblp key:
  - conf/rsctc/SarriasWHFR02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rsctc/SarriasWHFR02
Juan Francisco Martínez Sarrías, Anita Wasilewska, Michael Hadjimichael, Covadonga Fernández, Ernestina Menasalvas Ruiz:
Extension of Relational Management Systems with Data Mining Capabilities. Rough Sets and Current Trends in Computing 2002: 421-424
[c7]
- view
  authority control:
- export record
  dblp key:
  - conf/rsctc/SanchezCRR02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rsctc/SanchezCRR02
José M. Peña, F. Javier Crespo, Ernestina Menasalvas Ruiz, Víctor Robles:
Parallel Data Mining Experimentation Using Flexible Configurations. Rough Sets and Current Trends in Computing 2002: 441-448
[c6]
- view
  authority control:
- export record
  dblp key:
  - conf/rsctc/HochsztainMR02
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rsctc/HochsztainMR02
Esther Hochsztain, Socorro Millán, Ernestina Menasalvas Ruiz:
A Granular Approach for Analyzing the Degree of Affability of a Web Site. Rough Sets and Current Trends in Computing 2002: 479-486
2000
[j1]
- view
  - electronic edition @ cai.sk (open access)
  - details & citations
- export record
  dblp key:
  - journals/cai/MillanFRP00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/journals/cai/MillanFRP00
Socorro Millán, María C. Fernández-Baizán, Ernestina Menasalvas Ruiz, Rafael Portaencasa:
Multivalued Dependencies as Inference Rules on a Deductive Process under a Relational Data Model Set-theory Approach. Comput. Artif. Intell. 19(2): 131-145 (2000)
[c5]
- view
  authority control:
- export record
  dblp key:
  - conf/rsctc/Fernandez-BaizanRSSM00
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rsctc/Fernandez-BaizanRSSM00
María C. Fernández-Baizán, Ernestina Menasalvas Ruiz, José María Peña Sánchez, Juan Francisco Martínez Sarrías, Socorro Millán:
Using the Apriori Algorithm to Improve Rough Sets Results. Rough Sets and Current Trends in Computing 2000: 291-295

1990 – 1999

see FAQ

What is the meaning of the colors in the publication lists?

1999
[c4]
- view
  authority control:
- export record
  dblp key:
  - conf/pkdd/Fernandez-BaizanRSMM99
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/pkdd/Fernandez-BaizanRSMM99
María C. Fernández-Baizán, Ernestina Menasalvas Ruiz, José María Peña Sánchez, Socorro Millán, Eloina Mesa:
Rough Dependencies as a Particular Case of Correlation: Application to the Calculation of Approximative Reducts. PKDD 1999: 335-340
1998
[b1]
- view
  - electronic edition @ upm.es
  - details & citations
- export record
  dblp key:
  - phd/es/Ruiz98
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/phd/es/Ruiz98
Ernestina Menasalvas Ruiz:
Integración del proceso de inferencia de conocimiento con los sistemas de bases de datos relacionales: formalización matemática de la fase de análisis. Technical University of Madrid, Spain, 1998
[c3]
- view
  authority control:
- export record
  dblp key:
  - conf/rsctc/Fernandez-BaizanRW98
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rsctc/Fernandez-BaizanRW98
María C. Fernández-Baizán, Ernestina Menasalvas Ruiz, Anita Wasilewska:
A Model of RSDM Implementation. Rough Sets and Current Trends in Computing 1998: 186-193
[c2]
- view
  authority control:
- export record
  dblp key:
  - conf/rsctc/Fernandez-BaizanRSP98
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/rsctc/Fernandez-BaizanRSP98
María C. Fernández-Baizán, Ernestina Menasalvas Ruiz, José María Peña Sánchez, Borja Pardo Pastrana:
Integrating KDD Algorithms and RDBMS Code. Rough Sets and Current Trends in Computing 1998: 210-213
1996
[c1]
- no documents available
  - details & citations
- export record
  dblp key:
  - conf/jisbd/Fernandez-BaizanRP96
- ask others
- share record
  persistent URL:
  - https://dblp.org/rec/conf/jisbd/Fernandez-BaizanRP96
María C. Fernández-Baizán, Ernestina Menasalvas Ruiz, C. Pérez-Llera:
Definición de Dependencia Funcional (Aproximación Bases de Datos Relacionales) en términos de Dependencia de Conocimiento (Aproximación 'Rogh Sets'). JIDBD 1996: 204-209

Coauthor Index

see FAQ

manage site settings

To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.