default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Richa Singh"
download as .bib file
@article{DBLP:journals/bspc/KhurshidAVS24,
author = {Mahapara Khurshid and
Yasmeena Akhter and
Mayank Vatsa and
Richa Singh},
title = {AssistDistil for Medical Image Segmentation},
journal = {Biomed. Signal Process. Control.},
volume = {97},
pages = {106568},
year = {2024},
url = {https://doi.org/10.1016/j.bspc.2024.106568},
doi = {10.1016/J.BSPC.2024.106568},
timestamp = {Sun, 08 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bspc/KhurshidAVS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csm/CedergrenLFFKKLMOPSSSTV24,
author = {Andreas Cedergren and
Fabian de Laval and
Sorour Falahati and
Lars Falk and
Du Ho Kang and
Robert S. Karlsson and
Yazid Lyazidi and
Aliakbar Mirzaei and
Jonas Olsson and
Jose Luis Pradas and
Paul Schliwa{-}Bertling and
Nianshan Shi and
Bikramjit Singh and
Richard Tano and
Andra M. Voicu},
title = {5G Networks Evolution for Extended Reality},
journal = {{IEEE} Commun. Stand. Mag.},
volume = {8},
number = {3},
pages = {54--59},
year = {2024},
url = {https://doi.org/10.1109/MCOMSTD.0001.2400037},
doi = {10.1109/MCOMSTD.0001.2400037},
timestamp = {Thu, 19 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csm/CedergrenLFFKKLMOPSSSTV24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esi/VermaMkSSSHSTKS24,
author = {Nitin Verma and
Satya Prakash Maurya and
Ravi Kant and
K. H. Singh and
Raghav Singh and
A. P. Singh and
G. Hema and
M. K. Srivastava and
Alok K. Tiwari and
Pradeep Kumar Kushwaha and
Richa Singh},
title = {Comparison of neural networks techniques to predict subsurface parameters
based on seismic inversion: a machine learning approach},
journal = {Earth Sci. Informatics},
volume = {17},
number = {2},
pages = {1031--1052},
year = {2024},
url = {https://doi.org/10.1007/s12145-023-01199-x},
doi = {10.1007/S12145-023-01199-X},
timestamp = {Fri, 16 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/esi/VermaMkSSSHSTKS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fdata/AkhterSV24,
author = {Yasmeena Akhter and
Richa Singh and
Mayank Vatsa},
title = {AI-based radiodiagnosis using chest X-rays: {A} review},
journal = {Frontiers Big Data},
volume = {6},
year = {2024},
url = {https://doi.org/10.3389/fdata.2023.1120989},
doi = {10.3389/FDATA.2023.1120989},
timestamp = {Tue, 02 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fdata/AkhterSV24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijesdf/SinghalV24,
author = {Divya Singhal and
Richa Vijay},
title = {Predictive modelling for fake news detection using {TF-IDF} and count
vectorizers},
journal = {Int. J. Electron. Secur. Digit. Forensics},
volume = {16},
number = {4},
pages = {503--519},
year = {2024},
url = {https://doi.org/10.1504/IJESDF.2024.139672},
doi = {10.1504/IJESDF.2024.139672},
timestamp = {Thu, 19 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijesdf/SinghalV24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iotm/KaushikSLLDSASSR24,
author = {Aryan Kaushik and
Rohit Singh and
Ming Li and
Honghao Luo and
Shalanika Dayarathna and
Rajitha Senanayake and
Xueli An and
Richard A. Stirling{-}Gallacher and
Wonjae Shin and
Marco Di Renzo},
title = {Integrated Sensing and Communications for IoT: Synergies with Key
6G Technology Enablers},
journal = {{IEEE} Internet Things Mag.},
volume = {7},
number = {5},
pages = {136--143},
year = {2024},
url = {https://doi.org/10.1109/IOTM.001.2400052},
doi = {10.1109/IOTM.001.2400052},
timestamp = {Thu, 05 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iotm/KaushikSLLDSASSR24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kais/ChaudhariPJPS24,
author = {Jyoti Kant Chaudhari and
Shubham Pant and
Richa Jha and
Rajesh Kumar Pathak and
Dev Bukhsh Singh},
title = {Biological big-data sources, problems of storage, computational issues,
and applications: a comprehensive review},
journal = {Knowl. Inf. Syst.},
volume = {66},
number = {6},
pages = {3159--3209},
year = {2024},
url = {https://doi.org/10.1007/s10115-023-02049-4},
doi = {10.1007/S10115-023-02049-4},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/kais/ChaudhariPJPS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nn/AgarwalVSR24,
author = {Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Corruption depth: Analysis of {DNN} depth for misclassification},
journal = {Neural Networks},
volume = {172},
pages = {106013},
year = {2024},
url = {https://doi.org/10.1016/j.neunet.2023.11.035},
doi = {10.1016/J.NEUNET.2023.11.035},
timestamp = {Fri, 31 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nn/AgarwalVSR24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/saem/MohantySGBK24,
author = {Sachi Nandan Mohanty and
Tilottama Singh and
Richa Goel and
Sukanta Kumar Baral and
Rakesh Kumar},
title = {A study on building awareness in cyber security for educational system
in India using interpretive structural modellings},
journal = {Int. J. Syst. Assur. Eng. Manag.},
volume = {15},
number = {6},
pages = {2518--2528},
year = {2024},
url = {https://doi.org/10.1007/s13198-024-02273-3},
doi = {10.1007/S13198-024-02273-3},
timestamp = {Thu, 04 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/saem/MohantySGBK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tai/ChhabraTMVS24,
author = {Saheb Chhabra and
Kartik Thakral and
Surbhi Mittal and
Mayank Vatsa and
Richa Singh},
title = {Low-Quality Deepfake Detection via Unseen Artifacts},
journal = {{IEEE} Trans. Artif. Intell.},
volume = {5},
number = {4},
pages = {1573--1585},
year = {2024},
url = {https://doi.org/10.1109/TAI.2023.3299894},
doi = {10.1109/TAI.2023.3299894},
timestamp = {Sat, 04 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tai/ChhabraTMVS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbbis/ManchandaBBACDCVS24,
author = {Sunny Manchanda and
Kaushik Bhagwatkar and
Kavita Balutia and
Shivang Agarwal and
Jyoti Chaudhary and
Muskan Dosi and
Chiranjeev Chiranjeev and
Mayank Vatsa and
Richa Singh},
title = {{D-LORD:} {DYSL-AI} Database for Low-Resolution Disguised Face Recognition},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {6},
number = {2},
pages = {147--157},
year = {2024},
url = {https://doi.org/10.1109/TBIOM.2023.3306703},
doi = {10.1109/TBIOM.2023.3306703},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbbis/ManchandaBBACDCVS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tecs/SinghISS24,
author = {Richa Singh and
Saad Islam and
Berk Sunar and
Patrick Schaumont},
title = {Analysis of {EM} Fault Injection on Bit-sliced Number Theoretic Transform
Software in Dilithium},
journal = {{ACM} Trans. Embed. Comput. Syst.},
volume = {23},
number = {2},
pages = {32:1--32:27},
year = {2024},
url = {https://doi.org/10.1145/3583757},
doi = {10.1145/3583757},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tecs/SinghISS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/MalhotraVSMN24,
author = {Aakarsh Malhotra and
Mayank Vatsa and
Richa Singh and
Keith B. Morris and
Afzel Noore},
title = {Multi-Surface Multi-Technique {(MUST)} Latent Fingerprint Database},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {19},
pages = {1041--1055},
year = {2024},
url = {https://doi.org/10.1109/TIFS.2023.3280742},
doi = {10.1109/TIFS.2023.3280742},
timestamp = {Sun, 31 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tifs/MalhotraVSMN24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/KshitizSDDV0ASP24,
author = {Kshitiz and
Sonu Shreshtha and
Bikash Dutta and
Muskan Dosi and
Mayank Vatsa and
Richa Singh and
Saket Anand and
Sudeep Sarkar and
Sevaram Mali Parihar},
editor = {Michael J. Wooldridge and
Jennifer G. Dy and
Sriraam Natarajan},
title = {BirdCollect: {A} Comprehensive Benchmark for Analyzing Dense Bird
Flock Attributes},
booktitle = {Thirty-Eighth {AAAI} Conference on Artificial Intelligence, {AAAI}
2024, Thirty-Sixth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2024, Fourteenth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2014, February 20-27, 2024, Vancouver,
Canada},
pages = {21879--21887},
publisher = {{AAAI} Press},
year = {2024},
url = {https://doi.org/10.1609/aaai.v38i20.30189},
doi = {10.1609/AAAI.V38I20.30189},
timestamp = {Tue, 02 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/KshitizSDDV0ASP24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/VatsaJ024,
author = {Mayank Vatsa and
Anubhooti Jain and
Richa Singh},
editor = {Michael J. Wooldridge and
Jennifer G. Dy and
Sriraam Natarajan},
title = {Adventures of Trustworthy Vision-Language Models: {A} Survey},
booktitle = {Thirty-Eighth {AAAI} Conference on Artificial Intelligence, {AAAI}
2024, Thirty-Sixth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2024, Fourteenth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2014, February 20-27, 2024, Vancouver,
Canada},
pages = {22658--22659},
publisher = {{AAAI} Press},
year = {2024},
url = {https://doi.org/10.1609/aaai.v38i20.30275},
doi = {10.1609/AAAI.V38I20.30275},
timestamp = {Tue, 02 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/VatsaJ024.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/VedadiDMSAM24,
author = {Elahe Vedadi and
Joshua V. Dillon and
Philip Andrew Mansfield and
Karan Singhal and
Arash Afkanpour and
Warren Richard Morningstar},
editor = {Ron P. A. Petrick and
Christopher W. Geib},
title = {Federated Variational Inference: Towards Improved Personalization
and Generalization},
booktitle = {Proceedings of the {AAAI} 2024 Spring Symposium Series, Stanford,
CA, USA, March 25-27, 2024},
pages = {323--327},
publisher = {{AAAI} Press},
year = {2024},
url = {https://doi.org/10.1609/aaaiss.v3i1.31228},
doi = {10.1609/AAAISS.V3I1.31228},
timestamp = {Mon, 03 Jun 2024 16:39:00 +0200},
biburl = {https://dblp.org/rec/conf/aaaiss/VedadiDMSAM24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/KnowlesSABLPVW24,
author = {Bran Knowles and
Aneesha Singh and
Aloha May Hufana Ambe and
Robin N. Brewer and
Amanda Lazar and
Helen Petrie and
John Vines and
Jenny Waycott},
editor = {Florian 'Floyd' Mueller and
Penny Kyburz and
Julie R. Williamson and
Corina Sas},
title = {{HCI} and Aging: New Directions, New Principles},
booktitle = {Extended Abstracts of the {CHI} Conference on Human Factors in Computing
Systems, {CHI} {EA} 2024, Honolulu, HI, USA, May 11-16, 2024},
pages = {473:1--473:5},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3613905.3636295},
doi = {10.1145/3613905.3636295},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/KnowlesSABLPVW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ThakralPAV024,
author = {Kartik Thakral and
Shashikant Prasad and
Stuti Aswani and
Mayank Vatsa and
Richa Singh},
title = {ToonerGAN: Reinforcing GANs for Obfuscating Automated Facial Indexing},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2024, Seattle, WA, USA, June 16-22, 2024},
pages = {10875--10884},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/CVPR52733.2024.01034},
doi = {10.1109/CVPR52733.2024.01034},
timestamp = {Wed, 02 Oct 2024 09:45:16 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/ThakralPAV024.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/flairs/WuSZBCP24,
author = {Annie Wu and
Eashan Singh and
Ivy Zhang and
Anika Bilal and
Anna Casu and
Richard Pratley},
editor = {Soon Ae Chun and
Douglas A. Talbert},
title = {Machine learning prediction of severity and duration of hypoglycemic
events in type 1 diabetes patients},
booktitle = {Proceedings of the Thirty-Seventh International Florida Artificial
Intelligence Research Society Conference, {FLAIRS} 2024, Sandestin
Beach, FL, USA, May 19-21, 2024},
publisher = {{AAAI} Press},
year = {2024},
url = {https://doi.org/10.32473/flairs.37.1.135600},
doi = {10.32473/FLAIRS.37.1.135600},
timestamp = {Thu, 29 Aug 2024 17:13:57 +0200},
biburl = {https://dblp.org/rec/conf/flairs/WuSZBCP24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/YangYXS0CT024,
author = {Zhaoyuan Yang and
Zhengyang Yu and
Zhiwei Xu and
Jaskirat Singh and
Jing Zhang and
Dylan Campbell and
Peter H. Tu and
Richard Hartley},
title = {{IMPUS:} Image Morphing with Perceptually-Uniform Sampling Using Diffusion
Models},
booktitle = {The Twelfth International Conference on Learning Representations,
{ICLR} 2024, Vienna, Austria, May 7-11, 2024},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/forum?id=gG38EBe2S8},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/YangYXS0CT024.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsa/GsturKSK24,
author = {Moritz Gst{\"{u}}r and
Yves Richard Kirschner and
Snigdha Singh and
Anne Koziolek},
title = {MoCoRe - {A} Generic Model-Driven Composition and Rule-Based Refinement
Framework},
booktitle = {21st {IEEE} International Conference on Software Architecture, {ICSA}
2024 - Companion, Hyderabad, India, June 4-8, 2024},
pages = {273--280},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ICSA-C63560.2024.00039},
doi = {10.1109/ICSA-C63560.2024.00039},
timestamp = {Wed, 04 Sep 2024 21:11:41 +0200},
biburl = {https://dblp.org/rec/conf/icsa/GsturKSK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/SenarasHDWRGJ24,
author = {{\c{C}}aglar Senaras and
Piers Holden and
Timothy Davis and
Annett Wania and
Akhil Singh Rana and
Helen M. Grady and
Richard de Jeu},
title = {Early-Season Crop Classification with Planet Fusion},
booktitle = {{IGARSS} 2024 - 2024 {IEEE} International Geoscience and Remote Sensing
Symposium, Athens, Greece, July 7-12, 2024},
pages = {4145--4149},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/IGARSS53475.2024.10642187},
doi = {10.1109/IGARSS53475.2024.10642187},
timestamp = {Thu, 26 Sep 2024 12:36:11 +0200},
biburl = {https://dblp.org/rec/conf/igarss/SenarasHDWRGJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/KumarSRNR24,
author = {Deepak Kumar and
Pradeep Singh and
Richa and
Kishore Babu Nampalle and
Balasubramanian Raman},
title = {Integrating Physiological Signals with Dynamical Attention Networks
for Personality Trait Analysis},
booktitle = {International Joint Conference on Neural Networks, {IJCNN} 2024, Yokohama,
Japan, June 30 - July 5, 2024},
pages = {1--8},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/IJCNN60899.2024.10650662},
doi = {10.1109/IJCNN60899.2024.10650662},
timestamp = {Thu, 19 Sep 2024 10:41:53 +0200},
biburl = {https://dblp.org/rec/conf/ijcnn/KumarSRNR24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/AkhterRSV24,
author = {Yasmeena Akhter and
Rishabh Ranjan and
Richa Singh and
Mayank Vatsa},
title = {Low-Resolution Chest X-Ray Classification Via Knowledge Distillation
and Multi-Task Learning},
booktitle = {{IEEE} International Symposium on Biomedical Imaging, {ISBI} 2024,
Athens, Greece, May 27-30, 2024},
pages = {1--5},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISBI56570.2024.10635737},
doi = {10.1109/ISBI56570.2024.10635737},
timestamp = {Fri, 06 Sep 2024 21:02:06 +0200},
biburl = {https://dblp.org/rec/conf/isbi/AkhterRSV24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/KhurshidVS24,
author = {Mahapara Khurshid and
Mayank Vatsa and
Richa Singh},
title = {Optimizing Skin Lesion Classification Via Multimodal Data and Auxiliary
Task Integration},
booktitle = {{IEEE} International Symposium on Biomedical Imaging, {ISBI} 2024,
Athens, Greece, May 27-30, 2024},
pages = {1--5},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISBI56570.2024.10635277},
doi = {10.1109/ISBI56570.2024.10635277},
timestamp = {Fri, 06 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isbi/KhurshidVS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nsdi/LiuSTFGAAABCGLO24,
author = {Bingzhe Liu and
Colin Scott and
Mukarram Tariq and
Andrew D. Ferguson and
Phillipa Gill and
Richard Alimi and
Omid Alipourfard and
Deepak Arulkannan and
Virginia Beauregard and
Patrick Conner and
Philip Brighten Godfrey and
Xander Lin and
Joon Ong and
Mayur Patel and
Amr Sabaa and
Arjun Singh and
Alex Smirnov and
Manish Verma and
Prerepa V. Viswanadham and
Amin Vahdat},
editor = {Laurent Vanbever and
Irene Zhang},
title = {{CAPA:} An Architecture For Operating Cluster Networks With High Availability},
booktitle = {21st {USENIX} Symposium on Networked Systems Design and Implementation,
{NSDI} 2024, Santa Clara, CA, April 15-17, 2024},
publisher = {{USENIX} Association},
year = {2024},
url = {https://www.usenix.org/conference/nsdi24/presentation/liu-bingzhe},
timestamp = {Mon, 22 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nsdi/LiuSTFGAAABCGLO24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/SinghGB24,
author = {Ishaan Singh and
Jay Goodman and
Richard Burgess{-}Dawson},
editor = {Andres Burbano and
Susan Reiser},
title = {College Football is {HUGE:} Delivering a {AAA} Sports Game at Scale},
booktitle = {{ACM} {SIGGRAPH} 2024 Talks, {SIGGRAPH} 2024, Denver, CO, USA, 27
July 2024- 1 August 2024},
pages = {1},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3641233.3665345},
doi = {10.1145/3641233.3665345},
timestamp = {Fri, 02 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/siggraph/SinghGB24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/SinghBV0B24,
author = {Jaisidh Singh and
Harshil Bhatia and
Mayank Vatsa and
Richa Singh and
Aparna Bharati},
title = {SynthProv: Interpretable Framework for Profiling Identity Leakage},
booktitle = {{IEEE/CVF} Winter Conference on Applications of Computer Vision, {WACV}
2024, Waikoloa, HI, USA, January 3-8, 2024},
pages = {4734--4744},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/WACV57701.2024.00468},
doi = {10.1109/WACV57701.2024.00468},
timestamp = {Wed, 17 Apr 2024 07:41:22 +0200},
biburl = {https://dblp.org/rec/conf/wacv/SinghBV0B24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/comad/2024,
editor = {Sriraam Natarajan and
Indrajit Bhattacharya and
Richa Singh and
Arun Kumar and
Sayan Ranu and
Kalika Bali and
Abinaya K},
title = {Proceedings of the 7th Joint International Conference on Data Science
{\&} Management of Data (11th {ACM} {IKDD} {CODS} and 29th COMAD),
Bangalore, India, January 4-7, 2024},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3632410},
doi = {10.1145/3632410},
timestamp = {Thu, 04 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/comad/2024.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-01761,
author = {Chandan Singh and
Jeevana Priya Inala and
Michel Galley and
Rich Caruana and
Jianfeng Gao},
title = {Rethinking Interpretability in the Era of Large Language Models},
journal = {CoRR},
volume = {abs/2402.01761},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.01761},
doi = {10.48550/ARXIV.2402.01761},
eprinttype = {arXiv},
eprint = {2402.01761},
timestamp = {Thu, 11 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-01761.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-06463,
author = {Abdoul{-}aziz Amadou and
Laura Peralta Pereira and
Paul Dryburgh and
Paul Klein and
Kaloian Petkov and
Richard James Housden and
Vivek Singh and
Rui Liao and
Young{-}Ho Kim and
Florin{-}Cristian Ghesu and
Tommaso Mansi and
Ronak Rajani and
Alistair A. Young and
Kawal S. Rhode},
title = {Cardiac ultrasound simulation for autonomous ultrasound navigation},
journal = {CoRR},
volume = {abs/2402.06463},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.06463},
doi = {10.48550/ARXIV.2402.06463},
eprinttype = {arXiv},
eprint = {2402.06463},
timestamp = {Mon, 17 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-06463.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-10454,
author = {Mahapara Khurshid and
Mayank Vatsa and
Richa Singh},
title = {Optimizing Skin Lesion Classification via Multimodal Data and Auxiliary
Task Integration},
journal = {CoRR},
volume = {abs/2402.10454},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.10454},
doi = {10.48550/ARXIV.2402.10454},
eprinttype = {arXiv},
eprint = {2402.10454},
timestamp = {Mon, 26 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-10454.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-05726,
author = {Warren R. Morningstar and
Alex Bijamov and
Chris Duvarney and
Luke Friedman and
Neha Mukund Kalibhat and
Luyang Liu and
Philip Andrew Mansfield and
Renan A. Rojas{-}Gomez and
Karan Singhal and
Bradley Green and
Sushant Prakash},
title = {Augmentations vs Algorithms: What Works in Self-Supervised Learning},
journal = {CoRR},
volume = {abs/2403.05726},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.05726},
doi = {10.48550/ARXIV.2403.05726},
eprinttype = {arXiv},
eprint = {2403.05726},
timestamp = {Thu, 04 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-05726.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-20312,
author = {Jaisidh Singh and
Ishaan Shrivastava and
Mayank Vatsa and
Richa Singh and
Aparna Bharati},
title = {Learn "No" to Say "Yes" Better: Improving Vision-Language Models via
Negations},
journal = {CoRR},
volume = {abs/2403.20312},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.20312},
doi = {10.48550/ARXIV.2403.20312},
eprinttype = {arXiv},
eprint = {2403.20312},
timestamp = {Wed, 10 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-20312.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-16831,
author = {Jaime Spencer and
Fabio Tosi and
Matteo Poggi and
Ripudaman Singh Arora and
Chris Russell and
Simon Hadfield and
Richard Bowden and
GuangYuan Zhou and
ZhengXin Li and
Qiang Rao and
YiPing Bao and
Xiao Liu and
Dohyeong Kim and
Jinseong Kim and
Myunghyun Kim and
Mykola Lavreniuk and
Rui Li and
Qing Mao and
Jiang Wu and
Yu Zhu and
Jinqiu Sun and
Yanning Zhang and
Suraj Patni and
Aradhye Agarwal and
Chetan Arora and
Pihai Sun and
Kui Jiang and
Gang Wu and
Jian Liu and
Xianming Liu and
Junjun Jiang and
Xidan Zhang and
Jianing Wei and
Fangjun Wang and
Zhiming Tan and
Jiabao Wang and
Albert Luginov and
Muhammad Shahzad and
Seyed Hosseini and
Aleksander Trajcevski and
James H. Elder},
title = {The Third Monocular Depth Estimation Challenge},
journal = {CoRR},
volume = {abs/2404.16831},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2404.16831},
doi = {10.48550/ARXIV.2404.16831},
eprinttype = {arXiv},
eprint = {2404.16831},
timestamp = {Thu, 15 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2404-16831.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-13370,
author = {Yasmeena Akhter and
Rishabh Ranjan and
Richa Singh and
Mayank Vatsa},
title = {Low-Resolution Chest X-ray Classification via Knowledge Distillation
and Multi-task Learning},
journal = {CoRR},
volume = {abs/2405.13370},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2405.13370},
doi = {10.48550/ARXIV.2405.13370},
eprinttype = {arXiv},
eprint = {2405.13370},
timestamp = {Mon, 24 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2405-13370.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-16714,
author = {Vinamra Benara and
Chandan Singh and
John X. Morris and
Richard Antonello and
Ion Stoica and
Alexander G. Huth and
Jianfeng Gao},
title = {Crafting Interpretable Embeddings by Asking LLMs Questions},
journal = {CoRR},
volume = {abs/2405.16714},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2405.16714},
doi = {10.48550/ARXIV.2405.16714},
eprinttype = {arXiv},
eprint = {2405.16714},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2405-16714.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2408-00283,
author = {Surbhi Mittal and
Arnav Sudan and
Mayank Vatsa and
Richa Singh and
Tamar Glaser and
Tal Hassner},
title = {Navigating Text-to-Image Generative Bias across Indic Languages},
journal = {CoRR},
volume = {abs/2408.00283},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2408.00283},
doi = {10.48550/ARXIV.2408.00283},
eprinttype = {arXiv},
eprint = {2408.00283},
timestamp = {Thu, 12 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2408-00283.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2408-02494,
author = {Chiranjeev Chiranjeev and
Muskan Dosi and
Kartik Thakral and
Mayank Vatsa and
Richa Singh},
title = {HyperSpaceX: Radial and Angular Exploration of HyperSpherical Dimensions},
journal = {CoRR},
volume = {abs/2408.02494},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2408.02494},
doi = {10.48550/ARXIV.2408.02494},
eprinttype = {arXiv},
eprint = {2408.02494},
timestamp = {Thu, 12 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2408-02494.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2408-08577,
author = {Pavan K. Inguva and
Saikat Mukherjee and
Pierre J. Walker and
Mona A. Kanso and
Jie Wang and
Yanchen Wu and
Vico Tenberg and
Srimanta Santra and
Shalini Singh and
Shin Hyuk Kim and
Bernhardt L. Trout and
Martin Z. Bazant and
Allan S. Myerson and
Richard D. Braatz},
title = {Mechanistic Modeling of Lipid Nanoparticle Formation for the Delivery
of Nucleic Acid Therapeutics},
journal = {CoRR},
volume = {abs/2408.08577},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2408.08577},
doi = {10.48550/ARXIV.2408.08577},
eprinttype = {arXiv},
eprint = {2408.08577},
timestamp = {Sat, 28 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2408-08577.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computers/SinghIV23,
author = {Avinash Singh and
Richard Adeyemi Ikuesan and
Hein S. Venter},
title = {MalFe - Malware Feature Engineering Generation Platform},
journal = {Comput.},
volume = {12},
number = {10},
pages = {201},
year = {2023},
url = {https://doi.org/10.3390/computers12100201},
doi = {10.3390/COMPUTERS12100201},
timestamp = {Sat, 13 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/computers/SinghIV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fcomp/TuYHXZFCSW23,
author = {Peter H. Tu and
Zhaoyuan Yang and
Richard I. Hartley and
Zhiwei Xu and
Jing Zhang and
Yiwei Fu and
Dylan Campbell and
Jaskirat Singh and
Tianyu Wang},
title = {Probabilistic and semantic descriptions of image manifolds and their
applications},
journal = {Frontiers Comput. Sci.},
volume = {5},
year = {2023},
url = {https://doi.org/10.3389/fcomp.2023.1253682},
doi = {10.3389/FCOMP.2023.1253682},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fcomp/TuYHXZFCSW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fdata/SinghU23,
author = {Richa Singh and
R. L. Ujjwal},
title = {Hybridized bio-inspired intrusion detection system for Internet of
Things},
journal = {Frontiers Big Data},
volume = {6},
year = {2023},
url = {https://doi.org/10.3389/fdata.2023.1081466},
doi = {10.3389/FDATA.2023.1081466},
timestamp = {Wed, 08 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/fdata/SinghU23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsose/SinghGSSSG23,
author = {Narendra Singh and
Priyanka Gupta and
Richa Sharma and
Pushpa Singh and
Rajnesh Singh and
Sunil Gupta},
title = {Managing Employees Attendance using Real Time Face Recognition},
journal = {Int. J. Syst. Syst. Eng.},
volume = {13},
number = {4},
year = {2023},
url = {https://doi.org/10.1504/ijsse.2023.10055596},
doi = {10.1504/IJSSE.2023.10055596},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijsose/SinghGSSSG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsose/SinghSSGSG23,
author = {Rajnesh Singh and
Pushpa Singh and
Richa Kumari Sharma and
Priyanka Gupta and
Narendra Singh and
Sunil Gupta},
title = {Managing employee attendance using real-time face recognition},
journal = {Int. J. Syst. Syst. Eng.},
volume = {13},
number = {4},
pages = {407--418},
year = {2023},
url = {https://doi.org/10.1504/ijsse.2023.134435},
doi = {10.1504/IJSSE.2023.134435},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijsose/SinghSSGSG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/AgarwalVSR23,
author = {Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Parameter agnostic stacked wavelet transformer for detecting singularities},
journal = {Inf. Fusion},
volume = {95},
pages = {415--425},
year = {2023},
url = {https://doi.org/10.1016/j.inffus.2023.01.022},
doi = {10.1016/J.INFFUS.2023.01.022},
timestamp = {Sat, 29 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/inffus/AgarwalVSR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/information/Jain0SSMA23,
author = {Parth Jain and
Vivek Kumar and
Jim Samuel and
Sushmita Singh and
Abhinay Mannepalli and
Richard Anderson},
title = {Artificially Intelligent Readers: An Adaptive Framework for Original
Handwritten Numerical Digits Recognition with {OCR} Methods},
journal = {Inf.},
volume = {14},
number = {6},
pages = {305},
year = {2023},
url = {https://doi.org/10.3390/info14060305},
doi = {10.3390/INFO14060305},
timestamp = {Fri, 21 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/information/Jain0SSMA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jstsp/DosiCACMBBVS23,
author = {Muskan Dosi and
Chiranjeev Chiranjeev and
Shivang Agarwal and
Jyoti Chaudhary and
Sunny Manchanda and
Kavita Balutia and
Kaushik Bhagwatkar and
Mayank Vatsa and
Richa Singh},
title = {Seg-DGDNet: Segmentation Based Disguise Guided Dropout Network for
Low Resolution Face Recognition},
journal = {{IEEE} J. Sel. Top. Signal Process.},
volume = {17},
number = {6},
pages = {1264--1276},
year = {2023},
url = {https://doi.org/10.1109/JSTSP.2023.3288398},
doi = {10.1109/JSTSP.2023.3288398},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jstsp/DosiCACMBBVS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/OlsonABCCDDDDKKLLMMMNNOOPPPPSSSTTVV23,
author = {Robert D. Olson and
Rida Assaf and
Thomas S. Brettin and
Neal Conrad and
Clark Cucinell and
James J. Davis and
Donald M. Dempsey and
Allan Dickerman and
Emily M. Dietrich and
Ronald W. Kenyon and
Mehmet Kuscuoglu and
Elliot J. Lefkowitz and
Jian Lu and
Dustin Machi and
Catherine Macken and
Chunhong Mao and
Anna Maria Niewiadomska and
Marcus Nguyen and
Gary J. Olsen and
Jamie C. Overbeek and
Bruce D. Parrello and
Victoria Parrello and
Jacob s Porter and
Gordon D. Pusch and
Maulik Shukla and
Indresh Singh and
Lucy Stewart and
Gene Tan and
Chris Thomas and
Margo VanOeffelen and
Veronika Vonstein and
Zachary S. Wallace and
Andrew S. Warren and
Alice R. Wattam and
Fangfang Xia and
Hyun Seung Yoo and
Yun Zhang and
Christian M. Zmasek and
Richard H. Scheuermann and
Rick L. Stevens},
title = {Introducing the Bacterial and Viral Bioinformatics Resource Center
{(BV-BRC):} a resource combining PATRIC, {IRD} and ViPR},
journal = {Nucleic Acids Res.},
volume = {51},
number = {{D1}},
pages = {678--689},
year = {2023},
url = {https://doi.org/10.1093/nar/gkac1003},
doi = {10.1093/NAR/GKAC1003},
timestamp = {Fri, 04 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/OlsonABCCDDDDKKLLMMMNNOOPPPPSSSTTVV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/natmi/SandersSYQMBHRMHCKKABBBBDGGHHHJJK23,
author = {Lauren M. Sanders and
Ryan T. Scott and
Jason H. Yang and
Amina Ann Qutub and
H{\'{e}}ctor Garc{\'{\i}}a Mart{\'{\i}}n and
Daniel C. Berrios and
Jaden J. A. Hastings and
Jon Rask and
Graham Mackintosh and
Adrienne L. Hoarfrost and
Stuart J. Chalk and
John Kalantari and
Kia Khezeli and
Erik L. Antonsen and
Joel Babdor and
Richard Barker and
Sergio E. Baranzini and
Afshin Beheshti and
Guillermo M. Delgado{-}Aparicio and
Benjamin S. Glicksberg and
Casey S. Greene and
Melissa A. Haendel and
Arif A. Hamid and
Philip Heller and
Daniel Jamieson and
Katelyn J. Jarvis and
Svetlana V. Komarova and
Matthieu Komorowski and
Prachi Kothiyal and
Ashish Mahabal and
Uri Manor and
Christopher E. Mason and
Mona Matar and
George I. Mias and
Jack Miller and
Jerry G. Myers Jr. and
Charlotte A. Nelson and
Jonathan Oribello and
Seung{-}Min Park and
Patricia Parsons{-}Wingerter and
R. K. Prabhu and
Robert J. Reynolds and
Amanda Saravia{-}Butler and
Suchi Saria and
Aenor Sawyer and
Nitin Kumar Singh and
Michael Snyder and
Frank Soboczenski and
Karthik Soman and
Corey A. Theriot and
David Van Valen and
Kasthuri Venkateswaran and
Liz Warren and
Liz Worthey and
Marinka Zitnik and
Sylvain V. Costes},
title = {Biological research and self-driving labs in deep space supported
by artificial intelligence},
journal = {Nat. Mac. Intell.},
volume = {5},
number = {3},
pages = {208--219},
year = {2023},
url = {https://doi.org/10.1038/s42256-023-00618-4},
doi = {10.1038/S42256-023-00618-4},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/natmi/SandersSYQMBHRMHCKKABBBBDGGHHHJJK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/natmi/ScottSAHPMRHSGGTBMBBBBCDHHHJJKKKK23,
author = {Ryan T. Scott and
Lauren M. Sanders and
Erik L. Antonsen and
Jaden J. A. Hastings and
Seung{-}Min Park and
Graham Mackintosh and
Robert J. Reynolds and
Adrienne L. Hoarfrost and
Aenor Sawyer and
Casey S. Greene and
Benjamin S. Glicksberg and
Corey A. Theriot and
Daniel C. Berrios and
Jack Miller and
Joel Babdor and
Richard Barker and
Sergio E. Baranzini and
Afshin Beheshti and
Stuart J. Chalk and
Guillermo M. Delgado{-}Aparicio and
Melissa A. Haendel and
Arif A. Hamid and
Philip Heller and
Daniel Jamieson and
Katelyn J. Jarvis and
John Kalantari and
Kia Khezeli and
Svetlana V. Komarova and
Matthieu Komorowski and
Prachi Kothiyal and
Ashish Mahabal and
Uri Manor and
H{\'{e}}ctor Garc{\'{\i}}a Mart{\'{\i}}n and
Christopher E. Mason and
Mona Matar and
George I. Mias and
Jerry G. Myers Jr. and
Charlotte A. Nelson and
Jonathan Oribello and
Patricia Parsons{-}Wingerter and
R. K. Prabhu and
Amina Ann Qutub and
Jon Rask and
Amanda Saravia{-}Butler and
Suchi Saria and
Nitin Kumar Singh and
Michael Snyder and
Frank Soboczenski and
Karthik Soman and
David Van Valen and
Kasthuri Venkateswaran and
Liz Warren and
Liz Worthey and
Jason H. Yang and
Marinka Zitnik and
Sylvain V. Costes},
title = {Biomonitoring and precision health in deep space supported by artificial
intelligence},
journal = {Nat. Mac. Intell.},
volume = {5},
number = {3},
pages = {196--207},
year = {2023},
url = {https://doi.org/10.1038/s42256-023-00617-5},
doi = {10.1038/S42256-023-00617-5},
timestamp = {Tue, 14 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/natmi/ScottSAHPMRHSGGTBMBBBBCDHHHJJKKKK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/MajumdarVS23,
author = {Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Uniform misclassification loss for unbiased model prediction},
journal = {Pattern Recognit.},
volume = {144},
pages = {109689},
year = {2023},
url = {https://doi.org/10.1016/j.patcog.2023.109689},
doi = {10.1016/J.PATCOG.2023.109689},
timestamp = {Sat, 14 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pr/MajumdarVS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/saem/SharmaSSS23,
author = {Richa Sharma and
Purushottam Sharma and
Anshuman Singh and
Veer Srivastava},
title = {An approach to optimize performance of controller in networked control
system},
journal = {Int. J. Syst. Assur. Eng. Manag.},
volume = {14},
number = {5},
pages = {1639--1646},
year = {2023},
url = {https://doi.org/10.1007/s13198-023-01967-4},
doi = {10.1007/S13198-023-01967-4},
timestamp = {Thu, 14 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/saem/SharmaSSS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/00420ZP23,
author = {Jie Wang and
Richard Chang and
Ziyuan Zhao and
Ramanpreet Singh Pahwa},
title = {Robust Detection, Segmentation, and Metrology of High Bandwidth Memory
3D Scans Using an Improved Semi-Supervised Deep Learning Approach},
journal = {Sensors},
volume = {23},
number = {12},
pages = {5470},
year = {2023},
url = {https://doi.org/10.3390/s23125470},
doi = {10.3390/S23125470},
timestamp = {Thu, 13 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/00420ZP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/SinghPKSBH23,
author = {Mehar Singh and
Prithvi Prakash and
Rachneet Kaur and
Richard B. Sowers and
James Robert Brasic and
Manuel Enrique Hernandez},
title = {A Deep Learning Approach for Automatic and Objective Grading of the
Motor Impairment Severity in Parkinson's Disease for Use in Tele-Assessments},
journal = {Sensors},
volume = {23},
number = {21},
pages = {9004},
year = {2023},
url = {https://doi.org/10.3390/s23219004},
doi = {10.3390/S23219004},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/SinghPKSBH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sncs/GoelSGNSK23,
author = {Navansh Goel and
Mohanapriya Singaravelu and
Shivani Gupta and
Sriram Namana and
Richa Singh and
Ranjeet Kumar},
title = {Parameterized Clustering Cleaning Approach for High-Dimensional Datasets
with Class Overlap and Imbalance},
journal = {{SN} Comput. Sci.},
volume = {4},
number = {5},
pages = {464},
year = {2023},
url = {https://doi.org/10.1007/s42979-023-01906-x},
doi = {10.1007/S42979-023-01906-X},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sncs/GoelSGNSK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sncs/GuptaSKJ23,
author = {Shivani Gupta and
Richa Singh and
Ranjeet Kumar and
Kusum Lata Jain},
title = {Combat with Class Overlapping in Software Defect Prediction Using
Neighbourhood Metric},
journal = {{SN} Comput. Sci.},
volume = {4},
number = {5},
pages = {695},
year = {2023},
url = {https://doi.org/10.1007/s42979-023-02082-8},
doi = {10.1007/S42979-023-02082-8},
timestamp = {Mon, 18 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sncs/GuptaSKJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tai/AgarwalSVR23,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {IBAttack: Being Cautious About Data Labels},
journal = {{IEEE} Trans. Artif. Intell.},
volume = {4},
number = {6},
pages = {1484--1493},
year = {2023},
url = {https://doi.org/10.1109/TAI.2022.3206259},
doi = {10.1109/TAI.2022.3206259},
timestamp = {Sun, 10 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tai/AgarwalSVR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tai/ChhabraMVS23,
author = {Saheb Chhabra and
Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Feature-Guided Perturbation for Facial Attribute Classification},
journal = {{IEEE} Trans. Artif. Intell.},
volume = {4},
number = {6},
pages = {1739--1751},
year = {2023},
url = {https://doi.org/10.1109/TAI.2022.3228830},
doi = {10.1109/TAI.2022.3228830},
timestamp = {Sun, 10 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tai/ChhabraMVS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbbis/JackPTVCPS23,
author = {Rachael E. Jack and
Vishal M. Patel and
Pavan K. Turaga and
Mayank Vatsa and
Rama Chellappa and
Alex Pentland and
Richa Singh},
title = {Best Paper Section {IEEE} International Conference on Automatic Face
and Gesture Recognition 2021},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {5},
number = {3},
pages = {305--307},
year = {2023},
url = {https://doi.org/10.1109/TBIOM.2023.3296348},
doi = {10.1109/TBIOM.2023.3296348},
timestamp = {Fri, 12 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbbis/JackPTVCPS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbbis/MehraAVS23,
author = {Aman Mehra and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {Motion Magnified 3-D Residual-in-Dense Network for DeepFake Detection},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {5},
number = {1},
pages = {39--52},
year = {2023},
url = {https://doi.org/10.1109/TBIOM.2022.3201887},
doi = {10.1109/TBIOM.2022.3201887},
timestamp = {Sun, 12 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbbis/MehraAVS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbbis/NagpalS0V23,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa},
title = {Detox Loss: Fairness Constraints for Learning With Imbalanced Data},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {5},
number = {2},
pages = {244--254},
year = {2023},
url = {https://doi.org/10.1109/TBIOM.2022.3222048},
doi = {10.1109/TBIOM.2022.3222048},
timestamp = {Fri, 02 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbbis/NagpalS0V23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcbb/BaileySSDK23,
author = {Richard Bailey and
Aisharjya Sarkar and
Aaditya Singh and
Alin Dobra and
Tamer Kahveci},
title = {Optimal Supervised Reduction of High Dimensional Transcription Data},
journal = {{IEEE} {ACM} Trans. Comput. Biol. Bioinform.},
volume = {20},
number = {5},
pages = {3093--3105},
year = {2023},
url = {https://doi.org/10.1109/TCBB.2023.3280557},
doi = {10.1109/TCBB.2023.3280557},
timestamp = {Fri, 27 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcbb/BaileySSDK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcbb/DhanukaST23,
author = {Richa Dhanuka and
Jyoti Prakash Singh and
Anushree Tripathi},
title = {A Comprehensive Survey of Deep Learning Techniques in Protein Function
Prediction},
journal = {{IEEE} {ACM} Trans. Comput. Biol. Bioinform.},
volume = {20},
number = {3},
pages = {2291--2301},
year = {2023},
url = {https://doi.org/10.1109/TCBB.2023.3247634},
doi = {10.1109/TCBB.2023.3247634},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcbb/DhanukaST23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tci/AliMSDBDD23,
author = {Rehman Ali and
Trevor M. Mitcham and
Melanie Singh and
Marvin M. Doyley and
Richard R. Bouchard and
Jeremy J. Dahl and
Nebojsa Duric},
title = {Sound Speed Estimation for Distributed Aberration Correction in Laterally
Varying Media},
journal = {{IEEE} Trans. Computational Imaging},
volume = {9},
pages = {367--382},
year = {2023},
url = {https://doi.org/10.1109/TCI.2023.3261507},
doi = {10.1109/TCI.2023.3261507},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tci/AliMSDBDD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmlr/MalhotraVS23,
author = {Aakarsh Malhotra and
Mayank Vatsa and
Richa Singh},
title = {Dropped Scheduled Task: Mitigating Negative Transfer in Multi-task
Learning using Dynamic Task Dropping},
journal = {Trans. Mach. Learn. Res.},
volume = {2023},
year = {2023},
url = {https://openreview.net/forum?id=myjAVQrRxS},
timestamp = {Thu, 18 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmlr/MalhotraVS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmlr/SrivastavaRRSAF23,
author = {Aarohi Srivastava and
Abhinav Rastogi and
Abhishek Rao and
Abu Awal Md Shoeb and
Abubakar Abid and
Adam Fisch and
Adam R. Brown and
Adam Santoro and
Aditya Gupta and
Adri{\`{a}} Garriga{-}Alonso and
Agnieszka Kluska and
Aitor Lewkowycz and
Akshat Agarwal and
Alethea Power and
Alex Ray and
Alex Warstadt and
Alexander W. Kocurek and
Ali Safaya and
Ali Tazarv and
Alice Xiang and
Alicia Parrish and
Allen Nie and
Aman Hussain and
Amanda Askell and
Amanda Dsouza and
Ambrose Slone and
Ameet Rahane and
Anantharaman S. Iyer and
Anders Andreassen and
Andrea Madotto and
Andrea Santilli and
Andreas Stuhlm{\"{u}}ller and
Andrew M. Dai and
Andrew La and
Andrew K. Lampinen and
Andy Zou and
Angela Jiang and
Angelica Chen and
Anh Vuong and
Animesh Gupta and
Anna Gottardi and
Antonio Norelli and
Anu Venkatesh and
Arash Gholamidavoodi and
Arfa Tabassum and
Arul Menezes and
Arun Kirubarajan and
Asher Mullokandov and
Ashish Sabharwal and
Austin Herrick and
Avia Efrat and
Aykut Erdem and
Ayla Karakas and
B. Ryan Roberts and
Bao Sheng Loe and
Barret Zoph and
Bartlomiej Bojanowski and
Batuhan {\"{O}}zyurt and
Behnam Hedayatnia and
Behnam Neyshabur and
Benjamin Inden and
Benno Stein and
Berk Ekmekci and
Bill Yuchen Lin and
Blake Howald and
Bryan Orinion and
Cameron Diao and
Cameron Dour and
Catherine Stinson and
Cedrick Argueta and
C{\`{e}}sar Ferri Ram{\'{\i}}rez and
Chandan Singh and
Charles Rathkopf and
Chenlin Meng and
Chitta Baral and
Chiyu Wu and
Chris Callison{-}Burch and
Chris Waites and
Christian Voigt and
Christopher D. Manning and
Christopher Potts and
Cindy Ramirez and
Clara E. Rivera and
Clemencia Siro and
Colin Raffel and
Courtney Ashcraft and
Cristina Garbacea and
Damien Sileo and
Dan Garrette and
Dan Hendrycks and
Dan Kilman and
Dan Roth and
Daniel Freeman and
Daniel Khashabi and
Daniel Levy and
Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and
Danielle Perszyk and
Danny Hernandez and
Danqi Chen and
Daphne Ippolito and
Dar Gilboa and
David Dohan and
David Drakard and
David Jurgens and
Debajyoti Datta and
Deep Ganguli and
Denis Emelin and
Denis Kleyko and
Deniz Yuret and
Derek Chen and
Derek Tam and
Dieuwke Hupkes and
Diganta Misra and
Dilyar Buzan and
Dimitri Coelho Mollo and
Diyi Yang and
Dong{-}Ho Lee and
Dylan Schrader and
Ekaterina Shutova and
Ekin Dogus Cubuk and
Elad Segal and
Eleanor Hagerman and
Elizabeth Barnes and
Elizabeth Donoway and
Ellie Pavlick and
Emanuele Rodol{\`{a}} and
Emma Lam and
Eric Chu and
Eric Tang and
Erkut Erdem and
Ernie Chang and
Ethan A. Chi and
Ethan Dyer and
Ethan J. Jerzak and
Ethan Kim and
Eunice Engefu Manyasi and
Evgenii Zheltonozhskii and
Fanyue Xia and
Fatemeh Siar and
Fernando Mart{\'{\i}}nez{-}Plumed and
Francesca Happ{\'{e}} and
Fran{\c{c}}ois Chollet and
Frieda Rong and
Gaurav Mishra and
Genta Indra Winata and
Gerard de Melo and
Germ{\'{a}}n Kruszewski and
Giambattista Parascandolo and
Giorgio Mariani and
Gloria Wang and
Gonzalo Jaimovitch{-}L{\'{o}}pez and
Gregor Betz and
Guy Gur{-}Ari and
Hana Galijasevic and
Hannah Kim and
Hannah Rashkin and
Hannaneh Hajishirzi and
Harsh Mehta and
Hayden Bogar and
Henry Shevlin and
Hinrich Sch{\"{u}}tze and
Hiromu Yakura and
Hongming Zhang and
Hugh Mee Wong and
Ian Ng and
Isaac Noble and
Jaap Jumelet and
Jack Geissinger and
Jackson Kernion and
Jacob Hilton and
Jaehoon Lee and
Jaime Fern{\'{a}}ndez Fisac and
James B. Simon and
James Koppel and
James Zheng and
James Zou and
Jan Kocon and
Jana Thompson and
Janelle Wingfield and
Jared Kaplan and
Jarema Radom and
Jascha Sohl{-}Dickstein and
Jason Phang and
Jason Wei and
Jason Yosinski and
Jekaterina Novikova and
Jelle Bosscher and
Jennifer Marsh and
Jeremy Kim and
Jeroen Taal and
Jesse H. Engel and
Jesujoba Alabi and
Jiacheng Xu and
Jiaming Song and
Jillian Tang and
Joan Waweru and
John Burden and
John Miller and
John U. Balis and
Jonathan Batchelder and
Jonathan Berant and
J{\"{o}}rg Frohberg and
Jos Rozen and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Joseph Boudeman and
Joseph Guerr and
Joseph Jones and
Joshua B. Tenenbaum and
Joshua S. Rule and
Joyce Chua and
Kamil Kanclerz and
Karen Livescu and
Karl Krauth and
Karthik Gopalakrishnan and
Katerina Ignatyeva and
Katja Markert and
Kaustubh D. Dhole and
Kevin Gimpel and
Kevin Omondi and
Kory Mathewson and
Kristen Chiafullo and
Ksenia Shkaruta and
Kumar Shridhar and
Kyle McDonell and
Kyle Richardson and
Laria Reynolds and
Leo Gao and
Li Zhang and
Liam Dugan and
Lianhui Qin and
Lidia Contreras Ochando and
Louis{-}Philippe Morency and
Luca Moschella and
Lucas Lam and
Lucy Noble and
Ludwig Schmidt and
Luheng He and
Luis Oliveros Col{\'{o}}n and
Luke Metz and
L{\"{u}}tfi Kerem Senel and
Maarten Bosma and
Maarten Sap and
Maartje ter Hoeve and
Maheen Farooqi and
Manaal Faruqui and
Mantas Mazeika and
Marco Baturan and
Marco Marelli and
Marco Maru and
Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and
Marie Tolkiehn and
Mario Giulianelli and
Martha Lewis and
Martin Potthast and
Matthew L. Leavitt and
Matthias Hagen and
M{\'{a}}ty{\'{a}}s Schubert and
Medina Baitemirova and
Melody Arnaud and
Melvin McElrath and
Michael A. Yee and
Michael Cohen and
Michael Gu and
Michael I. Ivanitskiy and
Michael Starritt and
Michael Strube and
Michal Swedrowski and
Michele Bevilacqua and
Michihiro Yasunaga and
Mihir Kale and
Mike Cain and
Mimee Xu and
Mirac Suzgun and
Mitch Walker and
Mo Tiwari and
Mohit Bansal and
Moin Aminnaseri and
Mor Geva and
Mozhdeh Gheini and
Mukund Varma T. and
Nanyun Peng and
Nathan A. Chi and
Nayeon Lee and
Neta Gur{-}Ari Krakover and
Nicholas Cameron and
Nicholas Roberts and
Nick Doiron and
Nicole Martinez and
Nikita Nangia and
Niklas Deckers and
Niklas Muennighoff and
Nitish Shirish Keskar and
Niveditha Iyer and
Noah Constant and
Noah Fiedel and
Nuan Wen and
Oliver Zhang and
Omar Agha and
Omar Elbaghdadi and
Omer Levy and
Owain Evans and
Pablo Antonio Moreno Casares and
Parth Doshi and
Pascale Fung and
Paul Pu Liang and
Paul Vicol and
Pegah Alipoormolabashi and
Peiyuan Liao and
Percy Liang and
Peter Chang and
Peter Eckersley and
Phu Mon Htut and
Pinyu Hwang and
Piotr Milkowski and
Piyush Patil and
Pouya Pezeshkpour and
Priti Oli and
Qiaozhu Mei and
Qing Lyu and
Qinlang Chen and
Rabin Banjade and
Rachel Etta Rudolph and
Raefer Gabriel and
Rahel Habacker and
Ramon Risco and
Rapha{\"{e}}l Milli{\`{e}}re and
Rhythm Garg and
Richard Barnes and
Rif A. Saurous and
Riku Arakawa and
Robbe Raymaekers and
Robert Frank and
Rohan Sikand and
Roman Novak and
Roman Sitelew and
Ronan LeBras and
Rosanne Liu and
Rowan Jacobs and
Rui Zhang and
Ruslan Salakhutdinov and
Ryan Chi and
Ryan Lee and
Ryan Stovall and
Ryan Teehan and
Rylan Yang and
Sahib Singh and
Saif M. Mohammad and
Sajant Anand and
Sam Dillavou and
Sam Shleifer and
Sam Wiseman and
Samuel Gruetter and
Samuel R. Bowman and
Samuel S. Schoenholz and
Sanghyun Han and
Sanjeev Kwatra and
Sarah A. Rous and
Sarik Ghazarian and
Sayan Ghosh and
Sean Casey and
Sebastian Bischoff and
Sebastian Gehrmann and
Sebastian Schuster and
Sepideh Sadeghi and
Shadi Hamdan and
Sharon Zhou and
Shashank Srivastava and
Sherry Shi and
Shikhar Singh and
Shima Asaadi and
Shixiang Shane Gu and
Shubh Pachchigar and
Shubham Toshniwal and
Shyam Upadhyay and
Shyamolima (Shammie) Debnath and
Siamak Shakeri and
Simon Thormeyer and
Simone Melzi and
Siva Reddy and
Sneha Priscilla Makini and
Soo{-}Hwan Lee and
Spencer Torene and
Sriharsha Hatwar and
Stanislas Dehaene and
Stefan Divic and
Stefano Ermon and
Stella Biderman and
Stephanie Lin and
Stephen Prasad and
Steven T. Piantadosi and
Stuart M. Shieber and
Summer Misherghi and
Svetlana Kiritchenko and
Swaroop Mishra and
Tal Linzen and
Tal Schuster and
Tao Li and
Tao Yu and
Tariq Ali and
Tatsu Hashimoto and
Te{-}Lin Wu and
Th{\'{e}}o Desbordes and
Theodore Rothschild and
Thomas Phan and
Tianle Wang and
Tiberius Nkinyili and
Timo Schick and
Timofei Kornev and
Titus Tunduny and
Tobias Gerstenberg and
Trenton Chang and
Trishala Neeraj and
Tushar Khot and
Tyler Shultz and
Uri Shaham and
Vedant Misra and
Vera Demberg and
Victoria Nyamai and
Vikas Raunak and
Vinay V. Ramasesh and
Vinay Uday Prabhu and
Vishakh Padmakumar and
Vivek Srikumar and
William Fedus and
William Saunders and
William Zhang and
Wout Vossen and
Xiang Ren and
Xiaoyu Tong and
Xinran Zhao and
Xinyi Wu and
Xudong Shen and
Yadollah Yaghoobzadeh and
Yair Lakretz and
Yangqiu Song and
Yasaman Bahri and
Yejin Choi and
Yichi Yang and
Yiding Hao and
Yifu Chen and
Yonatan Belinkov and
Yu Hou and
Yufang Hou and
Yuntao Bai and
Zachary Seid and
Zhuoye Zhao and
Zijian Wang and
Zijie J. Wang and
Zirui Wang and
Ziyi Wu},
title = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities
of language models},
journal = {Trans. Mach. Learn. Res.},
volume = {2023},
year = {2023},
url = {https://openreview.net/forum?id=uyTL5Bvosj},
timestamp = {Tue, 06 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmlr/SrivastavaRRSAF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wc/SoltaniQHYMSLACKSBCBASTPSEECPWHS23,
author = {Mohammad Dehghani Soltani and
Ahmad Adnan Qidan and
Shenjie Huang and
Barzan A. Yosuf and
Sanaa H. Mohamed and
Ravinder Singh and
Yi Liu and
Wajahat Ali and
Rui Chen and
Hossein Kazemi and
Elham Sarbazi and
Bela Berde and
Dominique Chiaroni and
Bastien B{\'{e}}chadergue and
Fathi Abdeldayem and
Hardik Soni and
Jose Tabu and
Micheline Perrufel and
Nikola Serafimovski and
Taisir E. H. El{-}Gorashi and
Jaafar M. H. Elmirghani and
Michael J. Crisp and
Richard V. Penty and
Ian H. White and
Harald Haas and
Majid Safari},
title = {Terabit Indoor Laser-Based Wireless Communications: Lifi 2.0 For 6G},
journal = {{IEEE} Wirel. Commun.},
volume = {30},
number = {5},
pages = {36--43},
year = {2023},
url = {https://doi.org/10.1109/MWC.007.2300121},
doi = {10.1109/MWC.007.2300121},
timestamp = {Wed, 06 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/wc/SoltaniQHYMSLACKSBCBASTPSEECPWHS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wpc/GangwarSMP23,
author = {Amisha Gangwar and
Sudhakar Singh and
Richa Mishra and
Shiv Prakash},
title = {The State-of-the-Art in Air Pollution Monitoring and Forecasting Systems
Using IoT, Big Data, and Machine Learning},
journal = {Wirel. Pers. Commun.},
volume = {130},
number = {3},
pages = {1699--1729},
year = {2023},
url = {https://doi.org/10.1007/s11277-023-10351-1},
doi = {10.1007/S11277-023-10351-1},
timestamp = {Thu, 03 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/wpc/GangwarSMP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wsarai/ChangJTP23,
author = {Richard Chang and
Wang Jie and
Namrata Thakur and
Ramanpreet Singh Pahwa},
title = {AI-based 3D Metrology and Defect Detection of HBMs in {XRM} Scans},
journal = {World Sci. Annu. Rev. Artif. Intell.},
volume = {1},
pages = {2440002:1--2440002:31},
year = {2023},
url = {https://doi.org/10.1142/S2811032324400022},
doi = {10.1142/S2811032324400022},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/wsarai/ChangJTP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/BhatiaSSB0V23,
author = {Harshil Bhatia and
Jaisidh Singh and
Gaurav Sangwan and
Aparna Bharati and
Richa Singh and
Mayank Vatsa},
editor = {Brian Williams and
Yiling Chen and
Jennifer Neville},
title = {IdProv: Identity-Based Provenance for Synthetic Image Generation (Student
Abstract)},
booktitle = {Thirty-Seventh {AAAI} Conference on Artificial Intelligence, {AAAI}
2023, Thirty-Fifth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2023, Thirteenth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2023, Washington, DC, USA, February
7-14, 2023},
pages = {16164--16165},
publisher = {{AAAI} Press},
year = {2023},
url = {https://doi.org/10.1609/aaai.v37i13.26942},
doi = {10.1609/AAAI.V37I13.26942},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/BhatiaSSB0V23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/FitzGeraldHPMRS23,
author = {Jack FitzGerald and
Christopher Hench and
Charith Peris and
Scott Mackie and
Kay Rottmann and
Ana Sanchez and
Aaron Nash and
Liam Urbach and
Vishesh Kakarala and
Richa Singh and
Swetha Ranganath and
Laurie Crist and
Misha Britan and
Wouter Leeuwis and
G{\"{o}}khan T{\"{u}}r and
Prem Natarajan},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {{MASSIVE:} {A} 1M-Example Multilingual Natural Language Understanding
Dataset with 51 Typologically-Diverse Languages},
booktitle = {Proceedings of the 61st Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2023, Toronto, Canada,
July 9-14, 2023},
pages = {4277--4302},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.acl-long.235},
doi = {10.18653/V1/2023.ACL-LONG.235},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/FitzGeraldHPMRS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aied/MooreTSLHLLCKDB23,
author = {Steven Moore and
Richard Jiarui Tong and
Anjali Singh and
Zitao Liu and
Xiangen Hu and
Yu Lu and
Joleen Liang and
Chen Cao and
Hassan Khosravi and
Paul Denny and
Christopher Brooks and
John C. Stamper},
editor = {Ning Wang and
Genaro Rebolledo{-}Mendez and
Vania Dimitrova and
Noboru Matsuda and
Olga C. Santos},
title = {Empowering Education with LLMs - The Next-Gen Interface and Content
Generation},
booktitle = {Artificial Intelligence in Education. Posters and Late Breaking Results,
Workshops and Tutorials, Industry and Innovation Tracks, Practitioners,
Doctoral Consortium and Blue Sky - 24th International Conference,
{AIED} 2023, Tokyo, Japan, July 3-7, 2023, Proceedings},
series = {Communications in Computer and Information Science},
volume = {1831},
pages = {32--37},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-36336-8\_4},
doi = {10.1007/978-3-031-36336-8\_4},
timestamp = {Mon, 23 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aied/MooreTSLHLLCKDB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/AgarwalRSV23,
author = {Akshay Agarwal and
Nalini K. Ratha and
Richa Singh and
Mayank Vatsa},
title = {Robustness Against Gradient based Attacks through Cost Effective Network
Fine-Tuning},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023 - Workshops, Vancouver, BC, Canada, June 17-24, 2023},
pages = {28--37},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPRW59228.2023.00008},
doi = {10.1109/CVPRW59228.2023.00008},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/AgarwalRSV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/NarayanATMV023,
author = {Kartik Narayan and
Harsh Agarwal and
Kartik Thakral and
Surbhi Mittal and
Mayank Vatsa and
Richa Singh},
title = {DF-Platter: Multi-Face Heterogeneous Deepfake Dataset},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023, Vancouver, BC, Canada, June 17-24, 2023},
pages = {9739--9748},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPR52729.2023.00939},
doi = {10.1109/CVPR52729.2023.00939},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/NarayanATMV023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fat/NorvalCS23,
author = {Chris Norval and
Richard Cloete and
Jatinder Singh},
title = {Navigating the Audit Landscape: {A} Framework for Developing Transparent
and Auditable {XR}},
booktitle = {Proceedings of the 2023 {ACM} Conference on Fairness, Accountability,
and Transparency, FAccT 2023, Chicago, IL, USA, June 12-15, 2023},
pages = {1418--1431},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3593013.3594090},
doi = {10.1145/3593013.3594090},
timestamp = {Thu, 15 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fat/NorvalCS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fgr/MittalTMVS23,
author = {Surbhi Mittal and
Kartik Thakral and
Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Are Face Detection Models Biased?},
booktitle = {17th {IEEE} International Conference on Automatic Face and Gesture
Recognition, {FG} 2023, Waikoloa Beach, HI, USA, January 5-8, 2023},
pages = {1--7},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/FG57933.2023.10042564},
doi = {10.1109/FG57933.2023.10042564},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fgr/MittalTMVS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fgr/ThakralMVS23,
author = {Kartik Thakral and
Surbhi Mittal and
Mayank Vatsa and
Richa Singh},
title = {PhygitalNet: Unified Face Presentation Attack Detection via One-Class
Isolation Learning},
booktitle = {17th {IEEE} International Conference on Automatic Face and Gesture
Recognition, {FG} 2023, Waikoloa Beach, HI, USA, January 5-8, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/FG57933.2023.10042797},
doi = {10.1109/FG57933.2023.10042797},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fgr/ThakralMVS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/AgarwalCSSVSARAM23,
author = {Shivang Agarwal and
Jyoti Chaudhary and
Hard Savani and
Shivam Sharma and
Mayank Vatsa and
Richa Singh and
Shyam Prasad Adhikari and
Sangeeth Reddy and
Kshitij Agrawal and
Hemant Misra},
title = {Leveraging Synthetic Data and Hard Pair Mining for Selfie vs {ID}
Face Verification},
booktitle = {{IEEE} International Joint Conference on Biometrics, {IJCB} 2023,
Ljubljana, Slovenia, September 25-28, 2023},
pages = {1--9},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IJCB57857.2023.10449207},
doi = {10.1109/IJCB57857.2023.10449207},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/AgarwalCSSVSARAM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/DosiCSV23,
author = {Muskan Dosi and
Chiranjeev Chiranjeev and
Richa Singh and
Mayank Vatsa},
title = {UG-LDFace: Unified and Generalized Framework for Long-Range Disguised
Face Recognition},
booktitle = {{IEEE} International Joint Conference on Biometrics, {IJCB} 2023,
Ljubljana, Slovenia, September 25-28, 2023},
pages = {1--9},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IJCB57857.2023.10449234},
doi = {10.1109/IJCB57857.2023.10449234},
timestamp = {Wed, 13 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icb/DosiCSV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/RanjanVS23,
author = {Rishabh Ranjan and
Mayank Vatsa and
Richa Singh},
title = {SV-DeiT: Speaker Verification with DeiTCap Spoofing Detection},
booktitle = {{IEEE} International Joint Conference on Biometrics, {IJCB} 2023,
Ljubljana, Slovenia, September 25-28, 2023},
pages = {1--10},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IJCB57857.2023.10449121},
doi = {10.1109/IJCB57857.2023.10449121},
timestamp = {Wed, 13 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icb/RanjanVS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/CarvalhoFLL023,
author = {Wilka Carvalho and
Angelos Filos and
Richard L. Lewis and
Honglak Lee and
Satinder Singh},
title = {Composing Task Knowledge With Modular Successor Feature Approximators},
booktitle = {The Eleventh International Conference on Learning Representations,
{ICLR} 2023, Kigali, Rwanda, May 1-5, 2023},
publisher = {OpenReview.net},
year = {2023},
url = {https://openreview.net/forum?id=DrtSx1z40Ib},
timestamp = {Wed, 24 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/CarvalhoFLL023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/GoswamiARSV23,
author = {Gaurav Goswami and
Akshay Agarwal and
Nalini K. Ratha and
Richa Singh and
Mayank Vatsa},
editor = {Krystal Maughan and
Rosanne Liu and
Thomas F. Burns},
title = {Federated Learning for Local and Global Data Distribution},
booktitle = {The First Tiny Papers Track at {ICLR} 2023, Tiny Papers @ {ICLR} 2023,
Kigali, Rwanda, May 5, 2023},
publisher = {OpenReview.net},
year = {2023},
url = {https://openreview.net/forum?id=qX8cGLnfAd},
timestamp = {Wed, 24 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/GoswamiARSV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/RuanSMAIFD23,
author = {Yangjun Ruan and
Saurabh Singh and
Warren Richard Morningstar and
Alexander A. Alemi and
Sergey Ioffe and
Ian Fischer and
Joshua V. Dillon},
title = {Weighted Ensemble Self-Supervised Learning},
booktitle = {The Eleventh International Conference on Learning Representations,
{ICLR} 2023, Kigali, Rwanda, May 1-5, 2023},
publisher = {OpenReview.net},
year = {2023},
url = {https://openreview.net/forum?id=CL-sVR9pvF},
timestamp = {Wed, 24 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/RuanSMAIFD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/ThakralMUGVS23,
author = {Kartik Thakral and
Surbhi Mittal and
Utkarsh Uppal and
Bharat Giddwani and
Mayank Vatsa and
Richa Singh},
editor = {Krystal Maughan and
Rosanne Liu and
Thomas F. Burns},
title = {Self-Supervised Continual Learning},
booktitle = {The First Tiny Papers Track at {ICLR} 2023, Tiny Papers @ {ICLR} 2023,
Kigali, Rwanda, May 5, 2023},
publisher = {OpenReview.net},
year = {2023},
url = {https://openreview.net/forum?id=udl9OobOxZu},
timestamp = {Wed, 24 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/ThakralMUGVS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/AkhterR0VC23,
author = {Yasmeena Akhter and
Rishabh Ranjan and
Richa Singh and
Mayank Vatsa and
Santanu Chaudhury},
title = {On AI-Assisted Pneumoconiosis Detection from Chest X-rays},
booktitle = {Proceedings of the Thirty-Second International Joint Conference on
Artificial Intelligence, {IJCAI} 2023, 19th-25th August 2023, Macao,
SAR, China},
pages = {6353--6361},
publisher = {ijcai.org},
year = {2023},
url = {https://doi.org/10.24963/ijcai.2023/705},
doi = {10.24963/IJCAI.2023/705},
timestamp = {Mon, 28 Aug 2023 17:23:07 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/AkhterR0VC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/KhanAV0S23,
author = {Misaal Khan and
Shivang Agarwal and
Mayank Vatsa and
Richa Singh and
Kuldeep Singh},
title = {NutriAI: AI-Powered Child Malnutrition Assessment in Low-Resource
Environments},
booktitle = {Proceedings of the Thirty-Second International Joint Conference on
Artificial Intelligence, {IJCAI} 2023, 19th-25th August 2023, Macao,
SAR, China},
pages = {6378--6385},
publisher = {ijcai.org},
year = {2023},
url = {https://doi.org/10.24963/ijcai.2023/708},
doi = {10.24963/IJCAI.2023/708},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/KhanAV0S23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/KshitizSMV0ASP23,
author = {Kshitiz and
Sonu Shreshtha and
Ramy Mounir and
Mayank Vatsa and
Richa Singh and
Saket Anand and
Sudeep Sarkar and
Sevaram Mali Parihar},
title = {Long-term Monitoring of Bird Flocks in the Wild},
booktitle = {Proceedings of the Thirty-Second International Joint Conference on
Artificial Intelligence, {IJCAI} 2023, 19th-25th August 2023, Macao,
SAR, China},
pages = {6344--6352},
publisher = {ijcai.org},
year = {2023},
url = {https://doi.org/10.24963/ijcai.2023/704},
doi = {10.24963/IJCAI.2023/704},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/KshitizSMV0ASP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/RanjanV023,
author = {Rishabh Ranjan and
Mayank Vatsa and
Richa Singh},
title = {Uncovering the Deceptions: An Analysis on Audio Spoofing Detection
and Future Prospects},
booktitle = {Proceedings of the Thirty-Second International Joint Conference on
Artificial Intelligence, {IJCAI} 2023, 19th-25th August 2023, Macao,
SAR, China},
pages = {6750--6758},
publisher = {ijcai.org},
year = {2023},
url = {https://doi.org/10.24963/ijcai.2023/756},
doi = {10.24963/IJCAI.2023/756},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/RanjanV023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interact/SoubuttsSKADSMSSFPHR23,
author = {Ewan Soubutts and
Aneesha Singh and
Bran Knowles and
Amid Ayobi and
Nervo Verdezeto Dias and
Britta F. Schulte and
Julia McDowell and
Caroline Swarbrick and
Andrew Steptoe and
Jasmine Fledderjohann and
Helen Petrie and
Richard Harper and
Yvonne Rogers},
editor = {Jos{\'{e}} L. Abdelnour{-}Nocera and
Marta Krist{\'{\i}}n L{\'{a}}rusd{\'{o}}ttir and
Helen Petrie and
Antonio Piccinno and
Marco Winckler},
title = {Playful, Curious, Creative, Equitable: Exploring Opportunities for
{AI} Technologies with Older Adults},
booktitle = {Human-Computer Interaction - {INTERACT} 2023 - 19th {IFIP} {TC13}
International Conference, York, UK, August 28 - September 1, 2023,
Proceedings, Part {IV}},
series = {Lecture Notes in Computer Science},
volume = {14145},
pages = {662--667},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-42293-5\_90},
doi = {10.1007/978-3-031-42293-5\_90},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/interact/SoubuttsSKADSMSSFPHR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwbf/MalhotraVS23,
author = {Aakarsh Malhotra and
Mayank Vatsa and
Richa Singh},
title = {{MMFV:} {A} Multi-Movement Finger-Video Database for Contactless Fingerprint
Recognition},
booktitle = {11th International Workshop on Biometrics and Forensics, {IWBF} 2023,
Barcelona, Spain, April 19-20, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IWBF57495.2023.10156919},
doi = {10.1109/IWBF57495.2023.10156919},
timestamp = {Wed, 05 Jul 2023 16:00:01 +0200},
biburl = {https://dblp.org/rec/conf/iwbf/MalhotraVS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/BrooksWL023,
author = {Ethan A. Brooks and
Logan Walls and
Richard L. Lewis and
Satinder Singh},
editor = {Alice Oh and
Tristan Naumann and
Amir Globerson and
Kate Saenko and
Moritz Hardt and
Sergey Levine},
title = {Large Language Models can Implement Policy Iteration},
booktitle = {Advances in Neural Information Processing Systems 36: Annual Conference
on Neural Information Processing Systems 2023, NeurIPS 2023, New Orleans,
LA, USA, December 10 - 16, 2023},
year = {2023},
url = {http://papers.nips.cc/paper\_files/paper/2023/hash/60dc7fa827f5f761ad481e2ad40b5573-Abstract-Conference.html},
timestamp = {Fri, 01 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/BrooksWL023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/Carvalho0FLMLL023,
author = {Wilka Carvalho and
Andre Saraiva and
Angelos Filos and
Andrew K. Lampinen and
Loic Matthey and
Richard L. Lewis and
Honglak Lee and
Satinder Singh and
Danilo Jimenez Rezende and
Daniel Zoran},
editor = {Alice Oh and
Tristan Naumann and
Amir Globerson and
Kate Saenko and
Moritz Hardt and
Sergey Levine},
title = {Combining Behaviors with the Successor Features Keyboard},
booktitle = {Advances in Neural Information Processing Systems 36: Annual Conference
on Neural Information Processing Systems 2023, NeurIPS 2023, New Orleans,
LA, USA, December 10 - 16, 2023},
year = {2023},
url = {http://papers.nips.cc/paper\_files/paper/2023/hash/1f69928210578f4cf5b538a8c8806798-Abstract-Conference.html},
timestamp = {Fri, 01 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/Carvalho0FLMLL023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/DesaiBMMSPLDLCB23,
author = {Aashaka Desai and
Lauren Berger and
Fyodor Minakov and
Nessa Milano and
Chinmay Singh and
Kriston Pumphrey and
Richard E. Ladner and
Hal Daum{\'{e}} III and
Alex X. Lu and
Naomi Caselli and
Danielle Bragg},
editor = {Alice Oh and
Tristan Naumann and
Amir Globerson and
Kate Saenko and
Moritz Hardt and
Sergey Levine},
title = {{ASL} Citizen: {A} Community-Sourced Dataset for Advancing Isolated
Sign Language Recognition},
booktitle = {Advances in Neural Information Processing Systems 36: Annual Conference
on Neural Information Processing Systems 2023, NeurIPS 2023, New Orleans,
LA, USA, December 10 - 16, 2023},
year = {2023},
url = {http://papers.nips.cc/paper\_files/paper/2023/hash/f29cf8f8b4996a4a453ef366cf496354-Abstract-Datasets\_and\_Benchmarks.html},
timestamp = {Fri, 01 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/DesaiBMMSPLDLCB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/secdev/MurphyMSC23,
author = {Sinnott Murphy and
Richard Macwan and
Vivek Kumar Singh and
Chin{-}Yao Chang},
title = {A randomization-based, zero-trust cyberattack detection method for
hierarchical systems},
booktitle = {{IEEE} Secure Development Conference, SecDev 2023, Atlanta, GA, USA,
October 18-20, 2023},
pages = {145--155},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/SecDev56634.2023.00029},
doi = {10.1109/SECDEV56634.2023.00029},
timestamp = {Tue, 21 Nov 2023 22:37:15 +0100},
biburl = {https://dblp.org/rec/conf/secdev/MurphyMSC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/EasonHCNBAL23,
author = {John P. Eason and
Xueqi He and
Richard Cziva and
Max Noormohammadpour and
Srivatsan Balasubramanian and
Satyajeet Singh Ahuja and
Biao Lu},
editor = {Henning Schulzrinne and
Vishal Misra and
Eddie Kohler and
David A. Maltz},
title = {Hose-based cross-layer backbone network design with Benders decomposition},
booktitle = {Proceedings of the {ACM} {SIGCOMM} 2023 Conference, {ACM} {SIGCOMM}
2023, New York, NY, USA, 10-14 September 2023},
pages = {333--345},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3603269.3604854},
doi = {10.1145/3603269.3604854},
timestamp = {Fri, 02 Aug 2024 15:50:42 +0200},
biburl = {https://dblp.org/rec/conf/sigcomm/EasonHCNBAL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/ParmarS0LLZ23,
author = {Gaurav Parmar and
Krishna Kumar Singh and
Richard Zhang and
Yijun Li and
Jingwan Lu and
Jun{-}Yan Zhu},
editor = {Erik Brunvand and
Alla Sheffer and
Michael Wimmer},
title = {Zero-shot Image-to-Image Translation},
booktitle = {{ACM} {SIGGRAPH} 2023 Conference Proceedings, {SIGGRAPH} 2023, Los
Angeles, CA, USA, August 6-10, 2023},
pages = {11:1--11:11},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3588432.3591513},
doi = {10.1145/3588432.3591513},
timestamp = {Sat, 05 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/siggraph/ParmarS0LLZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/AgarwalRNSV23,
author = {Akshay Agarwal and
Nalini K. Ratha and
Afzel Noore and
Richa Singh and
Mayank Vatsa},
title = {Misclassifications of Contact Lens Iris {PAD} Algorithms: Is it Gender
Bias or Environmental Conditions?},
booktitle = {{IEEE/CVF} Winter Conference on Applications of Computer Vision, {WACV}
2023, Waikoloa, HI, USA, January 2-7, 2023},
pages = {961--970},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/WACV56688.2023.00102},
doi = {10.1109/WACV56688.2023.00102},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wacv/AgarwalRNSV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/aied/2023llm,
editor = {Steven Moore and
John C. Stamper and
Richard Jiarui Tong and
Chen Cao and
Zitao Liu and
Xiangen Hu and
Yu Lu and
Joleen Liang and
Hassan Khosravi and
Paul Denny and
Anjali Singh and
Christopher Brooks},
title = {Proceedings of the Workshop on Empowering Education with LLMs - the
Next-Gen Interface and Content Generation 2023 co-located with 24th
International Conference on Artificial Intelligence in Education {(AIED}
2023), Tokyo, Japan, July 7, 2023},
series = {{CEUR} Workshop Proceedings},
volume = {3487},
publisher = {CEUR-WS.org},
year = {2023},
url = {https://ceur-ws.org/Vol-3487},
urn = {urn:nbn:de:0074-3487-1},
timestamp = {Mon, 23 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aied/2023llm.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2301-12305,
author = {Wilka Carvalho and
Angelos Filos and
Richard L. Lewis and
Honglak Lee and
Satinder Singh},
title = {Composing Task Knowledge with Modular Successor Feature Approximators},
journal = {CoRR},
volume = {abs/2301.12305},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2301.12305},
doi = {10.48550/ARXIV.2301.12305},
eprinttype = {arXiv},
eprint = {2301.12305},
timestamp = {Wed, 01 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2301-12305.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-03027,
author = {Gaurav Parmar and
Krishna Kumar Singh and
Richard Zhang and
Yijun Li and
Jingwan Lu and
Jun{-}Yan Zhu},
title = {Zero-shot Image-to-Image Translation},
journal = {CoRR},
volume = {abs/2302.03027},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.03027},
doi = {10.48550/ARXIV.2302.03027},
eprinttype = {arXiv},
eprint = {2302.03027},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-03027.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-05934,
author = {Aashaka Desai and
Lauren Berger and
Fyodor O. Minakov and
Vanessa Milan and
Chinmay Singh and
Kriston Pumphrey and
Richard E. Ladner and
Hal Daum{\'{e}} III and
Alex X. Lu and
Naomi Caselli and
Danielle Bragg},
title = {{ASL} Citizen: {A} Community-Sourced Dataset for Advancing Isolated
Sign Language Recognition},
journal = {CoRR},
volume = {abs/2304.05934},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.05934},
doi = {10.48550/ARXIV.2304.05934},
eprinttype = {arXiv},
eprint = {2304.05934},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-05934.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-09574,
author = {Amisha Gangwar and
Sudhakar Singh and
Richa Mishra and
Shiv Prakash},
title = {The State-of-the-Art in Air Pollution Monitoring and Forecasting Systems
using IoT, Big Data, and Machine Learning},
journal = {CoRR},
volume = {abs/2304.09574},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.09574},
doi = {10.48550/ARXIV.2304.09574},
eprinttype = {arXiv},
eprint = {2304.09574},
timestamp = {Thu, 03 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-09574.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-09863,
author = {Chandan Singh and
Aliyah R. Hsu and
Richard Antonello and
Shailee Jain and
Alexander G. Huth and
Bin Yu and
Jianfeng Gao},
title = {Explaining black box text modules in natural language with language
models},
journal = {CoRR},
volume = {abs/2305.09863},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.09863},
doi = {10.48550/ARXIV.2305.09863},
eprinttype = {arXiv},
eprint = {2305.09863},
timestamp = {Thu, 11 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-09863.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-11896,
author = {Ayush Singh Rajput and
Richa Gupta},
title = {Hyper-automation-The next peripheral for automation in {IT} industries},
journal = {CoRR},
volume = {abs/2305.11896},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.11896},
doi = {10.48550/ARXIV.2305.11896},
eprinttype = {arXiv},
eprint = {2305.11896},
timestamp = {Thu, 25 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-11896.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-13672,
author = {Elahe Vedadi and
Joshua V. Dillon and
Philip Andrew Mansfield and
Karan Singhal and
Arash Afkanpour and
Warren Richard Morningstar},
title = {Federated Variational Inference: Towards Improved Personalization
and Generalization},
journal = {CoRR},
volume = {abs/2305.13672},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.13672},
doi = {10.48550/ARXIV.2305.13672},
eprinttype = {arXiv},
eprint = {2305.13672},
timestamp = {Mon, 05 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-13672.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-02881,
author = {Peter H. Tu and
Zhaoyuan Yang and
Richard I. Hartley and
Zhiwei Xu and
Jing Zhang and
Dylan Campbell and
Jaskirat Singh and
Tianyu Wang},
title = {Probabilistic and Semantic Descriptions of Image Manifolds and Their
Applications},
journal = {CoRR},
volume = {abs/2307.02881},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.02881},
doi = {10.48550/ARXIV.2307.02881},
eprinttype = {arXiv},
eprint = {2307.02881},
timestamp = {Wed, 14 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-02881.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-06669,
author = {Rishabh Ranjan and
Mayank Vatsa and
Richa Singh},
title = {Uncovering the Deceptions: An Analysis on Audio Spoofing Detection
and Future Prospects},
journal = {CoRR},
volume = {abs/2307.06669},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.06669},
doi = {10.48550/ARXIV.2307.06669},
eprinttype = {arXiv},
eprint = {2307.06669},
timestamp = {Mon, 24 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-06669.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-05213,
author = {Pengfei Guo and
Warren Richard Morningstar and
Raviteja Vemulapalli and
Karan Singhal and
Vishal M. Patel and
Philip Andrew Mansfield},
title = {Towards Federated Learning Under Resource Constraints via Layer-wise
Training and Depth Dropout},
journal = {CoRR},
volume = {abs/2309.05213},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2309.05213},
doi = {10.48550/ARXIV.2309.05213},
eprinttype = {arXiv},
eprint = {2309.05213},
timestamp = {Fri, 12 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2309-05213.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-13542,
author = {Aryan Kaushik and
Rohit Singh and
Ming Li and
Honghao Luo and
Shalanika Dayarathna and
Rajitha Senanayake and
Xueli An and
Richard A. Stirling{-}Gallacher and
Wonjae Shin and
Marco Di Renzo},
title = {Integrated Sensing and Communications for IoT: Synergies with Key
6G Technology Enablers},
journal = {CoRR},
volume = {abs/2309.13542},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2309.13542},
doi = {10.48550/ARXIV.2309.13542},
eprinttype = {arXiv},
eprint = {2309.13542},
timestamp = {Wed, 22 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2309-13542.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-07209,
author = {Mahapara Khurshid and
Mayank Vatsa and
Richa Singh},
title = {Multi-task Explainable Skin Lesion Classification},
journal = {CoRR},
volume = {abs/2310.07209},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.07209},
doi = {10.48550/ARXIV.2310.07209},
eprinttype = {arXiv},
eprint = {2310.07209},
timestamp = {Tue, 24 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-07209.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-15848,
author = {Surbhi Mittal and
Kartik Thakral and
Richa Singh and
Mayank Vatsa and
Tamar Glaser and
Cristian Canton{-}Ferrer and
Tal Hassner},
title = {On Responsible Machine Learning Datasets with Fairness, Privacy, and
Regulatory Norms},
journal = {CoRR},
volume = {abs/2310.15848},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.15848},
doi = {10.48550/ARXIV.2310.15848},
eprinttype = {arXiv},
eprint = {2310.15848},
timestamp = {Tue, 31 Oct 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-15848.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-15940,
author = {Wilka Carvalho and
Andre Saraiva and
Angelos Filos and
Andrew Kyle Lampinen and
Loic Matthey and
Richard L. Lewis and
Honglak Lee and
Satinder Singh and
Danilo J. Rezende and
Daniel Zoran},
title = {Combining Behaviors with the Successor Features Keyboard},
journal = {CoRR},
volume = {abs/2310.15940},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.15940},
doi = {10.48550/ARXIV.2310.15940},
eprinttype = {arXiv},
eprint = {2310.15940},
timestamp = {Tue, 31 Oct 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-15940.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-20081,
author = {Christopher Richardson and
Yao Zhang and
Kellen Gillespie and
Sudipta Kar and
Arshdeep Singh and
Zeynab Raeesy and
Omar Zia Khan and
Abhinav Sethy},
title = {Integrating Summarization and Retrieval for Enhanced Personalization
via Large Language Models},
journal = {CoRR},
volume = {abs/2310.20081},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.20081},
doi = {10.48550/ARXIV.2310.20081},
eprinttype = {arXiv},
eprint = {2310.20081},
timestamp = {Fri, 03 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-20081.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-03425,
author = {Faris F. Gulamali and
Ashwin S. Sawant and
Lora Liharska and
Carol R. Horowitz and
Lili Chan and
Patricia H. Kovatch and
Ira Hofer and
Karandeep Singh and
Lynne D. Richardson and
Emmanuel Mensah and
Alexander W. Charney and
David L. Reich and
Jianying Hu and
Girish N. Nadkarni},
title = {An AI-Guided Data Centric Strategy to Detect and Mitigate Biases in
Healthcare Datasets},
journal = {CoRR},
volume = {abs/2311.03425},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.03425},
doi = {10.48550/ARXIV.2311.03425},
eprinttype = {arXiv},
eprint = {2311.03425},
timestamp = {Tue, 14 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-03425.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-03629,
author = {Philip Andrew Mansfield and
Arash Afkanpour and
Warren Richard Morningstar and
Karan Singhal},
title = {Random Field Augmentations for Self-Supervised Representation Learning},
journal = {CoRR},
volume = {abs/2311.03629},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.03629},
doi = {10.48550/ARXIV.2311.03629},
eprinttype = {arXiv},
eprint = {2311.03629},
timestamp = {Tue, 14 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-03629.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-06792,
author = {Zhaoyuan Yang and
Zhengyang Yu and
Zhiwei Xu and
Jaskirat Singh and
Jing Zhang and
Dylan Campbell and
Peter H. Tu and
Richard I. Hartley},
title = {{IMPUS:} Image Morphing with Perceptually-Uniform Sampling Using Diffusion
Models},
journal = {CoRR},
volume = {abs/2311.06792},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.06792},
doi = {10.48550/ARXIV.2311.06792},
eprinttype = {arXiv},
eprint = {2311.06792},
timestamp = {Wed, 14 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-06792.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-01187,
author = {Renan A. Rojas{-}Gomez and
Karan Singhal and
Ali Etemad and
Alex Bijamov and
Warren R. Morningstar and
Philip Andrew Mansfield},
title = {{SASSL:} Enhancing Self-Supervised Learning via Neural Style Transfer},
journal = {CoRR},
volume = {abs/2312.01187},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.01187},
doi = {10.48550/ARXIV.2312.01187},
eprinttype = {arXiv},
eprint = {2312.01187},
timestamp = {Fri, 08 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-01187.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-02205,
author = {Neha Mukund Kalibhat and
Warren R. Morningstar and
Alex Bijamov and
Luyang Liu and
Karan Singhal and
Philip Andrew Mansfield},
title = {Disentangling the Effects of Data Augmentation and Format Transform
in Self-Supervised Learning of Image Representations},
journal = {CoRR},
volume = {abs/2312.02205},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.02205},
doi = {10.48550/ARXIV.2312.02205},
eprinttype = {arXiv},
eprint = {2312.02205},
timestamp = {Tue, 16 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-02205.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-04231,
author = {Mayank Vatsa and
Anubhooti Jain and
Richa Singh},
title = {Adventures of Trustworthy Vision-Language Models: {A} Survey},
journal = {CoRR},
volume = {abs/2312.04231},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.04231},
doi = {10.48550/ARXIV.2312.04231},
eprinttype = {arXiv},
eprint = {2312.04231},
timestamp = {Mon, 01 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-04231.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-05461,
author = {Ryan J. Urbanowicz and
Harsh Bandhey and
Brendan T. Keenan and
Greg Maislin and
Sy Hwang and
Danielle L. Mowery and
Shannon M. Lynch and
Diego R. Mazzotti and
Fang Han and
Qing Yun Li and
Thomas Penzel and
Sergio Tufik and
Lia Bittencourt and
Thorarinn Gislason and
Philip de Chazal and
Bhajan Singh and
Nigel McArdle and
Ning{-}Hung Chen and
Allan Pack and
Richard J. Schwab and
Peter A. Cistulli and
Ulysses J. Magalang},
title = {{STREAMLINE:} An Automated Machine Learning Pipeline for Biomedicine
Applied to Examine the Utility of Photography-Based Phenotypes for
{OSA} Prediction Across International Sleep Centers},
journal = {CoRR},
volume = {abs/2312.05461},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.05461},
doi = {10.48550/ARXIV.2312.05461},
eprinttype = {arXiv},
eprint = {2312.05461},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-05461.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aamas/VamplewSKRRRHHM22,
author = {Peter Vamplew and
Benjamin J. Smith and
Johan K{\"{a}}llstr{\"{o}}m and
Gabriel de Oliveira Ramos and
Roxana Radulescu and
Diederik M. Roijers and
Conor F. Hayes and
Fredrik Heintz and
Patrick Mannion and
Pieter J. K. Libin and
Richard Dazeley and
Cameron Foale},
title = {Scalar reward is not enough: a response to Silver, Singh, Precup and
Sutton {(2021)}},
journal = {Auton. Agents Multi Agent Syst.},
volume = {36},
number = {2},
pages = {41},
year = {2022},
url = {https://doi.org/10.1007/s10458-022-09575-5},
doi = {10.1007/S10458-022-09575-5},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aamas/VamplewSKRRRHHM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SinghIV22,
author = {Avinash Singh and
Richard Adeyemi Ikuesan and
Hein S. Venter},
title = {Secure Storage Model for Digital Forensic Readiness},
journal = {{IEEE} Access},
volume = {10},
pages = {19469--19480},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3151403},
doi = {10.1109/ACCESS.2022.3151403},
timestamp = {Tue, 15 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/SinghIV22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/candc/SinghMKSYRKSS22,
author = {Vishal Kumar Singh and
Richa Mishra and
Priyanka Kumari and
Anup Som and
Aditya K. Yadav and
Nand K. Ram and
Pradeep Kumar and
Dominique Schols and
Ramendra K. Singh},
title = {\emph{In silico} design, synthesis and anti-HIV activity of quinoline
derivatives as non-nucleoside reverse transcriptase inhibitors (NNRTIs)},
journal = {Comput. Biol. Chem.},
volume = {98},
pages = {107675},
year = {2022},
url = {https://doi.org/10.1016/j.compbiolchem.2022.107675},
doi = {10.1016/J.COMPBIOLCHEM.2022.107675},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/candc/SinghMKSYRKSS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cviu/TripathiAKLKVS22,
author = {Pavani Tripathi and
Yasmeena Akhter and
Mahapara Khurshid and
Aditya Lakra and
Rohit Keshari and
Mayank Vatsa and
Richa Singh},
title = {{MTCD:} Cataract detection via near infrared eye images},
journal = {Comput. Vis. Image Underst.},
volume = {214},
pages = {103303},
year = {2022},
url = {https://doi.org/10.1016/j.cviu.2021.103303},
doi = {10.1016/J.CVIU.2021.103303},
timestamp = {Fri, 21 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cviu/TripathiAKLKVS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/electronicmarkets/MisraMSKR22,
author = {Richa Misra and
Renuka Mahajan and
Nidhi Singh and
Sangeeta Khorana and
Nripendra P. Rana},
title = {Factors impacting behavioural intentions to adopt the electronic marketplace:
findings from small businesses in India},
journal = {Electron. Mark.},
volume = {32},
number = {3},
pages = {1639--1660},
year = {2022},
url = {https://doi.org/10.1007/s12525-022-00578-4},
doi = {10.1007/S12525-022-00578-4},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/electronicmarkets/MisraMSKR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/epjds/BuskirkBEMSY22,
author = {Trent Buskirk and
Brian P. Blakely and
Adam Eck and
Richard McGrath and
Ravinder Singh and
Youzhi Yu},
title = {Sweet tweets! Evaluating a new approach for probability-based sampling
of Twitter},
journal = {{EPJ} Data Sci.},
volume = {11},
number = {1},
pages = {9},
year = {2022},
url = {https://doi.org/10.1140/epjds/s13688-022-00321-1},
doi = {10.1140/EPJDS/S13688-022-00321-1},
timestamp = {Wed, 27 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/epjds/BuskirkBEMSY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fdata/AgarwalSVN22,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Boosting Face Presentation Attack Detection in Multi-Spectral Videos
Through Score Fusion of Wavelet Partition Images},
journal = {Frontiers Big Data},
volume = {5},
year = {2022},
url = {https://doi.org/10.3389/fdata.2022.836749},
doi = {10.3389/FDATA.2022.836749},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fdata/AgarwalSVN22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fdata/MilneSBKLNSMH22,
author = {Richard Milne and
Mark Sheehan and
Brendan Barnes and
Janek Kapper and
Nathan Lea and
James N'Dow and
Gurparkash Singh and
Amelia Mart{\'{\i}}n{-}Uranga and
Nigel Hughes},
title = {A concentric circles view of health data relations facilitates understanding
of sociotechnical challenges for learning health systems and the role
of federated data networks},
journal = {Frontiers Big Data},
volume = {5},
year = {2022},
url = {https://doi.org/10.3389/fdata.2022.945739},
doi = {10.3389/FDATA.2022.945739},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fdata/MilneSBKLNSMH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fdgth/PaulRTKJSIM0BHM22,
author = {Tanmoy Paul and
Md Kamruz Zaman Rana and
Preethi Aishwarya Tautam and
Teja Venkat Pavan Kotapati and
Yaswitha Jampani and
Nitesh Singh and
Humayera Islam and
Vasanthi Mandhadi and
Vishakha Sharma and
Michael Barnes and
Richard D. Hammer and
Abu Saleh Mohammad Mosa},
title = {Investigation of the Utility of Features in a Clinical De-identification
Model: {A} Demonstration Using {EHR} Pathology Reports for Advanced
{NSCLC} Patients},
journal = {Frontiers Digit. Health},
volume = {4},
pages = {728922},
year = {2022},
url = {https://doi.org/10.3389/fdgth.2022.728922},
doi = {10.3389/FDGTH.2022.728922},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fdgth/PaulRTKJSIM0BHM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijaip/SharmaVS22,
author = {Richa Sharma and
Vasudha Vashisht and
Umang Singh},
title = {eeFFA/DE - a fuzzy-based clustering algorithm using hybrid technique
for wireless sensor networks},
journal = {Int. J. Adv. Intell. Paradigms},
volume = {21},
number = {1/2},
pages = {129--157},
year = {2022},
url = {https://doi.org/10.1504/IJAIP.2022.121034},
doi = {10.1504/IJAIP.2022.121034},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijaip/SharmaVS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijesma/MisraMS22,
author = {Richa Misra and
Renuka Mahajan and
Nidhi Singh},
title = {Analysis of Factors Affecting Intent to Use Mobile Commerce Services
in India},
journal = {Int. J. {E} Serv. Mob. Appl.},
volume = {14},
number = {1},
pages = {1--21},
year = {2022},
url = {https://doi.org/10.4018/ijesma.300268},
doi = {10.4018/IJESMA.300268},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijesma/MisraMS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijiit/SinghDK22,
author = {Richa Singh and
Ashwani Kumar Dubey and
Rajiv Kapoor},
title = {Deep Neural Network Regularization {(DNNR)} on Denoised Image},
journal = {Int. J. Intell. Inf. Technol.},
volume = {18},
number = {1},
pages = {1--16},
year = {2022},
url = {https://doi.org/10.4018/ijiit.309584},
doi = {10.4018/IJIIT.309584},
timestamp = {Fri, 08 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijiit/SinghDK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijissc/RastogiCRCAAS22,
author = {Rohit Rastogi and
Devendra K. Chaturvedi and
Mukund K. Rastogi and
Saransh Chauhan and
Vaibhav Aggarwal and
Utkarsh Agrawal and
Richa Singh},
title = {Examining Vedic Yajna's Effects on the {AQI} of India in the Second
Wave of the {COVID-19} Pandemic: An Healthcare 4.0 Concept for Smart
Cities 5.0},
journal = {Int. J. Inf. Syst. Soc. Chang.},
volume = {13},
number = {1},
pages = {1--20},
year = {2022},
url = {https://doi.org/10.4018/ijissc.303605},
doi = {10.4018/IJISSC.303605},
timestamp = {Thu, 25 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijissc/RastogiCRCAAS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijoe/RichaKS22,
author = {Richa and
Karamjit Kaur and
Priti Singh},
title = {A Novel {MRI} And {CT} Image Fusion Based on Discrete Wavelet Transform
and Principal Component Analysis for Enhanced Clinical Diagnosis},
journal = {Int. J. Online Biomed. Eng.},
volume = {18},
number = {10},
pages = {64--82},
year = {2022},
url = {https://doi.org/10.3991/ijoe.v18i10.31969},
doi = {10.3991/IJOE.V18I10.31969},
timestamp = {Tue, 09 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijoe/RichaKS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijpe/SharmaS22,
author = {Richa Sharma and
Shailendra Narayan Singh},
title = {Towards Accurate Heart Disease Prediction System: An Enhanced Machine
Learning Approach},
journal = {Int. J. Perform. Eng.},
volume = {18},
number = {2},
pages = {136},
year = {2022},
url = {https://doi.org/10.23940/ijpe.22.02.p8.136148},
doi = {10.23940/IJPE.22.02.P8.136148},
timestamp = {Fri, 01 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijpe/SharmaS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijwbc/MisraMS22,
author = {Richa Misra and
Renuka Mahajan and
Nidhi Singh},
title = {Demystifying social media usage for insurance-related purchase intentions
among senior users in the pandemic period},
journal = {Int. J. Web Based Communities},
volume = {18},
number = {1},
pages = {64--86},
year = {2022},
url = {https://doi.org/10.1504/IJWBC.2022.122396},
doi = {10.1504/IJWBC.2022.122396},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijwbc/MisraMS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jksucis/SharmaVS22,
author = {Richa Sharma and
Vasudha Vashisht and
Umang Singh},
title = {Fuzzy modelling based energy aware clustering in wireless sensor networks
using modified invasive weed optimization},
journal = {J. King Saud Univ. Comput. Inf. Sci.},
volume = {34},
number = {5},
pages = {1884--1894},
year = {2022},
url = {https://doi.org/10.1016/j.jksuci.2019.11.014},
doi = {10.1016/J.JKSUCI.2019.11.014},
timestamp = {Tue, 12 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jksucis/SharmaVS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lgrs/SinghCNCY22,
author = {Anirudh Singh and
Amit Chougule and
Pratik Narang and
Vinay Chamola and
F. Richard Yu},
title = {Low-Light Image Enhancement for UAVs With Multi-Feature Fusion Deep
Neural Networks},
journal = {{IEEE} Geosci. Remote. Sens. Lett.},
volume = {19},
pages = {1--5},
year = {2022},
url = {https://doi.org/10.1109/LGRS.2022.3181106},
doi = {10.1109/LGRS.2022.3181106},
timestamp = {Thu, 22 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/lgrs/SinghCNCY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mia/LuCKLSWCM22,
author = {Ming Y. Lu and
Richard J. Chen and
Dehan Kong and
Jana Lipkov{\'{a}} and
Rajendra Singh and
Drew F. K. Williamson and
Tiffany Y. Chen and
Faisal Mahmood},
title = {Federated learning for computational pathology on gigapixel whole
slide images},
journal = {Medical Image Anal.},
volume = {76},
pages = {102298},
year = {2022},
url = {https://doi.org/10.1016/j.media.2021.102298},
doi = {10.1016/J.MEDIA.2021.102298},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mia/LuCKLSWCM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/SinghNSV22,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {DeriveNet for (Very) Low Resolution Image Classification},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {44},
number = {10},
pages = {6569--6577},
year = {2022},
url = {https://doi.org/10.1109/TPAMI.2021.3088756},
doi = {10.1109/TPAMI.2021.3088756},
timestamp = {Thu, 22 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pami/SinghNSV22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/JiangSWHP22,
author = {Richard M. Jiang and
Prashant Singh and
Fredrik Wrede and
Andreas Hellander and
Linda R. Petzold},
title = {Identification of dynamic mass-action biochemical reaction networks
using sparse Bayesian methods},
journal = {PLoS Comput. Biol.},
volume = {18},
number = {1},
year = {2022},
url = {https://doi.org/10.1371/journal.pcbi.1009830},
doi = {10.1371/JOURNAL.PCBI.1009830},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/JiangSWHP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/MalhotraMMCTVSC22,
author = {Aakarsh Malhotra and
Surbhi Mittal and
Puspita Majumdar and
Saheb Chhabra and
Kartik Thakral and
Mayank Vatsa and
Richa Singh and
Santanu Chaudhury and
Ashwin Pudrod and
Anjali Agrawal},
title = {Multi-task driven explainable diagnosis of {COVID-19} using chest
X-ray images},
journal = {Pattern Recognit.},
volume = {122},
pages = {108243},
year = {2022},
url = {https://doi.org/10.1016/j.patcog.2021.108243},
doi = {10.1016/J.PATCOG.2021.108243},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pr/MalhotraMMCTVSC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/AgarwalNVS22,
author = {Akshay Agarwal and
Afzel Noore and
Mayank Vatsa and
Richa Singh},
title = {Enhanced iris presentation attack detection via contraction-expansion
{CNN}},
journal = {Pattern Recognit. Lett.},
volume = {159},
pages = {61--69},
year = {2022},
url = {https://doi.org/10.1016/j.patrec.2022.04.007},
doi = {10.1016/J.PATREC.2022.04.007},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/prl/AgarwalNVS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/saem/SinghDK22,
author = {Richa Singh and
Ashwani Kumar Dubey and
Rajiv Kapoor},
title = {Image dehazing using autoencoder convolutional neural network},
journal = {Int. J. Syst. Assur. Eng. Manag.},
volume = {13},
number = {6},
pages = {3002--3016},
year = {2022},
url = {https://doi.org/10.1007/s13198-022-01780-5},
doi = {10.1007/S13198-022-01780-5},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/saem/SinghDK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbbis/AgarwalNVS22,
author = {Akshay Agarwal and
Afzel Noore and
Mayank Vatsa and
Richa Singh},
title = {Generalized Contact Lens Iris Presentation Attack Detection},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {4},
number = {3},
pages = {373--385},
year = {2022},
url = {https://doi.org/10.1109/TBIOM.2022.3177669},
doi = {10.1109/TBIOM.2022.3177669},
timestamp = {Mon, 08 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbbis/AgarwalNVS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbbis/GhoshVS22,
author = {Soumyadeep Ghosh and
Mayank Vatsa and
Richa Singh},
title = {{SUPREAR-NET:} Supervised Resolution Enhancement and Recognition Network},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {4},
number = {2},
pages = {185--196},
year = {2022},
url = {https://doi.org/10.1109/TBIOM.2022.3168584},
doi = {10.1109/TBIOM.2022.3168584},
timestamp = {Tue, 28 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbbis/GhoshVS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/SinghNSV22,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {Disguise Resilient Face Verification},
journal = {{IEEE} Trans. Circuits Syst. Video Technol.},
volume = {32},
number = {6},
pages = {3895--3905},
year = {2022},
url = {https://doi.org/10.1109/TCSVT.2021.3120772},
doi = {10.1109/TCSVT.2021.3120772},
timestamp = {Mon, 13 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcsv/SinghNSV22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/AgarwalRVS22,
author = {Akshay Agarwal and
Nalini K. Ratha and
Mayank Vatsa and
Richa Singh},
title = {Crafting Adversarial Perturbations via Transformed Image Component
Swapping},
journal = {{IEEE} Trans. Image Process.},
volume = {31},
pages = {7338--7349},
year = {2022},
url = {https://doi.org/10.1109/TIP.2022.3204206},
doi = {10.1109/TIP.2022.3204206},
timestamp = {Sun, 25 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tip/AgarwalRVS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/DhanukaTS22,
author = {Richa Dhanuka and
Anushree Tripathi and
Jyoti Prakash Singh},
title = {A Semi-Supervised Autoencoder-Based Approach for Protein Function
Prediction},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {26},
number = {10},
pages = {4957--4965},
year = {2022},
url = {https://doi.org/10.1109/JBHI.2022.3163150},
doi = {10.1109/JBHI.2022.3163150},
timestamp = {Tue, 18 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/titb/DhanukaTS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/AgarwalGVSR22,
author = {Akshay Agarwal and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {{DAMAD:} Database, Attack, and Model Agnostic Adversarial Perturbation
Detector},
journal = {{IEEE} Trans. Neural Networks Learn. Syst.},
volume = {33},
number = {8},
pages = {3277--3289},
year = {2022},
url = {https://doi.org/10.1109/TNNLS.2021.3051529},
doi = {10.1109/TNNLS.2021.3051529},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tnn/AgarwalGVSR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvt/SmithSDCG22,
author = {Peter J. Smith and
Ikram Singh and
Pawel A. Dmochowski and
Justin P. Coon and
Richard D. Green},
title = {Flexible Mobility Models Using Stochastic Differential Equations},
journal = {{IEEE} Trans. Veh. Technol.},
volume = {71},
number = {4},
pages = {4312--4321},
year = {2022},
url = {https://doi.org/10.1109/TVT.2022.3146407},
doi = {10.1109/TVT.2022.3146407},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvt/SmithSDCG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/0001MMV22,
author = {Richa Singh and
Puspita Majumdar and
Surbhi Mittal and
Mayank Vatsa},
title = {Anatomizing Bias in Facial Analysis},
booktitle = {Thirty-Sixth {AAAI} Conference on Artificial Intelligence, {AAAI}
2022, Thirty-Fourth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2022, The Twelveth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2022 Virtual Event, February 22
- March 1, 2022},
pages = {12351--12358},
publisher = {{AAAI} Press},
year = {2022},
url = {https://doi.org/10.1609/aaai.v36i11.21500},
doi = {10.1609/AAAI.V36I11.21500},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/0001MMV22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/AryaBCDHHHLLMMP22,
author = {Vijay Arya and
Rachel K. E. Bellamy and
Pin{-}Yu Chen and
Amit Dhurandhar and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Q. Vera Liao and
Ronny Luss and
Aleksandra Mojsilovic and
Sami Mourad and
Pablo Pedemonte and
Ramya Raghavendra and
John T. Richards and
Prasanna Sattigeri and
Karthikeyan Shanmugam and
Moninder Singh and
Kush R. Varshney and
Dennis Wei and
Yunfeng Zhang},
title = {{AI} Explainability 360: Impact and Design},
booktitle = {Thirty-Sixth {AAAI} Conference on Artificial Intelligence, {AAAI}
2022, Thirty-Fourth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2022, The Twelveth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2022 Virtual Event, February 22
- March 1, 2022},
pages = {12651--12657},
publisher = {{AAAI} Press},
year = {2022},
url = {https://doi.org/10.1609/aaai.v36i11.21540},
doi = {10.1609/AAAI.V36I11.21540},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/AryaBCDHHHLLMMP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ZhengVL022,
author = {Zeyu Zheng and
Risto Vuorio and
Richard L. Lewis and
Satinder Singh},
title = {Adaptive Pairwise Weights for Temporal Credit Assignment},
booktitle = {Thirty-Sixth {AAAI} Conference on Artificial Intelligence, {AAAI}
2022, Thirty-Fourth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2022, The Twelveth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2022 Virtual Event, February 22
- March 1, 2022},
pages = {9225--9232},
publisher = {{AAAI} Press},
year = {2022},
url = {https://doi.org/10.1609/aaai.v36i8.20909},
doi = {10.1609/AAAI.V36I8.20909},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/ZhengVL022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bcb/SarkarSBDK22,
author = {Aisharjya Sarkar and
Aaditya Singh and
Richard Bailey and
Alin Dobra and
Tamer Kahveci},
title = {Optimal separation of high dimensional transcriptome for complex multigenic
traits},
booktitle = {{BCB} '22: 13th {ACM} International Conference on Bioinformatics,
Computational Biology and Health Informatics, Northbrook, Illinois,
USA, August 7 - 10, 2022},
pages = {32:1--32:5},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3535508.3545506},
doi = {10.1145/3535508.3545506},
timestamp = {Mon, 01 Aug 2022 11:48:53 +0200},
biburl = {https://dblp.org/rec/conf/bcb/SarkarSBDK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmvc/ZhaoXQP022,
author = {Ziyuan Zhao and
Mingxi Xu and
Peisheng Qian and
Ramanpreet Singh Pahwa and
Richard Chang},
title = {{DA-CIL:} Towards Domain Adaptive Class-Incremental 3D Object Detection},
booktitle = {33rd British Machine Vision Conference 2022, {BMVC} 2022, London,
UK, November 21-24, 2022},
pages = {916},
publisher = {{BMVA} Press},
year = {2022},
url = {https://bmvc2022.mpi-inf.mpg.de/916/},
timestamp = {Thu, 16 Feb 2023 16:15:04 +0100},
biburl = {https://dblp.org/rec/conf/bmvc/ZhaoXQP022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/centeris/McubaSIV22,
author = {Mvelo Mcuba and
Avinash Singh and
Richard Adeyemi Ikuesan and
Hein S. Venter},
editor = {Maria Manuela Cruz{-}Cunha and
Ricardo Martinho and
Rui Rijo and
Dulce Domingos and
Emanuel Peres},
title = {The Effect of Deep Learning Methods on Deepfake Audio Detection for
Digital Investigation},
booktitle = {{CENTERIS} 2022 - International Conference on ENTERprise Information
Systems / ProjMAN - International Conference on Project MANagement
/ HCist - International Conference on Health and Social Care Information
Systems and Technologies 2022, Hybrid Event / Lisbon, Portugal, November
9-11, 2022},
pages = {211--219},
publisher = {Elsevier},
year = {2022},
url = {https://doi.org/10.1016/j.procs.2023.01.283},
doi = {10.1016/J.PROCS.2023.01.283},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/centeris/McubaSIV22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/centeris/MunkhondyaISV22,
author = {Howard Munkhondya and
Richard Adeyemi Ikuesan and
Avinash Singh and
Hein S. Venter},
editor = {Maria Manuela Cruz{-}Cunha and
Ricardo Martinho and
Rui Rijo and
Dulce Domingos and
Emanuel Peres},
title = {Understanding Issues and Challenges of {DFR} Implementation in {SDN}
Platform},
booktitle = {{CENTERIS} 2022 - International Conference on ENTERprise Information
Systems / ProjMAN - International Conference on Project MANagement
/ HCist - International Conference on Health and Social Care Information
Systems and Technologies 2022, Hybrid Event / Lisbon, Portugal, November
9-11, 2022},
pages = {286--293},
publisher = {Elsevier},
year = {2022},
url = {https://doi.org/10.1016/j.procs.2023.01.292},
doi = {10.1016/J.PROCS.2023.01.292},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/centeris/MunkhondyaISV22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/SinghalNBK22,
author = {Yatharth Singhal and
Richard Huynh Noeske and
Ayush Bhardwaj and
Jin Ryong Kim},
editor = {Simone D. J. Barbosa and
Cliff Lampe and
Caroline Appert and
David A. Shamma and
Steven Mark Drucker and
Julie R. Williamson and
Koji Yatani},
title = {Improving Finger Stroke Recognition Rate for Eyes-Free Mid-Air Typing
in {VR}},
booktitle = {{CHI} '22: {CHI} Conference on Human Factors in Computing Systems,
New Orleans, LA, USA, 29 April 2022 - 5 May 2022},
pages = {346:1--346:9},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3491102.3502100},
doi = {10.1145/3491102.3502100},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/chi/SinghalNBK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvmi/RakeshLMUCGDKSS22,
author = {Sumit Rakesh and
Foteini Liwicki and
Hamam Mokayed and
Richa Upadhyay and
Prakash Chandra Chhipa and
Vibha Gupta and
Kanjar De and
Gy{\"{o}}rgy Kov{\'{a}}cs and
Dinesh Singh and
Rajkumar Saini},
editor = {Massimo Tistarelli and
Shiv Ram Dubey and
Satish Kumar Singh and
Xiaoyi Jiang},
title = {Emotions Classification Using {EEG} in Health Care},
booktitle = {Computer Vision and Machine Intelligence - Proceedings of {CVMI} 2022,
{IIIT} Allahabad, India, August 2022},
series = {Lecture Notes in Networks and Systems},
volume = {586},
pages = {37--49},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-981-19-7867-8\_4},
doi = {10.1007/978-981-19-7867-8\_4},
timestamp = {Wed, 14 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvmi/RakeshLMUCGDKSS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/0001RV022,
author = {Akshay Agarwal and
Nalini K. Ratha and
Mayank Vatsa and
Richa Singh},
title = {Exploring Robustness Connection between Artificial and Natural Adversarial
Examples},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition Workshops,
{CVPR} Workshops 2022, New Orleans, LA, USA, June 19-20, 2022},
pages = {178--185},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/CVPRW56347.2022.00030},
doi = {10.1109/CVPRW56347.2022.00030},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/0001RV022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/NarayanAMTKV022,
author = {Kartik Narayan and
Harsh Agarwal and
Surbhi Mittal and
Kartik Thakral and
Suman Kundu and
Mayank Vatsa and
Richa Singh},
title = {DeSI: Deepfake Source Identifier for Social Media},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition Workshops,
{CVPR} Workshops 2022, New Orleans, LA, USA, June 19-20, 2022},
pages = {2857--2866},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/CVPRW56347.2022.00323},
doi = {10.1109/CVPRW56347.2022.00323},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/NarayanAMTKV022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ParmarLL0ZS22,
author = {Gaurav Parmar and
Yijun Li and
Jingwan Lu and
Richard Zhang and
Jun{-}Yan Zhu and
Krishna Kumar Singh},
title = {Spatially-Adaptive Multilayer Selection for {GAN} Inversion and Editing},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2022, New Orleans, LA, USA, June 18-24, 2022},
pages = {11389--11399},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/CVPR52688.2022.01111},
doi = {10.1109/CVPR52688.2022.01111},
timestamp = {Wed, 05 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/ParmarLL0ZS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/AgarwalRVS22,
author = {Akshay Agarwal and
Nalini K. Ratha and
Mayank Vatsa and
Richa Singh},
editor = {Leonid Karlinsky and
Tomer Michaeli and
Ko Nishino},
title = {Benchmarking Robustness Beyond l\({}_{\mbox{p}}\) Norm Adversaries},
booktitle = {Computer Vision - {ECCV} 2022 Workshops - Tel Aviv, Israel, October
23-27, 2022, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {13801},
pages = {342--359},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-25056-9\_23},
doi = {10.1007/978-3-031-25056-9\_23},
timestamp = {Sat, 25 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eccv/AgarwalRVS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eurosp/IslamMSSS22,
author = {Saad Islam and
Koksal Mus and
Richa Singh and
Patrick Schaumont and
Berk Sunar},
title = {Signature Correction Attack on Dilithium Signature Scheme},
booktitle = {7th {IEEE} European Symposium on Security and Privacy, EuroS{\&}P
2022, Genoa, Italy, June 6-10, 2022},
pages = {647--663},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/EuroSP53844.2022.00046},
doi = {10.1109/EUROSP53844.2022.00046},
timestamp = {Wed, 29 Jun 2022 16:03:24 +0200},
biburl = {https://dblp.org/rec/conf/eurosp/IslamMSSS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ic3i/SrivastavRSGS22,
author = {Gaurav Srivastav and
Mamoon Rashid and
Richa Singh and
Anita Gehlot and
Neha Sharma},
title = {Breast Cancer Detection in Mammogram Images using Machine Learning
Methods and {CLAHE} Algorithm},
booktitle = {5th International Conference on Contemporary Computing and Informatics,
{IC3I} 2022, Uttar Pradesh, India, December 14-16, 2022},
pages = {1187--1192},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IC3I56241.2022.10072725},
doi = {10.1109/IC3I56241.2022.10072725},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ic3i/SrivastavRSGS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/NwePCMWLLPD22,
author = {Tin Lay Nwe and
Ramanpreet Singh Pahwa and
Richard Chang and
Oo Zaw Min and
Jie Wang and
Yiqun Li and
Dongyun Lin and
Shitala Prasad and
Sheng Dong},
title = {On the Use of Component Structural Characteristics for Voxel Segmentation
in Semicon 3D Images},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2022, Virtual and Singapore, 23-27 May 2022},
pages = {2694--2698},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICASSP43922.2022.9747623},
doi = {10.1109/ICASSP43922.2022.9747623},
timestamp = {Tue, 07 Jun 2022 17:34:47 +0200},
biburl = {https://dblp.org/rec/conf/icassp/NwePCMWLLPD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/SinghCMSV22,
author = {Aditya Singh and
Saheb Chhabra and
Puspita Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Mannet: {A} Large-Scale Manipulated Image Detection Dataset And Baseline
Evaluations},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2022, Virtual and Singapore, 23-27 May 2022},
pages = {1780--1784},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICASSP43922.2022.9746945},
doi = {10.1109/ICASSP43922.2022.9746945},
timestamp = {Tue, 07 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/SinghCMSV22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/BharatiCVSB22,
author = {Aparna Bharati and
Emma Connors and
Mayank Vatsa and
Richa Singh and
Kevin W. Bowyer},
title = {In-group and Out-group Performance Bias in Facial Retouching Detection},
booktitle = {{IEEE} International Joint Conference on Biometrics, {IJCB} 2022,
Abu Dhabi, United Arab Emirates, October 10-13, 2022},
pages = {1--10},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IJCB54206.2022.10007942},
doi = {10.1109/IJCB54206.2022.10007942},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/BharatiCVSB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/NarayanATMVS22,
author = {Kartik Narayan and
Harsh Agarwal and
Kartik Thakral and
Surbhi Mittal and
Mayank Vatsa and
Richa Singh},
title = {DeePhy: On Deepfake Phylogeny},
booktitle = {{IEEE} International Joint Conference on Biometrics, {IJCB} 2022,
Abu Dhabi, United Arab Emirates, October 10-13, 2022},
pages = {1--10},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IJCB54206.2022.10007968},
doi = {10.1109/IJCB54206.2022.10007968},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/NarayanATMVS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/RanjanVS22,
author = {Rishabh Ranjan and
Mayank Vatsa and
Richa Singh},
title = {STATNet: Spectral and Temporal features based Multi-Task Network for
Audio Spoofing Detection},
booktitle = {{IEEE} International Joint Conference on Biometrics, {IJCB} 2022,
Abu Dhabi, United Arab Emirates, October 10-13, 2022},
pages = {1--9},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IJCB54206.2022.10007949},
doi = {10.1109/IJCB54206.2022.10007949},
timestamp = {Thu, 26 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icb/RanjanVS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/CaiPXW0ZF22,
author = {Lile Cai and
Ramanpreet Singh Pahwa and
Xun Xu and
Jie Wang and
Richard Chang and
Lining Zhang and
Chuan{-}Sheng Foo},
title = {Exploring Active Learning for Semiconductor Defect Segmentation},
booktitle = {2022 {IEEE} International Conference on Image Processing, {ICIP} 2022,
Bordeaux, France, 16-19 October 2022},
pages = {1796--1800},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICIP46576.2022.9897842},
doi = {10.1109/ICIP46576.2022.9897842},
timestamp = {Thu, 06 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/CaiPXW0ZF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/0002MNS22,
author = {Honglin Yuan and
Warren Richard Morningstar and
Lin Ning and
Karan Singhal},
title = {What Do We Mean by Generalization in Federated Learning?},
booktitle = {The Tenth International Conference on Learning Representations, {ICLR}
2022, Virtual Event, April 25-29, 2022},
publisher = {OpenReview.net},
year = {2022},
url = {https://openreview.net/forum?id=VimqQq-i\_Q},
timestamp = {Sat, 20 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/0002MNS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmla/KabraXLLLYYSGTAVGB22,
author = {Krish Kabra and
Alexander Xiong and
Wenbin Li and
Minxuan Luo and
William Lu and
Tianjiao Yu and
Jiahui Yu and
Dhananjay Singh and
Raul Garcia and
Maojie Tang and
Hank Arnold and
Anna Vallery and
Richard Gibbons and
Arko Barman},
editor = {M. Arif Wani and
Mehmed M. Kantardzic and
Vasile Palade and
Daniel Neagu and
Longzhi Yang and
Kit Yan Chan},
title = {Deep object detection for waterbird monitoring using aerial imagery},
booktitle = {21st {IEEE} International Conference on Machine Learning and Applications,
{ICMLA} 2022, Nassau, Bahamas, December 12-14, 2022},
pages = {455--460},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICMLA55696.2022.00073},
doi = {10.1109/ICMLA55696.2022.00073},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmla/KabraXLLLYYSGTAVGB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/Jain00VR22,
author = {Vishi Jain and
Akshay Agarwal and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Robust {IRIS} Presentation Attack Detection Through Stochastic Filter
Noise},
booktitle = {26th International Conference on Pattern Recognition, {ICPR} 2022,
Montreal, QC, Canada, August 21-25, 2022},
pages = {1134--1140},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICPR56361.2022.9956718},
doi = {10.1109/ICPR56361.2022.9956718},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icpr/Jain00VR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/WredeEJPEHS22,
author = {Fredrik Wrede and
Robin Eriksson and
Richard M. Jiang and
Linda R. Petzold and
Stefan Engblom and
Andreas Hellander and
Prashant Singh},
title = {Robust and integrative Bayesian neural networks for likelihood-free
parameter inference},
booktitle = {International Joint Conference on Neural Networks, {IJCNN} 2022, Padua,
Italy, July 18-23, 2022},
pages = {1--10},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IJCNN55064.2022.9892800},
doi = {10.1109/IJCNN55064.2022.9892800},
timestamp = {Mon, 10 Oct 2022 17:40:09 +0200},
biburl = {https://dblp.org/rec/conf/ijcnn/WredeEJPEHS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/KhashabiLMQ0WHK22,
author = {Daniel Khashabi and
Xinxi Lyu and
Sewon Min and
Lianhui Qin and
Kyle Richardson and
Sean Welleck and
Hannaneh Hajishirzi and
Tushar Khot and
Ashish Sabharwal and
Sameer Singh and
Yejin Choi},
editor = {Marine Carpuat and
Marie{-}Catherine de Marneffe and
Iv{\'{a}}n Vladimir Meza Ru{\'{\i}}z},
title = {Prompt Waywardness: The Curious Case of Discretized Interpretation
of Continuous Prompts},
booktitle = {Proceedings of the 2022 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL} 2022, Seattle, WA, United States, July 10-15, 2022},
pages = {3631--3643},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.naacl-main.266},
doi = {10.18653/V1/2022.NAACL-MAIN.266},
timestamp = {Thu, 04 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/KhashabiLMQ0WHK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/22/Majumdar0V022,
author = {Puspita Majumdar and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
editor = {Christian Rathgeb and
Ruben Tolosana and
Rub{\'{e}}n Vera{-}Rodr{\'{\i}}guez and
Christoph Busch},
title = {Facial Retouching and Alteration Detection},
booktitle = {Handbook of Digital Face Manipulation and Detection - From DeepFakes
to Morphing Attacks},
series = {Advances in Computer Vision and Pattern Recognition},
pages = {367--387},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-030-87664-7\_17},
doi = {10.1007/978-3-030-87664-7\_17},
timestamp = {Mon, 06 Nov 2023 09:47:46 +0100},
biburl = {https://dblp.org/rec/books/sp/22/Majumdar0V022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icmi/2022,
editor = {Raj Tumuluri and
Nicu Sebe and
Gopal Pingali and
Dinesh Babu Jayagopi and
Abhinav Dhall and
Richa Singh and
Lisa Anthony and
Albert Ali Salah},
title = {International Conference on Multimodal Interaction, {ICMI} 2022, Bengaluru,
India, November 7-11, 2022},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3536221},
doi = {10.1145/3536221},
isbn = {978-1-4503-9390-4},
timestamp = {Mon, 07 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmi/2022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icmi/2022c,
editor = {Raj Tumuluri and
Nicu Sebe and
Gopal Pingali and
Dinesh Babu Jayagopi and
Abhinav Dhall and
Richa Singh and
Lisa Anthony and
Albert Ali Salah},
title = {International Conference on Multimodal Interaction, {ICMI} 2022, Companion
Volume, Bengaluru, India, November 7-11, 2022},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3536220},
doi = {10.1145/3536220},
isbn = {978-1-4503-9389-8},
timestamp = {Mon, 07 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmi/2022c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-01486,
author = {Sharvani Srivastava and
Amisha Gangwar and
Richa Mishra and
Sudhakar Singh},
title = {Sign Language Recognition System using TensorFlow Object Detection
{API}},
journal = {CoRR},
volume = {abs/2201.01486},
year = {2022},
url = {https://arxiv.org/abs/2201.01486},
eprinttype = {arXiv},
eprint = {2201.01486},
timestamp = {Thu, 03 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2201-01486.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-03052,
author = {Richard Apaua and
Harjinder Singh Lallie},
title = {Measuring User Perceived Security of Mobile Banking Applications},
journal = {CoRR},
volume = {abs/2201.03052},
year = {2022},
url = {https://arxiv.org/abs/2201.03052},
eprinttype = {arXiv},
eprint = {2201.03052},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2201-03052.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2202-04772,
author = {Vivek Veeriah and
Zeyu Zheng and
Richard L. Lewis and
Satinder Singh},
title = {GrASP: Gradient-Based Affordance Selection for Planning},
journal = {CoRR},
volume = {abs/2202.04772},
year = {2022},
url = {https://arxiv.org/abs/2202.04772},
eprinttype = {arXiv},
eprint = {2202.04772},
timestamp = {Wed, 20 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2202-04772.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-00637,
author = {Saad Islam and
Koksal Mus and
Richa Singh and
Patrick Schaumont and
Berk Sunar},
title = {Signature Correction Attack on Dilithium Signature Scheme},
journal = {CoRR},
volume = {abs/2203.00637},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2203.00637},
doi = {10.48550/ARXIV.2203.00637},
eprinttype = {arXiv},
eprint = {2203.00637},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2203-00637.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-00715,
author = {Avishkar Bhoopchand and
Bethanie Brownfield and
Adrian Collister and
Agustin Dal Lago and
Ashley Edwards and
Richard Everett and
Alexandre Fr{\'{e}}chette and
Yanko Gitahy Oliveira and
Edward Hughes and
Kory W. Mathewson and
Piermaria Mendolicchio and
Julia Pawar and
Miruna Pislar and
Alex Platonov and
Evan Senter and
Sukhdeep Singh and
Alexander Zacherl and
Lei M. Zhang},
title = {Learning Robust Real-Time Cultural Transmission without Human Data},
journal = {CoRR},
volume = {abs/2203.00715},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2203.00715},
doi = {10.48550/ARXIV.2203.00715},
eprinttype = {arXiv},
eprint = {2203.00715},
timestamp = {Wed, 28 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2203-00715.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-16871,
author = {Avinash Singh and
Richard Adeyemi Ikuesan and
Hein S. Venter},
title = {Ransomware Detection using Process Memory},
journal = {CoRR},
volume = {abs/2203.16871},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2203.16871},
doi = {10.48550/ARXIV.2203.16871},
eprinttype = {arXiv},
eprint = {2203.16871},
timestamp = {Mon, 04 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2203-16871.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-06153,
author = {Richa Singh and
Saad Islam and
Berk Sunar and
Patrick Schaumont},
title = {An End-to-End Analysis of {EMFI} on Bit-sliced Post-Quantum Implementations},
journal = {CoRR},
volume = {abs/2204.06153},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2204.06153},
doi = {10.48550/ARXIV.2204.06153},
eprinttype = {arXiv},
eprint = {2204.06153},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2204-06153.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-08582,
author = {Jack FitzGerald and
Christopher Hench and
Charith Peris and
Scott Mackie and
Kay Rottmann and
Ana Sanchez and
Aaron Nash and
Liam Urbach and
Vishesh Kakarala and
Richa Singh and
Swetha Ranganath and
Laurie Crist and
Misha Britan and
Wouter Leeuwis and
G{\"{o}}khan T{\"{u}}r and
Prem Natarajan},
title = {{MASSIVE:} {A} 1M-Example Multilingual Natural Language Understanding
Dataset with 51 Typologically-Diverse Languages},
journal = {CoRR},
volume = {abs/2204.08582},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2204.08582},
doi = {10.48550/ARXIV.2204.08582},
eprinttype = {arXiv},
eprint = {2204.08582},
timestamp = {Mon, 25 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2204-08582.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-05882,
author = {Arpit Khare and
Sudhakar Singh and
Richa Mishra and
Shiv Prakash and
Pratibha Dixit},
title = {E-Mail Assistant - Automation of E-Mail Handling and Management using
Robotic Process Automation},
journal = {CoRR},
volume = {abs/2205.05882},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.05882},
doi = {10.48550/ARXIV.2205.05882},
eprinttype = {arXiv},
eprint = {2205.05882},
timestamp = {Thu, 03 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-05882.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-04615,
author = {Aarohi Srivastava and
Abhinav Rastogi and
Abhishek Rao and
Abu Awal Md Shoeb and
Abubakar Abid and
Adam Fisch and
Adam R. Brown and
Adam Santoro and
Aditya Gupta and
Adri{\`{a}} Garriga{-}Alonso and
Agnieszka Kluska and
Aitor Lewkowycz and
Akshat Agarwal and
Alethea Power and
Alex Ray and
Alex Warstadt and
Alexander W. Kocurek and
Ali Safaya and
Ali Tazarv and
Alice Xiang and
Alicia Parrish and
Allen Nie and
Aman Hussain and
Amanda Askell and
Amanda Dsouza and
Ambrose Slone and
Ameet Rahane and
Anantharaman S. Iyer and
Anders Andreassen and
Andrea Madotto and
Andrea Santilli and
Andreas Stuhlm{\"{u}}ller and
Andrew M. Dai and
Andrew La and
Andrew K. Lampinen and
Andy Zou and
Angela Jiang and
Angelica Chen and
Anh Vuong and
Animesh Gupta and
Anna Gottardi and
Antonio Norelli and
Anu Venkatesh and
Arash Gholamidavoodi and
Arfa Tabassum and
Arul Menezes and
Arun Kirubarajan and
Asher Mullokandov and
Ashish Sabharwal and
Austin Herrick and
Avia Efrat and
Aykut Erdem and
Ayla Karakas and
B. Ryan Roberts and
Bao Sheng Loe and
Barret Zoph and
Bartlomiej Bojanowski and
Batuhan {\"{O}}zyurt and
Behnam Hedayatnia and
Behnam Neyshabur and
Benjamin Inden and
Benno Stein and
Berk Ekmekci and
Bill Yuchen Lin and
Blake Howald and
Bryan Orinion and
Cameron Diao and
Cameron Dour and
Catherine Stinson and
Cedrick Argueta and
C{\`{e}}sar Ferri Ram{\'{\i}}rez and
Chandan Singh and
Charles Rathkopf and
Chenlin Meng and
Chitta Baral and
Chiyu Wu and
Chris Callison{-}Burch and
Chris Waites and
Christian Voigt and
Christopher D. Manning and
Christopher Potts and
Cindy Ramirez and
Clara E. Rivera and
Clemencia Siro and
Colin Raffel and
Courtney Ashcraft and
Cristina Garbacea and
Damien Sileo and
Dan Garrette and
Dan Hendrycks and
Dan Kilman and
Dan Roth and
Daniel Freeman and
Daniel Khashabi and
Daniel Levy and
Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and
Danielle Perszyk and
Danny Hernandez and
Danqi Chen and
Daphne Ippolito and
Dar Gilboa and
David Dohan and
David Drakard and
David Jurgens and
Debajyoti Datta and
Deep Ganguli and
Denis Emelin and
Denis Kleyko and
Deniz Yuret and
Derek Chen and
Derek Tam and
Dieuwke Hupkes and
Diganta Misra and
Dilyar Buzan and
Dimitri Coelho Mollo and
Diyi Yang and
Dong{-}Ho Lee and
Dylan Schrader and
Ekaterina Shutova and
Ekin Dogus Cubuk and
Elad Segal and
Eleanor Hagerman and
Elizabeth Barnes and
Elizabeth Donoway and
Ellie Pavlick and
Emanuele Rodol{\`{a}} and
Emma Lam and
Eric Chu and
Eric Tang and
Erkut Erdem and
Ernie Chang and
Ethan A. Chi and
Ethan Dyer and
Ethan J. Jerzak and
Ethan Kim and
Eunice Engefu Manyasi and
Evgenii Zheltonozhskii and
Fanyue Xia and
Fatemeh Siar and
Fernando Mart{\'{\i}}nez{-}Plumed and
Francesca Happ{\'{e}} and
Fran{\c{c}}ois Chollet and
Frieda Rong and
Gaurav Mishra and
Genta Indra Winata and
Gerard de Melo and
Germ{\'{a}}n Kruszewski and
Giambattista Parascandolo and
Giorgio Mariani and
Gloria Wang and
Gonzalo Jaimovitch{-}L{\'{o}}pez and
Gregor Betz and
Guy Gur{-}Ari and
Hana Galijasevic and
Hannah Kim and
Hannah Rashkin and
Hannaneh Hajishirzi and
Harsh Mehta and
Hayden Bogar and
Henry Shevlin and
Hinrich Sch{\"{u}}tze and
Hiromu Yakura and
Hongming Zhang and
Hugh Mee Wong and
Ian Ng and
Isaac Noble and
Jaap Jumelet and
Jack Geissinger and
Jackson Kernion and
Jacob Hilton and
Jaehoon Lee and
Jaime Fern{\'{a}}ndez Fisac and
James B. Simon and
James Koppel and
James Zheng and
James Zou and
Jan Kocon and
Jana Thompson and
Janelle Wingfield and
Jared Kaplan and
Jarema Radom and
Jascha Sohl{-}Dickstein and
Jason Phang and
Jason Wei and
Jason Yosinski and
Jekaterina Novikova and
Jelle Bosscher and
Jennifer Marsh and
Jeremy Kim and
Jeroen Taal and
Jesse H. Engel and
Jesujoba Alabi and
Jiacheng Xu and
Jiaming Song and
Jillian Tang and
Joan Waweru and
John Burden and
John Miller and
John U. Balis and
Jonathan Batchelder and
Jonathan Berant and
J{\"{o}}rg Frohberg and
Jos Rozen and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Joseph Boudeman and
Joseph Guerr and
Joseph Jones and
Joshua B. Tenenbaum and
Joshua S. Rule and
Joyce Chua and
Kamil Kanclerz and
Karen Livescu and
Karl Krauth and
Karthik Gopalakrishnan and
Katerina Ignatyeva and
Katja Markert and
Kaustubh D. Dhole and
Kevin Gimpel and
Kevin Omondi and
Kory Mathewson and
Kristen Chiafullo and
Ksenia Shkaruta and
Kumar Shridhar and
Kyle McDonell and
Kyle Richardson and
Laria Reynolds and
Leo Gao and
Li Zhang and
Liam Dugan and
Lianhui Qin and
Lidia Contreras Ochando and
Louis{-}Philippe Morency and
Luca Moschella and
Lucas Lam and
Lucy Noble and
Ludwig Schmidt and
Luheng He and
Luis Oliveros Col{\'{o}}n and
Luke Metz and
L{\"{u}}tfi Kerem Senel and
Maarten Bosma and
Maarten Sap and
Maartje ter Hoeve and
Maheen Farooqi and
Manaal Faruqui and
Mantas Mazeika and
Marco Baturan and
Marco Marelli and
Marco Maru and
Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and
Marie Tolkiehn and
Mario Giulianelli and
Martha Lewis and
Martin Potthast and
Matthew L. Leavitt and
Matthias Hagen and
M{\'{a}}ty{\'{a}}s Schubert and
Medina Baitemirova and
Melody Arnaud and
Melvin McElrath and
Michael A. Yee and
Michael Cohen and
Michael Gu and
Michael I. Ivanitskiy and
Michael Starritt and
Michael Strube and
Michal Swedrowski and
Michele Bevilacqua and
Michihiro Yasunaga and
Mihir Kale and
Mike Cain and
Mimee Xu and
Mirac Suzgun and
Mitch Walker and
Mo Tiwari and
Mohit Bansal and
Moin Aminnaseri and
Mor Geva and
Mozhdeh Gheini and
Mukund Varma T. and
Nanyun Peng and
Nathan A. Chi and
Nayeon Lee and
Neta Gur{-}Ari Krakover and
Nicholas Cameron and
Nicholas Roberts and
Nick Doiron and
Nicole Martinez and
Nikita Nangia and
Niklas Deckers and
Niklas Muennighoff and
Nitish Shirish Keskar and
Niveditha Iyer and
Noah Constant and
Noah Fiedel and
Nuan Wen and
Oliver Zhang and
Omar Agha and
Omar Elbaghdadi and
Omer Levy and
Owain Evans and
Pablo Antonio Moreno Casares and
Parth Doshi and
Pascale Fung and
Paul Pu Liang and
Paul Vicol and
Pegah Alipoormolabashi and
Peiyuan Liao and
Percy Liang and
Peter Chang and
Peter Eckersley and
Phu Mon Htut and
Pinyu Hwang and
Piotr Milkowski and
Piyush Patil and
Pouya Pezeshkpour and
Priti Oli and
Qiaozhu Mei and
Qing Lyu and
Qinlang Chen and
Rabin Banjade and
Rachel Etta Rudolph and
Raefer Gabriel and
Rahel Habacker and
Ramon Risco and
Rapha{\"{e}}l Milli{\`{e}}re and
Rhythm Garg and
Richard Barnes and
Rif A. Saurous and
Riku Arakawa and
Robbe Raymaekers and
Robert Frank and
Rohan Sikand and
Roman Novak and
Roman Sitelew and
Ronan LeBras and
Rosanne Liu and
Rowan Jacobs and
Rui Zhang and
Ruslan Salakhutdinov and
Ryan Chi and
Ryan Lee and
Ryan Stovall and
Ryan Teehan and
Rylan Yang and
Sahib Singh and
Saif M. Mohammad and
Sajant Anand and
Sam Dillavou and
Sam Shleifer and
Sam Wiseman and
Samuel Gruetter and
Samuel R. Bowman and
Samuel S. Schoenholz and
Sanghyun Han and
Sanjeev Kwatra and
Sarah A. Rous and
Sarik Ghazarian and
Sayan Ghosh and
Sean Casey and
Sebastian Bischoff and
Sebastian Gehrmann and
Sebastian Schuster and
Sepideh Sadeghi and
Shadi Hamdan and
Sharon Zhou and
Shashank Srivastava and
Sherry Shi and
Shikhar Singh and
Shima Asaadi and
Shixiang Shane Gu and
Shubh Pachchigar and
Shubham Toshniwal and
Shyam Upadhyay and
Shyamolima (Shammie) Debnath and
Siamak Shakeri and
Simon Thormeyer and
Simone Melzi and
Siva Reddy and
Sneha Priscilla Makini and
Soo{-}Hwan Lee and
Spencer Torene and
Sriharsha Hatwar and
Stanislas Dehaene and
Stefan Divic and
Stefano Ermon and
Stella Biderman and
Stephanie Lin and
Stephen Prasad and
Steven T. Piantadosi and
Stuart M. Shieber and
Summer Misherghi and
Svetlana Kiritchenko and
Swaroop Mishra and
Tal Linzen and
Tal Schuster and
Tao Li and
Tao Yu and
Tariq Ali and
Tatsu Hashimoto and
Te{-}Lin Wu and
Th{\'{e}}o Desbordes and
Theodore Rothschild and
Thomas Phan and
Tianle Wang and
Tiberius Nkinyili and
Timo Schick and
Timofei Kornev and
Titus Tunduny and
Tobias Gerstenberg and
Trenton Chang and
Trishala Neeraj and
Tushar Khot and
Tyler Shultz and
Uri Shaham and
Vedant Misra and
Vera Demberg and
Victoria Nyamai and
Vikas Raunak and
Vinay V. Ramasesh and
Vinay Uday Prabhu and
Vishakh Padmakumar and
Vivek Srikumar and
William Fedus and
William Saunders and
William Zhang and
Wout Vossen and
Xiang Ren and
Xiaoyu Tong and
Xinran Zhao and
Xinyi Wu and
Xudong Shen and
Yadollah Yaghoobzadeh and
Yair Lakretz and
Yangqiu Song and
Yasaman Bahri and
Yejin Choi and
Yichi Yang and
Yiding Hao and
Yifu Chen and
Yonatan Belinkov and
Yu Hou and
Yufang Hou and
Yuntao Bai and
Zachary Seid and
Zhuoye Zhao and
Zijian Wang and
Zijie J. Wang and
Zirui Wang and
Ziyi Wu},
title = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities
of language models},
journal = {CoRR},
volume = {abs/2206.04615},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.04615},
doi = {10.48550/ARXIV.2206.04615},
eprinttype = {arXiv},
eprint = {2206.04615},
timestamp = {Mon, 05 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-04615.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-08357,
author = {Gaurav Parmar and
Yijun Li and
Jingwan Lu and
Richard Zhang and
Jun{-}Yan Zhu and
Krishna Kumar Singh},
title = {Spatially-Adaptive Multilayer Selection for {GAN} Inversion and Editing},
journal = {CoRR},
volume = {abs/2206.08357},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.08357},
doi = {10.48550/ARXIV.2206.08357},
eprinttype = {arXiv},
eprint = {2206.08357},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-08357.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-10532,
author = {Mohammad Dehghani Soltani and
Hossein Kazemi and
Elham Sarbazi and
Ahmad Adnan Qidan and
Barzan A. Yosuf and
Sanaa H. Mohamed and
Ravinder Singh and
Bela Berde and
Dominique Chiaroni and
Bastien B{\'{e}}chadergue and
Fathi Abdeldayem and
Hardik Soni and
Jose Tabu and
Micheline Perrufel and
Nikola Serafimovski and
Taisir E. H. El{-}Gorashi and
Jaafar M. H. Elmirghani and
Richard V. Penty and
Ian H. White and
Harald Haas and
Majid Safari},
title = {Terabit Indoor Laser-Based Wireless Communications: LiFi 2.0 for 6G},
journal = {CoRR},
volume = {abs/2206.10532},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.10532},
doi = {10.48550/ARXIV.2206.10532},
eprinttype = {arXiv},
eprint = {2206.10532},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-10532.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-13061,
author = {Sasikanth Kotti and
Mayank Vatsa and
Richa Singh},
title = {On GANs perpetuating biases for face verification},
journal = {CoRR},
volume = {abs/2208.13061},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2208.13061},
doi = {10.48550/ARXIV.2208.13061},
eprinttype = {arXiv},
eprint = {2208.13061},
timestamp = {Fri, 02 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2208-13061.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2209-09111,
author = {Kartik Narayan and
Harsh Agarwal and
Kartik Thakral and
Surbhi Mittal and
Mayank Vatsa and
Richa Singh},
title = {DeePhy: On Deepfake Phylogeny},
journal = {CoRR},
volume = {abs/2209.09111},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2209.09111},
doi = {10.48550/ARXIV.2209.09111},
eprinttype = {arXiv},
eprint = {2209.09111},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2209-09111.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-00092,
author = {Raviteja Vemulapalli and
Warren Richard Morningstar and
Philip Andrew Mansfield and
Hubert Eichner and
Karan Singhal and
Arash Afkanpour and
Bradley Green},
title = {Federated Training of Dual Encoding Models on Small Non-IID Client
Datasets},
journal = {CoRR},
volume = {abs/2210.00092},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.00092},
doi = {10.48550/ARXIV.2210.00092},
eprinttype = {arXiv},
eprint = {2210.00092},
timestamp = {Fri, 07 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-00092.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-03821,
author = {Ethan A. Brooks and
Logan Walls and
Richard L. Lewis and
Satinder Singh},
title = {In-Context Policy Iteration},
journal = {CoRR},
volume = {abs/2210.03821},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.03821},
doi = {10.48550/ARXIV.2210.03821},
eprinttype = {arXiv},
eprint = {2210.03821},
timestamp = {Wed, 12 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-03821.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-03588,
author = {Surbhi Mittal and
Kartik Thakral and
Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Are Face Detection Models Biased?},
journal = {CoRR},
volume = {abs/2211.03588},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.03588},
doi = {10.48550/ARXIV.2211.03588},
eprinttype = {arXiv},
eprint = {2211.03588},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-03588.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-09981,
author = {Yangjun Ruan and
Saurabh Singh and
Warren R. Morningstar and
Alexander A. Alemi and
Sergey Ioffe and
Ian Fischer and
Joshua V. Dillon},
title = {Weighted Ensemble Self-Supervised Learning},
journal = {CoRR},
volume = {abs/2211.09981},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.09981},
doi = {10.48550/ARXIV.2211.09981},
eprinttype = {arXiv},
eprint = {2211.09981},
timestamp = {Thu, 24 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-09981.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-02057,
author = {Ziyuan Zhao and
Mingxi Xu and
Peisheng Qian and
Ramanpreet Singh Pahwa and
Richard Chang},
title = {{DA-CIL:} Towards Domain Adaptive Class-Incremental 3D Object Detection},
journal = {CoRR},
volume = {abs/2212.02057},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.02057},
doi = {10.48550/ARXIV.2212.02057},
eprinttype = {arXiv},
eprint = {2212.02057},
timestamp = {Thu, 08 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-02057.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ai/SilverSPS21,
author = {David Silver and
Satinder Singh and
Doina Precup and
Richard S. Sutton},
title = {Reward is enough},
journal = {Artif. Intell.},
volume = {299},
pages = {103535},
year = {2021},
url = {https://doi.org/10.1016/j.artint.2021.103535},
doi = {10.1016/J.ARTINT.2021.103535},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ai/SilverSPS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/JiangJGMRSWYDHP21,
author = {Richard M. Jiang and
Bruno Jacob and
Matthew Geiger and
Sean Matthew and
Bryan Rumsey and
Prashant Singh and
Fredrik Wrede and
Tau{-}Mu Yi and
Brian Drawert and
Andreas Hellander and
Linda R. Petzold},
title = {Epidemiological modeling in StochSS Live!},
journal = {Bioinform.},
volume = {37},
number = {17},
pages = {2787--2788},
year = {2021},
url = {https://doi.org/10.1093/bioinformatics/btab061},
doi = {10.1093/BIOINFORMATICS/BTAB061},
timestamp = {Tue, 12 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/JiangJGMRSWYDHP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/JiangWSHP21,
author = {Richard M. Jiang and
Fredrik Wrede and
Prashant Singh and
Andreas Hellander and
Linda R. Petzold},
title = {Accelerated regression-based summary statistics for discrete stochastic
systems via approximate simulators},
journal = {{BMC} Bioinform.},
volume = {22},
number = {1},
pages = {339},
year = {2021},
url = {https://doi.org/10.1186/s12859-021-04255-9},
doi = {10.1186/S12859-021-04255-9},
timestamp = {Mon, 10 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/JiangWSHP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/candc/DhanukaS21,
author = {Richa Dhanuka and
Jyoti Prakash Singh},
title = {Protein function prediction using functional inter-relationship},
journal = {Comput. Biol. Chem.},
volume = {95},
pages = {107593},
year = {2021},
url = {https://doi.org/10.1016/j.compbiolchem.2021.107593},
doi = {10.1016/J.COMPBIOLCHEM.2021.107593},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/candc/DhanukaS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/SpinaCAAGCCHLMS21,
author = {Gabriele Spina and
Pierluigi Casale and
Paul S. Albert and
Jennifer Alison and
Judith Garcia{-}Aymerich and
Christian F. Clarenbach and
Richard W. Costello and
Nidia A. Hernandes and
Jorg D. Leuppi and
Rafael Mesquita and
Sally J. Singh and
Frank W. J. M. Smeenk and
Ruth Tal{-}Singer and
Emiel F. M. Wouters and
Martijn A. Spruit and
Albertus C. den Brinker},
title = {Nighttime features derived from topic models for classification of
patients with {COPD}},
journal = {Comput. Biol. Medicine},
volume = {132},
pages = {104322},
year = {2021},
url = {https://doi.org/10.1016/j.compbiomed.2021.104322},
doi = {10.1016/J.COMPBIOMED.2021.104322},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cbm/SpinaCAAGCCHLMS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cea/JollyLMFORSBS21,
author = {Ben Jolly and
Jiafa Luo and
Promil Mehra and
Patrick Forrestal and
Macdara O'Neill and
Karl G. Richards and
Bhupinder Pal Singh and
Geoff Bates and
Surinder Saggar},
title = {Evaluation of proximal sensing technologies for mapping bovine urine
patches under grazing pastures},
journal = {Comput. Electron. Agric.},
volume = {188},
pages = {106309},
year = {2021},
url = {https://doi.org/10.1016/j.compag.2021.106309},
doi = {10.1016/J.COMPAG.2021.106309},
timestamp = {Thu, 26 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cea/JollyLMFORSBS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cviu/ChellappaGLMS21,
author = {Rama Chellappa and
Diego Gragnaniello and
Chang{-}Tsun Li and
Francesco Marra and
Richa Singh},
title = {Guest Editorial: Adversarial Deep Learning in Biometrics {\&}
Forensics},
journal = {Comput. Vis. Image Underst.},
volume = {208-209},
pages = {103227},
year = {2021},
url = {https://doi.org/10.1016/j.cviu.2021.103227},
doi = {10.1016/J.CVIU.2021.103227},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cviu/ChellappaGLMS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/frai/AgarwalSVN21,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {MagNet: Detecting Digital Presentation Attacks on Face Recognition},
journal = {Frontiers Artif. Intell.},
volume = {4},
year = {2021},
url = {https://doi.org/10.3389/frai.2021.643424},
doi = {10.3389/FRAI.2021.643424},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/frai/AgarwalSVN21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/frai/DhamechaGVS21,
author = {Tejas I. Dhamecha and
Soumyadeep Ghosh and
Mayank Vatsa and
Richa Singh},
title = {Kernelized Heterogeneity-Aware Cross-View Face Recognition},
journal = {Frontiers Artif. Intell.},
volume = {4},
pages = {670538},
year = {2021},
url = {https://doi.org/10.3389/frai.2021.670538},
doi = {10.3389/FRAI.2021.670538},
timestamp = {Wed, 04 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/frai/DhamechaGVS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieeejas/WangHBLBSRHW21,
author = {Shuangyi Wang and
James Housden and
Tianxiang Bai and
Hongbin Liu and
Junghwan Back and
Davinder Singh and
Kawal S. Rhode and
Zeng{-}Guang Hou and
Fei{-}Yue Wang},
title = {Robotic Intra-Operative Ultrasound: Virtual Environments and Parallel
Systems},
journal = {{IEEE} {CAA} J. Autom. Sinica},
volume = {8},
number = {5},
pages = {1095--1106},
year = {2021},
url = {https://doi.org/10.1109/JAS.2021.1003985},
doi = {10.1109/JAS.2021.1003985},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieeejas/WangHBLBSRHW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-ifs/SinghRSA21,
author = {Kunwar Singh and
C. Pandu Rangan and
Samir Sheshank and
Richa Agrawal},
title = {Lattice-based unidirectional Proxy Re-Encryption and Proxy Re-Encryption+
schemes},
journal = {{IET} Inf. Secur.},
volume = {15},
number = {1},
pages = {1--12},
year = {2021},
url = {https://doi.org/10.1049/ise2.12000},
doi = {10.1049/ISE2.12000},
timestamp = {Tue, 25 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iet-ifs/SinghRSA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcini/SinghSN21,
author = {Pavan Kumar Singh and
Nitin Singh and
Richa Negi},
title = {Short-Term Wind Power Prediction Using Hybrid Auto Regressive Integrated
Moving Average Model and Dynamic Particle Swarm Optimization},
journal = {Int. J. Cogn. Informatics Nat. Intell.},
volume = {15},
number = {2},
pages = {124--151},
year = {2021},
url = {https://doi.org/10.4018/IJCINI.20210401.oa9},
doi = {10.4018/IJCINI.20210401.OA9},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijcini/SinghSN21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijrr/SinghRSSP21,
author = {Sumeet Singh and
Spencer M. Richards and
Vikas Sindhwani and
Jean{-}Jacques E. Slotine and
Marco Pavone},
title = {Learning stabilizable nonlinear dynamics with contraction-based regularization},
journal = {Int. J. Robotics Res.},
volume = {40},
number = {10-11},
year = {2021},
url = {https://doi.org/10.1177/0278364920949931},
doi = {10.1177/0278364920949931},
timestamp = {Mon, 19 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijrr/SinghRSSP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/imwut/CloeteNS21,
author = {Richard Cloete and
Chris Norval and
Jatinder Singh},
title = {Auditable Augmented/Mixed/Virtual Reality: The Practicalities of Mobile
System Transparency},
journal = {Proc. {ACM} Interact. Mob. Wearable Ubiquitous Technol.},
volume = {5},
number = {4},
pages = {149:1--149:24},
year = {2021},
url = {https://doi.org/10.1145/3495001},
doi = {10.1145/3495001},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/imwut/CloeteNS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/integration/SharmaRSP21,
author = {Richa Sharma and
Vijaypal Singh Rathor and
G. K. Sharma and
Manisha Pattanaik},
title = {A new hardware Trojan detection technique using deep convolutional
neural network},
journal = {Integr.},
volume = {79},
pages = {1--11},
year = {2021},
url = {https://doi.org/10.1016/j.vlsi.2021.03.001},
doi = {10.1016/J.VLSI.2021.03.001},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/integration/SharmaRSP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/MishraSDB21,
author = {Santosh Kumar Mishra and
Koushlendra Kumar Singh and
Richa Dixit and
Manish Kumar Bajpai},
title = {Design of Fractional Calculus based differentiator for edge detection
in color images},
journal = {Multim. Tools Appl.},
volume = {80},
number = {19},
pages = {29965--29983},
year = {2021},
url = {https://doi.org/10.1007/s11042-021-11187-2},
doi = {10.1007/S11042-021-11187-2},
timestamp = {Wed, 01 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mta/MishraSDB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/SaxenaMRBSHWS21,
author = {Neeraj Saxena and
Suresh D. Muthukumaraswamy and
Lewys Richmond and
Adele Babic and
Krish D. Singh and
Judith E. Hall and
Richard G. Wise and
Alexander D. Shaw},
title = {A comparison of GABA-ergic (propofol) and non-GABA-ergic (dexmedetomidine)
sedation on visual and motor cortical oscillations, using magnetoencephalography},
journal = {NeuroImage},
volume = {245},
pages = {118659},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2021.118659},
doi = {10.1016/J.NEUROIMAGE.2021.118659},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/SaxenaMRBSHWS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/NagpalSSV21,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa},
title = {Discriminative shared transform learning for sketch to image matching},
journal = {Pattern Recognit.},
volume = {114},
pages = {107815},
year = {2021},
url = {https://doi.org/10.1016/j.patcog.2021.107815},
doi = {10.1016/J.PATCOG.2021.107815},
timestamp = {Wed, 07 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pr/NagpalSSV21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/AgarwalVSR21,
author = {Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Cognitive data augmentation for adversarial defense via pixel masking},
journal = {Pattern Recognit. Lett.},
volume = {146},
pages = {244--251},
year = {2021},
url = {https://doi.org/10.1016/j.patrec.2021.01.032},
doi = {10.1016/J.PATREC.2021.01.032},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/prl/AgarwalVSR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/SuriSVS21,
author = {Saksham Suri and
Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {Improving face recognition performance using TeCS2 dictionary},
journal = {Pattern Recognit. Lett.},
volume = {145},
pages = {88--95},
year = {2021},
url = {https://doi.org/10.1016/j.patrec.2020.12.022},
doi = {10.1016/J.PATREC.2020.12.022},
timestamp = {Fri, 23 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/prl/SuriSVS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ral/HousdenWBZSMNES21,
author = {James Housden and
Shuangyi Wang and
Xianqiang Bao and
Jia Zheng and
Emily Skelton and
Jacqueline Matthew and
Yohan Noh and
Olla Eltiraifi and
Anisha Singh and
Davinder Singh and
Kawal S. Rhode},
title = {Towards Standardized Acquisition With a Dual-Probe Ultrasound Robot
for Fetal Imaging},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {6},
number = {2},
pages = {1059--1065},
year = {2021},
url = {https://doi.org/10.1109/LRA.2021.3056033},
doi = {10.1109/LRA.2021.3056033},
timestamp = {Mon, 31 Oct 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ral/HousdenWBZSMNES21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbbis/MajumdarCSV21,
author = {Puspita Majumdar and
Saheb Chhabra and
Richa Singh and
Mayank Vatsa},
title = {Recognizing Injured Faces via {SCIFI} Loss},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {3},
number = {1},
pages = {112--123},
year = {2021},
url = {https://doi.org/10.1109/TBIOM.2020.3047274},
doi = {10.1109/TBIOM.2020.3047274},
timestamp = {Tue, 02 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbbis/MajumdarCSV21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbbis/MalhotraSVSMN21,
author = {Aakarsh Malhotra and
Anush Sankaran and
Mayank Vatsa and
Richa Singh and
Keith B. Morris and
Afzel Noore},
title = {Understanding {ACE-V} Latent Fingerprint Examination Process via Eye-Gaze
Analysis},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {3},
number = {1},
pages = {44--58},
year = {2021},
url = {https://doi.org/10.1109/TBIOM.2020.3027144},
doi = {10.1109/TBIOM.2020.3027144},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbbis/MalhotraSVSMN21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbbis/RathaSSKPV21,
author = {Nalini K. Ratha and
Richa Singh and
Vitomir Struc and
Ioannis A. Kakadiaris and
P. Jonathon Phillips and
Mayank Vatsa},
title = {{TBIOM} Special Issue on "Best Reviewed Papers From {IJCB} 2020 -
Editorial"},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {3},
number = {4},
pages = {441--442},
year = {2021},
url = {https://doi.org/10.1109/TBIOM.2021.3128673},
doi = {10.1109/TBIOM.2021.3128673},
timestamp = {Mon, 06 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbbis/RathaSSKPV21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tdsc/AgarwalSVR21,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Image Transformation-Based Defense Against Adversarial Perturbation
on Deep Learning Models},
journal = {{IEEE} Trans. Dependable Secur. Comput.},
volume = {18},
number = {5},
pages = {2106--2121},
year = {2021},
url = {https://doi.org/10.1109/TDSC.2020.3027183},
doi = {10.1109/TDSC.2020.3027183},
timestamp = {Thu, 16 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tdsc/AgarwalSVR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/0001V021,
author = {Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {Role of Optimizer on Network Fine-tuning for Adversarial Robustness
(Student Abstract)},
booktitle = {Thirty-Fifth {AAAI} Conference on Artificial Intelligence, {AAAI}
2021, Thirty-Third Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2021, The Eleventh Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2021, Virtual Event, February 2-9,
2021},
pages = {15745--15746},
publisher = {{AAAI} Press},
year = {2021},
url = {https://doi.org/10.1609/aaai.v35i18.17869},
doi = {10.1609/AAAI.V35I18.17869},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/0001V021.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ChauhanV021,
author = {Arushi Chauhan and
Mayank Vatsa and
Richa Singh},
title = {{NEAP-F:} Network Epoch Accuracy Prediction Framework (Student Abstract)},
booktitle = {Thirty-Fifth {AAAI} Conference on Artificial Intelligence, {AAAI}
2021, Thirty-Third Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2021, The Eleventh Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2021, Virtual Event, February 2-9,
2021},
pages = {15767--15768},
publisher = {{AAAI} Press},
year = {2021},
url = {https://doi.org/10.1609/aaai.v35i18.17880},
doi = {10.1609/AAAI.V35I18.17880},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/ChauhanV021.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/Majumdar0V21,
author = {Puspita Majumdar and
Richa Singh and
Mayank Vatsa},
title = {On Learning Deep Models with Imbalanced Data Distribution},
booktitle = {Thirty-Fifth {AAAI} Conference on Artificial Intelligence, {AAAI}
2021, Thirty-Third Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2021, The Eleventh Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2021, Virtual Event, February 2-9,
2021},
pages = {15720--15721},
publisher = {{AAAI} Press},
year = {2021},
url = {https://doi.org/10.1609/aaai.v35i18.17857},
doi = {10.1609/AAAI.V35I18.17857},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/Majumdar0V21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/Mehra0V021,
author = {Aman Mehra and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {Detection of Digital Manipulation in Facial Images (Student Abstract)},
booktitle = {Thirty-Fifth {AAAI} Conference on Artificial Intelligence, {AAAI}
2021, Thirty-Third Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2021, The Eleventh Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2021, Virtual Event, February 2-9,
2021},
pages = {15845--15846},
publisher = {{AAAI} Press},
year = {2021},
url = {https://doi.org/10.1609/aaai.v35i18.17919},
doi = {10.1609/AAAI.V35I18.17919},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/Mehra0V021.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/SundriyalGV021,
author = {Divyanshu Sundriyal and
Soumyadeep Ghosh and
Mayank Vatsa and
Richa Singh},
title = {Semi-Supervised Learning via Triplet Network Based Active Learning
(Student Abstract)},
booktitle = {Thirty-Fifth {AAAI} Conference on Artificial Intelligence, {AAAI}
2021, Thirty-Third Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2021, The Eleventh Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2021, Virtual Event, February 2-9,
2021},
pages = {15903--15904},
publisher = {{AAAI} Press},
year = {2021},
url = {https://doi.org/10.1609/aaai.v35i18.17948},
doi = {10.1609/AAAI.V35I18.17948},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/SundriyalGV021.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aies/JavadiNCS21,
author = {Seyyed Ahmad Javadi and
Chris Norval and
Richard Cloete and
Jatinder Singh},
editor = {Marion Fourcade and
Benjamin Kuipers and
Seth Lazar and
Deirdre K. Mulligan},
title = {Monitoring {AI} Services for Misuse},
booktitle = {{AIES} '21: {AAAI/ACM} Conference on AI, Ethics, and Society, Virtual
Event, USA, May 19-21, 2021},
pages = {597--607},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3461702.3462566},
doi = {10.1145/3461702.3462566},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aies/JavadiNCS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/comad/0001VR21,
author = {Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
editor = {Jayant R. Haritsa and
Shourya Roy and
Manish Gupta and
Sharad Mehrotra and
Balaji Vasan Srinivasan and
Yogesh Simmhan},
title = {Trustworthy {AI}},
booktitle = {{CODS-COMAD} 2021: 8th {ACM} {IKDD} {CODS} and 26th COMAD, Virtual
Event, Bangalore, India, January 2-4, 2021},
pages = {449--453},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3430984.3431966},
doi = {10.1145/3430984.3431966},
timestamp = {Mon, 18 Jan 2021 16:22:22 +0100},
biburl = {https://dblp.org/rec/conf/comad/0001VR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/comad/AryaBCDHHHLLMMP21,
author = {Vijay Arya and
Rachel K. E. Bellamy and
Pin{-}Yu Chen and
Amit Dhurandhar and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Q. Vera Liao and
Ronny Luss and
Aleksandra Mojsilovic and
Sami Mourad and
Pablo Pedemonte and
Ramya Raghavendra and
John T. Richards and
Prasanna Sattigeri and
Karthikeyan Shanmugam and
Moninder Singh and
Kush R. Varshney and
Dennis Wei and
Yunfeng Zhang},
editor = {Jayant R. Haritsa and
Shourya Roy and
Manish Gupta and
Sharad Mehrotra and
Balaji Vasan Srinivasan and
Yogesh Simmhan},
title = {{AI} Explainability 360 Toolkit},
booktitle = {{CODS-COMAD} 2021: 8th {ACM} {IKDD} {CODS} and 26th COMAD, Virtual
Event, Bangalore, India, January 2-4, 2021},
pages = {376--379},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3430984.3430987},
doi = {10.1145/3430984.3430987},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/comad/AryaBCDHHHLLMMP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cscw/KarusalaIBGPKAB21,
author = {Naveena Karusala and
Azra Ismail and
Karthik S. Bhat and
Aakash Gautam and
Sachin R. Pendse and
Neha Kumar and
Richard J. Anderson and
Madeline Balaam and
Shaowen Bardzell and
Nicola J. Bidwell and
Melissa Densmore and
Elizabeth Kaziunas and
Anne Marie Piper and
Noopur Raval and
Pushpendra Singh and
Austin Toombs and
Nervo Verdezoto Dias and
Ding Wang},
editor = {Jeremy P. Birnholtz and
Luigina Ciolfi and
Sharon Ding and
Susan R. Fussell and
Andr{\'{e}}s Monroy{-}Hern{\'{a}}ndez and
Sean Munson and
Irina Shklovski and
Mor Naaman},
title = {The Future of Care Work: Towards a Radical Politics of Care in {CSCW}
Research and Practice},
booktitle = {Companion Publication of the 2021 {ACM} Conference on Computer Supported
Cooperative Work and Social Computing, {CSCW} 2021, Virtual Event,
USA, October 23-27, 2021},
pages = {338--342},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3462204.3481734},
doi = {10.1145/3462204.3481734},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cscw/KarusalaIBGPKAB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fast/PanSZSZSPSWGCPS21,
author = {Satadru Pan and
Theano Stavrinos and
Yunqiao Zhang and
Atul Sikaria and
Pavel Zakharov and
Abhinav Sharma and
Shiva Shankar P. and
Mike Shuey and
Richard Wareing and
Monika Gangapuram and
Guanglei Cao and
Christian Preseau and
Pratap Singh and
Kestutis Patiejunas and
J. R. Tipton and
Ethan Katz{-}Bassett and
Wyatt Lloyd},
editor = {Marcos K. Aguilera and
Gala Yadgar},
title = {Facebook's Tectonic Filesystem: Efficiency from Exascale},
booktitle = {19th {USENIX} Conference on File and Storage Technologies, {FAST}
2021, February 23-25, 2021},
pages = {217--231},
publisher = {{USENIX} Association},
year = {2021},
url = {https://www.usenix.org/conference/fast21/presentation/pan},
timestamp = {Thu, 12 Aug 2021 18:19:16 +0200},
biburl = {https://dblp.org/rec/conf/fast/PanSZSZSPSWGCPS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fgr/AgarwalASVS21,
author = {Aayushi Agarwal and
Akshay Agarwal and
Sayan Sinha and
Mayank Vatsa and
Richa Singh},
title = {MD-CSDNetwork: Multi-Domain Cross Stitched Network for Deepfake Detection},
booktitle = {16th {IEEE} International Conference on Automatic Face and Gesture
Recognition, {FG} 2021, Jodhpur, India, December 15-18, 2021},
pages = {1--8},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/FG52635.2021.9666937},
doi = {10.1109/FG52635.2021.9666937},
timestamp = {Tue, 19 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fgr/AgarwalASVS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fgr/AgarwalRVS21,
author = {Akshay Agarwal and
Nalini K. Ratha and
Mayank Vatsa and
Richa Singh},
title = {When Sketch Face Recognition Meets Mask Obfuscation: Database and
Benchmark},
booktitle = {16th {IEEE} International Conference on Automatic Face and Gesture
Recognition, {FG} 2021, Jodhpur, India, December 15-18, 2021},
pages = {1--5},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/FG52635.2021.9667075},
doi = {10.1109/FG52635.2021.9667075},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fgr/AgarwalRVS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fgr/DosiTMVS21,
author = {Muskan Dosi and
Kartik Thakral and
Surbhi Mittal and
Mayank Vatsa and
Richa Singh},
title = {AECNet: Attentive EfficientNet For Crowd Counting},
booktitle = {16th {IEEE} International Conference on Automatic Face and Gesture
Recognition, {FG} 2021, Jodhpur, India, December 15-18, 2021},
pages = {1--8},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/FG52635.2021.9666790},
doi = {10.1109/FG52635.2021.9666790},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fgr/DosiTMVS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fgr/GhoshSVN21,
author = {Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {{RGB-D} Face Recognition using Reconstruction based Shared Representation},
booktitle = {16th {IEEE} International Conference on Automatic Face and Gesture
Recognition, {FG} 2021, Jodhpur, India, December 15-18, 2021},
pages = {1--8},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/FG52635.2021.9667035},
doi = {10.1109/FG52635.2021.9667035},
timestamp = {Tue, 18 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fgr/GhoshSVN21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fgr/MishraMDVS21,
author = {Shiksha Mishra and
Puspita Majumdar and
Muskan Dosi and
Mayank Vatsa and
Richa Singh},
title = {Dual Sensor Indian Masked Face Dataset},
booktitle = {16th {IEEE} International Conference on Automatic Face and Gesture
Recognition, {FG} 2021, Jodhpur, India, December 15-18, 2021},
pages = {1--8},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/FG52635.2021.9667057},
doi = {10.1109/FG52635.2021.9667057},
timestamp = {Tue, 18 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fgr/MishraMDVS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ficta/KumariSR21,
author = {Pallavi Kumari and
Richa Sharma and
Virendra Singh Rathore},
editor = {Suresh Chandra Satapathy and
Peter Peer and
Jinshan Tang and
Vikrant Bhateja and
Anumoy Ghosh},
title = {{COVID-19:} Geospatial Analysis of the Pandemic - {A} Case Study of
Bihar State, India, Using Data Derived from Remote Sensing Satellites
and {COVID-19} National Geoportal},
booktitle = {Intelligent Data Engineering and Analytics - Proceedings of the 9th
International Conference on Frontiers in Intelligent Computing: Theory
and Applications {(FICTA} 2021), Aizawl, India, June 25-26, 2021},
series = {Smart Innovation, Systems and Technologies},
volume = {266},
pages = {425--431},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-981-16-6624-7\_42},
doi = {10.1007/978-981-16-6624-7\_42},
timestamp = {Tue, 28 Nov 2023 12:36:13 +0100},
biburl = {https://dblp.org/rec/conf/ficta/KumariSR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/PozdniakovMSCRB21,
author = {Stanislav Pozdniakov and
Roberto Mart{'{i}}nez{ }Maldonado and
Shaveen Singh and
Peter Chen and
Dan Richardson and
Tom Bartindale and
Patrick Olivier and
Dragan Gasevic},
editor = {Maiga Chang and
Nian{-}Shing Chen and
Demetrios G. Sampson and
Ahmed Tlili},
title = {Question-driven Learning Analytics: Designing a Teacher Dashboard
for Online Breakout Rooms},
booktitle = {21st International Conference on Advanced Learning Technologies, {ICALT}
2021, Tartu, Estonia, July 12-15, 2021},
pages = {176--178},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICALT52272.2021.00060},
doi = {10.1109/ICALT52272.2021.00060},
timestamp = {Mon, 23 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icalt/PozdniakovMSCRB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccvw/MajumdarMSV21,
author = {Puspita Majumdar and
Surbhi Mittal and
Richa Singh and
Mayank Vatsa},
title = {Unravelling the Effect of Image Distortions for Biased Prediction
of Pre-trained Face Recognition Models},
booktitle = {{IEEE/CVF} International Conference on Computer Vision Workshops,
{ICCVW} 2021, Montreal, BC, Canada, October 11-17, 2021},
pages = {3779--3788},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICCVW54120.2021.00422},
doi = {10.1109/ICCVW54120.2021.00422},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccvw/MajumdarMSV21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccvw/MajumdarSV21,
author = {Puspita Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Attention Aware Debiasing for Unbiased Model Prediction},
booktitle = {{IEEE/CVF} International Conference on Computer Vision Workshops,
{ICCVW} 2021, Montreal, BC, Canada, October 11-17, 2021},
pages = {4116--4124},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICCVW54120.2021.00459},
doi = {10.1109/ICCVW54120.2021.00459},
timestamp = {Fri, 03 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccvw/MajumdarSV21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/0001V0R21,
author = {Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Intelligent and Adaptive Mixup Technique for Adversarial Robustness},
booktitle = {2021 {IEEE} International Conference on Image Processing, {ICIP} 2021,
Anchorage, AK, USA, September 19-22, 2021},
pages = {824--828},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICIP42928.2021.9506180},
doi = {10.1109/ICIP42928.2021.9506180},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/0001V0R21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/MishraM0V21,
author = {Shiksha Mishra and
Puspita Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Indian Masked Faces in the Wild Dataset},
booktitle = {2021 {IEEE} International Conference on Image Processing, {ICIP} 2021,
Anchorage, AK, USA, September 19-22, 2021},
pages = {884--888},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICIP42928.2021.9506447},
doi = {10.1109/ICIP42928.2021.9506447},
timestamp = {Thu, 03 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icip/MishraM0V21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/BrooksRLS21,
author = {Ethan A. Brooks and
Janarthanan Rajendran and
Richard L. Lewis and
Satinder Singh},
editor = {Marina Meila and
Tong Zhang},
title = {Reinforcement Learning of Implicit and Explicit Control Flow Instructions},
booktitle = {Proceedings of the 38th International Conference on Machine Learning,
{ICML} 2021, 18-24 July 2021, Virtual Event},
series = {Proceedings of Machine Learning Research},
volume = {139},
pages = {1082--1091},
publisher = {{PMLR}},
year = {2021},
url = {http://proceedings.mlr.press/v139/brooks21a.html},
timestamp = {Wed, 20 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/BrooksRLS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/CarvalhoLLSLLS21,
author = {Wilka Carvalho and
Anthony Liang and
Kimin Lee and
Sungryull Sohn and
Honglak Lee and
Richard L. Lewis and
Satinder Singh},
editor = {Zhi{-}Hua Zhou},
title = {Reinforcement Learning for Sparse-Reward Object-Interaction Tasks
in a First-person Simulated 3D Environment},
booktitle = {Proceedings of the Thirtieth International Joint Conference on Artificial
Intelligence, {IJCAI} 2021, Virtual Event / Montreal, Canada, 19-27
August 2021},
pages = {2219--2226},
publisher = {ijcai.org},
year = {2021},
url = {https://doi.org/10.24963/ijcai.2021/306},
doi = {10.24963/IJCAI.2021/306},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/CarvalhoLLSLLS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/ChhabraMVS21,
author = {Saheb Chhabra and
Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Class Equilibrium using Coulomb's Law},
booktitle = {International Joint Conference on Neural Networks, {IJCNN} 2021, Shenzhen,
China, July 18-22, 2021},
pages = {1--8},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IJCNN52387.2021.9533445},
doi = {10.1109/IJCNN52387.2021.9533445},
timestamp = {Wed, 29 Sep 2021 17:00:55 +0200},
biburl = {https://dblp.org/rec/conf/ijcnn/ChhabraMVS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/SinghNVS21,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh},
title = {Enhancing Fine-Grained Classification for Low Resolution Images},
booktitle = {International Joint Conference on Neural Networks, {IJCNN} 2021, Shenzhen,
China, July 18-22, 2021},
pages = {1--8},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IJCNN52387.2021.9534026},
doi = {10.1109/IJCNN52387.2021.9534026},
timestamp = {Wed, 29 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnn/SinghNVS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/SinghNYKPPSVNBM21,
author = {Maneet Singh and
Shruti Nagpal and
Daksha Yadav and
Naman Kohli and
Prateekshit Pandey and
Gokulraj Prabhakaran and
Richa Singh and
Mayank Vatsa and
Afzel Noore and
Julie Brefczynski{-}Lewis and
Harsh Mahajan},
title = {Understanding Neural Responses to Face Verification of Cross-Domain
Representations},
booktitle = {International Joint Conference on Neural Networks, {IJCNN} 2021, Shenzhen,
China, July 18-22, 2021},
pages = {1--8},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IJCNN52387.2021.9534242},
doi = {10.1109/IJCNN52387.2021.9534242},
timestamp = {Wed, 29 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnn/SinghNYKPPSVNBM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isr2/ZhengWHHSR21,
author = {Jia Zheng and
Shuangyi Wang and
James Housden and
Zeng{-}Guang Hou and
Davinder Singh and
Kawal S. Rhode},
title = {A Safety Joint with Passive Compliant and Manual Override Mechanisms
for Medical Robotics},
booktitle = {{IEEE} International Conference on Intelligence and Safety for Robotics,
{ISR} 2021, Tokoname, Japan, March 4-6, 2021},
pages = {144--147},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISR50024.2021.9419379},
doi = {10.1109/ISR50024.2021.9419379},
timestamp = {Mon, 31 Oct 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isr2/ZhengWHHSR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/VasudevanJBSSHS21,
author = {Shobha Vasudevan and
Wenjie Jiang and
David Bieber and
Rishabh Singh and
Hamid Shojaei and
Richard Ho and
Charles Sutton},
editor = {Marc'Aurelio Ranzato and
Alina Beygelzimer and
Yann N. Dauphin and
Percy Liang and
Jennifer Wortman Vaughan},
title = {Learning Semantic Representations to Verify Hardware Designs},
booktitle = {Advances in Neural Information Processing Systems 34: Annual Conference
on Neural Information Processing Systems 2021, NeurIPS 2021, December
6-14, 2021, virtual},
pages = {23491--23504},
year = {2021},
url = {https://proceedings.neurips.cc/paper/2021/hash/c5aa65949d20f6b20e1a922c13d974e7-Abstract.html},
timestamp = {Tue, 03 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/VasudevanJBSSHS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ZhengVVLS21,
author = {Zeyu Zheng and
Vivek Veeriah and
Risto Vuorio and
Richard L. Lewis and
Satinder Singh},
editor = {Marc'Aurelio Ranzato and
Alina Beygelzimer and
Yann N. Dauphin and
Percy Liang and
Jennifer Wortman Vaughan},
title = {Learning State Representations from Random Deep Action-conditional
Predictions},
booktitle = {Advances in Neural Information Processing Systems 34: Annual Conference
on Neural Information Processing Systems 2021, NeurIPS 2021, December
6-14, 2021, virtual},
pages = {23679--23691},
year = {2021},
url = {https://proceedings.neurips.cc/paper/2021/hash/c71df24045cfddab4a963d3ac9bdc9a3-Abstract.html},
timestamp = {Tue, 03 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/ZhengVVLS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nsdi/FergusonGHKMMOP21,
author = {Andrew D. Ferguson and
Steve D. Gribble and
Chi{-}Yao Hong and
Charles Edwin Killian and
Waqar Mohsin and
Henrik M{\"{u}}he and
Joon Ong and
Leon Poutievski and
Arjun Singh and
Lorenzo Vicisano and
Richard Alimi and
Shawn Shuoshuo Chen and
Mike Conley and
Subhasree Mandal and
Karthik Nagaraj and
Kondapa Naidu Bollineni and
Amr Sabaa and
Shidong Zhang and
Min Zhu and
Amin Vahdat},
editor = {James Mickens and
Renata Teixeira},
title = {Orion: Google's Software-Defined Networking Control Plane},
booktitle = {18th {USENIX} Symposium on Networked Systems Design and Implementation,
{NSDI} 2021, April 12-14, 2021},
pages = {83--98},
publisher = {{USENIX} Association},
year = {2021},
url = {https://www.usenix.org/conference/nsdi21/presentation/ferguson},
timestamp = {Tue, 02 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nsdi/FergusonGHKMMOP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/socrob/PahwaCJSVDJPW21,
author = {Ramanpreet Singh Pahwa and
Richard Chang and
Jie Wang and
Sankeerthana Satini and
Chandrashekar Viswanathan and
Yiming Du and
Vernica Jain and
Tai Pang Chen and
Kong{-}Wah Wan},
editor = {Haizhou Li and
Shuzhi Sam Ge and
Yan Wu and
Agnieszka Wykowska and
Hongsheng He and
Xiaorui Liu and
Dongyu Li and
Jairo P{\'{e}}rez{-}Osorio},
title = {A Survey on Object Detection Performance with Different Data Distributions},
booktitle = {Social Robotics - 13th International Conference, {ICSR} 2021, Singapore,
November 10-13, 2021, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13086},
pages = {553--563},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-90525-5\_48},
doi = {10.1007/978-3-030-90525-5\_48},
timestamp = {Fri, 28 Oct 2022 22:20:17 +0200},
biburl = {https://dblp.org/rec/conf/socrob/PahwaCJSVDJPW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wifs/AgarwalRVS21,
author = {Akshay Agarwal and
Nalini K. Ratha and
Mayank Vatsa and
Richa Singh},
title = {Impact of Super-Resolution and Human Identification in Drone Surveillance},
booktitle = {{IEEE} International Workshop on Information Forensics and Security,
{WIFS} 2021, Montpellier, France, December 7-10, 2021},
pages = {1--6},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/WIFS53200.2021.9648399},
doi = {10.1109/WIFS53200.2021.9648399},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wifs/AgarwalRVS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wosp/BieringaRSVDI21,
author = {Richard Bieringa and
Abijith Radhakrishnan and
Tavneet Singh and
Sophie Vos and
Jesse Donkervliet and
Alexandru Iosup},
editor = {Johann Bourcier and
Zhen Ming (Jack) Jiang and
Cor{-}Paul Bezemer and
Vittorio Cortellessa and
Daniele Di Pompeo and
Ana Lucia Varbanescu},
title = {An Empirical Evaluation of the Performance of Video Conferencing Systems},
booktitle = {{ICPE} '21: {ACM/SPEC} International Conference on Performance Engineering,
Virtual Event, France, April 19-21, 2021, Companion Volume},
pages = {65--71},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3447545.3451186},
doi = {10.1145/3447545.3451186},
timestamp = {Mon, 01 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wosp/BieringaRSVDI21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wosp/SinghKK21,
author = {Snigdha Singh and
Yves Richard Kirschner and
Anne Koziolek},
editor = {Johann Bourcier and
Zhen Ming (Jack) Jiang and
Cor{-}Paul Bezemer and
Vittorio Cortellessa and
Daniele Di Pompeo and
Ana Lucia Varbanescu},
title = {Towards Extraction of Message-Based Communication in Mixed-Technology
Architectures for Performance Model},
booktitle = {{ICPE} '21: {ACM/SPEC} International Conference on Performance Engineering,
Virtual Event, France, April 19-21, 2021, Companion Volume},
pages = {133--138},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3447545.3451201},
doi = {10.1145/3447545.3451201},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wosp/SinghKK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-04897,
author = {Zeyu Zheng and
Vivek Veeriah and
Risto Vuorio and
Richard L. Lewis and
Satinder Singh},
title = {Learning State Representations from Random Deep Action-conditional
Predictions},
journal = {CoRR},
volume = {abs/2102.04897},
year = {2021},
url = {https://arxiv.org/abs/2102.04897},
eprinttype = {arXiv},
eprint = {2102.04897},
timestamp = {Wed, 20 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2102-04897.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-04999,
author = {Zeyu Zheng and
Risto Vuorio and
Richard L. Lewis and
Satinder Singh},
title = {Pairwise Weights for Temporal Credit Assignment},
journal = {CoRR},
volume = {abs/2102.04999},
year = {2021},
url = {https://arxiv.org/abs/2102.04999},
eprinttype = {arXiv},
eprint = {2102.04999},
timestamp = {Wed, 20 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2102-04999.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-06521,
author = {Fredrik Wrede and
Robin Eriksson and
Richard M. Jiang and
Linda R. Petzold and
Stefan Engblom and
Andreas Hellander and
Prashant Singh},
title = {Robust and integrative Bayesian neural networks for likelihood-free
parameter inference},
journal = {CoRR},
volume = {abs/2102.06521},
year = {2021},
url = {https://arxiv.org/abs/2102.06521},
eprinttype = {arXiv},
eprint = {2102.06521},
timestamp = {Mon, 10 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2102-06521.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-13195,
author = {Ethan A. Brooks and
Janarthanan Rajendran and
Richard L. Lewis and
Satinder Singh},
title = {Reinforcement Learning of Implicit and Explicit Control Flow in Instructions},
journal = {CoRR},
volume = {abs/2102.13195},
year = {2021},
url = {https://arxiv.org/abs/2102.13195},
eprinttype = {arXiv},
eprint = {2102.13195},
timestamp = {Wed, 20 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2102-13195.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-04838,
author = {Ramanpreet Singh Pahwa and
Soon Wee Ho and
Ren Qin and
Richard Chang and
Oo Zaw Min and
Jie Wang and
Vempati Srinivasa Rao and
Tin Lay Nwe and
Yanjing Yang and
Jens Timo Neumann and
Ramani Pichumani and
Thomas Gregorich},
title = {Machine-learning based methodologies for 3d x-ray measurement, characterization
and optimization for buried structures in advanced ic packages},
journal = {CoRR},
volume = {abs/2103.04838},
year = {2021},
url = {https://arxiv.org/abs/2103.04838},
eprinttype = {arXiv},
eprint = {2103.04838},
timestamp = {Thu, 16 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2103-04838.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2104-12287,
author = {Saheb Chhabra and
Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Class Equilibrium using Coulomb's Law},
journal = {CoRR},
volume = {abs/2104.12287},
year = {2021},
url = {https://arxiv.org/abs/2104.12287},
eprinttype = {arXiv},
eprint = {2104.12287},
timestamp = {Mon, 03 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2104-12287.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2105-00241,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh},
title = {Enhancing Fine-Grained Classification for Low Resolution Images},
journal = {CoRR},
volume = {abs/2105.00241},
year = {2021},
url = {https://arxiv.org/abs/2105.00241},
eprinttype = {arXiv},
eprint = {2105.00241},
timestamp = {Fri, 14 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2105-00241.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-09670,
author = {Shiksha Mishra and
Puspita Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Indian Masked Faces in the Wild Dataset},
journal = {CoRR},
volume = {abs/2106.09670},
year = {2021},
url = {https://arxiv.org/abs/2106.09670},
eprinttype = {arXiv},
eprint = {2106.09670},
timestamp = {Tue, 29 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-09670.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-13784,
author = {Yuan Yao and
Pantea Kiaei and
Richa Singh and
Shahin Tajik and
Patrick Schaumont},
title = {Programmable {RO} {(PRO):} {A} Multipurpose Countermeasure against
Side-channel and Fault Injection Attack},
journal = {CoRR},
volume = {abs/2106.13784},
year = {2021},
url = {https://arxiv.org/abs/2106.13784},
eprinttype = {arXiv},
eprint = {2106.13784},
timestamp = {Wed, 08 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-13784.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2108-06581,
author = {Puspita Majumdar and
Surbhi Mittal and
Richa Singh and
Mayank Vatsa},
title = {Unravelling the Effect of Image Distortions for Biased Prediction
of Pre-trained Face Recognition Models},
journal = {CoRR},
volume = {abs/2108.06581},
year = {2021},
url = {https://arxiv.org/abs/2108.06581},
eprinttype = {arXiv},
eprint = {2108.06581},
timestamp = {Wed, 18 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2108-06581.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-07311,
author = {Aayushi Agarwal and
Akshay Agarwal and
Sayan Sinha and
Mayank Vatsa and
Richa Singh},
title = {MD-CSDNetwork: Multi-Domain Cross Stitched Network for Deepfake Detection},
journal = {CoRR},
volume = {abs/2109.07311},
year = {2021},
url = {https://arxiv.org/abs/2109.07311},
eprinttype = {arXiv},
eprint = {2109.07311},
timestamp = {Tue, 19 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-07311.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-12151,
author = {Vijay Arya and
Rachel K. E. Bellamy and
Pin{-}Yu Chen and
Amit Dhurandhar and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Q. Vera Liao and
Ronny Luss and
Aleksandra Mojsilovic and
Sami Mourad and
Pablo Pedemonte and
Ramya Raghavendra and
John T. Richards and
Prasanna Sattigeri and
Karthikeyan Shanmugam and
Moninder Singh and
Kush R. Varshney and
Dennis Wei and
Yunfeng Zhang},
title = {{AI} Explainability 360: Impact and Design},
journal = {CoRR},
volume = {abs/2109.12151},
year = {2021},
url = {https://arxiv.org/abs/2109.12151},
eprinttype = {arXiv},
eprint = {2109.12151},
timestamp = {Mon, 04 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-12151.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-02564,
author = {Pavani Tripathi and
Yasmeena Akhter and
Mahapara Khurshid and
Aditya Lakra and
Rohit Keshari and
Mayank Vatsa and
Richa Singh},
title = {{MTCD:} Cataract Detection via Near Infrared Eye Images},
journal = {CoRR},
volume = {abs/2110.02564},
year = {2021},
url = {https://arxiv.org/abs/2110.02564},
eprinttype = {arXiv},
eprint = {2110.02564},
timestamp = {Wed, 08 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2110-02564.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-08820,
author = {Richa Singh},
title = {On-board Fault Diagnosis of a Laboratory Mini {SR-30} Gas Turbine
Engine},
journal = {CoRR},
volume = {abs/2110.08820},
year = {2021},
url = {https://arxiv.org/abs/2110.08820},
eprinttype = {arXiv},
eprint = {2110.08820},
timestamp = {Fri, 22 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2110-08820.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-14216,
author = {Honglin Yuan and
Warren R. Morningstar and
Lin Ning and
Karan Singhal},
title = {What Do We Mean by Generalization in Federated Learning?},
journal = {CoRR},
volume = {abs/2110.14216},
year = {2021},
url = {https://arxiv.org/abs/2110.14216},
eprinttype = {arXiv},
eprint = {2110.14216},
timestamp = {Fri, 29 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2110-14216.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-02721,
author = {Kaustubh D. Dhole and
Varun Gangal and
Sebastian Gehrmann and
Aadesh Gupta and
Zhenhao Li and
Saad Mahamood and
Abinaya Mahendiran and
Simon Mille and
Ashish Srivastava and
Samson Tan and
Tongshuang Wu and
Jascha Sohl{-}Dickstein and
Jinho D. Choi and
Eduard H. Hovy and
Ondrej Dusek and
Sebastian Ruder and
Sajant Anand and
Nagender Aneja and
Rabin Banjade and
Lisa Barthe and
Hanna Behnke and
Ian Berlot{-}Attwell and
Connor Boyle and
Caroline Brun and
Marco Antonio Sobrevilla Cabezudo and
Samuel Cahyawijaya and
Emile Chapuis and
Wanxiang Che and
Mukund Choudhary and
Christian Clauss and
Pierre Colombo and
Filip Cornell and
Gautier Dagan and
Mayukh Das and
Tanay Dixit and
Thomas Dopierre and
Paul{-}Alexis Dray and
Suchitra Dubey and
Tatiana Ekeinhor and
Marco Di Giovanni and
Tanya Goyal and
Rishabh Gupta and
Louanes Hamla and
Sang Han and
Fabrice Harel{-}Canada and
Antoine Honore and
Ishan Jindal and
Przemyslaw K. Joniak and
Denis Kleyko and
Venelin Kovatchev and
Kalpesh Krishna and
Ashutosh Kumar and
Stefan Langer and
Seungjae Ryan Lee and
Corey James Levinson and
Hualou Liang and
Kaizhao Liang and
Zhexiong Liu and
Andrey Lukyanenko and
Vukosi Marivate and
Gerard de Melo and
Simon Meoni and
Maxime Meyer and
Afnan Mir and
Nafise Sadat Moosavi and
Niklas Muennighoff and
Timothy Sum Hon Mun and
Kenton Murray and
Marcin Namysl and
Maria Obedkova and
Priti Oli and
Nivranshu Pasricha and
Jan Pfister and
Richard Plant and
Vinay Prabhu and
Vasile Pais and
Libo Qin and
Shahab Raji and
Pawan Kumar Rajpoot and
Vikas Raunak and
Roy Rinberg and
Nicholas Roberts and
Juan Diego Rodriguez and
Claude Roux and
Paulo Henrique Santos Vasconcellos and
Ananya B. Sai and
Robin M. Schmidt and
Thomas Scialom and
Tshephisho Sefara and
Saqib Shamsi and
Xudong Shen and
Yiwen Shi and
Haoyue Shi and
Anna Shvets and
Nick Siegel and
Damien Sileo and
Jamie Simon and
Chandan Singh and
Roman Sitelew and
Priyank Soni and
Taylor Sorensen and
William Soto and
Aman Srivastava and
K. V. Aditya Srivatsa and
Tony Sun and
Mukund Varma T. and
A. Tabassum and
Fiona Anting Tan and
Ryan Teehan and
Mo Tiwari and
Marie Tolkiehn and
Athena Wang and
Zijian Wang and
Zijie J. Wang and
Gloria Wang and
Fuxuan Wei and
Bryan Wilie and
Genta Indra Winata and
Xinyi Wu and
Witold Wydmanski and
Tianbao Xie and
Usama Yaseen and
Michael A. Yee and
Jing Zhang and
Yue Zhang},
title = {NL-Augmenter: {A} Framework for Task-Sensitive Natural Language Augmentation},
journal = {CoRR},
volume = {abs/2112.02721},
year = {2021},
url = {https://arxiv.org/abs/2112.02721},
eprinttype = {arXiv},
eprint = {2112.02721},
timestamp = {Tue, 23 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-02721.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-06522,
author = {Richa Singh and
Puspita Majumdar and
Surbhi Mittal and
Mayank Vatsa},
title = {Anatomizing Bias in Facial Analysis},
journal = {CoRR},
volume = {abs/2112.06522},
year = {2021},
url = {https://arxiv.org/abs/2112.06522},
eprinttype = {arXiv},
eprint = {2112.06522},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-06522.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-08348,
author = {Daniel Khashabi and
Shane Lyu and
Sewon Min and
Lianhui Qin and
Kyle Richardson and
Sameer Singh and
Sean Welleck and
Hannaneh Hajishirzi and
Tushar Khot and
Ashish Sabharwal and
Yejin Choi},
title = {{PROMPT} {WAYWARDNESS:} The Curious Case of Discretized Interpretation
of Continuous Prompts},
journal = {CoRR},
volume = {abs/2112.08348},
year = {2021},
url = {https://arxiv.org/abs/2112.08348},
eprinttype = {arXiv},
eprint = {2112.08348},
timestamp = {Thu, 04 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-08348.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-10074,
author = {Raghav Mehta and
Angelos Filos and
Ujjwal Baid and
Chiharu Sako and
Richard McKinley and
Michael Rebsamen and
Katrin D{\"{a}}twyler and
Raphael Meier and
Piotr Radojewski and
Gowtham Krishnan Murugesan and
Sahil S. Nalawade and
Chandan Ganesh and
Benjamin C. Wagner and
Fang F. Yu and
Baowei Fei and
Ananth J. Madhuranthakam and
Joseph A. Maldjian and
Laura Alexandra Daza and
Catalina G{\'{o}}mez Caballero and
Pablo Arbel{\'{a}}ez and
Chengliang Dai and
Shuo Wang and
Hadrien Raynaud and
Yuanhan Mo and
Elsa D. Angelini and
Yike Guo and
Wenjia Bai and
Subhashis Banerjee and
Linmin Pei and
Murat Ak and
Sarahi Rosas{-}Gonz{\'{a}}lez and
Ilyess Zemmoura and
Clovis Tauber and
Minh H. Vu and
Tufve Nyholm and
Tommy L{\"{o}}fstedt and
Laura Mora Ballestar and
Ver{\'{o}}nica Vilaplana and
Hugh McHugh and
Gonzalo D. Maso Talou and
Alan Wang and
Jay B. Patel and
Ken Chang and
Katharina Hoebel and
Mishka Gidwani and
Nishanth Thumbavanam Arun and
Sharut Gupta and
Mehak Aggarwal and
Praveer Singh and
Elizabeth R. Gerstner and
Jayashree Kalpathy{-}Cramer and
Nicolas Boutry and
Alexis Huard and
Lasitha Vidyaratne and
Md Monibor Rahman and
Khan M. Iftekharuddin and
Joseph Chazalon and
{\'{E}}lodie Puybareau and
Guillaume Tochon and
Jun Ma and
Mariano Cabezas and
Xavier Llad{\'{o}} and
Arnau Oliver and
Liliana Valencia and
Sergi Valverde and
Mehdi Amian and
Mohammadreza Soltaninejad and
Andriy Myronenko and
Ali Hatamizadeh and
Xue Feng and
Quan Dou and
Nicholas J. Tustison and
Craig H. Meyer and
Nisarg A. Shah and
Sanjay N. Talbar and
Marc{-}Andr{\'{e}} Weber and
Abhishek Mahajan and
Andr{\'{a}}s Jakab and
Roland Wiest and
Hassan M. Fathallah{-}Shaykh and
Arash Nazeri and
Mikhail Milchenko and
Daniel S. Marcus and
Aikaterini Kotrotsou and
Rivka Colen and
John B. Freymann and
Justin S. Kirby and
Christos Davatzikos and
Bjoern H. Menze and
Spyridon Bakas and
Yarin Gal and
Tal Arbel},
title = {QU-BraTS: {MICCAI} BraTS 2020 Challenge on Quantifying Uncertainty
in Brain Tumor Segmentation - Analysis of Ranking Metrics and Benchmarking
Results},
journal = {CoRR},
volume = {abs/2112.10074},
year = {2021},
url = {https://arxiv.org/abs/2112.10074},
eprinttype = {arXiv},
eprint = {2112.10074},
timestamp = {Wed, 28 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-10074.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-12554,
author = {Ryan T. Scott and
Erik L. Antonsen and
Lauren M. Sanders and
Jaden J. A. Hastings and
Seung{-}Min Park and
Graham Mackintosh and
Robert J. Reynolds and
Adrienne L. Hoarfrost and
Aenor Sawyer and
Casey S. Greene and
Benjamin S. Glicksberg and
Corey A. Theriot and
Daniel C. Berrios and
Jack Miller and
Joel Babdor and
Richard Barker and
Sergio E. Baranzini and
Afshin Beheshti and
Stuart J. Chalk and
Guillermo M. Delgado{-}Aparicio and
Melissa A. Haendel and
Arif A. Hamid and
Philip Heller and
Daniel Jamieson and
Katelyn J. Jarvis and
John Kalantari and
Kia Khezeli and
Svetlana V. Komarova and
Matthieu Komorowski and
Prachi Kothiyal and
Ashish Mahabal and
Uri Manor and
H{\'{e}}ctor Garc{\'{\i}}a Mart{\'{\i}}n and
Christopher E. Mason and
Mona Matar and
George I. Mias and
Jerry G. Myers Jr. and
Charlotte A. Nelson and
Jonathan Oribello and
Patricia Parsons{-}Wingerter and
R. K. Prabhu and
Amina Ann Qutub and
Jon Rask and
Amanda Saravia{-}Butler and
Suchi Saria and
Nitin Kumar Singh and
Frank Soboczenski and
Michael Snyder and
Karthik Soman and
David Van Valen and
Kasthuri Venkateswaran and
Liz Warren and
Liz Worthey and
Jason H. Yang and
Marinka Zitnik and
Sylvain V. Costes},
title = {Beyond Low Earth Orbit: Biomonitoring, Artificial Intelligence, and
Precision Space Health},
journal = {CoRR},
volume = {abs/2112.12554},
year = {2021},
url = {https://arxiv.org/abs/2112.12554},
eprinttype = {arXiv},
eprint = {2112.12554},
timestamp = {Tue, 14 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-12554.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-12582,
author = {Lauren M. Sanders and
Jason H. Yang and
Ryan T. Scott and
Amina Ann Qutub and
H{\'{e}}ctor Garc{\'{\i}}a Mart{\'{\i}}n and
Daniel C. Berrios and
Jaden J. A. Hastings and
Jon Rask and
Graham Mackintosh and
Adrienne L. Hoarfrost and
Stuart J. Chalk and
John Kalantari and
Kia Khezeli and
Erik L. Antonsen and
Joel Babdor and
Richard Barker and
Sergio E. Baranzini and
Afshin Beheshti and
Guillermo M. Delgado{-}Aparicio and
Benjamin S. Glicksberg and
Casey S. Greene and
Melissa A. Haendel and
Arif A. Hamid and
Philip Heller and
Daniel Jamieson and
Katelyn J. Jarvis and
Svetlana V. Komarova and
Matthieu Komorowski and
Prachi Kothiyal and
Ashish Mahabal and
Uri Manor and
Christopher E. Mason and
Mona Matar and
George I. Mias and
Jack Miller and
Jerry G. Myers Jr. and
Charlotte A. Nelson and
Jonathan Oribello and
Seung{-}Min Park and
Patricia Parsons{-}Wingerter and
R. K. Prabhu and
Robert J. Reynolds and
Amanda Saravia{-}Butler and
Suchi Saria and
Aenor Sawyer and
Nitin Kumar Singh and
Frank Soboczenski and
Michael Snyder and
Karthik Soman and
Corey A. Theriot and
David Van Valen and
Kasthuri Venkateswaran and
Liz Warren and
Liz Worthey and
Marinka Zitnik and
Sylvain V. Costes},
title = {Beyond Low Earth Orbit: Biological Research, Artificial Intelligence,
and Self-Driving Labs},
journal = {CoRR},
volume = {abs/2112.12582},
year = {2021},
url = {https://arxiv.org/abs/2112.12582},
eprinttype = {arXiv},
eprint = {2112.12582},
timestamp = {Tue, 14 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-12582.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-15422,
author = {Peter Vamplew and
Benjamin J. Smith and
Johan K{\"{a}}llstr{\"{o}}m and
Gabriel de Oliveira Ramos and
Roxana Radulescu and
Diederik M. Roijers and
Conor F. Hayes and
Fredrik Heintz and
Patrick Mannion and
Pieter J. K. Libin and
Richard Dazeley and
Cameron Foale},
title = {Scalar reward is not enough: {A} response to Silver, Singh, Precup
and Sutton {(2021)}},
journal = {CoRR},
volume = {abs/2112.15422},
year = {2021},
url = {https://arxiv.org/abs/2112.15422},
eprinttype = {arXiv},
eprint = {2112.15422},
timestamp = {Wed, 05 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-15422.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/YaoKSTS21,
author = {Yuan Yao and
Pantea Kiaei and
Richa Singh and
Shahin Tajik and
Patrick Schaumont},
title = {Programmable {RO} {(PRO):} {A} Multipurpose Countermeasure against
Side-channel and Fault Injection Attacks},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {878},
year = {2021},
url = {https://eprint.iacr.org/2021/878},
timestamp = {Wed, 08 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iacr/YaoKSTS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fdata/MajumdarCSV20,
author = {Puspita Majumdar and
Saheb Chhabra and
Richa Singh and
Mayank Vatsa},
title = {Subgroup Invariant Perturbation for Unbiased Pre-Trained Model Prediction},
journal = {Frontiers Big Data},
volume = {3},
pages = {590296},
year = {2020},
url = {https://doi.org/10.3389/fdata.2020.590296},
doi = {10.3389/FDATA.2020.590296},
timestamp = {Tue, 02 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/fdata/MajumdarCSV20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-com/SharmaVS20,
author = {Richa Sharma and
Vasudha Vashisht and
Umang Singh},
title = {{WOATCA:} {A} secure and energy aware scheme based on whale optimisation
in clustered wireless sensor networks},
journal = {{IET} Commun.},
volume = {14},
number = {8},
pages = {1199--1208},
year = {2020},
url = {https://doi.org/10.1049/iet-com.2019.0359},
doi = {10.1049/IET-COM.2019.0359},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iet-com/SharmaVS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-wss/SharmaVS20,
author = {Richa Sharma and
Vasudha Vashisht and
Umang Singh},
title = {Modelling and simulation frameworks for wireless sensor networks:
a comparative study},
journal = {{IET} Wirel. Sens. Syst.},
volume = {10},
number = {5},
pages = {181--197},
year = {2020},
url = {https://doi.org/10.1049/iet-wss.2020.0046},
doi = {10.1049/IET-WSS.2020.0046},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iet-wss/SharmaVS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-wss/SharmaVS20a,
author = {Richa Sharma and
Vasudha Vashisht and
Umang Singh},
title = {Metaheuristics-based energy efficient clustering in WSNs: challenges
and research contributions},
journal = {{IET} Wirel. Sens. Syst.},
volume = {10},
number = {6},
pages = {253--264},
year = {2020},
url = {https://doi.org/10.1049/iet-wss.2020.0102},
doi = {10.1049/IET-WSS.2020.0102},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iet-wss/SharmaVS20a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijabim/MisraSM20,
author = {Richa Misra and
Sonali Singh and
Renuka Mahajan},
title = {An Analysis on Consumer Preference of Ayurvedic Products in Indian
Market},
journal = {Int. J. Asian Bus. Inf. Manag.},
volume = {11},
number = {4},
pages = {1--15},
year = {2020},
url = {https://doi.org/10.4018/ijabim.2020100101},
doi = {10.4018/IJABIM.2020100101},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijabim/MisraSM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcbpl/MisraSS20,
author = {Richa Misra and
Sonali Singh and
Nidhi Singh},
title = {Assessing Behavioral Patterns for Online Gaming Addiction: {A} Study
Among Indian Youth},
journal = {Int. J. Cyber Behav. Psychol. Learn.},
volume = {10},
number = {2},
pages = {43--64},
year = {2020},
url = {https://doi.org/10.4018/IJCBPL.2020040104},
doi = {10.4018/IJCBPL.2020040104},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijcbpl/MisraSS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdet/KushwahaMAM20,
author = {Pooja Singh Kushwaha and
Renuka Mahajan and
Rekha Attri and
Richa Misra},
title = {Study of Attitude of B-School Faculty for Learning Management System
Implementation an Indian Case Study},
journal = {Int. J. Distance Educ. Technol.},
volume = {18},
number = {2},
pages = {52--72},
year = {2020},
url = {https://doi.org/10.4018/IJDET.2020040104},
doi = {10.4018/IJDET.2020040104},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijdet/KushwahaMAM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijinfoman/DubeyT20,
author = {Richa Singh Dubey and
Vijayshri Tiwari},
title = {Operationalisation of soft skill attributes and determining the existing
gap in novice {ICT} professionals},
journal = {Int. J. Inf. Manag.},
volume = {50},
pages = {375--386},
year = {2020},
url = {https://doi.org/10.1016/j.ijinfomgt.2019.09.006},
doi = {10.1016/J.IJINFOMGT.2019.09.006},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijinfoman/DubeyT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/istr/SinghRAS20,
author = {Kunwar Singh and
C. Pandu Rangan and
Richa Agrawal and
Samir Sheshank},
title = {Provably secure lattice based identity based unidirectional {PRE}
and {PRE+} schemes},
journal = {J. Inf. Secur. Appl.},
volume = {54},
pages = {102569},
year = {2020},
url = {https://doi.org/10.1016/j.jisa.2020.102569},
doi = {10.1016/J.JISA.2020.102569},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/istr/SinghRAS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/MishraBSDJSRG20,
author = {Avinash Mishra and
Rohit Bansal and
Shravan Sreenivasan and
Rozaleen Dash and
Srishti Joshi and
Richa Singh and
Anurag S. Rathore and
Gaurav Goel},
title = {Structure-Based Design of Small Peptide Ligands to Inhibit Early-Stage
Protein Aggregation Nucleation},
journal = {J. Chem. Inf. Model.},
volume = {60},
number = {6},
pages = {3304--3314},
year = {2020},
url = {https://doi.org/10.1021/acs.jcim.0c00226},
doi = {10.1021/ACS.JCIM.0C00226},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/MishraBSDJSRG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmlr/AryaBCDHHHLLMMP20,
author = {Vijay Arya and
Rachel K. E. Bellamy and
Pin{-}Yu Chen and
Amit Dhurandhar and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Q. Vera Liao and
Ronny Luss and
Aleksandra Mojsilovic and
Sami Mourad and
Pablo Pedemonte and
Ramya Raghavendra and
John T. Richards and
Prasanna Sattigeri and
Karthikeyan Shanmugam and
Moninder Singh and
Kush R. Varshney and
Dennis Wei and
Yunfeng Zhang},
title = {{AI} Explainability 360: An Extensible Toolkit for Understanding Data
and Machine Learning Models},
journal = {J. Mach. Learn. Res.},
volume = {21},
pages = {130:1--130:6},
year = {2020},
url = {https://jmlr.org/papers/v21/19-1035.html},
timestamp = {Wed, 11 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmlr/AryaBCDHHHLLMMP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/TajalliPCCGGGHH20,
author = {Armin Tajalli and
Mani Bastani Parizi and
Dario Albino Carnelli and
Chen Cao and
Kiarash Gharibdoust and
Davide Gorret and
Amit Gupta and
Christopher Hall and
Ahmed Hassanin and
Klaas L. Hofstra and
Brian Holden and
Ali Hormati and
John Keay and
Yohann Mogentale and
Victor Perrin and
John Phillips and
Sumathi Raparthy and
Amin Shokrollahi and
David Stauffer and
Richard Simpson and
Andrew Stewart and
Giuseppe Surace and
Omid Talebi Amiri and
Emanuele Truffa and
Anton Tschank and
Roger Ulrich and
Christoph Walter and
Anant Singh},
title = {A 1.02-pJ/b 20.83-Gb/s/Wire {USR} Transceiver Using {CNRZ-5} in 16-nm
FinFET},
journal = {{IEEE} J. Solid State Circuits},
volume = {55},
number = {4},
pages = {1108--1123},
year = {2020},
url = {https://doi.org/10.1109/JSSC.2019.2962655},
doi = {10.1109/JSSC.2019.2962655},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/TajalliPCCGGGHH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/SrivastavaGKS20,
author = {Richa Srivastava and
Om Krishna Gupta and
Anup Kumar and
Devesh Singh},
title = {Low-voltage bulk-driven self-cascode transistor based voltage differencing
inverting buffered amplifier and its application as universal filter},
journal = {Microelectron. J.},
volume = {102},
pages = {104828},
year = {2020},
url = {https://doi.org/10.1016/j.mejo.2020.104828},
doi = {10.1016/J.MEJO.2020.104828},
timestamp = {Tue, 11 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mj/SrivastavaGKS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/SmithGSMEAUNSKD20,
author = {Morgan E. Smith and
Emily Griswold and
Brajendra K. Singh and
Emmanuel Miri and
Abel Eigege and
Solomon Adelamo and
John Umaru and
Kenrick Nwodu and
Yohanna Sambo and
Jonathan Kadimbo and
Jacob Danyobi and
Frank O. Richards and
Edwin Michael},
title = {Predicting lymphatic filariasis elimination in data-limited settings:
{A} reconstructive computational framework for combining data generation
and model discovery},
journal = {PLoS Comput. Biol.},
volume = {16},
number = {7},
year = {2020},
url = {https://doi.org/10.1371/journal.pcbi.1007506},
doi = {10.1371/JOURNAL.PCBI.1007506},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/SmithGSMEAUNSKD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ppna/SrivastavaASTN20,
author = {Gaurav Srivastava and
Richa Agrawal and
Kunwar Singh and
Rajeev Tripathi and
Kshirasagar Naik},
title = {A hierarchical identity-based security for delay tolerant networks
using lattice-based cryptography},
journal = {Peer-to-Peer Netw. Appl.},
volume = {13},
number = {1},
pages = {348--367},
year = {2020},
url = {https://doi.org/10.1007/s12083-019-00776-6},
doi = {10.1007/S12083-019-00776-6},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ppna/SrivastavaASTN20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbbis/BeveridgeDPS20,
author = {J. Ross Beveridge and
Mohamed Daoudi and
Catherine Pelachaud and
Richa Singh},
title = {Selected Best Works From Automated Face and Gesture Recognition 2019},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {2},
number = {2},
pages = {83--84},
year = {2020},
url = {https://doi.org/10.1109/TBIOM.2020.2982274},
doi = {10.1109/TBIOM.2020.2982274},
timestamp = {Fri, 17 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbbis/BeveridgeDPS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbbis/GhoshSV20,
author = {Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa},
title = {Subclass Heterogeneity Aware Loss for Cross-Spectral Cross-Resolution
Face Recognition},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {2},
number = {3},
pages = {245--256},
year = {2020},
url = {https://doi.org/10.1109/TBIOM.2020.2984324},
doi = {10.1109/TBIOM.2020.2984324},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbbis/GhoshSV20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbbis/MalhotraSVS20,
author = {Aakarsh Malhotra and
Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {On Matching Finger-Selfies Using Deep Scattering Networks},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {2},
number = {4},
pages = {350--362},
year = {2020},
url = {https://doi.org/10.1109/TBIOM.2020.2999850},
doi = {10.1109/TBIOM.2020.2999850},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbbis/MalhotraSVS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbbis/SuriVS20,
author = {Anshuman Suri and
Mayank Vatsa and
Richa Singh},
title = {{A2-LINK:} Recognizing Disguised Faces via Active Learning and Adversarial
Noise Based Inter-Domain Knowledge},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {2},
number = {4},
pages = {326--336},
year = {2020},
url = {https://doi.org/10.1109/TBIOM.2020.2998912},
doi = {10.1109/TBIOM.2020.2998912},
timestamp = {Mon, 20 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbbis/SuriVS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/telsys/SharmaVS20,
author = {Richa Sharma and
Vasudha Vashisht and
Umang Singh},
title = {eeTMFO/GA: a secure and energy efficient cluster head selection in
wireless sensor networks},
journal = {Telecommun. Syst.},
volume = {74},
number = {3},
pages = {253--268},
year = {2020},
url = {https://doi.org/10.1007/s11235-020-00654-0},
doi = {10.1007/S11235-020-00654-0},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/telsys/SharmaVS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/0001ASNV20,
author = {Richa Singh and
Akshay Agarwal and
Maneet Singh and
Shruti Nagpal and
Mayank Vatsa},
title = {On the Robustness of Face Recognition Algorithms Against Attacks and
Bias},
booktitle = {The Thirty-Fourth {AAAI} Conference on Artificial Intelligence, {AAAI}
2020, The Thirty-Second Innovative Applications of Artificial Intelligence
Conference, {IAAI} 2020, The Tenth {AAAI} Symposium on Educational
Advances in Artificial Intelligence, {EAAI} 2020, New York, NY, USA,
February 7-12, 2020},
pages = {13583--13589},
publisher = {{AAAI} Press},
year = {2020},
url = {https://doi.org/10.1609/aaai.v34i09.7085},
doi = {10.1609/AAAI.V34I09.7085},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/0001ASNV20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/JindalS0V020,
author = {Sarthak Jindal and
Raghav Sood and
Richa Singh and
Mayank Vatsa and
Tanmoy Chakraborty},
editor = {Hu{\'{a}}scar Espinoza and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Xin Cynthia Chen and
Se{\'{a}}n S. {\'{O}}h{\'{E}}igeartaigh and
Xiaowei Huang and
Mauricio Castillo{-}Effen and
Richard Mallah and
John A. McDermid},
title = {NewsBag: {A} Benchmark Multimodal Dataset for Fake News Detection},
booktitle = {Proceedings of the Workshop on Artificial Intelligence Safety, co-located
with 34th {AAAI} Conference on Artificial Intelligence, SafeAI@AAAI
2020, New York City, NY, USA, February 7, 2020},
series = {{CEUR} Workshop Proceedings},
volume = {2560},
pages = {138--145},
publisher = {CEUR-WS.org},
year = {2020},
url = {https://ceur-ws.org/Vol-2560/paper27.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:15 +0100},
biburl = {https://dblp.org/rec/conf/aaai/JindalS0V020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/RajendranLVLS20,
author = {Janarthanan Rajendran and
Richard L. Lewis and
Vivek Veeriah and
Honglak Lee and
Satinder Singh},
title = {How Should an Agent Practice?},
booktitle = {The Thirty-Fourth {AAAI} Conference on Artificial Intelligence, {AAAI}
2020, The Thirty-Second Innovative Applications of Artificial Intelligence
Conference, {IAAI} 2020, The Tenth {AAAI} Symposium on Educational
Advances in Artificial Intelligence, {EAAI} 2020, New York, NY, USA,
February 7-12, 2020},
pages = {5454--5461},
publisher = {{AAAI} Press},
year = {2020},
url = {https://doi.org/10.1609/aaai.v34i04.5995},
doi = {10.1609/AAAI.V34I04.5995},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/RajendranLVLS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aies/JavadiCCLS20,
author = {Seyyed Ahmad Javadi and
Richard Cloete and
Jennifer Cobbe and
Michelle Seng Ah Lee and
Jatinder Singh},
editor = {Annette N. Markham and
Julia Powles and
Toby Walsh and
Anne L. Washington},
title = {Monitoring Misuse for Accountable 'Artificial Intelligence as a Service'},
booktitle = {{AIES} '20: {AAAI/ACM} Conference on AI, Ethics, and Society, New
York, NY, USA, February 7-8, 2020},
pages = {300--306},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3375627.3375873},
doi = {10.1145/3375627.3375873},
timestamp = {Thu, 14 Oct 2021 10:27:33 +0200},
biburl = {https://dblp.org/rec/conf/aies/JavadiCCLS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigmm/KeshariGCV020,
author = {Rohit Keshari and
Soumyadeep Ghosh and
Saheb Chhabra and
Mayank Vatsa and
Richa Singh},
title = {Unravelling Small Sample Size Problems in the Deep Learning World},
booktitle = {6th {IEEE} International Conference on Multimedia Big Data, BigMM
2020, New Delhi, India, September 24-26, 2020},
pages = {134--143},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/BigMM50055.2020.00028},
doi = {10.1109/BIGMM50055.2020.00028},
timestamp = {Wed, 28 Oct 2020 09:58:11 +0100},
biburl = {https://dblp.org/rec/conf/bigmm/KeshariGCV020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/TajalliPCCGGHHH20,
author = {Armin Tajalli and
Mani Bastani Parizi and
Dario Albino Carnelli and
Chen Cao and
Kiarash Gharibdoust and
Amit Gupta and
Ahmed Hassanin and
Klaas L. Hofstra and
Brian Holden and
Ali Hormati and
John Keay and
Amin Shokrollahi and
David Stauffer and
Richard Simpson and
Andrew Stewart and
Giuseppe Surace and
Omid Talebi Amiri and
Anton Tschank and
Roger Ulrich and
Christoph Walter and
Anant Singh},
title = {Short-Reach and Pin-Efficient Interfaces Using Correlated {NRZ}},
booktitle = {2020 {IEEE} Custom Integrated Circuits Conference, {CICC} 2020, Boston,
MA, USA, March 22-25, 2020},
pages = {1--8},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/CICC48029.2020.9075920},
doi = {10.1109/CICC48029.2020.9075920},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cicc/TajalliPCCGGHHH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/00010V20,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {The Role of 'Sign' and 'Direction' of Gradient on the Performance
of {CNN}},
booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} Workshops 2020, Seattle, WA, USA, June 14-19, 2020},
pages = {2748--2756},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020},
url = {https://openaccess.thecvf.com/content\_CVPRW\_2020/html/w39/Agarwal\_The\_Role\_of\_Sign\_and\_Direction\_of\_Gradient\_on\_the\_CVPRW\_2020\_paper.html},
doi = {10.1109/CVPRW50498.2020.00331},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/00010V20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/0001V0R20,
author = {Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Noise is Inside Me! Generating Adversarial Perturbations with Noise
Derived from Natural Filters},
booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} Workshops 2020, Seattle, WA, USA, June 14-19, 2020},
pages = {3354--3363},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020},
url = {https://openaccess.thecvf.com/content\_CVPRW\_2020/html/w47/Agarwal\_Noise\_Is\_Inside\_Me\_Generating\_Adversarial\_Perturbations\_With\_Noise\_Derived\_CVPRW\_2020\_paper.html},
doi = {10.1109/CVPRW50498.2020.00395},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/0001V0R20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/Goel0V0R20,
author = {Akhil Goel and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {DNDNet: Reconfiguring {CNN} for Adversarial Robustness},
booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} Workshops 2020, Seattle, WA, USA, June 14-19, 2020},
pages = {103--110},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020},
url = {https://openaccess.thecvf.com/content\_CVPRW\_2020/html/w1/Goel\_DNDNet\_Reconfiguring\_CNN\_for\_Adversarial\_Robustness\_CVPRW\_2020\_paper.html},
doi = {10.1109/CVPRW50498.2020.00019},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/Goel0V0R20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/JainM0V20,
author = {Anubhav Jain and
Puspita Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Detecting GANs and Retouching based Digital Alterations via {DAD-HCNN}},
booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} Workshops 2020, Seattle, WA, USA, June 14-19, 2020},
pages = {2870--2879},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020},
url = {https://openaccess.thecvf.com/content\_CVPRW\_2020/html/w39/Jain\_Detecting\_GANs\_and\_Retouching\_Based\_Digital\_Alterations\_via\_DAD-HCNN\_CVPRW\_2020\_paper.html},
doi = {10.1109/CVPRW50498.2020.00344},
timestamp = {Wed, 08 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/JainM0V20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/Keshari0V20,
author = {Rohit Keshari and
Richa Singh and
Mayank Vatsa},
title = {Generalized Zero-Shot Learning via Over-Complete Distribution},
booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2020, Seattle, WA, USA, June 13-19, 2020},
pages = {13297--13305},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020},
url = {https://openaccess.thecvf.com/content\_CVPR\_2020/html/Keshari\_Generalized\_Zero-Shot\_Learning\_via\_Over-Complete\_Distribution\_CVPR\_2020\_paper.html},
doi = {10.1109/CVPR42600.2020.01331},
timestamp = {Tue, 31 Aug 2021 14:00:04 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/Keshari0V20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/MalhotraCV020,
author = {Aakarsh Malhotra and
Saheb Chhabra and
Mayank Vatsa and
Richa Singh},
title = {On Privacy Preserving Anonymization of Finger-selfies},
booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} Workshops 2020, Seattle, WA, USA, June 14-19, 2020},
pages = {120--128},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020},
url = {https://openaccess.thecvf.com/content\_CVPRW\_2020/html/w1/Malhotra\_On\_Privacy\_Preserving\_Anonymization\_of\_Finger-Selfies\_CVPRW\_2020\_paper.html},
doi = {10.1109/CVPRW50498.2020.00021},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/MalhotraCV020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/NagpalS0V20,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa},
title = {Attribute Aware Filter-Drop for Bias-Invariant Classification},
booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} Workshops 2020, Seattle, WA, USA, June 14-19, 2020},
pages = {147--153},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020},
url = {https://openaccess.thecvf.com/content\_CVPRW\_2020/html/w1/Nagpal\_Attribute\_Aware\_Filter-Drop\_for\_Bias\_Invariant\_Classification\_CVPRW\_2020\_paper.html},
doi = {10.1109/CVPRW50498.2020.00024},
timestamp = {Mon, 30 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/NagpalS0V20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/AnshumaanAVS20,
author = {Divyam Anshumaan and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
editor = {Adrien Bartoli and
Andrea Fusiello},
title = {WaveTransform: Crafting Adversarial Examples via Input Decomposition},
booktitle = {Computer Vision - {ECCV} 2020 Workshops - Glasgow, UK, August 23-28,
2020, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {12535},
pages = {152--168},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-66415-2\_10},
doi = {10.1007/978-3-030-66415-2\_10},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eccv/AnshumaanAVS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/KarSVS20,
author = {Amlaan Kar and
Maneet Singh and
Mayank Vatsa and
Richa Singh},
editor = {Adrien Bartoli and
Andrea Fusiello},
title = {Disguised Face Verification Using Inverse Disguise Quality},
booktitle = {Computer Vision - {ECCV} 2020 Workshops - Glasgow, UK, August 23-28,
2020, Proceedings, Part {VI}},
series = {Lecture Notes in Computer Science},
volume = {12540},
pages = {524--540},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-65414-6\_36},
doi = {10.1007/978-3-030-65414-6\_36},
timestamp = {Wed, 06 Jan 2021 16:08:53 +0100},
biburl = {https://dblp.org/rec/conf/eccv/KarSVS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/SinhaVS20,
author = {Raunak Sinha and
Mayank Vatsa and
Richa Singh},
editor = {Adrien Bartoli and
Andrea Fusiello},
title = {FamilyGAN: Generating Kin Face Images Using Generative Adversarial
Networks},
booktitle = {Computer Vision - {ECCV} 2020 Workshops - Glasgow, UK, August 23-28,
2020, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {12537},
pages = {297--311},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-67070-2\_18},
doi = {10.1007/978-3-030-67070-2\_18},
timestamp = {Tue, 02 Feb 2021 17:17:09 +0100},
biburl = {https://dblp.org/rec/conf/eccv/SinhaVS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fat/AryaBCDHHHLLMMP20,
author = {Vijay Arya and
Rachel K. E. Bellamy and
Pin{-}Yu Chen and
Amit Dhurandhar and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Q. Vera Liao and
Ronny Luss and
Aleksandra Mojsilovic and
Sami Mourad and
Pablo Pedemonte and
Ramya Raghavendra and
John T. Richards and
Prasanna Sattigeri and
Karthikeyan Shanmugam and
Moninder Singh and
Kush R. Varshney and
Dennis Wei and
Yunfeng Zhang},
editor = {Mireille Hildebrandt and
Carlos Castillo and
L. Elisa Celis and
Salvatore Ruggieri and
Linnet Taylor and
Gabriela Zanfir{-}Fortuna},
title = {{AI} explainability 360: hands-on tutorial},
booktitle = {FAT* '20: Conference on Fairness, Accountability, and Transparency,
Barcelona, Spain, January 27-30, 2020},
pages = {696},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3351095.3375667},
doi = {10.1145/3351095.3375667},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fat/AryaBCDHHHLLMMP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/BatraRW20,
author = {Jaskirat Singh Batra and
Ra'sheedah Richardson and
Robert Webb},
title = {How can instructors strengthen students' motivation to learn complex
3D concepts in an engineering classroom?},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2020, Uppsala, Sweden,
October 21-24, 2020},
pages = {1--9},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/FIE44824.2020.9274193},
doi = {10.1109/FIE44824.2020.9274193},
timestamp = {Mon, 14 Dec 2020 09:13:16 +0100},
biburl = {https://dblp.org/rec/conf/fie/BatraRW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpec/SinghCS20,
author = {Richa Singh and
Thomas Conroy and
Patrick Schaumont},
title = {Variable Precision Multiplication for Software-Based Neural Networks},
booktitle = {2020 {IEEE} High Performance Extreme Computing Conference, {HPEC}
2020, Waltham, MA, USA, September 22-24, 2020},
pages = {1--7},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/HPEC43674.2020.9286170},
doi = {10.1109/HPEC43674.2020.9286170},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hpec/SinghCS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/NagpalSSV20,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa},
title = {Diversity Blocks for De-biasing Classification Models},
booktitle = {2020 {IEEE} International Joint Conference on Biometrics, {IJCB} 2020,
Houston, TX, USA, September 28 - October 1, 2020},
pages = {1--9},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IJCB48548.2020.9304931},
doi = {10.1109/IJCB48548.2020.9304931},
timestamp = {Thu, 14 Jan 2021 15:14:16 +0100},
biburl = {https://dblp.org/rec/conf/icb/NagpalSSV20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/OsbandDHASSMLSS20,
author = {Ian Osband and
Yotam Doron and
Matteo Hessel and
John Aslanides and
Eren Sezener and
Andre Saraiva and
Katrina McKinney and
Tor Lattimore and
Csaba Szepesv{\'{a}}ri and
Satinder Singh and
Benjamin Van Roy and
Richard S. Sutton and
David Silver and
Hado van Hasselt},
title = {Behaviour Suite for Reinforcement Learning},
booktitle = {8th International Conference on Learning Representations, {ICLR} 2020,
Addis Ababa, Ethiopia, April 26-30, 2020},
publisher = {OpenReview.net},
year = {2020},
url = {https://openreview.net/forum?id=rygf-kSYwH},
timestamp = {Mon, 15 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/OsbandDHASSMLSS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/Chhabra00V20,
author = {Saheb Chhabra and
Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Attack Agnostic Adversarial Defense via Visual Imperceptible Bound},
booktitle = {25th International Conference on Pattern Recognition, {ICPR} 2020,
Virtual Event / Milan, Italy, January 10-15, 2021},
pages = {5302--5309},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICPR48806.2021.9412663},
doi = {10.1109/ICPR48806.2021.9412663},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icpr/Chhabra00V20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/GuptaS0V020,
author = {Mehak Gupta and
Vishal Singh and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {Generalized Iris Presentation Attack Detection Algorithm under Cross-Database
Settings},
booktitle = {25th International Conference on Pattern Recognition, {ICPR} 2020,
Virtual Event / Milan, Italy, January 10-15, 2021},
pages = {5318--5325},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICPR48806.2021.9412700},
doi = {10.1109/ICPR48806.2021.9412700},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icpr/GuptaS0V020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/SanghviS0V020,
author = {Nilay Sanghvi and
Sushant Kumar Singh and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {MixNet for Generalized Face Presentation Attack Detection},
booktitle = {25th International Conference on Pattern Recognition, {ICPR} 2020,
Virtual Event / Milan, Italy, January 10-15, 2021},
pages = {5511--5518},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICPR48806.2021.9412123},
doi = {10.1109/ICPR48806.2021.9412123},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icpr/SanghviS0V020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/YadavKV0N20,
author = {Daksha Yadav and
Naman Kohli and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Age Gap Reducer-GAN for Recognizing Age-Separated Faces},
booktitle = {25th International Conference on Pattern Recognition, {ICPR} 2020,
Virtual Event / Milan, Italy, January 10-15, 2021},
pages = {10090--10097},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICPR48806.2021.9412078},
doi = {10.1109/ICPR48806.2021.9412078},
timestamp = {Fri, 07 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icpr/YadavKV0N20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsoc/SamantCVKN20,
author = {Sunil Singh Samant and
Mohan Baruwal Chhetri and
Quoc Bao Vo and
Ryszard Kowalczyk and
Surya Nepal},
editor = {Hakim Hacid and
Fatma Outay and
Hye{-}young Paik and
Amira Alloum and
Marinella Petrocchi and
Mohamed Reda Bouadjenek and
Amin Beheshti and
Xumin Liu and
Abderrahmane Maaradji},
title = {AuraEN: Autonomous Resource Allocation for Cloud-Hosted Data Processing
Pipelines},
booktitle = {Service-Oriented Computing - {ICSOC} 2020 Workshops - AIOps, CFTIC,
STRAPS, AI-PA, AI-IOTS, and Satellite Events, Dubai, United Arab Emirates,
December 14-17, 2020, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12632},
pages = {77--80},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-76352-7\_12},
doi = {10.1007/978-3-030-76352-7\_12},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icsoc/SamantCVKN20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/RothCSNLGGQIBWB20,
author = {Holger R. Roth and
Ken Chang and
Praveer Singh and
Nir Neumark and
Wenqi Li and
Vikash Gupta and
Sharut Gupta and
Liangqiong Qu and
Alvin Ihsani and
Bernardo C. Bizzo and
Yuhong Wen and
Varun Buch and
Meesam Shah and
Felipe Kitamura and
Matheus Mendon{\c{c}}a and
Vitor Lavor and
Ahmed Harouni and
Colin Compas and
Jesse Tetreault and
Prerna Dogra and
Yan Cheng and
Selnur Erdal and
Richard D. White and
Behrooz Hashemian and
Thomas J. Schultz and
Miao Zhang and
Adam McCarthy and
B. Min Yun and
Elshaimaa Sharaf and
Katharina Viktoria Hoebel and
Jay B. Patel and
Bryan Chen and
Sean Ko and
Evan Leibovitz and
Etta D. Pisano and
Laura Coombs and
Daguang Xu and
Keith J. Dreyer and
Ittai Dayan and
Ram C. Naidu and
Mona Flores and
Daniel L. Rubin and
Jayashree Kalpathy{-}Cramer},
editor = {Shadi Albarqouni and
Spyridon Bakas and
Konstantinos Kamnitsas and
M. Jorge Cardoso and
Bennett A. Landman and
Wenqi Li and
Fausto Milletari and
Nicola Rieke and
Holger Roth and
Daguang Xu and
Ziyue Xu},
title = {Federated Learning for Breast Density Classification: {A} Real-World
Implementation},
booktitle = {Domain Adaptation and Representation Transfer, and Distributed and
Collaborative Learning - Second {MICCAI} Workshop, {DART} 2020, and
First {MICCAI} Workshop, {DCL} 2020, Held in Conjunction with {MICCAI}
2020, Lima, Peru, October 4-8, 2020, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12444},
pages = {181--191},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-60548-3\_18},
doi = {10.1007/978-3-030-60548-3\_18},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miccai/RothCSNLGGQIBWB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/WangHHHSR20,
author = {Shuangyi Wang and
Xilong Hou and
James Housden and
Zengguang Hou and
Davinder Singh and
Kawal S. Rhode},
editor = {Yipeng Hu and
Roxane Licandro and
J. Alison Noble and
Jana Hutter and
Stephen R. Aylward and
Andrew Melbourne and
Esra Abaci Turk and
Jordina Torrents{-}Barrena},
title = {IoT-Based Remote Control Study of a Robotic Trans-Esophageal Ultrasound
Probe via {LAN} and 5G},
booktitle = {Medical Ultrasound, and Preterm, Perinatal and Paediatric Image Analysis
- First International Workshop, {ASMUS} 2020, and 5th International
Workshop, {PIPPI} 2020, Held in Conjunction with {MICCAI} 2020, Lima,
Peru, October 4-8, 2020, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12437},
pages = {171--179},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-60334-2\_17},
doi = {10.1007/978-3-030-60334-2\_17},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miccai/WangHHHSR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/AnthonyETKGHPLP20,
author = {Thomas W. Anthony and
Tom Eccles and
Andrea Tacchetti and
J{\'{a}}nos Kram{\'{a}}r and
Ian Gemp and
Thomas C. Hudson and
Nicolas Porcel and
Marc Lanctot and
Julien P{\'{e}}rolat and
Richard Everett and
Satinder Singh and
Thore Graepel and
Yoram Bachrach},
editor = {Hugo Larochelle and
Marc'Aurelio Ranzato and
Raia Hadsell and
Maria{-}Florina Balcan and
Hsuan{-}Tien Lin},
title = {Learning to Play No-Press Diplomacy with Best Response Policy Iteration},
booktitle = {Advances in Neural Information Processing Systems 33: Annual Conference
on Neural Information Processing Systems 2020, NeurIPS 2020, December
6-12, 2020, virtual},
year = {2020},
url = {https://proceedings.neurips.cc/paper/2020/hash/d1419302db9c022ab1d48681b13d5f8b-Abstract.html},
timestamp = {Wed, 06 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/AnthonyETKGHPLP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pimrc/0001DSGDC20,
author = {Peter J. Smith and
Pawel A. Dmochowski and
Ikram Singh and
Richard D. Green and
Carl P. Dettmann and
Justin P. Coon},
title = {3D Mobility Models and Analysis for UAVs},
booktitle = {31st {IEEE} Annual International Symposium on Personal, Indoor and
Mobile Radio Communications, {PIMRC} 2020, London, United Kingdom,
August 31 - September 3, 2020},
pages = {1--6},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/PIMRC48278.2020.9217263},
doi = {10.1109/PIMRC48278.2020.9217263},
timestamp = {Wed, 17 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pimrc/0001DSGDC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmod/ChenCDD0HKMMNOP20,
author = {Andrew Chen and
Andy Chow and
Aaron Davidson and
Arjun DCunha and
Ali Ghodsi and
Sue Ann Hong and
Andy Konwinski and
Clemens Mewald and
Siddharth Murching and
Tomas Nykodym and
Paul Ogilvie and
Mani Parkhe and
Avesh Singh and
Fen Xie and
Matei Zaharia and
Richard Zang and
Juntai Zheng and
Corey Zumar},
editor = {Sebastian Schelter and
Steven Whang and
Julia Stoyanovich},
title = {Developments in MLflow: {A} System to Accelerate the Machine Learning
Lifecycle},
booktitle = {Proceedings of the Fourth Workshop on Data Management for End-To-End
Machine Learning, In conjunction with the 2020 {ACM} {SIGMOD/PODS}
Conference, DEEM@SIGMOD 2020, Portland, OR, USA, June 14, 2020},
pages = {5:1--5:4},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3399579.3399867},
doi = {10.1145/3399579.3399867},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigmod/ChenCDD0HKMMNOP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vrst/CloeteNS20,
author = {Richard Cloete and
Chris Norval and
Jatinder Singh},
editor = {Robert J. Teather and
Chris Joslin and
Wolfgang Stuerzlinger and
Pablo A. Figueroa and
Yaoping Hu and
Anil Ufuk Batmaz and
Wonsook Lee and
Francisco R. Ortega},
title = {A Call for Auditable Virtual, Augmented and Mixed Reality},
booktitle = {{VRST} '20: 26th {ACM} Symposium on Virtual Reality Software and Technology,
Virtual Event, Canada, November 1-4, 2020},
pages = {16:1--16:6},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3385956.3418960},
doi = {10.1145/3385956.3418960},
timestamp = {Tue, 17 Sep 2024 12:05:45 +0200},
biburl = {https://dblp.org/rec/conf/vrst/CloeteNS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/KumarV020,
author = {Prabhat Kumar and
Mayank Vatsa and
Richa Singh},
title = {Detecting Face2Face Facial Reenactment in Videos},
booktitle = {{IEEE} Winter Conference on Applications of Computer Vision, {WACV}
2020, Snowmass Village, CO, USA, March 1-5, 2020},
pages = {2578--2586},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/WACV45572.2020.9093628},
doi = {10.1109/WACV45572.2020.9093628},
timestamp = {Tue, 18 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wacv/KumarV020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/20/Ghosh0VRP20,
author = {Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha and
Vishal M. Patel},
editor = {Richa Singh and
Mayank Vatsa and
Vishal M. Patel and
Nalini K. Ratha},
title = {Domain Adaptation for Visual Understanding},
booktitle = {Domain Adaptation for Visual Understanding},
pages = {1--15},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-30671-7\_1},
doi = {10.1007/978-3-030-30671-7\_1},
timestamp = {Fri, 12 Jul 2024 19:38:54 +0200},
biburl = {https://dblp.org/rec/books/sp/20/Ghosh0VRP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/20/SankaranV020,
author = {Anush Sankaran and
Mayank Vatsa and
Richa Singh},
editor = {Richa Singh and
Mayank Vatsa and
Vishal M. Patel and
Nalini K. Ratha},
title = {Intuition Learning},
booktitle = {Domain Adaptation for Visual Understanding},
pages = {111--127},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-30671-7\_8},
doi = {10.1007/978-3-030-30671-7\_8},
timestamp = {Fri, 27 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/sp/20/SankaranV020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/20/SVPR2020,
editor = {Richa Singh and
Mayank Vatsa and
Vishal M. Patel and
Nalini K. Ratha},
title = {Domain Adaptation for Visual Understanding},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-30671-7},
doi = {10.1007/978-3-030-30671-7},
isbn = {978-3-030-30670-0},
timestamp = {Fri, 12 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/sp/20/SVPR2020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2001-07444,
author = {Prabhat Kumar and
Mayank Vatsa and
Richa Singh},
title = {Detecting Face2Face Facial Reenactment in Videos},
journal = {CoRR},
volume = {abs/2001.07444},
year = {2020},
url = {https://arxiv.org/abs/2001.07444},
eprinttype = {arXiv},
eprint = {2001.07444},
timestamp = {Tue, 18 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2001-07444.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2001-08383,
author = {Thomas Paul Matthews and
Sadanand Singh and
Brent Mombourquette and
Jason Su and
Meet P. Shah and
Stefano Pedemonte and
Aaron Long and
David Maffit and
Jenny Gurney and
Rodrigo Morales Hoil and
Nikita Ghare and
Douglas Smith and
Stephen M. Moore and
Susan C. Marks and
Richard L. Wahl},
title = {A multi-site study of a breast density deep learning model for full-field
digital mammography and digital breast tomosynthesis exams},
journal = {CoRR},
volume = {abs/2001.08383},
year = {2020},
url = {https://arxiv.org/abs/2001.08383},
eprinttype = {arXiv},
eprint = {2001.08383},
timestamp = {Mon, 19 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2001-08383.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2001-09723,
author = {Seyyed Ahmad Javadi and
Richard Cloete and
Jennifer Cobbe and
Michelle Seng Ah Lee and
Jatinder Singh},
title = {Monitoring Misuse for Accountable 'Artificial Intelligence as a Service'},
journal = {CoRR},
volume = {abs/2001.09723},
year = {2020},
url = {https://arxiv.org/abs/2001.09723},
eprinttype = {arXiv},
eprint = {2001.09723},
timestamp = {Sat, 23 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2001-09723.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2002-02942,
author = {Richa Singh and
Akshay Agarwal and
Maneet Singh and
Shruti Nagpal and
Mayank Vatsa},
title = {On the Robustness of Face Recognition Algorithms Against Attacks and
Bias},
journal = {CoRR},
volume = {abs/2002.02942},
year = {2020},
url = {https://arxiv.org/abs/2002.02942},
eprinttype = {arXiv},
eprint = {2002.02942},
timestamp = {Mon, 10 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2002-02942.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-00666,
author = {Rohit Keshari and
Richa Singh and
Mayank Vatsa},
title = {Generalized Zero-Shot Learning Via Over-Complete Distribution},
journal = {CoRR},
volume = {abs/2004.00666},
year = {2020},
url = {https://arxiv.org/abs/2004.00666},
eprinttype = {arXiv},
eprint = {2004.00666},
timestamp = {Wed, 08 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2004-00666.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-13749,
author = {Shuangyi Wang and
Xilong Hou and
Richard James Housden and
Zengguang Hou and
Davinder Singh and
Kawal S. Rhode},
title = {IoT-based Remote Control Study of a Robotic Trans-esophageal Ultrasound
Probe via {LAN} and 5G},
journal = {CoRR},
volume = {abs/2005.13749},
year = {2020},
url = {https://arxiv.org/abs/2005.13749},
eprinttype = {arXiv},
eprint = {2005.13749},
timestamp = {Wed, 03 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-13749.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-04635,
author = {Thomas W. Anthony and
Tom Eccles and
Andrea Tacchetti and
J{\'{a}}nos Kram{\'{a}}r and
Ian Gemp and
Thomas C. Hudson and
Nicolas Porcel and
Marc Lanctot and
Julien P{\'{e}}rolat and
Richard Everett and
Satinder Singh and
Thore Graepel and
Yoram Bachrach},
title = {Learning to Play No-Press Diplomacy with Best Response Policy Iteration},
journal = {CoRR},
volume = {abs/2006.04635},
year = {2020},
url = {https://arxiv.org/abs/2006.04635},
eprinttype = {arXiv},
eprint = {2006.04635},
timestamp = {Wed, 06 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2006-04635.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2007-00463,
author = {Richa Verma and
Aniruddha Singhal and
Harshad Khadilkar and
Ansuma Basumatary and
Siddharth Nayak and
Harsh Vardhan Singh and
Swagat Kumar and
Rajesh Sinha},
title = {A Generalized Reinforcement Learning Algorithm for Online 3D Bin-Packing},
journal = {CoRR},
volume = {abs/2007.00463},
year = {2020},
url = {https://arxiv.org/abs/2007.00463},
eprinttype = {arXiv},
eprint = {2007.00463},
timestamp = {Mon, 06 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2007-00463.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-00054,
author = {Akhil Goel and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Securing {CNN} Model and Biometric Template using Blockchain},
journal = {CoRR},
volume = {abs/2008.00054},
year = {2020},
url = {https://arxiv.org/abs/2008.00054},
eprinttype = {arXiv},
eprint = {2008.00054},
timestamp = {Mon, 14 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2008-00054.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-00141,
author = {Jing Shi and
Zhiheng Li and
Haitian Zheng and
Yihang Xu and
Tianyou Xiao and
Weitao Tan and
Xiaoning Guo and
Sizhe Li and
Bin Yang and
Zhexin Xu and
Ruitao Lin and
Zhongkai Shangguan and
Yue Zhao and
Jingwen Wang and
Rohan Sharma and
Surya Iyer and
Ajinkya Deshmukh and
Raunak Mahalik and
Srishti Singh and
Jayant G. Rohra and
Yipeng Zhang and
Tongyu Yang and
Xuan Wen and
Ethan Fahnestock and
Bryce Ikeda and
Ian Lawson and
Alan Finkelstein and
Kehao Guo and
Richard Magnotti and
Andrew Sexton and
Jeet Ketan Thaker and
Yiyang Su and
Chenliang Xu},
title = {Actor-Action Video Classification {CSC} 249/449 Spring 2020 Challenge
Report},
journal = {CoRR},
volume = {abs/2008.00141},
year = {2020},
url = {https://arxiv.org/abs/2008.00141},
eprinttype = {arXiv},
eprint = {2008.00141},
timestamp = {Thu, 07 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2008-00141.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-01993,
author = {Puspita Majumdar and
Saheb Chhabra and
Richa Singh and
Mayank Vatsa},
title = {Subclass Contrastive Loss for Injured Face Recognition},
journal = {CoRR},
volume = {abs/2008.01993},
year = {2020},
url = {https://arxiv.org/abs/2008.01993},
eprinttype = {arXiv},
eprint = {2008.01993},
timestamp = {Fri, 07 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2008-01993.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-03205,
author = {Aakarsh Malhotra and
Surbhi Mittal and
Puspita Majumdar and
Saheb Chhabra and
Kartik Thakral and
Mayank Vatsa and
Richa Singh and
Santanu Chaudhury and
Ashwin Pudrod and
Anjali Agrawal},
title = {Multi-Task Driven Explainable Diagnosis of {COVID-19} using Chest
X-ray Images},
journal = {CoRR},
volume = {abs/2008.03205},
year = {2020},
url = {https://arxiv.org/abs/2008.03205},
eprinttype = {arXiv},
eprint = {2008.03205},
timestamp = {Mon, 17 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2008-03205.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-03522,
author = {Rohit Keshari and
Soumyadeep Ghosh and
Saheb Chhabra and
Mayank Vatsa and
Richa Singh},
title = {Unravelling Small Sample Size Problems in the Deep Learning World},
journal = {CoRR},
volume = {abs/2008.03522},
year = {2020},
url = {https://arxiv.org/abs/2008.03522},
eprinttype = {arXiv},
eprint = {2008.03522},
timestamp = {Fri, 14 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2008-03522.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2009-01871,
author = {Holger R. Roth and
Ken Chang and
Praveer Singh and
Nir Neumark and
Wenqi Li and
Vikash Gupta and
Sharut Gupta and
Liangqiong Qu and
Alvin Ihsani and
Bernardo C. Bizzo and
Yuhong Wen and
Varun Buch and
Meesam Shah and
Felipe Kitamura and
Matheus Mendon{\c{c}}a and
Vitor Lavor and
Ahmed Harouni and
Colin Compas and
Jesse Tetreault and
Prerna Dogra and
Yan Cheng and
Selnur Erdal and
Richard D. White and
Behrooz Hashemian and
Thomas J. Schultz and
Miao Zhang and
Adam McCarthy and
B. Min Yun and
Elshaimaa Sharaf and
Katharina Viktoria Hoebel and
Jay B. Patel and
Bryan Chen and
Sean Ko and
Evan Leibovitz and
Etta D. Pisano and
Laura Coombs and
Daguang Xu and
Keith J. Dreyer and
Ittai Dayan and
Ram C. Naidu and
Mona Flores and
Daniel L. Rubin and
Jayashree Kalpathy{-}Cramer},
title = {Federated Learning for Breast Density Classification: {A} Real-World
Implementation},
journal = {CoRR},
volume = {abs/2009.01871},
year = {2020},
url = {https://arxiv.org/abs/2009.01871},
eprinttype = {arXiv},
eprint = {2009.01871},
timestamp = {Fri, 11 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2009-01871.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2009-10190,
author = {Ming Y. Lu and
Dehan Kong and
Jana Lipkov{\'{a}} and
Richard J. Chen and
Rajendra Singh and
Drew F. K. Williamson and
Tiffany Y. Chen and
Faisal Mahmood},
title = {Federated Learning for Computational Pathology on Gigapixel Whole
Slide Images},
journal = {CoRR},
volume = {abs/2009.10190},
year = {2020},
url = {https://arxiv.org/abs/2009.10190},
eprinttype = {arXiv},
eprint = {2009.10190},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2009-10190.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-13244,
author = {Mehak Gupta and
Vishal Singh and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {Generalized Iris Presentation Attack Detection Algorithm under Cross-Database
Settings},
journal = {CoRR},
volume = {abs/2010.13244},
year = {2020},
url = {https://arxiv.org/abs/2010.13244},
eprinttype = {arXiv},
eprint = {2010.13244},
timestamp = {Mon, 02 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-13244.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-13246,
author = {Nilay Sanghvi and
Sushant Kumar Singh and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {MixNet for Generalized Face Presentation Attack Detection},
journal = {CoRR},
volume = {abs/2010.13246},
year = {2020},
url = {https://arxiv.org/abs/2010.13246},
eprinttype = {arXiv},
eprint = {2010.13246},
timestamp = {Mon, 02 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-13246.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-13247,
author = {Saheb Chhabra and
Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Attack Agnostic Adversarial Defense via Visual Imperceptible Bound},
journal = {CoRR},
volume = {abs/2010.13247},
year = {2020},
url = {https://arxiv.org/abs/2010.13247},
eprinttype = {arXiv},
eprint = {2010.13247},
timestamp = {Mon, 02 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-13247.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-13778,
author = {Clarice D. Aiello and
D. D. Awschalom and
Hannes Bernien and
Tina Brower{-}Thomas and
Kenneth R. Brown and
Todd A. Brun and
Justin R. Caram and
Eric Chitambar and
Rosa Di Felice and
Michael F. J. Fox and
Stephan Haas and
Alexander W. Holleitner and
Eric R. Hudson and
Jeffrey H. Hunt and
Robert Joynt and
Scott Koziol and
H. J. Lewandowski and
Douglas T. McClure and
Jens Palsberg and
Gina Passante and
Kristen L. Pudenz and
Christopher J. K. Richardson and
Jessica L. Rosenberg and
R. S. Ross and
Mark Saffman and
M. Singh and
David W. Steuerman and
Chad Stark and
Jos Thijssen and
A. Nick Vamivakas and
James D. Whitfield and
Benjamin M. Zwickl},
title = {Achieving a quantum smart workforce},
journal = {CoRR},
volume = {abs/2010.13778},
year = {2020},
url = {https://arxiv.org/abs/2010.13778},
eprinttype = {arXiv},
eprint = {2010.13778},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-13778.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-15195,
author = {Wilka Carvalho and
Anthony Liang and
Kimin Lee and
Sungryull Sohn and
Honglak Lee and
Richard L. Lewis and
Satinder Singh},
title = {Reinforcement Learning for Sparse-Reward Object-Interaction Tasks
in First-person Simulated 3D Environments},
journal = {CoRR},
volume = {abs/2010.15195},
year = {2020},
url = {https://arxiv.org/abs/2010.15195},
eprinttype = {arXiv},
eprint = {2010.15195},
timestamp = {Wed, 20 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-15195.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-15773,
author = {Divyam Anshumaan and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {WaveTransform: Crafting Adversarial Examples via Input Decomposition},
journal = {CoRR},
volume = {abs/2010.15773},
year = {2020},
url = {https://arxiv.org/abs/2010.15773},
eprinttype = {arXiv},
eprint = {2010.15773},
timestamp = {Tue, 03 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-15773.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-02272,
author = {Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Trustworthy {AI}},
journal = {CoRR},
volume = {abs/2011.02272},
year = {2020},
url = {https://arxiv.org/abs/2011.02272},
eprinttype = {arXiv},
eprint = {2011.02272},
timestamp = {Fri, 06 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-02272.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-05897,
author = {Daksha Yadav and
Naman Kohli and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Age Gap Reducer-GAN for Recognizing Age-Separated Faces},
journal = {CoRR},
volume = {abs/2011.05897},
year = {2020},
url = {https://arxiv.org/abs/2011.05897},
eprinttype = {arXiv},
eprint = {2011.05897},
timestamp = {Thu, 12 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-05897.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2012-01772,
author = {Darshan Gandhi and
Rohan Sukumaran and
Priyanshi Katiyar and
Alex Radunsky and
Sunaina Anand and
Shailesh Advani and
Jil Kothari and
Kasia Jakimowicz and
Sheshank Shankar and
Sethuraman T. V. and
Krutika Misra and
Aishwarya Saxena and
Sanskruti Landage and
Richa Sonker and
Parth Patwa and
Aryan Mahindra and
Mikhail Dmitrienko and
Kanishka Vaish and
Ashley Mehra and
Srinidhi Murali and
Rohan Iyer and
Joseph Bae and
Vivek Sharma and
Abhishek Singh and
Rachel Barbar and
Ramesh Raskar},
title = {Digital Landscape of {COVID-19} Testing: Challenges and Opportunities},
journal = {CoRR},
volume = {abs/2012.01772},
year = {2020},
url = {https://arxiv.org/abs/2012.01772},
eprinttype = {arXiv},
eprint = {2012.01772},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2012-01772.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/BellamyDHHHKLMM19,
author = {Rachel K. E. Bellamy and
Kuntal Dey and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Kalapriya Kannan and
Pranay Lohia and
Jacquelyn Martino and
Sameep Mehta and
Aleksandra Mojsilovic and
Seema Nagar and
Karthikeyan Natesan Ramamurthy and
John T. Richards and
Diptikalyan Saha and
Prasanna Sattigeri and
Moninder Singh and
Kush R. Varshney and
Yunfeng Zhang},
title = {{AI} Fairness 360: An extensible toolkit for detecting and mitigating
algorithmic bias},
journal = {{IBM} J. Res. Dev.},
volume = {63},
number = {4/5},
pages = {4:1--4:15},
year = {2019},
url = {https://doi.org/10.1147/JRD.2019.2942287},
doi = {10.1147/JRD.2019.2942287},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ibmrd/BellamyDHHHKLMM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-com/SharmaVS19,
author = {Richa Sharma and
Vasudha Vashisht and
Umang Singh},
title = {{EEFCM-DE:} energy-efficient clustering based on fuzzy {C} means and
differential evolution algorithm in WSNs},
journal = {{IET} Commun.},
volume = {13},
number = {8},
pages = {996--1007},
year = {2019},
url = {https://doi.org/10.1049/iet-com.2018.5546},
doi = {10.1049/IET-COM.2018.5546},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iet-com/SharmaVS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbra/SinghBBMK19,
author = {Pushpendra Singh and
Felix Bast and
Satej Bhushan and
Richa Mehra and
Pooja Kamboj},
title = {Molecular docking and in vitro study of Syzygium cumini-derived natural
compounds on receptor tyrosine kinases pathway components},
journal = {Int. J. Bioinform. Res. Appl.},
volume = {15},
number = {2},
pages = {144--158},
year = {2019},
url = {https://doi.org/10.1504/IJBRA.2019.099576},
doi = {10.1504/IJBRA.2019.099576},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbra/SinghBBMK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcv/GoswamiARSV19,
author = {Gaurav Goswami and
Akshay Agarwal and
Nalini K. Ratha and
Richa Singh and
Mayank Vatsa},
title = {Detecting and Mitigating Adversarial Perturbations for Robust Face
Recognition},
journal = {Int. J. Comput. Vis.},
volume = {127},
number = {6-7},
pages = {719--742},
year = {2019},
url = {https://doi.org/10.1007/s11263-019-01160-w},
doi = {10.1007/S11263-019-01160-W},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijcv/GoswamiARSV19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdats/SharmaSK19,
author = {Richa Sharma and
Shailendra Narayan Singh and
Sujata Khatri},
title = {Data mining classification techniques - comparison for better accuracy
in prediction of cardiovascular disease},
journal = {Int. J. Data Anal. Tech. Strateg.},
volume = {11},
number = {4},
pages = {356--373},
year = {2019},
url = {https://doi.org/10.1504/IJDATS.2019.103756},
doi = {10.1504/IJDATS.2019.103756},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijdats/SharmaSK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/AgarwalKWVPSV19,
author = {Akshay Agarwal and
Rohit Keshari and
Manya Wadhwa and
Mansi Vijh and
Chandani Parmar and
Richa Singh and
Mayank Vatsa},
title = {Iris sensor identification in multi-camera environment},
journal = {Inf. Fusion},
volume = {45},
pages = {333--345},
year = {2019},
url = {https://doi.org/10.1016/j.inffus.2017.11.004},
doi = {10.1016/J.INFFUS.2017.11.004},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/inffus/AgarwalKWVPSV19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/SinghSR19,
author = {Maneet Singh and
Richa Singh and
Arun Ross},
title = {A comprehensive overview of biometric fusion},
journal = {Inf. Fusion},
volume = {52},
pages = {187--205},
year = {2019},
url = {https://doi.org/10.1016/j.inffus.2018.12.003},
doi = {10.1016/J.INFFUS.2018.12.003},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/inffus/SinghSR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/SunLYXNEDLSSZ19,
author = {Xin Sun and
Xin Li and
Jiong Yang and
Jinyang Xi and
Ryky Nelson and
Christina Ertural and
Richard Dronskowski and
Weishu Liu and
Gerald J. Snyder and
David J. Singh and
Wenqing Zhang},
title = {Achieving band convergence by tuning the bonding ionicity in n-type
Mg3Sb2},
journal = {J. Comput. Chem.},
volume = {40},
number = {18},
pages = {1693--1700},
year = {2019},
url = {https://doi.org/10.1002/jcc.25822},
doi = {10.1002/JCC.25822},
timestamp = {Mon, 19 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcc/SunLYXNEDLSSZ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/LiuSZLTDZZKLCMG19,
author = {Zhijie Liu and
Suresh B. Singh and
Yajun Zheng and
Peter Lindblom and
Colin Tice and
Chengguo Dong and
Linghang Zhuang and
Yi Zhao and
Barbara A. Kruk and
Deepak Lala and
David A. Claremon and
Gerard M. McGeehan and
Richard D. Gregg and
Robert Cain},
title = {Discovery of Potent Inhibitors of 11{\(\beta\)}-Hydroxysteroid Dehydrogenase
Type 1 Using a Novel Growth-Based Protocol of in Silico Screening
and Optimization in {CONTOUR}},
journal = {J. Chem. Inf. Model.},
volume = {59},
number = {8},
pages = {3422--3436},
year = {2019},
url = {https://doi.org/10.1021/acs.jcim.9b00198},
doi = {10.1021/ACS.JCIM.9B00198},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/LiuSZLTDZZKLCMG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jdi/SinghDGFL19,
author = {Varun Singh and
Varun Danda and
Richard J. T. Gorniak and
Adam E. Flanders and
Paras Lakhani},
title = {Assessment of Critical Feeding Tube Malpositions on Radiographs Using
Deep Learning},
journal = {J. Digit. Imaging},
volume = {32},
number = {4},
pages = {651--655},
year = {2019},
url = {https://doi.org/10.1007/s10278-019-00229-9},
doi = {10.1007/S10278-019-00229-9},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jdi/SinghDGFL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mcs/HasanSRB19,
author = {Bushra Hasan and
Manmohan Singh and
David Richards and
Aaron Simon Blicblau},
title = {Mathematical modelling of Zika virus as a mosquito-borne and sexually
transmitted disease with diffusion effects},
journal = {Math. Comput. Simul.},
volume = {166},
pages = {56--75},
year = {2019},
url = {https://doi.org/10.1016/j.matcom.2019.04.007},
doi = {10.1016/J.MATCOM.2019.04.007},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mcs/HasanSRB19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BoringJWWWRG19,
author = {Matthew J. Boring and
Zachary F. Jessen and
Thomas A. Wozny and
Michael J. Ward and
Ashley C. Whiteman and
Robert Mark Richardson and
Avniel Singh Ghuman},
title = {Quantitatively validating the efficacy of artifact suppression techniques
to study the cortical consequences of deep brain stimulation with
magnetoencephalography},
journal = {NeuroImage},
volume = {199},
pages = {366--374},
year = {2019},
url = {https://doi.org/10.1016/j.neuroimage.2019.05.080},
doi = {10.1016/J.NEUROIMAGE.2019.05.080},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/BoringJWWWRG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/BradburySCGKHEC19,
author = {Katherine J. Bradbury and
Mary Steele and
Teresa Corbett and
Adam W. A. Geraghty and
Adele Krusche and
Elena Heber and
Steph Easton and
Tara Cheetham{-}Blake and
Joanna Slodkowska{-}Barabasz and
Andre Matthias M{\"{u}}ller and
Kirsten Smith and
Laura J. Wilde and
Liz Payne and
Karmpaul Singh and
Roger Bacon and
Tamsin Burford and
Kevin Summers and
Lesley Turner and
Alison Richardson and
Eila Watson and
Claire L. Foster and
Paul Little and
Lucy Yardley},
title = {Developing a digital intervention for cancer survivors: an evidence-,
theory- and person-based approach},
journal = {npj Digit. Medicine},
volume = {2},
year = {2019},
url = {https://doi.org/10.1038/s41746-019-0163-4},
doi = {10.1038/S41746-019-0163-4},
timestamp = {Tue, 16 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/BradburySCGKHEC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/DhamechaNSV19,
author = {Tejas Indulal Dhamecha and
Afzel Noore and
Richa Singh and
Mayank Vatsa},
title = {Between-subclass piece-wise linear solutions in large scale kernel
{SVM} learning},
journal = {Pattern Recognit.},
volume = {95},
pages = {173--190},
year = {2019},
url = {https://doi.org/10.1016/j.patcog.2019.04.012},
doi = {10.1016/J.PATCOG.2019.04.012},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pr/DhamechaNSV19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/SethiSSV19,
author = {Akshay Sethi and
Maneet Singh and
Richa Singh and
Mayank Vatsa},
title = {Residual Codean Autoencoder for Facial Attribute Analysis},
journal = {Pattern Recognit. Lett.},
volume = {119},
pages = {157--165},
year = {2019},
url = {https://doi.org/10.1016/j.patrec.2018.03.010},
doi = {10.1016/J.PATREC.2018.03.010},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/prl/SethiSSV19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/SinghNVS19,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh},
title = {Are you eligible? Predicting adulthood from face images via Class
Specific Mean Autoencoder},
journal = {Pattern Recognit. Lett.},
volume = {119},
pages = {121--130},
year = {2019},
url = {https://doi.org/10.1016/j.patrec.2018.03.013},
doi = {10.1016/J.PATREC.2018.03.013},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/prl/SinghNVS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/software/BellamyDHHHKLMM19,
author = {Rachel K. E. Bellamy and
Kuntal Dey and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Kalapriya Kannan and
Pranay Lohia and
Sameep Mehta and
Aleksandra Mojsilovic and
Seema Nagar and
Karthikeyan Natesan Ramamurthy and
John T. Richards and
Diptikalyan Saha and
Prasanna Sattigeri and
Moninder Singh and
Kush R. Varshney and
Yunfeng Zhang},
title = {Think Your Artificial Intelligence Software Is Fair? Think Again},
journal = {{IEEE} Softw.},
volume = {36},
number = {4},
pages = {76--80},
year = {2019},
url = {https://doi.org/10.1109/MS.2019.2908514},
doi = {10.1109/MS.2019.2908514},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/software/BellamyDHHHKLMM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbbis/SinghSVRC19,
author = {Maneet Singh and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha and
Rama Chellappa},
title = {Recognizing Disguised Faces in the Wild},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {1},
number = {2},
pages = {97--108},
year = {2019},
url = {https://doi.org/10.1109/TBIOM.2019.2903860},
doi = {10.1109/TBIOM.2019.2903860},
timestamp = {Thu, 09 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbbis/SinghSVRC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/KohliYVSN19,
author = {Naman Kohli and
Daksha Yadav and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Supervised Mixed Norm Autoencoder for Kinship Verification in Unconstrained
Videos},
journal = {{IEEE} Trans. Image Process.},
volume = {28},
number = {3},
pages = {1329--1341},
year = {2019},
url = {https://doi.org/10.1109/TIP.2018.2840880},
doi = {10.1109/TIP.2018.2840880},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tip/KohliYVSN19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ChhabraMV019,
author = {Saheb Chhabra and
Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Data Fine-Tuning},
booktitle = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI}
2019, The Thirty-First Innovative Applications of Artificial Intelligence
Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational
Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii,
USA, January 27 - February 1, 2019},
pages = {8223--8230},
publisher = {{AAAI} Press},
year = {2019},
url = {https://doi.org/10.1609/aaai.v33i01.33018223},
doi = {10.1609/AAAI.V33I01.33018223},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/ChhabraMV019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/Keshari0V19,
author = {Rohit Keshari and
Richa Singh and
Mayank Vatsa},
title = {Guided Dropout},
booktitle = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI}
2019, The Thirty-First Innovative Applications of Artificial Intelligence
Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational
Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii,
USA, January 27 - February 1, 2019},
pages = {4065--4072},
publisher = {{AAAI} Press},
year = {2019},
url = {https://doi.org/10.1609/aaai.v33i01.33014065},
doi = {10.1609/AAAI.V33I01.33014065},
timestamp = {Tue, 02 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aaai/Keshari0V19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ZhangLSD19,
author = {Qi Zhang and
Richard L. Lewis and
Satinder Singh and
Edmund H. Durfee},
title = {Learning to Communicate and Solve Visual Blocks-World Tasks},
booktitle = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI}
2019, The Thirty-First Innovative Applications of Artificial Intelligence
Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational
Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii,
USA, January 27 - February 1, 2019},
pages = {5781--5788},
publisher = {{AAAI} Press},
year = {2019},
url = {https://doi.org/10.1609/aaai.v33i01.33015781},
doi = {10.1609/AAAI.V33I01.33015781},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/ZhangLSD19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl-deeplo/SinghMSX19,
author = {Jasdeep Singh and
Bryan McCann and
Richard Socher and
Caiming Xiong},
editor = {Colin Cherry and
Greg Durrett and
George F. Foster and
Reza Haffari and
Shahram Khadivi and
Nanyun Peng and
Xiang Ren and
Swabha Swayamdipta},
title = {{BERT} is Not an Interlingua and the Bias of Tokenization},
booktitle = {Proceedings of the 2nd Workshop on Deep Learning Approaches for Low-Resource
NLP, DeepLo@EMNLP-IJCNLP 2019, Hong Kong, China, November 3, 2019},
pages = {47--55},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/D19-6106},
doi = {10.18653/V1/D19-6106},
timestamp = {Thu, 05 Aug 2021 17:36:17 +0200},
biburl = {https://dblp.org/rec/conf/acl-deeplo/SinghMSX19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/air/VirkCSPKDP19,
author = {Gurvinder Singh Virk and
Stephen Cameron and
Ratna Sambhav and
Moumita Paul and
Roshan Kumar and
Arvind Dixit and
Richa Pandey},
title = {Towards realising wearable exoskeletons for elderly people},
booktitle = {{AIR} 2019: Advances in Robotics 2019, Chennai, India, July 2-6, 2019},
pages = {20:1--20:6},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3352593.3352614},
doi = {10.1145/3352593.3352614},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/air/VirkCSPKDP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/SinghalM19,
author = {Vipul Singhal and
Richard M. Murray},
title = {Transforming Data Across Environments Despite Structural Non-Identifiability},
booktitle = {2019 American Control Conference, {ACC} 2019, Philadelphia, PA, USA,
July 10-12, 2019},
pages = {5639--5646},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.23919/ACC.2019.8814953},
doi = {10.23919/ACC.2019.8814953},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amcc/SinghalM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigmm/0002S0V19,
author = {Akshay Agarwal and
Akarsha Sehwag and
Richa Singh and
Mayank Vatsa},
title = {Deceiving Face Presentation Attack Detection via Image Transforms},
booktitle = {Fifth {IEEE} International Conference on Multimedia Big Data, BigMM
2019, Singapore, September 11-13, 2019},
pages = {373--382},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/BigMM.2019.00018},
doi = {10.1109/BIGMM.2019.00018},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bigmm/0002S0V19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/AgarwalVS19,
author = {Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {{CHIF:} Convoluted Histogram Image Features for Detecting Silicone
Mask based Face Presentation Attack},
booktitle = {10th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2019, Tampa, FL, USA, September 23-26, 2019},
pages = {1--5},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/BTAS46853.2019.9186000},
doi = {10.1109/BTAS46853.2019.9186000},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/AgarwalVS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/GoelAVSR19,
author = {Akhil Goel and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Securing {CNN} Model and Biometric Template using Blockchain},
booktitle = {10th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2019, Tampa, FL, USA, September 23-26, 2019},
pages = {1--7},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/BTAS46853.2019.9185999},
doi = {10.1109/BTAS46853.2019.9185999},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/GoelAVSR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/GoelVS19,
author = {Lamha Goel and
Mayank Vatsa and
Richa Singh},
title = {{LC-DECAL:} Label Consistent Deep Collaborative Learning for Face
Recognition},
booktitle = {10th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2019, Tampa, FL, USA, September 23-26, 2019},
pages = {1--8},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/BTAS46853.2019.9185992},
doi = {10.1109/BTAS46853.2019.9185992},
timestamp = {Mon, 14 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/GoelVS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/MajumdarCSV19,
author = {Puspita Majumdar and
Saheb Chhabra and
Richa Singh and
Mayank Vatsa},
title = {Subclass Contrastive Loss for Injured Face Recognition},
booktitle = {10th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2019, Tampa, FL, USA, September 23-26, 2019},
pages = {1--7},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/BTAS46853.2019.9185987},
doi = {10.1109/BTAS46853.2019.9185987},
timestamp = {Mon, 14 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/MajumdarCSV19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/SuriVS19,
author = {Anshuman Suri and
Mayank Vatsa and
Richa Singh},
title = {{A-LINK:} Recognizing Disguised Faces via Active Learning based Inter-Domain
Knowledge},
booktitle = {10th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2019, Tampa, FL, USA, September 23-26, 2019},
pages = {1--8},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/BTAS46853.2019.9186004},
doi = {10.1109/BTAS46853.2019.9186004},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/btas/SuriVS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coinco/SamantCVNK19,
author = {Sunil Singh Samant and
Mohan Baruwal Chhetri and
Quoc Bao Vo and
Surya Nepal and
Ryszard Kowalczyk},
title = {Benchmarking for End-to-End QoS Sustainability in Cloud-Hosted Data
Processing Pipelines},
booktitle = {5th {IEEE} International Conference on Collaboration and Internet
Computing, {CIC} 2019, Los Angeles, CA, USA, December 12-14, 2019},
pages = {39--48},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CIC48465.2019.00014},
doi = {10.1109/CIC48465.2019.00014},
timestamp = {Fri, 27 May 2022 15:04:14 +0200},
biburl = {https://dblp.org/rec/conf/coinco/SamantCVNK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/complexnetworks/TripathiMSMJ19,
author = {Richa Tripathi and
Dyutiman Mukhopadhyay and
Chakresh Kumar Singh and
Krishna Prasad Miyapuram and
Shivakumar Jolad},
editor = {Hocine Cherifi and
Sabrina Gaito and
Jos{\'{e}} Fernendo Mendes and
Esteban Moro and
Luis Mateus Rocha},
title = {Characterization of Functional Brain Networks and Emotional Centers
Using the Complex Networks Techniques},
booktitle = {Complex Networks and Their Applications {VIII} - Volume 2 Proceedings
of the Eighth International Conference on Complex Networks and Their
Applications {COMPLEX} {NETWORKS} 2019, Lisbon, Portugal, December
10-12, 2019},
series = {Studies in Computational Intelligence},
volume = {882},
pages = {854--867},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-36683-4\_68},
doi = {10.1007/978-3-030-36683-4\_68},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/complexnetworks/TripathiMSMJ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/Ghosh0V19,
author = {Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa},
title = {On Learning Density Aware Embeddings},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
2019, Long Beach, CA, USA, June 16-20, 2019},
pages = {4884--4892},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2019},
url = {http://openaccess.thecvf.com/content\_CVPR\_2019/html/Ghosh\_On\_Learning\_Density\_Aware\_Embeddings\_CVPR\_2019\_paper.html},
doi = {10.1109/CVPR.2019.00502},
timestamp = {Mon, 30 Aug 2021 17:01:14 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/Ghosh0V19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/Goel0V0R19,
author = {Akhil Goel and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {DeepRing: Protecting Deep Neural Network With Blockchain},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition Workshops,
{CVPR} Workshops 2019, Long Beach, CA, USA, June 16-20, 2019},
pages = {2821--2828},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2019},
url = {http://openaccess.thecvf.com/content\_CVPRW\_2019/html/BCMCVAI/Goel\_DeepRing\_Protecting\_Deep\_Neural\_Network\_With\_Blockchain\_CVPRW\_2019\_paper.html},
doi = {10.1109/CVPRW.2019.00341},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/Goel0V0R19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/GuTZ19,
author = {Shuhang Gu and
Radu Timofte and
Richard Zhang and
Maitreya Suin and
Kuldeep Purohit and
A. N. Rajagopalan and
S. Athi Narayanan and
Jameer Babu Pinjari and
Zhiwei Xiong and
Zhan Shi and
Chang Chen and
Dong Liu and
Manoj Sharma and
Megh Makwana and
Anuj Badhwar and
Ajay Pratap Singh and
Avinash Upadhyay and
Akkshita Trivedi and
Anil K. Saini and
Santanu Chaudhury and
Prasen Kumar Sharma and
Priyankar Jain and
Arijit Sur and
G{\"{o}}khan {\"{O}}zbulak},
title = {{NTIRE} 2019 Challenge on Image Colorization: Report},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition Workshops,
{CVPR} Workshops 2019, Long Beach, CA, USA, June 16-20, 2019},
pages = {2233--2240},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2019},
url = {http://openaccess.thecvf.com/content\_CVPRW\_2019/html/NTIRE/Gu\_NTIRE\_2019\_Challenge\_on\_Image\_Colorization\_Report\_CVPRW\_2019\_paper.html},
doi = {10.1109/CVPRW.2019.00276},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/GuTZ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/GuptaAA00V19,
author = {Viresh Gupta and
Mohit Agarwal and
Manik Arora and
Tanmoy Chakraborty and
Richa Singh and
Mayank Vatsa},
title = {Bag-Of-Lies: {A} Multimodal Dataset for Deception Detection},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition Workshops,
{CVPR} Workshops 2019, Long Beach, CA, USA, June 16-20, 2019},
pages = {83--90},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2019},
url = {http://openaccess.thecvf.com/content\_CVPRW\_2019/html/CV-COPS/Gupta\_Bag-Of-Lies\_A\_Multimodal\_Dataset\_for\_Deception\_Detection\_CVPRW\_2019\_paper.html},
doi = {10.1109/CVPRW.2019.00016},
timestamp = {Fri, 25 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/GuptaAA00V19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/Majumdar00V19,
author = {Puspita Majumdar and
Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Evading Face Recognition via Partial Tampering of Faces},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition Workshops,
{CVPR} Workshops 2019, Long Beach, CA, USA, June 16-20, 2019},
pages = {11--20},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2019},
url = {http://openaccess.thecvf.com/content\_CVPRW\_2019/html/CV-COPS/Majumdar\_Evading\_Face\_Recognition\_via\_Partial\_Tampering\_of\_Faces\_CVPRW\_2019\_paper.html},
doi = {10.1109/CVPRW.2019.00008},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/Majumdar00V19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/NagpalSV0N19,
author = {Shruti Nagpal and
Maneet Singh and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Expression Classification in Children Using Mean Supervised Deep Boltzmann
Machine},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition Workshops,
{CVPR} Workshops 2019, Long Beach, CA, USA, June 16-20, 2019},
pages = {236--245},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2019},
url = {http://openaccess.thecvf.com/content\_CVPRW\_2019/html/AMFG/Nagpal\_Expression\_Classification\_in\_Children\_Using\_Mean\_Supervised\_Deep\_Boltzmann\_Machine\_CVPRW\_2019\_paper.html},
doi = {10.1109/CVPRW.2019.00033},
timestamp = {Mon, 20 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/NagpalSV0N19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/YadavKV0N19,
author = {Daksha Yadav and
Naman Kohli and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Detecting Textured Contact Lens in Uncontrolled Environment Using
DensePAD},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition Workshops,
{CVPR} Workshops 2019, Long Beach, CA, USA, June 16-20, 2019},
pages = {2336--2344},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2019},
url = {http://openaccess.thecvf.com/content\_CVPRW\_2019/html/Biometrics/Yadav\_Detecting\_Textured\_Contact\_Lens\_in\_Uncontrolled\_Environment\_Using\_DensePAD\_CVPRW\_2019\_paper.html},
doi = {10.1109/CVPRW.2019.00287},
timestamp = {Mon, 20 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/YadavKV0N19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fgr/GuptaGG0NVS19,
author = {Sanchit Gupta and
Nikita Gupta and
Soumyadeep Ghosh and
Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh},
title = {FaceSurv: {A} Benchmark Video Dataset for Face Detection and Recognition
Across Spectra and Resolutions},
booktitle = {14th {IEEE} International Conference on Automatic Face {\&} Gesture
Recognition, {FG} 2019, Lille, France, May 14-18, 2019},
pages = {1--7},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/FG.2019.8756510},
doi = {10.1109/FG.2019.8756510},
timestamp = {Fri, 21 Feb 2020 16:58:58 +0100},
biburl = {https://dblp.org/rec/conf/fgr/GuptaGG0NVS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fgr/KalraSN0VS19,
author = {Isha Kalra and
Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa and
P. B. Sujit},
title = {DroneSURF: Benchmark Dataset for Drone-based Face Recognition},
booktitle = {14th {IEEE} International Conference on Automatic Face {\&} Gesture
Recognition, {FG} 2019, Lille, France, May 14-18, 2019},
pages = {1--7},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/FG.2019.8756593},
doi = {10.1109/FG.2019.8756593},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fgr/KalraSN0VS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/0001SV019,
author = {Akshay Agarwal and
Akarsha Sehwag and
Mayank Vatsa and
Richa Singh},
title = {Deceiving the Protector: Fooling Face Presentation Attack Detection
Algorithms},
booktitle = {2019 International Conference on Biometrics, {ICB} 2019, Crete, Greece,
June 4-7, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICB45273.2019.8987293},
doi = {10.1109/ICB45273.2019.8987293},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/0001SV019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/MehtaU0V019,
author = {Suril Mehta and
Anannya Uberoi and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {Crafting {A} Panoptic Face Presentation Attack Detector},
booktitle = {2019 International Conference on Biometrics, {ICB} 2019, Crete, Greece,
June 4-7, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICB45273.2019.8987257},
doi = {10.1109/ICB45273.2019.8987257},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/MehtaU0V019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/SGV019,
author = {Ramya Y. S. and
Soumyadeep Ghosh and
Mayank Vatsa and
Richa Singh},
title = {Face Sketch Colorization via Supervised GANs},
booktitle = {2019 International Conference on Biometrics, {ICB} 2019, Crete, Greece,
June 4-7, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICB45273.2019.8987296},
doi = {10.1109/ICB45273.2019.8987296},
timestamp = {Fri, 14 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icb/SGV019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/SinghN0V19,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {Dual Directed Capsule Network for Very Low Resolution Image Recognition},
booktitle = {2019 {IEEE/CVF} International Conference on Computer Vision, {ICCV}
2019, Seoul, Korea (South), October 27 - November 2, 2019},
pages = {340--349},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICCV.2019.00043},
doi = {10.1109/ICCV.2019.00043},
timestamp = {Thu, 05 Mar 2020 10:01:04 +0100},
biburl = {https://dblp.org/rec/conf/iccv/SinghN0V19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccvw/SinghC0VC19,
author = {Maneet Singh and
Mohit Chawla and
Richa Singh and
Mayank Vatsa and
Rama Chellappa},
title = {Disguised Faces in the Wild 2019},
booktitle = {2019 {IEEE/CVF} International Conference on Computer Vision Workshops,
{ICCV} Workshops 2019, Seoul, Korea (South), October 27-28, 2019},
pages = {542--550},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICCVW.2019.00067},
doi = {10.1109/ICCVW.2019.00067},
timestamp = {Thu, 12 Mar 2020 10:53:35 +0100},
biburl = {https://dblp.org/rec/conf/iccvw/SinghC0VC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/AgarwalS0N0V19,
author = {Mohit Agarwal and
Sanchit Sinha and
Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {Triplet Transform Learning for Automated Primate Face Recognition},
booktitle = {2019 {IEEE} International Conference on Image Processing, {ICIP} 2019,
Taipei, Taiwan, September 22-25, 2019},
pages = {3462--3466},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICIP.2019.8803501},
doi = {10.1109/ICIP.2019.8803501},
timestamp = {Thu, 24 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/AgarwalS0N0V19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/TripathiKGVS19,
author = {Pavani Tripathi and
Rohit Keshari and
Soumyadeep Ghosh and
Mayank Vatsa and
Richa Singh},
title = {{AUTO-G:} Gesture Recognition in the Crowd for Autonomous Vehicl},
booktitle = {2019 {IEEE} International Conference on Image Processing, {ICIP} 2019,
Taipei, Taiwan, September 22-25, 2019},
pages = {3482--3486},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICIP.2019.8803692},
doi = {10.1109/ICIP.2019.8803692},
timestamp = {Thu, 12 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icip/TripathiKGVS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/ShinKGBTSS19,
author = {Richard Shin and
Neel Kant and
Kavi Gupta and
Chris Bender and
Brandon Trabucco and
Rishabh Singh and
Dawn Song},
title = {Synthetic Datasets for Neural Program Synthesis},
booktitle = {7th International Conference on Learning Representations, {ICLR} 2019,
New Orleans, LA, USA, May 6-9, 2019},
publisher = {OpenReview.net},
year = {2019},
url = {https://openreview.net/forum?id=ryeOSnAqYm},
timestamp = {Thu, 25 Jul 2019 13:03:15 +0200},
biburl = {https://dblp.org/rec/conf/iclr/ShinKGBTSS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/SinghalMV019,
author = {Vanika Singhal and
Angshul Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Siamese Deep Dictionary Learning},
booktitle = {International Joint Conference on Neural Networks, {IJCNN} 2019 Budapest,
Hungary, July 14-19, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/IJCNN.2019.8851771},
doi = {10.1109/IJCNN.2019.8851771},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ijcnn/SinghalMV019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medinfo/HunterELWGS19,
author = {Inga M. Hunter and
Phoebe Elers and
Caroline Lockhart and
Dick Whiddett and
Hans W. Guesgen and
Amardeep Singh},
editor = {Lucila Ohno{-}Machado and
Brigitte S{\'{e}}roussi},
title = {Technology to Assist Aging in Place: The Perspective of Health Organizations},
booktitle = {{MEDINFO} 2019: Health and Wellbeing e-Networks for All - Proceedings
of the 17th World Congress on Medical and Health Informatics, Lyon,
France, 25-30 August 2019},
series = {Studies in Health Technology and Informatics},
volume = {264},
pages = {1688--1689},
publisher = {{IOS} Press},
year = {2019},
url = {https://doi.org/10.3233/SHTI190598},
doi = {10.3233/SHTI190598},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/medinfo/HunterELWGS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/VeeriahHXRLOHSS19,
author = {Vivek Veeriah and
Matteo Hessel and
Zhongwen Xu and
Janarthanan Rajendran and
Richard L. Lewis and
Junhyuk Oh and
Hado van Hasselt and
David Silver and
Satinder Singh},
editor = {Hanna M. Wallach and
Hugo Larochelle and
Alina Beygelzimer and
Florence d'Alch{\'{e}}{-}Buc and
Emily B. Fox and
Roman Garnett},
title = {Discovery of Useful Questions as Auxiliary Tasks},
booktitle = {Advances in Neural Information Processing Systems 32: Annual Conference
on Neural Information Processing Systems 2019, NeurIPS 2019, December
8-14, 2019, Vancouver, BC, Canada},
pages = {9306--9317},
year = {2019},
url = {https://proceedings.neurips.cc/paper/2019/hash/10ff0b5e85e5b85cc3095d431d8c08b4-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/VeeriahHXRLOHSS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/taros/WangHNSSSMTBLGT19,
author = {Shuangyi Wang and
James Housden and
Yohan Noh and
Davinder Singh and
Anisha Singh and
Emily Skelton and
Jacqueline Matthew and
Cornelius Tan and
Junghwan Back and
Lukas Lindenroth and
Alberto G{\'{o}}mez and
Nicolas Toussaint and
Veronika A. M. Zimmer and
Caroline Knight and
Tara P. Fletcher and
David Lloyd and
John M. Simpson and
Dharmintra Pasupathy and
Hongbin Liu and
Kaspar Althoefer and
Joseph V. Hajnal and
Reza Razavi and
Kawal S. Rhode},
editor = {Kaspar Althoefer and
Jelizaveta Konstantinova and
Ketao Zhang},
title = {Robotic-Assisted Ultrasound for Fetal Imaging: Evolution from Single-Arm
to Dual-Arm System},
booktitle = {Towards Autonomous Robotic Systems - 20th Annual Conference, {TAROS}
2019, London, UK, July 3-5, 2019, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {11650},
pages = {27--38},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-25332-5\_3},
doi = {10.1007/978-3-030-25332-5\_3},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/taros/WangHNSSSMTBLGT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/TajalliBCCFGGGH19,
author = {Armin Tajalli and
Mani Bastani Parizi and
Dario Albino Carnelli and
Chen Cao and
John Fox and
Kiarash Gharibdoust and
Davide Gorret and
Amit Gupta and
Christopher Hall and
Ahmed Hassanin and
Klaas L. Hofstra and
Brian Holden and
Ali Hormati and
John Keay and
Yohann Mogentale and
G. Paul and
Victor Perrin and
John Phillips and
Sumathi Raparthy and
Amin Shokrollahi and
David Stauffer and
Richard Simpson and
Andrew Stewart and
Giuseppe Surace and
Omid Talebi Amiri and
Emanuele Truffa and
Anton Tschank and
Roger Ulrich and
Christoph Walter and
Anant Singh},
title = {A 1.02pJ/b 417Gb/s/mm {USR} Link in 16nm FinFET},
booktitle = {2019 Symposium on {VLSI} Circuits, Kyoto, Japan, June 9-14, 2019},
pages = {92},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.23919/VLSIC.2019.8778172},
doi = {10.23919/VLSIC.2019.8778172},
timestamp = {Fri, 07 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/TajalliBCCFGGGH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/JoshiAV0RK19,
author = {Indu Joshi and
Adithya Anand and
Mayank Vatsa and
Richa Singh and
Sumantra Dutta Roy and
Prem Kalra},
title = {Latent Fingerprint Enhancement Using Generative Adversarial Networks},
booktitle = {{IEEE} Winter Conference on Applications of Computer Vision, {WACV}
2019, Waikoloa Village, HI, USA, January 7-11, 2019},
pages = {895--903},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/WACV.2019.00100},
doi = {10.1109/WACV.2019.00100},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wacv/JoshiAV0RK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/19/MalhotraCV019,
author = {Aakarsh Malhotra and
Shaan Chopra and
Mayank Vatsa and
Richa Singh},
editor = {Ajita Rattani and
Reza Derakhshani and
Arun Ross},
title = {User Authentication via Finger-Selfies},
booktitle = {Selfie Biometrics - Advances and Challenges},
series = {Advances in Computer Vision and Pattern Recognition},
pages = {21--47},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-26972-2\_2},
doi = {10.1007/978-3-030-26972-2\_2},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/sp/19/MalhotraCV019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/acvpr/YambayCBV0NKYS19,
author = {David Yambay and
Adam Czajka and
Kevin W. Bowyer and
Mayank Vatsa and
Richa Singh and
Afzel Noore and
Naman Kohli and
Daksha Yadav and
Stephanie Schuckers},
editor = {S{\'{e}}bastien Marcel and
Mark S. Nixon and
Julian Fi{\'{e}}rrez and
Nicholas W. D. Evans},
title = {Review of Iris Presentation Attack Detection Competitions},
booktitle = {Handbook of Biometric Anti-Spoofing - Presentation Attack Detection,
Second Edition},
series = {Advances in Computer Vision and Pattern Recognition},
pages = {169--183},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-319-92627-8\_8},
doi = {10.1007/978-3-319-92627-8\_8},
timestamp = {Wed, 07 Dec 2022 23:14:30 +0100},
biburl = {https://dblp.org/rec/series/acvpr/YambayCBV0NKYS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/dsaa/2019,
editor = {Lisa Singh and
Richard D. De Veaux and
George Karypis and
Francesco Bonchi and
Jennifer Hill},
title = {2019 {IEEE} International Conference on Data Science and Advanced
Analytics, {DSAA} 2019, Washington, DC, USA, October 5-8, 2019},
publisher = {{IEEE}},
year = {2019},
url = {https://ieeexplore.ieee.org/xpl/conhome/8961324/proceeding},
isbn = {978-1-7281-4493-1},
timestamp = {Thu, 06 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsaa/2019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sin/2019,
editor = {Oleg B. Makarevich and
Dmitry Popov and
Ludmila K. Babenko and
Pete Burnap and
Atilla El{\c{c}}i and
Ron Poet and
Jaideep Vaidya and
Mehmet A. Orgun and
Manoj Singh Gaur and
Rajveer Singh Shekhawat},
title = {Proceedings of the 12th International Conference on Security of Information
and Networks, {SIN} 2019, Sochi, Russian Federation, September 12-15,
2019},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3357613},
doi = {10.1145/3357613},
isbn = {978-1-4503-7242-8},
timestamp = {Mon, 19 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sin/2019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1901-09237,
author = {Anubhav Jain and
Richa Singh and
Mayank Vatsa},
title = {On Detecting GANs and Retouching based Synthetic Alterations},
journal = {CoRR},
volume = {abs/1901.09237},
year = {2019},
url = {http://arxiv.org/abs/1901.09237},
eprinttype = {arXiv},
eprint = {1901.09237},
timestamp = {Wed, 08 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1901-09237.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1902-02919,
author = {Maneet Singh and
Richa Singh and
Arun Ross},
title = {A Comprehensive Overview of Biometric Fusion},
journal = {CoRR},
volume = {abs/1902.02919},
year = {2019},
url = {http://arxiv.org/abs/1902.02919},
eprinttype = {arXiv},
eprint = {1902.02919},
timestamp = {Tue, 21 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1902-02919.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1902-05458,
author = {Shuangyi Wang and
James Housden and
Yohan Noh and
Davinder Singh and
Anisha Singh and
Emily Skelton and
Jacqueline Matthew and
Cornelius Tan and
Junghwan Back and
Lukas Lindenroth and
Alberto G{\'{o}}mez and
Nicolas Toussaint and
Veronika A. M. Zimmer and
Caroline Knight and
Tara P. Fletcher and
David Lloyd and
John M. Simpson and
Dharmintra Pasupathy and
Hongbin Liu and
Kaspar Althoefer and
Joseph V. Hajnal and
Reza Razavi and
Kawal S. Rhode},
title = {Robotic-assisted Ultrasound for Fetal Imaging: Evolution from Single-arm
to Dual-arm System},
journal = {CoRR},
volume = {abs/1902.05458},
year = {2019},
url = {http://arxiv.org/abs/1902.05458},
eprinttype = {arXiv},
eprint = {1902.05458},
timestamp = {Thu, 11 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1902-05458.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1904-01219,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Deep Learning for Face Recognition: Pride or Prejudiced?},
journal = {CoRR},
volume = {abs/1904.01219},
year = {2019},
url = {http://arxiv.org/abs/1904.01219},
eprinttype = {arXiv},
eprint = {1904.01219},
timestamp = {Wed, 24 Apr 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1904-01219.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1904-03911,
author = {Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa},
title = {On Learning Density Aware Embeddings},
journal = {CoRR},
volume = {abs/1904.03911},
year = {2019},
url = {http://arxiv.org/abs/1904.03911},
eprinttype = {arXiv},
eprint = {1904.03911},
timestamp = {Thu, 25 Apr 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1904-03911.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1905-11471,
author = {Jasdeep Singh and
Bryan McCann and
Nitish Shirish Keskar and
Caiming Xiong and
Richard Socher},
title = {{XLDA:} Cross-Lingual Data Augmentation for Natural Language Inference
and Question Answering},
journal = {CoRR},
volume = {abs/1905.11471},
year = {2019},
url = {http://arxiv.org/abs/1905.11471},
eprinttype = {arXiv},
eprint = {1905.11471},
timestamp = {Mon, 03 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1905-11471.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-13122,
author = {Sumeet Singh and
Spencer M. Richards and
Vikas Sindhwani and
Jean{-}Jacques E. Slotine and
Marco Pavone},
title = {Learning Stabilizable Nonlinear Dynamics with Contraction-Based Regularization},
journal = {CoRR},
volume = {abs/1907.13122},
year = {2019},
url = {http://arxiv.org/abs/1907.13122},
eprinttype = {arXiv},
eprint = {1907.13122},
timestamp = {Mon, 19 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1907-13122.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1908-03568,
author = {Ian Osband and
Yotam Doron and
Matteo Hessel and
John Aslanides and
Eren Sezener and
Andre Saraiva and
Katrina McKinney and
Tor Lattimore and
Csaba Szepesv{\'{a}}ri and
Satinder Singh and
Benjamin Van Roy and
Richard S. Sutton and
David Silver and
Hado van Hasselt},
title = {Behaviour Suite for Reinforcement Learning},
journal = {CoRR},
volume = {abs/1908.03568},
year = {2019},
url = {http://arxiv.org/abs/1908.03568},
eprinttype = {arXiv},
eprint = {1908.03568},
timestamp = {Mon, 15 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1908-03568.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1908-10027,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {Dual Directed Capsule Network for Very Low Resolution Image Recognition},
journal = {CoRR},
volume = {abs/1908.10027},
year = {2019},
url = {http://arxiv.org/abs/1908.10027},
eprinttype = {arXiv},
eprint = {1908.10027},
timestamp = {Thu, 29 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1908-10027.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-03012,
author = {Vijay Arya and
Rachel K. E. Bellamy and
Pin{-}Yu Chen and
Amit Dhurandhar and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Q. Vera Liao and
Ronny Luss and
Aleksandra Mojsilovic and
Sami Mourad and
Pablo Pedemonte and
Ramya Raghavendra and
John T. Richards and
Prasanna Sattigeri and
Karthikeyan Shanmugam and
Moninder Singh and
Kush R. Varshney and
Dennis Wei and
Yunfeng Zhang},
title = {One Explanation Does Not Fit All: {A} Toolkit and Taxonomy of {AI}
Explainability Techniques},
journal = {CoRR},
volume = {abs/1909.03012},
year = {2019},
url = {http://arxiv.org/abs/1909.03012},
eprinttype = {arXiv},
eprint = {1909.03012},
timestamp = {Tue, 17 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-03012.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-04607,
author = {Vivek Veeriah and
Matteo Hessel and
Zhongwen Xu and
Richard L. Lewis and
Janarthanan Rajendran and
Junhyuk Oh and
Hado van Hasselt and
David Silver and
Satinder Singh},
title = {Discovery of Useful Questions as Auxiliary Tasks},
journal = {CoRR},
volume = {abs/1909.04607},
year = {2019},
url = {http://arxiv.org/abs/1909.04607},
eprinttype = {arXiv},
eprint = {1909.04607},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-04607.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1911-13250,
author = {Raunak Sinha and
Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {AuthorGAN: Improving {GAN} Reproducibility using a Modular {GAN} Framework},
journal = {CoRR},
volume = {abs/1911.13250},
year = {2019},
url = {http://arxiv.org/abs/1911.13250},
eprinttype = {arXiv},
eprint = {1911.13250},
timestamp = {Wed, 08 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1911-13250.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1912-07045,
author = {Janarthanan Rajendran and
Richard L. Lewis and
Vivek Veeriah and
Honglak Lee and
Satinder Singh},
title = {How Should an Agent Practice?},
journal = {CoRR},
volume = {abs/1912.07045},
year = {2019},
url = {http://arxiv.org/abs/1912.07045},
eprinttype = {arXiv},
eprint = {1912.07045},
timestamp = {Wed, 20 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1912-07045.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1912-12345,
author = {Richard Shin and
Neel Kant and
Kavi Gupta and
Christopher Bender and
Brandon Trabucco and
Rishabh Singh and
Dawn Song},
title = {Synthetic Datasets for Neural Program Synthesis},
journal = {CoRR},
volume = {abs/1912.12345},
year = {2019},
url = {http://arxiv.org/abs/1912.12345},
eprinttype = {arXiv},
eprint = {1912.12345},
timestamp = {Fri, 03 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1912-12345.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/amc/SinghN18,
author = {Maneesh Kumar Singh and
Srinivasan Natesan},
title = {Richardson extrapolation technique for singularly perturbed system
of parabolic partial differential equations with exponential boundary
layers},
journal = {Appl. Math. Comput.},
volume = {333},
pages = {254--275},
year = {2018},
url = {https://doi.org/10.1016/j.amc.2018.03.059},
doi = {10.1016/J.AMC.2018.03.059},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/amc/SinghN18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/amc/SinghN18a,
author = {Maneesh Kumar Singh and
Srinivasan Natesan},
title = {Corrigendum to "Richardson extrapolation technique for singularly
perturbed system of parabolic partial differential equations with
exponential boundary layers" [Applied Mathematics and Computation
333 {(2018)} 254-275]},
journal = {Appl. Math. Comput.},
volume = {338},
pages = {660},
year = {2018},
url = {https://doi.org/10.1016/j.amc.2018.06.011},
doi = {10.1016/J.AMC.2018.06.011},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/amc/SinghN18a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/SinghKMGBVF18,
author = {Gurnoor Singh and
Arnold Kuzniar and
Erik M. van Mulligen and
Anand Gavai and
Christian W. Bachem and
Richard G. F. Visser and
Richard Finkers},
title = {QTLTableMiner++: semantic mining of {QTL} tables in scientific articles},
journal = {{BMC} Bioinform.},
volume = {19},
number = {1},
pages = {183:1--183:11},
year = {2018},
url = {https://doi.org/10.1186/s12859-018-2165-7},
doi = {10.1186/S12859-018-2165-7},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/SinghKMGBVF18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/brain/SharmaTCKKSDK18,
author = {Kanishka Sharma and
Richa Trivedi and
Sushil Chandra and
Prabhjot Kaur and
Pawan Kumar and
Kavita Singh and
Ashok K. Dubey and
Subash Khushu},
title = {Enhanced White Matter Integrity in Corpus Callosum of Long-Term Brahmakumaris
Rajayoga Meditators},
journal = {Brain Connect.},
volume = {8},
number = {1},
pages = {49--55},
year = {2018},
url = {https://doi.org/10.1089/brain.2017.0524},
doi = {10.1089/BRAIN.2017.0524},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/brain/SharmaTCKKSDK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/ChhokraCGVS18,
author = {Pawas Chhokra and
Anurag Chowdhury and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh},
title = {Unconstrained Kinect video face database},
journal = {Inf. Fusion},
volume = {44},
pages = {113--125},
year = {2018},
url = {https://doi.org/10.1016/j.inffus.2017.09.002},
doi = {10.1016/J.INFFUS.2017.09.002},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/inffus/ChhokraCGVS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iotj/BediVSBW18,
author = {Guneet Bedi and
Ganesh Kumar Venayagamoorthy and
Rajendra Singh and
Richard R. Brooks and
Kuang{-}Ching Wang},
title = {Review of Internet of Things (IoT) in Electric Power and Energy Systems},
journal = {{IEEE} Internet Things J.},
volume = {5},
number = {2},
pages = {847--870},
year = {2018},
url = {https://doi.org/10.1109/JIOT.2018.2802704},
doi = {10.1109/JIOT.2018.2802704},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iotj/BediVSBW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mktsci/SchaeferRM18,
author = {Richard Schaefer and
Raghunath Singh Rao and
Vijay Mahajan},
title = {Marketing Self-Improvement Programs for Self-Signaling Consumers},
journal = {Mark. Sci.},
volume = {37},
number = {6},
pages = {912--929},
year = {2018},
url = {https://doi.org/10.1287/mksc.2018.1107},
doi = {10.1287/MKSC.2018.1107},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mktsci/SchaeferRM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/DhamechaSVVS18,
author = {Tejas I. Dhamecha and
Mahek Shah and
Priyanka Verma and
Mayank Vatsa and
Richa Singh},
title = {CrowdFaceDB: Database and benchmarking for face verification in crowd},
journal = {Pattern Recognit. Lett.},
volume = {107},
pages = {17--24},
year = {2018},
url = {https://doi.org/10.1016/j.patrec.2017.12.028},
doi = {10.1016/J.PATREC.2017.12.028},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/prl/DhamechaSVVS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmis/MendlingWABCDDC18,
author = {Jan Mendling and
Ingo Weber and
Wil M. P. van der Aalst and
Jan vom Brocke and
Cristina Cabanillas and
Florian Daniel and
S{\o}ren Debois and
Claudio Di Ciccio and
Marlon Dumas and
Schahram Dustdar and
Avigdor Gal and
Luciano Garc{\'{\i}}a{-}Ba{\~{n}}uelos and
Guido Governatori and
Richard Hull and
Marcello La Rosa and
Henrik Leopold and
Frank Leymann and
Jan Recker and
Manfred Reichert and
Hajo A. Reijers and
Stefanie Rinderle{-}Ma and
Andreas Solti and
Michael Rosemann and
Stefan Schulte and
Munindar P. Singh and
Tijs Slaats and
Mark Staples and
Barbara Weber and
Matthias Weidlich and
Mathias Weske and
Xiwei Xu and
Liming Zhu},
title = {Blockchains for Business Process Management - Challenges and Opportunities},
journal = {{ACM} Trans. Manag. Inf. Syst.},
volume = {9},
number = {1},
pages = {4:1--4:16},
year = {2018},
url = {https://doi.org/10.1145/3183367},
doi = {10.1145/3183367},
timestamp = {Sat, 27 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmis/MendlingWABCDDC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEscc/SamantCVKN18,
author = {Sunil Singh Samant and
Mohan Baruwal Chhetri and
Quoc Bao Vo and
Ryszard Kowalczyk and
Surya Nepal},
title = {Towards End-to-End QoS and Cost-Aware Resource Scaling in Cloud-Based
IoT Data Processing Pipelines},
booktitle = {2018 {IEEE} International Conference on Services Computing, {SCC}
2018, San Francisco, CA, USA, July 2-7, 2018},
pages = {287--290},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/SCC.2018.00050},
doi = {10.1109/SCC.2018.00050},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/IEEEscc/SamantCVKN18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/GoswamiRASV18,
author = {Gaurav Goswami and
Nalini K. Ratha and
Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
editor = {Sheila A. McIlraith and
Kilian Q. Weinberger},
title = {Unravelling Robustness of Deep Learning Based Face Recognition Against
Adversarial Attacks},
booktitle = {Proceedings of the Thirty-Second {AAAI} Conference on Artificial Intelligence,
(AAAI-18), the 30th innovative Applications of Artificial Intelligence
(IAAI-18), and the 8th {AAAI} Symposium on Educational Advances in
Artificial Intelligence (EAAI-18), New Orleans, Louisiana, USA, February
2-7, 2018},
pages = {6829--6836},
publisher = {{AAAI} Press},
year = {2018},
url = {https://doi.org/10.1609/aaai.v32i1.12341},
doi = {10.1609/AAAI.V32I1.12341},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/GoswamiRASV18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigdataconf/MarcianoUHMST18,
author = {Richard Marciano and
William Underwood and
Mohammad Hanaee and
Connor Mullane and
Aakanksha Singh and
Zayden Tethong},
editor = {Naoki Abe and
Huan Liu and
Calton Pu and
Xiaohua Hu and
Nesreen K. Ahmed and
Mu Qiao and
Yang Song and
Donald Kossmann and
Bing Liu and
Kisung Lee and
Jiliang Tang and
Jingrui He and
Jeffrey S. Saltz},
title = {Automating the Detection of Personally Identifiable Information {(PII)}
in Japanese-American {WWII} Incarceration Camp Records},
booktitle = {{IEEE} International Conference on Big Data {(IEEE} BigData 2018),
Seattle, WA, USA, December 10-13, 2018},
pages = {2725--2732},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/BigData.2018.8622634},
doi = {10.1109/BIGDATA.2018.8622634},
timestamp = {Fri, 19 Nov 2021 16:08:20 +0100},
biburl = {https://dblp.org/rec/conf/bigdataconf/MarcianoUHMST18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/Agarwal0VR18,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Are Image-Agnostic Universal Adversarial Perturbations for Face Recognition
Difficult to Detect?},
booktitle = {9th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2018, Redondo Beach, CA, USA, October 22-25, 2018},
pages = {1--7},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/BTAS.2018.8698548},
doi = {10.1109/BTAS.2018.8698548},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/Agarwal0VR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/GargBG0VR18,
author = {Rishabh Garg and
Yashasvi Baweja and
Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Heterogeneity Aware Deep Embedding for Mobile Periocular Recognition},
booktitle = {9th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2018, Redondo Beach, CA, USA, October 22-25, 2018},
pages = {1--7},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/BTAS.2018.8698551},
doi = {10.1109/BTAS.2018.8698551},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/btas/GargBG0VR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/GoelSAV018,
author = {Akhil Goel and
Anirudh Singh and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {SmartBox: Benchmarking Adversarial Detection and Mitigation Algorithms
for Face Recognition},
booktitle = {9th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2018, Redondo Beach, CA, USA, October 22-25, 2018},
pages = {1--7},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/BTAS.2018.8698567},
doi = {10.1109/BTAS.2018.8698567},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/GoelSAV018.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/Jain0V18,
author = {Anubhav Jain and
Richa Singh and
Mayank Vatsa},
title = {On Detecting GANs and Retouching based Synthetic Alterations},
booktitle = {9th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2018, Redondo Beach, CA, USA, October 22-25, 2018},
pages = {1--7},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/BTAS.2018.8698545},
doi = {10.1109/BTAS.2018.8698545},
timestamp = {Wed, 08 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/btas/Jain0V18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/SinghN0VN18,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Learning {A} Shared Transform Model for Skull to Digital Face Image
Matching},
booktitle = {9th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2018, Redondo Beach, CA, USA, October 22-25, 2018},
pages = {1--7},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/BTAS.2018.8698604},
doi = {10.1109/BTAS.2018.8698604},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/btas/SinghN0VN18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/SuriSV018,
author = {Saksham Suri and
Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {On Matching Faces with Alterations due to Plastic Surgery and Disguise},
booktitle = {9th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2018, Redondo Beach, CA, USA, October 22-25, 2018},
pages = {1--7},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/BTAS.2018.8698571},
doi = {10.1109/BTAS.2018.8698571},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/btas/SuriSV018.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ChopraMV018,
author = {Shaan Chopra and
Aakarsh Malhotra and
Mayank Vatsa and
Richa Singh},
title = {Unconstrained Fingerphoto Database},
booktitle = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition
Workshops, {CVPR} Workshops 2018, Salt Lake City, UT, USA, June 18-22,
2018},
pages = {517--525},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018},
url = {http://openaccess.thecvf.com/content\_cvpr\_2018\_workshops/w11/html/Chopra\_Unconstrained\_Fingerphoto\_Database\_CVPR\_2018\_paper.html},
doi = {10.1109/CVPRW.2018.00093},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/ChopraMV018.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/KeshariV0N18,
author = {Rohit Keshari and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Learning Structure and Strength of {CNN} Filters for Small Sample
Size Training},
booktitle = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2018, Salt Lake City, UT, USA, June 18-22, 2018},
pages = {9349--9358},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018},
url = {http://openaccess.thecvf.com/content\_cvpr\_2018/html/Keshari\_Learning\_Structure\_and\_CVPR\_2018\_paper.html},
doi = {10.1109/CVPR.2018.00974},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/KeshariV0N18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/KushwahaS0VRC18,
author = {Vineet Kushwaha and
Maneet Singh and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha and
Rama Chellappa},
title = {Disguised Faces in the Wild},
booktitle = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition
Workshops, {CVPR} Workshops 2018, Salt Lake City, UT, USA, June 18-22,
2018},
pages = {1--9},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018},
url = {http://openaccess.thecvf.com/content\_cvpr\_2018\_workshops/w1/html/Kushwaha\_Disguised\_Faces\_in\_CVPR\_2018\_paper.html},
doi = {10.1109/CVPRW.2018.00008},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/KushwahaS0VRC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/MajumdarC0V18,
author = {Puspita Majumdar and
Saheb Chhabra and
Richa Singh and
Mayank Vatsa},
title = {On Detecting Domestic Abuse via Faces},
booktitle = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition
Workshops, {CVPR} Workshops 2018, Salt Lake City, UT, USA, June 18-22,
2018},
pages = {2173--2179},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018},
url = {http://openaccess.thecvf.com/content\_cvpr\_2018\_workshops/w41/html/Majumdar\_On\_Detecting\_Domestic\_CVPR\_2018\_paper.html},
doi = {10.1109/CVPRW.2018.00292},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/MajumdarC0V18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/SinghNV0M18,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh and
Angshul Majumdar},
title = {Identity Aware Synthesis for Cross Resolution Face Recognition},
booktitle = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition
Workshops, {CVPR} Workshops 2018, Salt Lake City, UT, USA, June 18-22,
2018},
pages = {479--488},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018},
url = {http://openaccess.thecvf.com/content\_cvpr\_2018\_workshops/w11/html/Singh\_Identity\_Aware\_Synthesis\_CVPR\_2018\_paper.html},
doi = {10.1109/CVPRW.2018.00089},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/SinghNV0M18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/YadavKAV0N18,
author = {Daksha Yadav and
Naman Kohli and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Fusion of Handcrafted and Deep Learning Features for Large-Scale Multiple
Iris Presentation Attack Detection},
booktitle = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition
Workshops, {CVPR} Workshops 2018, Salt Lake City, UT, USA, June 18-22,
2018},
pages = {572--579},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018},
url = {http://openaccess.thecvf.com/content\_cvpr\_2018\_workshops/w11/html/Yadav\_Fusion\_of\_Handcrafted\_CVPR\_2018\_paper.html},
doi = {10.1109/CVPRW.2018.00099},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/YadavKAV0N18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/YadavKKV0N18,
author = {Daksha Yadav and
Naman Kohli and
Ekampreet Kalsi and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Unraveling Human Perception of Facial Aging Using Eye Gaze},
booktitle = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition
Workshops, {CVPR} Workshops 2018, Salt Lake City, UT, USA, June 18-22,
2018},
pages = {2140--2147},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018},
url = {http://openaccess.thecvf.com/content\_cvpr\_2018\_workshops/w41/html/Yadav\_Unraveling\_Human\_Perception\_CVPR\_2018\_paper.html},
doi = {10.1109/CVPRW.2018.00288},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/YadavKKV0N18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dh/MarcianoLULDS18,
author = {Richard Marciano and
Myeong Lee and
William Underwood and
Sandra Laib and
Zeynep Diker and
Aakanksha Singh},
editor = {Alonzo C. Addison and
Harold Thwaites},
title = {Digital Curation of a World War {II} Japanese-American Incarceration
Camp Collection: Implications for Sociotechnical Archival Systems},
booktitle = {3rd Digital Heritage International Congress, held jointly with 24th
International Conference on Virtual Systems {\&} Multimedia, DigitalHERITAGE/VSMM
2018, San Francisco, CA, USA, October 26-30, 2018},
pages = {1--4},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/DigitalHeritage.2018.8810034},
doi = {10.1109/DIGITALHERITAGE.2018.8810034},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dh/MarcianoLULDS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/KristanLMFPZVBL18,
author = {Matej Kristan and
Ales Leonardis and
Jiri Matas and
Michael Felsberg and
Roman P. Pflugfelder and
Luka Cehovin Zajc and
Tom{\'{a}}s Voj{\'{\i}}r and
Goutam Bhat and
Alan Lukezic and
Abdelrahman Eldesokey and
Gustavo Fern{\'{a}}ndez and
{\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and
{\'{A}}lvaro Iglesias{-}Arias and
A. Aydin Alatan and
Abel Gonz{\'{a}}lez{-}Garc{\'{\i}}a and
Alfredo Petrosino and
Alireza Memarmoghadam and
Andrea Vedaldi and
Andrej Muhic and
Anfeng He and
Arnold W. M. Smeulders and
Asanka G. Perera and
Bo Li and
Boyu Chen and
Changick Kim and
Changsheng Xu and
Changzhen Xiong and
Cheng Tian and
Chong Luo and
Chong Sun and
Cong Hao and
Daijin Kim and
Deepak Mishra and
Deming Chen and
Dong Wang and
Dongyoon Wee and
Efstratios Gavves and
Erhan Gundogdu and
Erik Velasco{-}Salido and
Fahad Shahbaz Khan and
Fan Yang and
Fei Zhao and
Feng Li and
Francesco Battistone and
George De Ath and
Gorthi R. K. Sai Subrahmanyam and
Guilherme Sousa Bastos and
Haibin Ling and
Hamed Kiani Galoogahi and
Hankyeol Lee and
Haojie Li and
Haojie Zhao and
Heng Fan and
Honggang Zhang and
Horst Possegger and
Houqiang Li and
Huchuan Lu and
Hui Zhi and
Huiyun Li and
Hyemin Lee and
Hyung Jin Chang and
Isabela Drummond and
Jack Valmadre and
Jaime Spencer Martin and
Javaan Singh Chahl and
Jin Young Choi and
Jing Li and
Jinqiao Wang and
Jinqing Qi and
Jinyoung Sung and
Joakim Johnander and
Jo{\~{a}}o F. Henriques and
Jongwon Choi and
Joost van de Weijer and
Jorge Rodr{\'{\i}}guez Herranz and
Jos{\'{e}} M. Mart{\'{\i}}nez and
Josef Kittler and
Junfei Zhuang and
Junyu Gao and
Klemen Grm and
Lichao Zhang and
Lijun Wang and
Lingxiao Yang and
Litu Rout and
Liu Si and
Luca Bertinetto and
Lutao Chu and
Manqiang Che and
Mario Edoardo Maresca and
Martin Danelljan and
Ming{-}Hsuan Yang and
Mohamed H. Abdelpakey and
Mohamed S. Shehata and
Myunggu Kang and
Namhoon Lee and
Ning Wang and
Ondrej Miksik and
Payman Moallem and
Pablo Vicente{-}Mo{\~{n}}ivar and
Pedro Senna and
Peixia Li and
Philip H. S. Torr and
Priya Mariam Raju and
Ruihe Qian and
Qiang Wang and
Qin Zhou and
Qing Guo and
Rafael Martin Nieto and
Rama Krishna Sai Subrahmanyam Gorthi and
Ran Tao and
Richard Bowden and
Richard M. Everson and
Runling Wang and
Sangdoo Yun and
Seokeon Choi and
Sergio Vivas and
Shuai Bai and
Shuangping Huang and
Sihang Wu and
Simon Hadfield and
Siwen Wang and
Stuart Golodetz and
Ming Tang and
Tianyang Xu and
Tianzhu Zhang and
Tobias Fischer and
Vincenzo Santopietro and
Vitomir Struc and
Wei Wang and
Wangmeng Zuo and
Wei Feng and
Wei Wu and
Wei Zou and
Weiming Hu and
Wengang Zhou and
Wenjun Zeng and
Xiaofan Zhang and
Xiaohe Wu and
Xiao{-}Jun Wu and
Xinmei Tian and
Yan Li and
Yan Lu and
Yee Wei Law and
Yi Wu and
Yiannis Demiris and
Yicai Yang and
Yifan Jiao and
Yuhong Li and
Yunhua Zhang and
Yuxuan Sun and
Zheng Zhang and
Zheng Zhu and
Zhen{-}Hua Feng and
Zhihui Wang and
Zhiqun He},
editor = {Laura Leal{-}Taix{\'{e}} and
Stefan Roth},
title = {The Sixth Visual Object Tracking {VOT2018} Challenge Results},
booktitle = {Computer Vision - {ECCV} 2018 Workshops - Munich, Germany, September
8-14, 2018, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {11129},
pages = {3--53},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-11009-3\_1},
doi = {10.1007/978-3-030-11009-3\_1},
timestamp = {Wed, 14 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eccv/KristanLMFPZVBL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/SinhaAV0A18,
author = {Sanchit Sinha and
Mohit Agarwal and
Mayank Vatsa and
Richa Singh and
Saket Anand},
editor = {Laura Leal{-}Taix{\'{e}} and
Stefan Roth},
title = {Exploring Bias in Primate Face Detection and Recognition},
booktitle = {Computer Vision - {ECCV} 2018 Workshops - Munich, Germany, September
8-14, 2018, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {11129},
pages = {541--555},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-11009-3\_33},
doi = {10.1007/978-3-030-11009-3\_33},
timestamp = {Thu, 24 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eccv/SinhaAV0A18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/flairs/GuesgenWHELSM18,
author = {Hans W. Guesgen and
Dick Whiddett and
Inga M. Hunter and
Phoebe Elers and
Caroline Lockhart and
Amardeep Singh and
Stephen Marsland},
editor = {Keith Brawner and
Vasile Rus},
title = {Using Spatio-Temporal Anomalies to Detect Abnormal Behaviour in Smart
Homes},
booktitle = {Proceedings of the Thirty-First International Florida Artificial Intelligence
Research Society Conference, {FLAIRS} 2018, Melbourne, Florida, {USA.}
May 21-23 2018},
pages = {20--25},
publisher = {{AAAI} Press},
year = {2018},
url = {https://aaai.org/ocs/index.php/FLAIRS/FLAIRS18/paper/view/17636},
timestamp = {Wed, 26 Oct 2022 08:35:09 +0200},
biburl = {https://dblp.org/rec/conf/flairs/GuesgenWHELSM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdf2c/SinghIV18,
author = {Avinash Singh and
Adeyemi R. Ikuesan and
Hein S. Venter},
editor = {Frank Breitinger and
Ibrahim M. Baggili},
title = {Digital Forensic Readiness Framework for Ransomware Investigation},
booktitle = {Digital Forensics and Cyber Crime - 10th International {EAI} Conference,
{ICDF2C} 2018, New Orleans, LA, USA, September 10-12, 2018, Proceedings},
series = {Lecture Notes of the Institute for Computer Sciences, Social Informatics
and Telecommunications Engineering},
volume = {259},
pages = {91--105},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-05487-8\_5},
doi = {10.1007/978-3-030-05487-8\_5},
timestamp = {Thu, 14 Oct 2021 10:05:19 +0200},
biburl = {https://dblp.org/rec/conf/icdf2c/SinghIV18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/GuptaB0V18,
author = {Ishita Gupta and
Ikshu Bhalla and
Richa Singh and
Mayank Vatsa},
title = {Scattering Transform for Matching Surgically Altered Face Images},
booktitle = {24th International Conference on Pattern Recognition, {ICPR} 2018,
Beijing, China, August 20-24, 2018},
pages = {2215--2220},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/ICPR.2018.8545219},
doi = {10.1109/ICPR.2018.8545219},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpr/GuptaB0V18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/LakraTKV018,
author = {Aditya Lakra and
Pavani Tripathi and
Rohit Keshari and
Mayank Vatsa and
Richa Singh},
title = {SegDenseNet: Iris Segmentation for Pre-and-Post Cataract Surgery},
booktitle = {24th International Conference on Pattern Recognition, {ICPR} 2018,
Beijing, China, August 20-24, 2018},
pages = {3150--3155},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/ICPR.2018.8545840},
doi = {10.1109/ICPR.2018.8545840},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpr/LakraTKV018.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/SiddiquiV018,
author = {Sahar Siddiqui and
Mayank Vatsa and
Richa Singh},
title = {Face Recognition for Newborns, Toddlers, and Pre-School Children:
{A} Deep Learning Approach},
booktitle = {24th International Conference on Pattern Recognition, {ICPR} 2018,
Beijing, China, August 20-24, 2018},
pages = {3156--3161},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/ICPR.2018.8545742},
doi = {10.1109/ICPR.2018.8545742},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpr/SiddiquiV018.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieeesensors/ChaturvediLSKMC18,
author = {Nidhi Chaturvedi and
Richard Lossy and
Kuldip Singh and
Dheeraj K. Kharbanda and
Shivanshu Mishra and
Ashok Chauhan and
Kaushal Kishore and
Pramod K. Khanna and
Joachim W{\"{u}}rfl},
title = {Design and Development of Gallium Nitride HEMTs Based Liquid Sensor},
booktitle = {2018 {IEEE} SENSORS, New Delhi, India, October 28-31, 2018},
pages = {1--3},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ICSENS.2018.8589615},
doi = {10.1109/ICSENS.2018.8589615},
timestamp = {Mon, 19 Dec 2022 11:25:47 +0100},
biburl = {https://dblp.org/rec/conf/ieeesensors/ChaturvediLSKMC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/ChhabraSVG18,
author = {Saheb Chhabra and
Richa Singh and
Mayank Vatsa and
Gaurav Gupta},
editor = {J{\'{e}}r{\^{o}}me Lang},
title = {Anonymizing k Facial Attributes via Adversarial Perturbations},
booktitle = {Proceedings of the Twenty-Seventh International Joint Conference on
Artificial Intelligence, {IJCAI} 2018, July 13-19, 2018, Stockholm,
Sweden},
pages = {656--662},
publisher = {ijcai.org},
year = {2018},
url = {https://doi.org/10.24963/ijcai.2018/91},
doi = {10.24963/IJCAI.2018/91},
timestamp = {Tue, 20 Aug 2019 16:19:08 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/ChhabraSVG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uemcom/GrewalMTCG18,
author = {Harkishan Singh Grewal and
Aaron Matthews and
Richard Tea and
Ved Contractor and
Kiran George},
editor = {Satyajit Chakrabarti and
Himadri Nath Saha},
title = {Sip-and-Puff Autonomous Wheelchair for Individuals with Severe Disabilities},
booktitle = {9th {IEEE} Annual Ubiquitous Computing, Electronics {\&} Mobile
Communication Conference, {UEMCON} 2018, New York City, NY, USA, November
8-10, 2018},
pages = {705--710},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/UEMCON.2018.8796679},
doi = {10.1109/UEMCON.2018.8796679},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/uemcom/GrewalMTCG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/MalhotraSVP18,
author = {Aakarsh Malhotra and
Richa Singh and
Mayank Vatsa and
Vishal M. Patel},
title = {Person Authentication Using Head Images},
booktitle = {2018 {IEEE} Winter Conference on Applications of Computer Vision,
{WACV} 2018, Lake Tahoe, NV, USA, March 12-15, 2018},
pages = {409--417},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/WACV.2018.00051},
doi = {10.1109/WACV.2018.00051},
timestamp = {Fri, 12 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wacv/MalhotraSVP18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/YadavKVSN18,
author = {Daksha Yadav and
Naman Kohli and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Iris Presentation Attack via Textured Contact Lens in Unconstrained
Environment},
booktitle = {2018 {IEEE} Winter Conference on Applications of Computer Vision,
{WACV} 2018, Lake Tahoe, NV, USA, March 12-15, 2018},
pages = {503--511},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/WACV.2018.00061},
doi = {10.1109/WACV.2018.00061},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wacv/YadavKVSN18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/hotsos/2018,
editor = {Munindar P. Singh and
Laurie A. Williams and
Rick Kuhn and
Tao Xie},
title = {Proceedings of the 5th Annual Symposium and Bootcamp on Hot Topics
in the Science of Security, HoTSoS 2018, Raleigh, North Carolina,
USA, April 10-11, 2018},
publisher = {{ACM}},
year = {2018},
url = {http://dl.acm.org/citation.cfm?id=3190619},
timestamp = {Mon, 07 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hotsos/2018.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1801-10100,
author = {Aditya Lakra and
Pavani Tripathi and
Rohit Keshari and
Mayank Vatsa and
Richa Singh},
title = {SegDenseNet: Iris Segmentation for Pre and Post Cataract Surgery},
journal = {CoRR},
volume = {abs/1801.10100},
year = {2018},
url = {http://arxiv.org/abs/1801.10100},
eprinttype = {arXiv},
eprint = {1801.10100},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1801-10100.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1802-08057,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa and
Angshul Majumdar},
title = {MagnifyMe: Aiding Cross Resolution Face Recognition via Identity Aware
Synthesis},
journal = {CoRR},
volume = {abs/1802.08057},
year = {2018},
url = {http://arxiv.org/abs/1802.08057},
eprinttype = {arXiv},
eprint = {1802.08057},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1802-08057.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1803-00401,
author = {Gaurav Goswami and
Nalini K. Ratha and
Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Unravelling Robustness of Deep Learning based Face Recognition Against
Adversarial Attacks},
journal = {CoRR},
volume = {abs/1803.00401},
year = {2018},
url = {http://arxiv.org/abs/1803.00401},
eprinttype = {arXiv},
eprint = {1803.00401},
timestamp = {Mon, 20 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1803-00401.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1803-07385,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh},
title = {Are you eligible? Predicting adulthood from face images via class
specific mean autoencoder},
journal = {CoRR},
volume = {abs/1803.07385},
year = {2018},
url = {http://arxiv.org/abs/1803.07385},
eprinttype = {arXiv},
eprint = {1803.07385},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1803-07385.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1803-07386,
author = {Akshay Sethi and
Maneet Singh and
Richa Singh and
Mayank Vatsa},
title = {Residual Codean Autoencoder for Facial Attribute Analysis},
journal = {CoRR},
volume = {abs/1803.07386},
year = {2018},
url = {http://arxiv.org/abs/1803.07386},
eprinttype = {arXiv},
eprint = {1803.07386},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1803-07386.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1803-11405,
author = {Rohit Keshari and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Learning Structure and Strength of {CNN} Filters for Small Sample
Size Training},
journal = {CoRR},
volume = {abs/1803.11405},
year = {2018},
url = {http://arxiv.org/abs/1803.11405},
eprinttype = {arXiv},
eprint = {1803.11405},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1803-11405.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-07905,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {Class Representative Autoencoder for Low Resolution Multi-Spectral
Gender Classification},
journal = {CoRR},
volume = {abs/1805.07905},
year = {2018},
url = {http://arxiv.org/abs/1805.07905},
eprinttype = {arXiv},
eprint = {1805.07905},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-07905.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-09380,
author = {Saheb Chhabra and
Richa Singh and
Mayank Vatsa and
Gaurav Gupta},
title = {Anonymizing k-Facial Attributes via Adversarial Perturbations},
journal = {CoRR},
volume = {abs/1805.09380},
year = {2018},
url = {http://arxiv.org/abs/1805.09380},
eprinttype = {arXiv},
eprint = {1805.09380},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-09380.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-10557,
author = {Naman Kohli and
Mayank Vatsa and
Richa Singh and
Afzel Noore and
Angshul Majumdar},
title = {Hierarchical Representation Learning for Kinship Verification},
journal = {CoRR},
volume = {abs/1805.10557},
year = {2018},
url = {http://arxiv.org/abs/1805.10557},
eprinttype = {arXiv},
eprint = {1805.10557},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-10557.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-12167,
author = {Naman Kohli and
Daksha Yadav and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Supervised Mixed Norm Autoencoder for Kinship Verification in Unconstrained
Videos},
journal = {CoRR},
volume = {abs/1805.12167},
year = {2018},
url = {http://arxiv.org/abs/1805.12167},
eprinttype = {arXiv},
eprint = {1805.12167},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-12167.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1808-04571,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Learning {A} Shared Transform Model for Skull to Digital Face Image
Matching},
journal = {CoRR},
volume = {abs/1808.04571},
year = {2018},
url = {http://arxiv.org/abs/1808.04571},
eprinttype = {arXiv},
eprint = {1808.04571},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1808-04571.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1810-01943,
author = {Rachel K. E. Bellamy and
Kuntal Dey and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Kalapriya Kannan and
Pranay Lohia and
Jacquelyn Martino and
Sameep Mehta and
Aleksandra Mojsilovic and
Seema Nagar and
Karthikeyan Natesan Ramamurthy and
John T. Richards and
Diptikalyan Saha and
Prasanna Sattigeri and
Moninder Singh and
Kush R. Varshney and
Yunfeng Zhang},
title = {{AI} Fairness 360: An Extensible Toolkit for Detecting, Understanding,
and Mitigating Unwanted Algorithmic Bias},
journal = {CoRR},
volume = {abs/1810.01943},
year = {2018},
url = {http://arxiv.org/abs/1810.01943},
eprinttype = {arXiv},
eprint = {1810.01943},
timestamp = {Tue, 30 Oct 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1810-01943.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1810-06221,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Supervised {COSMOS} Autoencoder: Learning Beyond the Euclidean Loss!},
journal = {CoRR},
volume = {abs/1810.06221},
year = {2018},
url = {http://arxiv.org/abs/1810.06221},
eprinttype = {arXiv},
eprint = {1810.06221},
timestamp = {Tue, 30 Oct 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1810-06221.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-00846,
author = {Rishabh Garg and
Yashasvi Baweja and
Soumyadeep Ghosh and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Heterogeneity Aware Deep Embedding for Mobile Periocular Recognition},
journal = {CoRR},
volume = {abs/1811.00846},
year = {2018},
url = {http://arxiv.org/abs/1811.00846},
eprinttype = {arXiv},
eprint = {1811.00846},
timestamp = {Thu, 22 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1811-00846.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-07318,
author = {Saksham Suri and
Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {On Matching Faces with Alterations due to Plastic Surgery and Disguise},
journal = {CoRR},
volume = {abs/1811.07318},
year = {2018},
url = {http://arxiv.org/abs/1811.07318},
eprinttype = {arXiv},
eprint = {1811.07318},
timestamp = {Sun, 25 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1811-07318.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-08837,
author = {Maneet Singh and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha and
Rama Chellappa},
title = {Recognizing Disguised Faces in the Wild},
journal = {CoRR},
volume = {abs/1811.08837},
year = {2018},
url = {http://arxiv.org/abs/1811.08837},
eprinttype = {arXiv},
eprint = {1811.08837},
timestamp = {Mon, 26 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1811-08837.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1812-03944,
author = {Saheb Chhabra and
Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Data Fine-tuning},
journal = {CoRR},
volume = {abs/1812.03944},
year = {2018},
url = {http://arxiv.org/abs/1812.03944},
eprinttype = {arXiv},
eprint = {1812.03944},
timestamp = {Tue, 01 Jan 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1812-03944.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1812-03965,
author = {Rohit Keshari and
Richa Singh and
Mayank Vatsa},
title = {Guided Dropout},
journal = {CoRR},
volume = {abs/1812.03965},
year = {2018},
url = {http://arxiv.org/abs/1812.03965},
eprinttype = {arXiv},
eprint = {1812.03965},
timestamp = {Tue, 01 Jan 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1812-03965.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/RouchkaCTPRSVCFCMJJHCSDSMFWHFLMLD17,
author = {Eric C. Rouchka and
Julia H. Chariker and
David Tieri and
Juw Won Park and
Shreedharkumar D. Rajurkar and
Vikas Singh and
Nishchal K. Verma and
Yan Cui and
Mark L. Farman and
Bradford Condon and
Neil Moore and
Jerzy W. Jaromczyk and
Jolanta Jaromczyk and
Daniel R. Harris and
Patrick Calie and
Eun Kyong Shin and
Robert L. Davis and
Arash Shaban{-}Nejad and
Joshua M. Mitchell and
Robert M. Flight and
Qing Jun Wang and
Richard M. Higashi and
Teresa W.{-}M. Fan and
Andrew N. Lane and
Hunter N. B. Moseley and
Liangqun Lu and
Bernie J. Daigle and
Xi Chen and
Andrey Smelter and
Li Chen and
Bailey K. Phan and
Nathaniel J. Serpico and
Ethan G. Toney and
Caroline E. Melton and
Jennifer R. Mandel and
Bernie J. Daigle Jr. and
Hao Chen and
Kazi I. Zaman and
Ramin Homayouni and
Patrick J. Trainor and
Samantha M. Carlisle and
Andrew P. DeFilippis and
Shesh N. Rai},
title = {Proceedings of the 16th Annual {UT-KBRIN} Bioinformatics Summit 2016:
bioinformatics: Burns, TN, {USA.} April 21-23, 2017},
journal = {{BMC} Bioinform.},
volume = {18},
number = {{S-9}},
year = {2017},
url = {https://doi.org/10.1186/s12859-017-1781-y},
doi = {10.1186/S12859-017-1781-Y},
timestamp = {Wed, 24 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/RouchkaCTPRSVCFCMJJHCSDSMFWHFLMLD17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/MittalJGVS17,
author = {Paritosh Mittal and
Aishwarya Jain and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh},
title = {Composite sketch recognition using saliency and attribute feedback},
journal = {Inf. Fusion},
volume = {33},
pages = {86--99},
year = {2017},
url = {https://doi.org/10.1016/j.inffus.2016.04.003},
doi = {10.1016/J.INFFUS.2016.04.003},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/inffus/MittalJGVS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/SankaranJVVS17,
author = {Anush Sankaran and
Aayush Jain and
Tarun Vashisth and
Mayank Vatsa and
Richa Singh},
title = {Adaptive latent fingerprint segmentation using feature selection and
random decision forest classification},
journal = {Inf. Fusion},
volume = {34},
pages = {1--15},
year = {2017},
url = {https://doi.org/10.1016/j.inffus.2016.05.002},
doi = {10.1016/J.INFFUS.2016.05.002},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/inffus/SankaranJVVS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ivc/SankaranVSM17,
author = {Anush Sankaran and
Mayank Vatsa and
Richa Singh and
Angshul Majumdar},
title = {Group sparse autoencoder},
journal = {Image Vis. Comput.},
volume = {60},
pages = {64--74},
year = {2017},
url = {https://doi.org/10.1016/j.imavis.2017.01.005},
doi = {10.1016/J.IMAVIS.2017.01.005},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ivc/SankaranVSM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/McEvoySHAA17,
author = {Dustin McEvoy and
Dean F. Sittig and
Thu{-}Trang T. Hickman and
Skye Aaron and
Angela Ai and
Mary G. Amato and
David W. Bauer and
Greg Fraser and
Jeremy Harper and
Angela Kennemer and
Michael Krall and
Christoph U. Lehmann and
Sameer Malhotra and
Daniel R. Murphy and
Brandi O'Kelley and
Lipika Samal and
Richard Schreiber and
Hardeep Singh and
Eric J. Thomas and
Carl V. Vartian and
Jennifer Westmorland and
Allison B. McCoy and
Adam Wright},
title = {Variation in high-priority drug-drug interaction alerts across institutions
and electronic health records},
journal = {J. Am. Medical Informatics Assoc.},
volume = {24},
number = {2},
pages = {331--338},
year = {2017},
url = {https://doi.org/10.1093/jamia/ocw114},
doi = {10.1093/JAMIA/OCW114},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jamia/McEvoySHAA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsyml/RastS17,
author = {Richard Rast and
Davender Singh Sahota},
title = {The Borel Complexity of Isomorphism for O-Minimal Theories},
journal = {J. Symb. Log.},
volume = {82},
number = {2},
pages = {453--473},
year = {2017},
url = {https://doi.org/10.1017/jsl.2017.17},
doi = {10.1017/JSL.2017.17},
timestamp = {Wed, 19 Jul 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsyml/RastS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/SrivastavaSGS17,
author = {Richa Srivastava and
Urvashi Singh and
Maneesha Gupta and
Devesh Singh},
title = {Low-voltage low-power high performance current mode fullwave rectifier},
journal = {Microelectron. J.},
volume = {61},
pages = {51--56},
year = {2017},
url = {https://doi.org/10.1016/j.mejo.2017.01.004},
doi = {10.1016/J.MEJO.2017.01.004},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mj/SrivastavaSGS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/LiRG17,
author = {Yuanning Li and
Robert Mark Richardson and
Avniel Singh Ghuman},
title = {Multi-Connection Pattern Analysis: Decoding the representational content
of neural communication},
journal = {NeuroImage},
volume = {162},
pages = {32--44},
year = {2017},
url = {https://doi.org/10.1016/j.neuroimage.2017.08.033},
doi = {10.1016/J.NEUROIMAGE.2017.08.033},
timestamp = {Wed, 29 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/LiRG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/MajumdarSV17,
author = {Angshul Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Face Verification via Class Sparsity Based Supervised Encoding},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {39},
number = {6},
pages = {1273--1280},
year = {2017},
url = {https://doi.org/10.1109/TPAMI.2016.2569436},
doi = {10.1109/TPAMI.2016.2569436},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pami/MajumdarSV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/peerj-cs/MeurerSPCKRKIMS17,
author = {Aaron Meurer and
Christopher P. Smith and
Mateusz Paprocki and
Ondrej Cert{\'{\i}}k and
Sergey B. Kirpichev and
Matthew Rocklin and
Amit Kumar and
Sergiu Ivanov and
Jason Keith Moore and
Sartaj Singh and
Thilina Rathnayake and
Sean Vig and
Brian E. Granger and
Richard P. Muller and
Francesco Bonazzi and
Harsh Gupta and
Shivam Vats and
Fredrik Johansson and
Fabian Pedregosa and
Matthew J. Curry and
Andy R. Terrel and
Step{\'{a}}n Roucka and
Ashutosh Saboo and
Isuru Fernando and
Sumith Kulal and
Robert Cimrman and
Anthony M. Scopatz},
title = {SymPy: symbolic computing in Python},
journal = {PeerJ Comput. Sci.},
volume = {3},
pages = {e103},
year = {2017},
url = {https://doi.org/10.7717/peerj-cs.103},
doi = {10.7717/PEERJ-CS.103},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/peerj-cs/MeurerSPCKRKIMS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/SankaranGVSM17,
author = {Anush Sankaran and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh and
Angshul Majumdar},
title = {Class sparsity signature based Restricted Boltzmann Machine},
journal = {Pattern Recognit.},
volume = {61},
pages = {674--685},
year = {2017},
url = {https://doi.org/10.1016/j.patcog.2016.04.014},
doi = {10.1016/J.PATCOG.2016.04.014},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pr/SankaranGVSM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/AminRMTMRDSYCOR17,
author = {Ruhul Amin and
Benjamin L. Richards and
William F. X. E. Misa and
Jeremy C. Taylor and
Dianna R. Miller and
Audrey K. Rollo and
Christopher Demarke and
Hanumant Singh and
Grace C. Young and
Jeremy Childress and
Justin E. Ossolinski and
Russell T. Reardon and
Kyle H. Koyanagi},
title = {The Modular Optical Underwater Survey System},
journal = {Sensors},
volume = {17},
number = {10},
pages = {2309},
year = {2017},
url = {https://doi.org/10.3390/s17102309},
doi = {10.3390/S17102309},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/AminRMTMRDSYCOR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/GoswamiVS17,
author = {Gaurav Goswami and
Mayank Vatsa and
Richa Singh},
title = {Face Verification via Learned Representation on Feature-Rich Video
Frames},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {12},
number = {7},
pages = {1686--1698},
year = {2017},
url = {https://doi.org/10.1109/TIFS.2017.2668221},
doi = {10.1109/TIFS.2017.2668221},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/GoswamiVS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/ManjaniTVSM17,
author = {Ishan Manjani and
Snigdha Tariyal and
Mayank Vatsa and
Richa Singh and
Angshul Majumdar},
title = {Detecting Silicone Mask-Based Presentation Attack via Deep Dictionary
Learning},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {12},
number = {7},
pages = {1713--1723},
year = {2017},
url = {https://doi.org/10.1109/TIFS.2017.2676720},
doi = {10.1109/TIFS.2017.2676720},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/ManjaniTVSM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tii/NegiKUN17,
author = {Sanjay Singh Negi and
Nand Kishor and
Kjetil Uhlen and
Richa Negi},
title = {Event Detection and Its Signal Characterization in {PMU} Data Stream},
journal = {{IEEE} Trans. Ind. Informatics},
volume = {13},
number = {6},
pages = {3108--3118},
year = {2017},
url = {https://doi.org/10.1109/TII.2017.2731366},
doi = {10.1109/TII.2017.2731366},
timestamp = {Thu, 21 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tii/NegiKUN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/KohliVSNM17,
author = {Naman Kohli and
Mayank Vatsa and
Richa Singh and
Afzel Noore and
Angshul Majumdar},
title = {Hierarchical Representation Learning for Kinship Verification},
journal = {{IEEE} Trans. Image Process.},
volume = {26},
number = {1},
pages = {289--302},
year = {2017},
url = {https://doi.org/10.1109/TIP.2016.2609811},
doi = {10.1109/TIP.2016.2609811},
timestamp = {Sun, 10 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tip/KohliVSNM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigdataconf/UnderwoodMLABFG17,
author = {William Underwood and
Richard Marciano and
Sandra Laib and
Carl Apgar and
Luis Beteta and
Waleed Falak and
Marisa Gilman and
Riss Hardcastle and
Keona Holden and
Yun Huang and
David Baasch and
Brittni Ballard and
Tricia Glaser and
Adam Gray and
Leigh Plummer and
Zeynep Diker and
Mayanka Jha and
Aakanksha Singh and
Namrata Walanj},
editor = {Jian{-}Yun Nie and
Zoran Obradovic and
Toyotaro Suzumura and
Rumi Ghosh and
Raghunath Nambiar and
Chonggang Wang and
Hui Zang and
Ricardo Baeza{-}Yates and
Xiaohua Hu and
Jeremy Kepner and
Alfredo Cuzzocrea and
Jian Tang and
Masashi Toyoda},
title = {Computational curation of a digitized record series of {WWII} Japanese-American
Internment},
booktitle = {2017 {IEEE} International Conference on Big Data {(IEEE} BigData 2017),
Boston, MA, USA, December 11-14, 2017},
pages = {2309--2313},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/BigData.2017.8258184},
doi = {10.1109/BIGDATA.2017.8258184},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bigdataconf/UnderwoodMLABFG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coinco/SamantCVKN17,
author = {Sunil Singh Samant and
Mohan Baruwal Chhetri and
Quoc Bao Vo and
Ryszard Kowalczyk and
Surya Nepal},
title = {Towards Quality-Assured Data Delivery in Cloud-Based IoT Platforms
for Smart Cities},
booktitle = {3rd {IEEE} International Conference on Collaboration and Internet
Computing, {CIC} 2017, San Jose, CA, USA, October 15-17, 2017},
pages = {291--298},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/CIC.2017.00046},
doi = {10.1109/CIC.2017.00046},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/coinco/SamantCVKN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/AgarwalYKSVN17,
author = {Akshay Agarwal and
Daksha Yadav and
Naman Kohli and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Face Presentation Attack with Latex Masks in Multispectral Videos},
booktitle = {2017 {IEEE} Conference on Computer Vision and Pattern Recognition
Workshops, {CVPR} Workshops 2017, Honolulu, HI, USA, July 21-26, 2017},
pages = {275--283},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/CVPRW.2017.40},
doi = {10.1109/CVPRW.2017.40},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/AgarwalYKSVN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ChughSNSV17,
author = {Tarang Chugh and
Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {Transfer Learning Based Evolutionary Algorithm for Composite Face
Sketch Recognition},
booktitle = {2017 {IEEE} Conference on Computer Vision and Pattern Recognition
Workshops, {CVPR} Workshops 2017, Honolulu, HI, USA, July 21-26, 2017},
pages = {619--627},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/CVPRW.2017.90},
doi = {10.1109/CVPRW.2017.90},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/ChughSNSV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ehealth2/PartlJSSBSSWNS17,
author = {Richard Partl and
Beata Jonko and
Stefan Schnidar and
Michael Sch{\"{o}}llhammer and
Max Bauer and
Sanchit Singh and
Julia Simeckova and
Kathrin Wiesner and
Andreas Neubauer and
Harald Schnidar},
editor = {Dieter Hayn and
G{\"{u}}nter Schreier},
title = {128 {SHADES} {OF} {RED:} Objective Remote Assessment of Radiation
Dermatitis by Augmented Digital Skin Imaging},
booktitle = {Health Informatics Meets eHealth - Digital Insight - Information-Driven
Health {\&} Care - Proceedings of the 11th eHealth2017 Conference,
eHealth 2017, Vienna, Austria, May 2017},
series = {Studies in Health Technology and Informatics},
volume = {236},
pages = {363--374},
publisher = {{IOS} Press},
year = {2017},
url = {https://doi.org/10.3233/978-1-61499-759-7-363},
doi = {10.3233/978-1-61499-759-7-363},
timestamp = {Mon, 14 Mar 2022 17:10:13 +0100},
biburl = {https://dblp.org/rec/conf/ehealth2/PartlJSSBSSWNS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/AgarwalSVN17,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {SWAPPED! Digital face presentation attack detection via weighted local
magnitude pattern},
booktitle = {2017 {IEEE} International Joint Conference on Biometrics, {IJCB} 2017,
Denver, CO, USA, October 1-4, 2017},
pages = {659--665},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/BTAS.2017.8272754},
doi = {10.1109/BTAS.2017.8272754},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/AgarwalSVN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/BasakDAMVS17,
author = {Pratichi Basak and
Saurabh De and
Mallika Agarwal and
Aakarsh Malhotra and
Mayank Vatsa and
Richa Singh},
title = {Multimodal biometric recognition for toddlers and pre-school children},
booktitle = {2017 {IEEE} International Joint Conference on Biometrics, {IJCB} 2017,
Denver, CO, USA, October 1-4, 2017},
pages = {627--633},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/BTAS.2017.8272750},
doi = {10.1109/BTAS.2017.8272750},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/BasakDAMVS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/BharatiVSBT17,
author = {Aparna Bharati and
Mayank Vatsa and
Richa Singh and
Kevin W. Bowyer and
Xin Tong},
title = {Demography-based facial retouching detection using subclass supervised
sparse autoencoder},
booktitle = {2017 {IEEE} International Joint Conference on Biometrics, {IJCB} 2017,
Denver, CO, USA, October 1-4, 2017},
pages = {474--482},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/BTAS.2017.8272732},
doi = {10.1109/BTAS.2017.8272732},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/BharatiVSBT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/KohliYVSN17,
author = {Naman Kohli and
Daksha Yadav and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Synthetic iris presentation attack using iDCGAN},
booktitle = {2017 {IEEE} International Joint Conference on Biometrics, {IJCB} 2017,
Denver, CO, USA, October 1-4, 2017},
pages = {674--680},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/BTAS.2017.8272756},
doi = {10.1109/BTAS.2017.8272756},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icb/KohliYVSN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/NagpalSJSVN17,
author = {Shruti Nagpal and
Maneet Singh and
Arushi Jain and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {On matching skulls to digital face images: {A} preliminary approach},
booktitle = {2017 {IEEE} International Joint Conference on Biometrics, {IJCB} 2017,
Denver, CO, USA, October 1-4, 2017},
pages = {813--819},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/BTAS.2017.8272775},
doi = {10.1109/BTAS.2017.8272775},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icb/NagpalSJSVN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/SinghNVSNM17,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh and
Afzel Noore and
Angshul Majumdar},
title = {Gender and ethnicity classification of Iris images using deep class-encoder},
booktitle = {2017 {IEEE} International Joint Conference on Biometrics, {IJCB} 2017,
Denver, CO, USA, October 1-4, 2017},
pages = {666--673},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/BTAS.2017.8272755},
doi = {10.1109/BTAS.2017.8272755},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icb/SinghNVSNM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/YadavKVSN17,
author = {Daksha Yadav and
Naman Kohli and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Unconstrained visible spectrum iris with textured contact lens variations:
Database and benchmarking},
booktitle = {2017 {IEEE} International Joint Conference on Biometrics, {IJCB} 2017,
Denver, CO, USA, October 1-4, 2017},
pages = {574--580},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/BTAS.2017.8272744},
doi = {10.1109/BTAS.2017.8272744},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icb/YadavKVSN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/YambayBKYCBSSVN17,
author = {David Yambay and
Benedict Becker and
Naman Kohli and
Daksha Yadav and
Adam Czajka and
Kevin W. Bowyer and
Stephanie Schuckers and
Richa Singh and
Mayank Vatsa and
Afzel Noore and
Diego Gragnaniello and
Carlo Sansone and
Luisa Verdoliva and
Lingxiao He and
Yiwei Ru and
Haiqing Li and
Nianfeng Liu and
Zhenan Sun and
Tieniu Tan},
title = {LivDet iris 2017 - Iris liveness detection competition 2017},
booktitle = {2017 {IEEE} International Joint Conference on Biometrics, {IJCB} 2017,
Denver, CO, USA, October 1-4, 2017},
pages = {733--741},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/BTAS.2017.8272763},
doi = {10.1109/BTAS.2017.8272763},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/YambayBKYCBSSVN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/NagpalSSVNM17,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa and
Afzel Noore and
Angshul Majumdar},
title = {Face Sketch Matching via Coupled Deep Transform Learning},
booktitle = {{IEEE} International Conference on Computer Vision, {ICCV} 2017, Venice,
Italy, October 22-29, 2017},
pages = {5429--5438},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/ICCV.2017.579},
doi = {10.1109/ICCV.2017.579},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccv/NagpalSSVNM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/GoswamiSVM17,
author = {Gaurav Goswami and
Richa Singh and
Mayank Vatsa and
Angshul Majumdar},
title = {Kernel group sparse representation based classifier for multimodal
biometrics},
booktitle = {2017 International Joint Conference on Neural Networks, {IJCNN} 2017,
Anchorage, AK, USA, May 14-19, 2017},
pages = {2894--2901},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/IJCNN.2017.7966214},
doi = {10.1109/IJCNN.2017.7966214},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ijcnn/GoswamiSVM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/SinghNSV17,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {Class representative autoencoder for low resolution multi-spectral
gender classification},
booktitle = {2017 International Joint Conference on Neural Networks, {IJCNN} 2017,
Anchorage, AK, USA, May 14-19, 2017},
pages = {1026--1033},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/IJCNN.2017.7965965},
doi = {10.1109/IJCNN.2017.7965965},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ijcnn/SinghNSV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/YadavKNSPVSNPM17,
author = {Daksha Yadav and
Naman Kohli and
Shruti Nagpal and
Maneet Singh and
Prateekshit Pandey and
Mayank Vatsa and
Richa Singh and
Afzel Noore and
Gokulraj Prabhakaran and
Harsh Mahajan},
title = {Region-specific fMRI dictionary for decoding face verification in
humans},
booktitle = {2017 International Joint Conference on Neural Networks, {IJCNN} 2017,
Anchorage, AK, USA, May 14-19, 2017},
pages = {3814--3821},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/IJCNN.2017.7966337},
doi = {10.1109/IJCNN.2017.7966337},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ijcnn/YadavKNSPVSNPM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sipaim/SinghSMCCGR017,
author = {Shibani Singh and
Anant Srivastava and
Liang Mi and
Richard J. Caselli and
Kewei Chen and
Dhruman Goradia and
Eric M. Reiman and
Yalin Wang},
editor = {Eduardo Romero and
Natasha Lepor{\'{e}} and
Jorge Brieva and
Juan David Garc{\'{\i}}a},
title = {Deep-learning-based classification of {FDG-PET} data for Alzheimer's
disease categories},
booktitle = {13th International Symposium on Medical Information Processing and
Analysis, {SIPAIM} 2017, San Andres Island, Colombia, 5-7 October
2017},
series = {{SPIE} Proceedings},
volume = {10572},
pages = {105720J},
publisher = {{SPIE}},
year = {2017},
url = {https://doi.org/10.1117/12.2294537},
doi = {10.1117/12.2294537},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sipaim/SinghSMCCGR017.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sp/PowellKGVSN17,
author = {Brian M. Powell and
Ekampreet Kalsy and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Attack-Resistant aiCAPTCHA Using a Negative Selection Artificial Immune
System},
booktitle = {2017 {IEEE} Security and Privacy Workshops, {SP} Workshops 2017, San
Jose, CA, USA, May 25, 2017},
pages = {41--46},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/SPW.2017.22},
doi = {10.1109/SPW.2017.22},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sp/PowellKGVSN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/SinghBOFL17,
author = {Ravinder Singh and
Qiang Bai and
Timothy O'Farrell and
Kenneth Lee Ford and
Richard J. Langley},
title = {Concurrent, Tunable, Multi-Band, Single Chain Radio Receivers for
5G RANs},
booktitle = {85th {IEEE} Vehicular Technology Conference, {VTC} Spring 2017, Sydney,
Australia, June 4-7, 2017},
pages = {1--5},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/VTCSpring.2017.8108423},
doi = {10.1109/VTCSPRING.2017.8108423},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vtc/SinghBOFL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/SinghBOFL17a,
author = {Ravinder Singh and
Qiang Bai and
Timothy O'Farrell and
Kenneth Lee Ford and
Richard J. Langley},
title = {Concurrent, Multi-Band, Single-Chain Radio Receiver for High Data-Rate
HetNets},
booktitle = {86th {IEEE} Vehicular Technology Conference, {VTC} Fall 2017, Toronto,
ON, Canada, September 24-27, 2017},
pages = {1--5},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/VTCFall.2017.8287876},
doi = {10.1109/VTCFALL.2017.8287876},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vtc/SinghBOFL17a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wiopt/OFarrellSBFLBAG17,
author = {Timothy O'Farrell and
Ravinder Singh and
Qiang Bai and
Kenneth Lee Ford and
Richard J. Langley and
Mark A. Beach and
Eyad Arabi and
Chris Gamlath and
Kevin A. Morris},
title = {Tunable, concurrent multiband, single chain radio architecture for
low energy 5G-RANs},
booktitle = {15th International Symposium on Modeling and Optimization in Mobile,
Ad Hoc, and Wireless Networks, WiOpt 2017, Paris, France, May 15-19,
2017},
pages = {1--6},
publisher = {{IEEE}},
year = {2017},
url = {https://dl.ifip.org/db/conf/wiopt/wiopt2017/1570349372.pdf},
doi = {10.23919/WIOPT.2017.7959932},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wiopt/OFarrellSBFLBAG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/MendlingWABCDDC17,
author = {Jan Mendling and
Ingo Weber and
Wil M. P. van der Aalst and
Jan vom Brocke and
Cristina Cabanillas and
Florian Daniel and
S{\o}ren Debois and
Claudio Di Ciccio and
Marlon Dumas and
Schahram Dustdar and
Avigdor Gal and
Luciano Garc{\'{\i}}a{-}Ba{\~{n}}uelos and
Guido Governatori and
Richard Hull and
Marcello La Rosa and
Henrik Leopold and
Frank Leymann and
Jan Recker and
Manfred Reichert and
Hajo A. Reijers and
Stefanie Rinderle{-}Ma and
Andreas Rogge{-}Solti and
Michael Rosemann and
Stefan Schulte and
Munindar P. Singh and
Tijs Slaats and
Mark Staples and
Barbara Weber and
Matthias Weidlich and
Mathias Weske and
Xiwei Xu and
Liming Zhu},
title = {Blockchains for Business Process Management - Challenges and Opportunities},
journal = {CoRR},
volume = {abs/1704.03610},
year = {2017},
url = {http://arxiv.org/abs/1704.03610},
eprinttype = {arXiv},
eprint = {1704.03610},
timestamp = {Sat, 27 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/MendlingWABCDDC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1709-07598,
author = {Aparna Bharati and
Mayank Vatsa and
Richa Singh and
Kevin W. Bowyer and
Xin Tong},
title = {Demography-based Facial Retouching Detection using Subclass Supervised
Sparse Autoencoder},
journal = {CoRR},
volume = {abs/1709.07598},
year = {2017},
url = {http://arxiv.org/abs/1709.07598},
eprinttype = {arXiv},
eprint = {1709.07598},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1709-07598.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1710-02856,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh and
Afzel Noore and
Angshul Majumdar},
title = {Gender and Ethnicity Classification of Iris Images using Deep Class-Encoder},
journal = {CoRR},
volume = {abs/1710.02856},
year = {2017},
url = {http://arxiv.org/abs/1710.02856},
eprinttype = {arXiv},
eprint = {1710.02856},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1710-02856.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1710-02866,
author = {Shruti Nagpal and
Maneet Singh and
Arushi Jain and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {On Matching Skulls to Digital Face Images: {A} Preliminary Approach},
journal = {CoRR},
volume = {abs/1710.02866},
year = {2017},
url = {http://arxiv.org/abs/1710.02866},
eprinttype = {arXiv},
eprint = {1710.02866},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1710-02866.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1710-02914,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa and
Afzel Noore and
Angshul Majumdar},
title = {Face Sketch Matching via Coupled Deep Transform Learning},
journal = {CoRR},
volume = {abs/1710.02914},
year = {2017},
url = {http://arxiv.org/abs/1710.02914},
eprinttype = {arXiv},
eprint = {1710.02914},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1710-02914.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1710-10565,
author = {Naman Kohli and
Daksha Yadav and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Synthetic Iris Presentation Attack using iDCGAN},
journal = {CoRR},
volume = {abs/1710.10565},
year = {2017},
url = {http://arxiv.org/abs/1710.10565},
eprinttype = {arXiv},
eprint = {1710.10565},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1710-10565.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/TariyalMSV16,
author = {Snigdha Tariyal and
Angshul Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Deep Dictionary Learning},
journal = {{IEEE} Access},
volume = {4},
pages = {10096--10109},
year = {2016},
url = {https://doi.org/10.1109/ACCESS.2016.2611583},
doi = {10.1109/ACCESS.2016.2611583},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/TariyalMSV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/SingheeLKWCKKTM16,
author = {Amith Singhee and
Zhiguo Li and
Ali Koc and
Haijing Wang and
James P. Cipriani and
Younghun Kim and
Ashok Pon Kumar and
Lloyd A. Treinish and
Richard Mueller and
Gerard Labut and
Richard A. Foltman and
Gary M. Gauthier},
title = {{OPRO:} Precise emergency preparedness for electric utilities},
journal = {{IBM} J. Res. Dev.},
volume = {60},
number = {1},
year = {2016},
url = {https://doi.org/10.1147/JRD.2015.2494999},
doi = {10.1147/JRD.2015.2494999},
timestamp = {Wed, 10 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ibmrd/SingheeLKWCKKTM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/GoswamiMMVS16,
author = {Gaurav Goswami and
Paritosh Mittal and
Angshul Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Group sparse representation based classification for multi-feature
multimodal biometrics},
journal = {Inf. Fusion},
volume = {32},
pages = {3--12},
year = {2016},
url = {https://doi.org/10.1016/j.inffus.2015.06.007},
doi = {10.1016/J.INFFUS.2015.06.007},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/inffus/GoswamiMMVS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/SinghRB16,
author = {Richa Singh and
Arun Ross and
Kevin W. Bowyer},
title = {Special issue on information fusion in biometrics},
journal = {Inf. Fusion},
volume = {32},
pages = {1--2},
year = {2016},
url = {https://doi.org/10.1016/j.inffus.2016.04.004},
doi = {10.1016/J.INFFUS.2016.04.004},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/inffus/SinghRB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ivc/NagpalVS16,
author = {Shruti Nagpal and
Mayank Vatsa and
Richa Singh},
title = {Sketch Recognition: What Lies Ahead?},
journal = {Image Vis. Comput.},
volume = {55},
pages = {9--13},
year = {2016},
url = {https://doi.org/10.1016/j.imavis.2016.03.019},
doi = {10.1016/J.IMAVIS.2016.03.019},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ivc/NagpalVS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/PandeySKM16,
author = {Richa Pandey and
Amit Kumar Singh and
Basant Kumar and
Anand Mohan},
title = {Iris based secure {NROI} multiple eye image watermarking for teleophthalmology},
journal = {Multim. Tools Appl.},
volume = {75},
number = {22},
pages = {14381--14397},
year = {2016},
url = {https://doi.org/10.1007/s11042-016-3536-6},
doi = {10.1007/S11042-016-3536-6},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mta/PandeySKM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/DhamechaSV16,
author = {Tejas Indulal Dhamecha and
Richa Singh and
Mayank Vatsa},
title = {On incremental semi-supervised discriminant analysis},
journal = {Pattern Recognit.},
volume = {52},
pages = {135--147},
year = {2016},
url = {https://doi.org/10.1016/j.patcog.2015.09.030},
doi = {10.1016/J.PATCOG.2015.09.030},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pr/DhamechaSV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/MehrotraSVM16,
author = {Hunny Mehrotra and
Richa Singh and
Mayank Vatsa and
Banshidhar Majhi},
title = {Incremental granular relevance vector machine: {A} case study in multimodal
biometrics},
journal = {Pattern Recognit.},
volume = {56},
pages = {63--76},
year = {2016},
url = {https://doi.org/10.1016/j.patcog.2015.11.013},
doi = {10.1016/J.PATCOG.2015.11.013},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pr/MehrotraSVM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ram/WangSJARH16,
author = {Shuangyi Wang and
Davinder Singh and
Devapriyan Johnson and
Kaspar Althoefer and
Kawal S. Rhode and
Richard James Housden},
title = {Robotic Ultrasound: View Planning, Tracking, and Automatic Acquisition
of Transesophageal Echocardiography},
journal = {{IEEE} Robotics Autom. Mag.},
volume = {23},
number = {4},
pages = {118--127},
year = {2016},
url = {https://doi.org/10.1109/MRA.2016.2580478},
doi = {10.1109/MRA.2016.2580478},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ram/WangSJARH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/BharadwajBVS16,
author = {Samarth Bharadwaj and
Himanshu S. Bhatt and
Mayank Vatsa and
Richa Singh},
title = {Domain Specific Learning for Newborn Face Recognition},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {11},
number = {7},
pages = {1630--1641},
year = {2016},
url = {https://doi.org/10.1109/TIFS.2016.2538744},
doi = {10.1109/TIFS.2016.2538744},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/BharadwajBVS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/BharatiSVB16,
author = {Aparna Bharati and
Richa Singh and
Mayank Vatsa and
Kevin W. Bowyer},
title = {Detecting Facial Retouching Using Supervised Deep Learning},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {11},
number = {9},
pages = {1903--1913},
year = {2016},
url = {https://doi.org/10.1109/TIFS.2016.2561898},
doi = {10.1109/TIFS.2016.2561898},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/BharatiSVB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmc/SinghLBLS16,
author = {Vaibhav Singh and
Matthew Lentz and
Bobby Bhattacharjee and
Richard J. La and
Mark A. Shayman},
title = {Dynamic Frequency Resource Allocation in Heterogeneous Cellular Networks},
journal = {{IEEE} Trans. Mob. Comput.},
volume = {15},
number = {11},
pages = {2735--2748},
year = {2016},
url = {https://doi.org/10.1109/TMC.2016.2516980},
doi = {10.1109/TMC.2016.2516980},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tmc/SinghLBLS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/ManningSDDB16,
author = {John D. Manning and
Manmeet Singh and
Pavithra I. Dissanayake and
Elizabeth Day and
Richard Banchs},
title = {Incorporation of Case Setup Complexities into the Analysis of Operating
Room Turnover Times},
booktitle = {{AMIA} 2016, American Medical Informatics Association Annual Symposium,
Chicago, IL, USA, November 12-16, 2016},
publisher = {{AMIA}},
year = {2016},
url = {https://knowledge.amia.org/amia-63300-1.3360278/t005-1.3362920/f005-1.3362921/2500186-1.3363680/2499760-1.3363675},
timestamp = {Wed, 17 Apr 2024 11:47:32 +0200},
biburl = {https://dblp.org/rec/conf/amia/ManningSDDB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/AgarwalSV16,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Face anti-spoofing using Haralick features},
booktitle = {8th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2016, Niagara Falls, NY, USA, September 6-9, 2016},
pages = {1--6},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/BTAS.2016.7791171},
doi = {10.1109/BTAS.2016.7791171},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/AgarwalSV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/ChowdhuryGSV16,
author = {Anurag Chowdhury and
Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa},
title = {{RGB-D} face recognition via learning-based reconstruction},
booktitle = {8th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2016, Niagara Falls, NY, USA, September 6-9, 2016},
pages = {1--7},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/BTAS.2016.7791199},
doi = {10.1109/BTAS.2016.7791199},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/ChowdhuryGSV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/KohliYVSN16,
author = {Naman Kohli and
Daksha Yadav and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Detecting medley of iris spoofing attacks using {DESIST}},
booktitle = {8th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2016, Niagara Falls, NY, USA, September 6-9, 2016},
pages = {1--6},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/BTAS.2016.7791168},
doi = {10.1109/BTAS.2016.7791168},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/KohliYVSN16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/PowellKTGVSN16,
author = {Brian M. Powell and
Abhishek Kumar and
Jatin Thapar and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {A multibiometrics-based {CAPTCHA} for improved online security},
booktitle = {8th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2016, Niagara Falls, NY, USA, September 6-9, 2016},
pages = {1--8},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/BTAS.2016.7791157},
doi = {10.1109/BTAS.2016.7791157},
timestamp = {Tue, 13 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/PowellKTGVSN16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/SinghNGGGSV16,
author = {Maneet Singh and
Shruti Nagpal and
Nikita Gupta and
Sanchit Gupta and
Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa},
title = {Cross-spectral cross-resolution video database for face recognition},
booktitle = {8th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2016, Niagara Falls, NY, USA, September 6-9, 2016},
pages = {1--7},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/BTAS.2016.7791166},
doi = {10.1109/BTAS.2016.7791166},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/SinghNGGGSV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/TanejaTMSVS16,
author = {Archit Taneja and
Aakriti Tayal and
Aakarsh Malhotra and
Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {Fingerphoto spoofing in mobile devices: {A} preliminary study},
booktitle = {8th {IEEE} International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2016, Niagara Falls, NY, USA, September 6-9, 2016},
pages = {1--7},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/BTAS.2016.7791201},
doi = {10.1109/BTAS.2016.7791201},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/TanejaTMSVS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/PandeySV16,
author = {Prateekshit Pandey and
Richa Singh and
Mayank Vatsa},
title = {Face recognition using scattering wavelet under Illicit Drug Abuse
variations},
booktitle = {International Conference on Biometrics, {ICB} 2016, Halmstad, Sweden,
June 13-16, 2016},
pages = {1--6},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICB.2016.7550091},
doi = {10.1109/ICB.2016.7550091},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/icb/PandeySV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/GhoshKSV16,
author = {Soumyadeep Ghosh and
Rohit Keshari and
Richa Singh and
Mayank Vatsa},
title = {Face identification from low resolution near-infrared images},
booktitle = {2016 {IEEE} International Conference on Image Processing, {ICIP} 2016,
Phoenix, AZ, USA, September 25-28, 2016},
pages = {938--942},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICIP.2016.7532495},
doi = {10.1109/ICIP.2016.7532495},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icip/GhoshKSV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/KeshariGASV16,
author = {Rohit Keshari and
Soumyadeep Ghosh and
Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Mobile periocular matching with pre-post cataract surgery},
booktitle = {2016 {IEEE} International Conference on Image Processing, {ICIP} 2016,
Phoenix, AZ, USA, September 25-28, 2016},
pages = {3116--3120},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICIP.2016.7532933},
doi = {10.1109/ICIP.2016.7532933},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/KeshariGASV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/VermaMVS16,
author = {Shalini Verma and
Paritosh Mittal and
Mayank Vatsa and
Richa Singh},
title = {At-a-distance person recognition via combining ocular features},
booktitle = {2016 {IEEE} International Conference on Image Processing, {ICIP} 2016,
Phoenix, AZ, USA, September 25-28, 2016},
pages = {3131--3135},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICIP.2016.7532936},
doi = {10.1109/ICIP.2016.7532936},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/VermaMVS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/YadavSVSM16,
author = {Shivangi Yadav and
Maneet Singh and
Mayank Vatsa and
Richa Singh and
Angshul Majumdar},
title = {Low rank group sparse representation based classifier for pose variation},
booktitle = {2016 {IEEE} International Conference on Image Processing, {ICIP} 2016,
Phoenix, AZ, USA, September 25-28, 2016},
pages = {2986--2990},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICIP.2016.7532907},
doi = {10.1109/ICIP.2016.7532907},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/YadavSVSM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/AgarwalSV16,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Fingerprint sensor classification via M{\'{e}}lange of handcrafted
features},
booktitle = {23rd International Conference on Pattern Recognition, {ICPR} 2016,
Canc{\'{u}}n, Mexico, December 4-8, 2016},
pages = {3001--3006},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICPR.2016.7900094},
doi = {10.1109/ICPR.2016.7900094},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icpr/AgarwalSV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/GoswamiRSV16,
author = {Gaurav Goswami and
Nalini K. Ratha and
Richa Singh and
Mayank Vatsa},
title = {Improving classifier fusion via Pool Adjacent Violators normalization},
booktitle = {23rd International Conference on Pattern Recognition, {ICPR} 2016,
Canc{\'{u}}n, Mexico, December 4-8, 2016},
pages = {1011--1016},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICPR.2016.7899768},
doi = {10.1109/ICPR.2016.7899768},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icpr/GoswamiRSV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/SiddiquiBDAVSR16,
author = {Talha Ahmad Siddiqui and
Samarth Bharadwaj and
Tejas I. Dhamecha and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Face anti-spoofing with multifeature videolet aggregation},
booktitle = {23rd International Conference on Pattern Recognition, {ICPR} 2016,
Canc{\'{u}}n, Mexico, December 4-8, 2016},
pages = {1035--1040},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICPR.2016.7899772},
doi = {10.1109/ICPR.2016.7899772},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icpr/SiddiquiBDAVSR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieeesensors/SuHKSDKHALRT16,
author = {Peter Su and
Zhaohong Han and
Derek Kita and
Vivek Singh and
Qingyang Du and
Lionel C. Kimerling and
Juejun Hu and
Anu Agarwal and
Pao Tai Lin and
Kathleen A. Richardson and
Dawn T. H. Tan},
title = {Irradiation of on-chip chalcogenide glass waveguide mid-infrared gas
sensor},
booktitle = {2016 {IEEE} SENSORS, Orlando, FL, USA, October 30 - November 3, 2016},
pages = {1--3},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICSENS.2016.7808675},
doi = {10.1109/ICSENS.2016.7808675},
timestamp = {Wed, 28 Dec 2022 14:09:32 +0100},
biburl = {https://dblp.org/rec/conf/ieeesensors/SuHKSDKHALRT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ihci/SinghTB016,
author = {Ankita Singh and
Richa Tibrewal and
Chandrima Bhattacharya and
Malay Bhattacharyya},
editor = {Anupam Basu and
Sukhendu Das and
Patrick Horain and
Samit Bhattacharya},
title = {Hands Up! To Assess Your Sustained Fitness},
booktitle = {Intelligent Human Computer Interaction - 8th International Conference,
{IHCI} 2016, Pilani, India, December 12-13, 2016, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {10127},
pages = {187--194},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-52503-7\_15},
doi = {10.1007/978-3-319-52503-7\_15},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ihci/SinghTB016.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/GuoSLL16,
author = {Xiaoxiao Guo and
Satinder Singh and
Richard L. Lewis and
Honglak Lee},
editor = {Subbarao Kambhampati},
title = {Deep Learning for Reward Design to Improve Monte Carlo Tree Search
in {ATARI} Games},
booktitle = {Proceedings of the Twenty-Fifth International Joint Conference on
Artificial Intelligence, {IJCAI} 2016, New York, NY, USA, 9-15 July
2016},
pages = {1519--1525},
publisher = {{IJCAI/AAAI} Press},
year = {2016},
url = {http://www.ijcai.org/Abstract/16/218},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/GuoSLL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/JiangKSL16,
author = {Nan Jiang and
Alex Kulesza and
Satinder Singh and
Richard L. Lewis},
editor = {Subbarao Kambhampati},
title = {The Dependence of Effective Planning Horizon on Model Accuracy},
booktitle = {Proceedings of the Twenty-Fifth International Joint Conference on
Artificial Intelligence, {IJCAI} 2016, New York, NY, USA, 9-15 July
2016},
pages = {4180--4189},
publisher = {{IJCAI/AAAI} Press},
year = {2016},
url = {http://www.ijcai.org/Abstract/16/626},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/JiangKSL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ShokrollahiCFHH16,
author = {Amin Shokrollahi and
Dario Albino Carnelli and
John Fox and
Klaas L. Hofstra and
Brian Holden and
Ali Hormati and
Peter Hunt and
Margaret Johnston and
John Keay and
Sergio Pesenti and
Richard Simpson and
David Stauffer and
Andrew Stewart and
Giuseppe Surace and
Armin Tajalli and
Omid Talebi Amiri and
Anton Tschank and
Roger Ulrich and
Christoph Walter and
Fabio Licciardello and
Yohann Mogentale and
Anant Singh},
title = {10.1 {A} pin-efficient 20.83Gb/s/wire 0.94pJ/bit forwarded clock CNRZ-5-coded
SerDes up to 12mm for {MCM} packages in 28nm {CMOS}},
booktitle = {2016 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2016, San Francisco, CA, USA, January 31 - February 4, 2016},
pages = {182--183},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ISSCC.2016.7417967},
doi = {10.1109/ISSCC.2016.7417967},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/ShokrollahiCFHH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mhci/TibrewalSB16,
author = {Richa Tibrewal and
Ankita Singh and
Malay Bhattacharyya},
editor = {Fabio Patern{\`{o}} and
Kaisa V{\"{a}}{\"{a}}n{\"{a}}nen and
Karen Church and
Jonna H{\"{a}}kkil{\"{a}} and
Antonio Kr{\"{u}}ger and
Marcos Serrano},
title = {mSTROKE: a crowd-powered mobility towards stroke recognition},
booktitle = {Proceedings of the 18th International Conference on Human-Computer
Interaction with Mobile Devices and Services Adjunct, MobileHCI 2016,
Florence, Italy, September 6-9, 2016},
pages = {645--650},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2957265.2961831},
doi = {10.1145/2957265.2961831},
timestamp = {Sat, 30 Sep 2023 09:52:37 +0200},
biburl = {https://dblp.org/rec/conf/mhci/TibrewalSB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/WangSLRARH16,
author = {Shuangyi Wang and
Davinder Singh and
David Lau and
Kiran Reddy and
Kaspar Althoefer and
Kawal S. Rhode and
Richard James Housden},
editor = {Terry M. Peters and
Guang{-}Zhong Yang and
Nassir Navab and
Kensaku Mori and
Xiongbiao Luo and
Tobias Reichl and
A. Jonathan McLeod},
title = {Probe Tracking and Its Application in Automatic Acquisition Using
a Trans-Esophageal Ultrasound Robot},
booktitle = {Computer-Assisted and Robotic Endoscopy - Third International Workshop,
{CARE} 2016, Held in Conjunction with {MICCAI} 2016, Athens, Greece,
October 17, 2016, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {10170},
pages = {14--23},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-54057-3\_2},
doi = {10.1007/978-3-319-54057-3\_2},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miccai/WangSLRARH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ClarkJSCGB16,
author = {Michael A. Clark and
B{\'{a}}lint Jo{\'{o}} and
Alexei Strelchenko and
Michael Cheng and
Arjun Singh Gambhir and
Richard C. Brower},
editor = {John West and
Cherri M. Pancake},
title = {Accelerating lattice {QCD} multigrid on GPUs using fine-grained parallelization},
booktitle = {Proceedings of the International Conference for High Performance Computing,
Networking, Storage and Analysis, {SC} 2016, Salt Lake City, UT, USA,
November 13-18, 2016},
pages = {795--806},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/SC.2016.67},
doi = {10.1109/SC.2016.67},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/ClarkJSCGB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/SinghBOFL16,
author = {Ravinder Singh and
Qiang Bai and
Timothy O'Farrell and
Kenneth Lee Ford and
Richard J. Langley},
title = {Demonstration of {RF} Digitising Concurrent Dual-Band Receiver for
Carrier Aggregation over {TV} White Spaces},
booktitle = {{IEEE} 84th Vehicular Technology Conference, {VTC} Fall 2016, Montreal,
QC, Canada, September 18-21, 2016},
pages = {1--5},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/VTCFall.2016.7880952},
doi = {10.1109/VTCFALL.2016.7880952},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vtc/SinghBOFL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/DhamechaSSV16,
author = {Tejas Indulal Dhamecha and
Praneet Sharma and
Richa Singh and
Mayank Vatsa},
title = {Discriminative FaceTopics for face recognition via latent Dirichlet
allocation},
booktitle = {2016 {IEEE} Winter Conference on Applications of Computer Vision,
{WACV} 2016, Lake Placid, NY, USA, March 7-10, 2016},
pages = {1--8},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/WACV.2016.7477451},
doi = {10.1109/WACV.2016.7477451},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wacv/DhamechaSSV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/YadavKPSVN16,
author = {Daksha Yadav and
Naman Kohli and
Prateekshit Pandey and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Effect of illicit drug abuse on face recognition},
booktitle = {2016 {IEEE} Winter Conference on Applications of Computer Vision,
{WACV} 2016, Lake Placid, NY, USA, March 7-10, 2016},
pages = {1--7},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/WACV.2016.7477556},
doi = {10.1109/WACV.2016.7477556},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wacv/YadavKPSVN16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wiopt/SinghLS16,
author = {Vaibhav Singh and
Richard J. La and
Mark A. Shayman},
title = {Coordinated scheduling in {MIMO} heterogeneous wireless networks using
submodular optimization},
booktitle = {14th International Symposium on Modeling and Optimization in Mobile,
Ad Hoc, and Wireless Networks, WiOpt 2016, Tempe, AZ, USA, May 9-13,
2016},
pages = {107--114},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/WIOPT.2016.7492911},
doi = {10.1109/WIOPT.2016.7492911},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/wiopt/SinghLS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/xsede/ChiuLSDJPGLP16,
author = {Chui{-}Hui Chiu and
Nathan Lewis and
Dipak Kumar Singh and
Arghya Kusum Das and
Mohammad M. Jalazai and
Richard Platania and
Sayan Goswami and
Kisung Lee and
Seung{-}Jong Park},
title = {{BIC-LSU:} Big Data Research Integration with Cyberinfrastructure
for {LSU}},
booktitle = {Proceedings of the {XSEDE16} Conference on Diversity, Big Data, and
Science at Scale, Miami, USA, July 17-21, 2016},
pages = {28:1--28:8},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2949550.2949556},
doi = {10.1145/2949550.2949556},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/xsede/ChiuLSDJPGLP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/16/AgrawalPDSV16,
author = {Janhavi Agrawal and
Aishwarya Pant and
Tejas I. Dhamecha and
Richa Singh and
Mayank Vatsa},
editor = {Thirimachos Bourlai},
title = {Understanding Thermal Face Detection: Challenges and Evaluation},
booktitle = {Face Recognition Across the Imaging Spectrum},
pages = {139--163},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-28501-6\_7},
doi = {10.1007/978-3-319-28501-6\_7},
timestamp = {Tue, 29 Dec 2020 18:14:51 +0100},
biburl = {https://dblp.org/rec/books/sp/16/AgrawalPDSV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/16/GoswamiVS16,
author = {Gaurav Goswami and
Mayank Vatsa and
Richa Singh},
editor = {Thirimachos Bourlai},
title = {Face Recognition with {RGB-D} Images Using Kinect},
booktitle = {Face Recognition Across the Imaging Spectrum},
pages = {281--303},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-28501-6\_12},
doi = {10.1007/978-3-319-28501-6\_12},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/sp/16/GoswamiVS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/GuoSLL16,
author = {Xiaoxiao Guo and
Satinder Singh and
Richard L. Lewis and
Honglak Lee},
title = {Deep Learning for Reward Design to Improve Monte Carlo Tree Search
in {ATARI} Games},
journal = {CoRR},
volume = {abs/1604.07095},
year = {2016},
url = {http://arxiv.org/abs/1604.07095},
eprinttype = {arXiv},
eprint = {1604.07095},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/GuoSLL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/TariyalMSV16,
author = {Snigdha Tariyal and
Angshul Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Greedy Deep Dictionary Learning},
journal = {CoRR},
volume = {abs/1602.00203},
year = {2016},
url = {http://arxiv.org/abs/1602.00203},
eprinttype = {arXiv},
eprint = {1602.00203},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/TariyalMSV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/TomarR16,
author = {Vikrant Singh Tomar and
Richard C. Rose},
title = {Graph based manifold regularized deep neural networks for automatic
speech recognition},
journal = {CoRR},
volume = {abs/1606.05925},
year = {2016},
url = {http://arxiv.org/abs/1606.05925},
eprinttype = {arXiv},
eprint = {1606.05925},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/TomarR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/peerjpre/MeurerSPCRK0MSR16,
author = {Aaron Meurer and
Christopher P. Smith and
Mateusz Paprocki and
Ondrej Cert{\'{\i}}k and
Matthew Rocklin and
Amit Kumar and
Sergiu Ivanov and
Jason Keith Moore and
Sartaj Singh and
Thilina Rathnayake and
Sean Vig and
Brian E. Granger and
Richard P. Muller and
Francesco Bonazzi and
Harsh Gupta and
Shivam Vats and
Fredrik Johansson and
Fabian Pedregosa and
Matthew J. Curry and
Ashutosh Saboo and
Isuru Fernando and
Sumith Kulal and
Robert Cimrman and
Anthony M. Scopatz},
title = {SymPy: Symbolic computing in Python},
journal = {PeerJ Prepr.},
volume = {4},
pages = {e2083},
year = {2016},
url = {https://doi.org/10.7287/peerj.preprints.2083v2},
doi = {10.7287/PEERJ.PREPRINTS.2083V2},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/peerjpre/MeurerSPCRK0MSR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/NagpalSSV15,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa},
title = {Regularized Deep Learning for Face Recognition With Weight Variations},
journal = {{IEEE} Access},
volume = {3},
pages = {3010--3018},
year = {2015},
url = {https://doi.org/10.1109/ACCESS.2015.2510865},
doi = {10.1109/ACCESS.2015.2510865},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/NagpalSSV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/NigamASV15,
author = {Ishan Nigam and
Shreyasi Agrawal and
Richa Singh and
Mayank Vatsa},
title = {Revisiting HEp-2 Cell Image Classification},
journal = {{IEEE} Access},
volume = {3},
pages = {3102--3113},
year = {2015},
url = {https://doi.org/10.1109/ACCESS.2015.2504125},
doi = {10.1109/ACCESS.2015.2504125},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/NigamASV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SankaranVS15,
author = {Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {Multisensor Optical and Latent Fingerprint Database},
journal = {{IEEE} Access},
volume = {3},
pages = {653--665},
year = {2015},
url = {https://doi.org/10.1109/ACCESS.2015.2428631},
doi = {10.1109/ACCESS.2015.2428631},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/SankaranVS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/VatsaSB15,
author = {Mayank Vatsa and
Richa Singh and
Kevin W. Bowyer},
title = {{IEEE} Access Special Section Editorial: Applying Four D'S of Machine
Learning to Advance Biometrics},
journal = {{IEEE} Access},
volume = {3},
pages = {3083--3084},
year = {2015},
url = {https://doi.org/10.1109/ACCESS.2015.2513478},
doi = {10.1109/ACCESS.2015.2513478},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/VatsaSB15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/BresnikerSW15,
author = {Kirk Bresniker and
Sharad Singhal and
R. Stanley Williams},
title = {Adapting to Thrive in a New Economy of Memory Abundance},
journal = {Computer},
volume = {48},
number = {12},
pages = {44--53},
year = {2015},
url = {https://doi.org/10.1109/MC.2015.368},
doi = {10.1109/MC.2015.368},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/computer/BresnikerSW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijstm/SharmaSP15,
author = {Veenu Sharma and
Richa Singh and
G. N. Patel},
title = {Measuring the effect of brand equity on the consumers' purchase intention},
journal = {Int. J. Serv. Technol. Manag.},
volume = {21},
number = {1/2/3},
pages = {98--110},
year = {2015},
url = {https://doi.org/10.1504/IJSTM.2015.071106},
doi = {10.1504/IJSTM.2015.071106},
timestamp = {Thu, 30 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijstm/SharmaSP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijuwbcs/GuptaY15,
author = {Richa Gupta and
Rajveer S. Yaduvanshi},
title = {Embedded cylindrical magneto-hydrodynamic antenna},
journal = {Int. J. Ultra Wideband Commun. Syst.},
volume = {3},
number = {2},
pages = {68--74},
year = {2015},
url = {https://doi.org/10.1504/IJUWBCS.2015.077099},
doi = {10.1504/IJUWBCS.2015.077099},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijuwbcs/GuptaY15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijuwbcs/GuptaY15a,
author = {Richa Gupta and
Rajveer S. Yaduvanshi},
title = {High gain and wide band rectangular {DRA}},
journal = {Int. J. Ultra Wideband Commun. Syst.},
volume = {3},
number = {2},
pages = {107--114},
year = {2015},
url = {https://doi.org/10.1504/IJUWBCS.2015.077149},
doi = {10.1504/IJUWBCS.2015.077149},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijuwbcs/GuptaY15a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/NigamVS15,
author = {Ishan Nigam and
Mayank Vatsa and
Richa Singh},
title = {Ocular biometrics: {A} survey of modalities and fusion approaches},
journal = {Inf. Fusion},
volume = {26},
pages = {1--35},
year = {2015},
url = {https://doi.org/10.1016/j.inffus.2015.03.005},
doi = {10.1016/J.INFFUS.2015.03.005},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/inffus/NigamVS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/GuptaSS15,
author = {Maneesha Gupta and
Richa Srivastava and
Urvashi Singh},
title = {Low-voltage low-power {FGMOS} based {VDIBA} and its application as
universal filter},
journal = {Microelectron. J.},
volume = {46},
number = {2},
pages = {125--134},
year = {2015},
url = {https://doi.org/10.1016/j.mejo.2014.11.007},
doi = {10.1016/J.MEJO.2014.11.007},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mj/GuptaSS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/SinghGS15,
author = {Urvashi Singh and
Maneesha Gupta and
Richa Srivastava},
title = {A new wideband regulated cascode amplifier with improved performance
and its application},
journal = {Microelectron. J.},
volume = {46},
number = {8},
pages = {758--776},
year = {2015},
url = {https://doi.org/10.1016/j.mejo.2015.06.007},
doi = {10.1016/J.MEJO.2015.06.007},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mj/SinghGS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/BharadwajBSVN15,
author = {Samarth Bharadwaj and
Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {QFuse: Online learning framework for adaptive biometric system},
journal = {Pattern Recognit.},
volume = {48},
number = {11},
pages = {3428--3439},
year = {2015},
url = {https://doi.org/10.1016/j.patcog.2015.05.002},
doi = {10.1016/J.PATCOG.2015.05.002},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pr/BharadwajBSVN15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/SpinaCAAGCHGLMS15,
author = {Gabriele Spina and
Pierluigi Casale and
Paul S. Albert and
Jennifer Alison and
Judith Garcia{-}Aymerich and
Richard W. Costello and
Nidia A. Hernandes and
Arnoldus J. R. van Gestel and
Jorg D. Leuppi and
Rafael Mesquita and
Sally J. Singh and
Frank W. J. M. Smeenk and
Ruth Tal{-}Singer and
Emiel F. M. Wouters and
Martijn Spruit and
Albertus C. den Brinker},
title = {Identifying Physical Activity Profiles in {COPD} Patients Using Topic
Models},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {19},
number = {5},
pages = {1567--1576},
year = {2015},
url = {https://doi.org/10.1109/JBHI.2015.2432033},
doi = {10.1109/JBHI.2015.2432033},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/titb/SpinaCAAGCHGLMS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcis/AgrawalAJRS15,
author = {Deepti Agrawal and
John Amis and
Brian Janz and
Sandra M. Richardson and
Kulraj Singh},
title = {'What are they saying?' Examining healthcare field discourses in West
Tennessee},
booktitle = {21st Americas Conference on Information Systems, {AMCIS} 2015, Puerto
Rico, August 13-15, 2015},
publisher = {Association for Information Systems},
year = {2015},
url = {http://aisel.aisnet.org/amcis2015/HealthIS/GeneralPresentations/24},
timestamp = {Sun, 13 Dec 2015 13:10:52 +0100},
biburl = {https://dblp.org/rec/conf/amcis/AgrawalAJRS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atal/JiangKSL15,
author = {Nan Jiang and
Alex Kulesza and
Satinder Singh and
Richard L. Lewis},
editor = {Gerhard Weiss and
Pinar Yolum and
Rafael H. Bordini and
Edith Elkind},
title = {The Dependence of Effective Planning Horizon on Model Accuracy},
booktitle = {Proceedings of the 2015 International Conference on Autonomous Agents
and Multiagent Systems, {AAMAS} 2015, Istanbul, Turkey, May 4-8, 2015},
pages = {1181--1189},
publisher = {{ACM}},
year = {2015},
url = {http://dl.acm.org/citation.cfm?id=2773300},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/atal/JiangKSL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/ChaharYNSV15,
author = {Aman Chahar and
Shivangi Yadav and
Ishan Nigam and
Richa Singh and
Mayank Vatsa},
title = {A Leap Password based verification system},
booktitle = {{IEEE} 7th International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2015, Arlington, VA, USA, September 8-11, 2015},
pages = {1--6},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/BTAS.2015.7358745},
doi = {10.1109/BTAS.2015.7358745},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/btas/ChaharYNSV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/GhoshDKSV15,
author = {Soumyadeep Ghosh and
Tejas I. Dhamecha and
Rohit Keshari and
Richa Singh and
Mayank Vatsa},
title = {Feature and keypoint selection for visible to near-infrared face matching},
booktitle = {{IEEE} 7th International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2015, Arlington, VA, USA, September 8-11, 2015},
pages = {1--7},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/BTAS.2015.7358760},
doi = {10.1109/BTAS.2015.7358760},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/GhoshDKSV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/NagpalSVS15,
author = {Shruti Nagpal and
Maneet Singh and
Mayank Vatsa and
Richa Singh},
title = {Regularizing deep learning architecture for face recognition with
weight variations},
booktitle = {{IEEE} 7th International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2015, Arlington, VA, USA, September 8-11, 2015},
pages = {1--6},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/BTAS.2015.7358791},
doi = {10.1109/BTAS.2015.7358791},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/NagpalSVS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/SankaranAKGSVS15,
author = {Anush Sankaran and
Akshay Agarwal and
Rohit Keshari and
Soumyadeep Ghosh and
Anjali Sharma and
Mayank Vatsa and
Richa Singh},
title = {Latent fingerprint from multiple surfaces: Database and quality analysis},
booktitle = {{IEEE} 7th International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2015, Arlington, VA, USA, September 8-11, 2015},
pages = {1--6},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/BTAS.2015.7358773},
doi = {10.1109/BTAS.2015.7358773},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/SankaranAKGSVS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/SankaranMMVS15,
author = {Anush Sankaran and
Aakarsh Malhotra and
Apoorva Mittal and
Mayank Vatsa and
Richa Singh},
title = {On smartphone camera based fingerphoto authentication},
booktitle = {{IEEE} 7th International Conference on Biometrics Theory, Applications
and Systems, {BTAS} 2015, Arlington, VA, USA, September 8-11, 2015},
pages = {1--7},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/BTAS.2015.7358782},
doi = {10.1109/BTAS.2015.7358782},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/SankaranMMVS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/BhardwajGSV15,
author = {Romil Bhardwaj and
Gaurav Goswami and
Richa Singh and
Mayank Vatsa},
title = {Harnessing social context for improved face recognition},
booktitle = {International Conference on Biometrics, {ICB} 2015, Phuket, Thailand,
19-22 May, 2015},
pages = {121--126},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICB.2015.7139085},
doi = {10.1109/ICB.2015.7139085},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/icb/BhardwajGSV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/DhamechaVSSV15,
author = {Tejas I. Dhamecha and
Priyanka Verma and
Mahek Shah and
Richa Singh and
Mayank Vatsa},
title = {Annotated crowd video face database},
booktitle = {International Conference on Biometrics, {ICB} 2015, Phuket, Thailand,
19-22 May, 2015},
pages = {106--112},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICB.2015.7139083},
doi = {10.1109/ICB.2015.7139083},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/DhamechaVSSV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/MittalVS15,
author = {Paritosh Mittal and
Mayank Vatsa and
Richa Singh},
title = {Composite sketch recognition via deep network - a transfer learning
approach},
booktitle = {International Conference on Biometrics, {ICB} 2015, Phuket, Thailand,
19-22 May, 2015},
pages = {251--256},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICB.2015.7139092},
doi = {10.1109/ICB.2015.7139092},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/MittalVS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icit2/SinghPGM15,
author = {Santosh Kumar Singh and
Naresh K. Pilli and
Florent Guedon and
Richard A. McMahon},
title = {{PMSM} drive using silicon carbide inverter: Design, development and
testing at elevated temperature},
booktitle = {{IEEE} International Conference on Industrial Technology, {ICIT} 2015,
Seville, Spain, March 17-19, 2015},
pages = {2612--2618},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICIT.2015.7125483},
doi = {10.1109/ICIT.2015.7125483},
timestamp = {Fri, 28 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icit2/SinghPGM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isba/JainMGVS15,
author = {Aishwarya Jain and
Paritosh Mittal and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh},
title = {Person identification at a distance via ocular biometrics},
booktitle = {{IEEE} International Conference on Identity, Security and Behavior
Analysis, {ISBA} 2015, Hong Kong, China, March 23-25, 2015},
pages = {1--6},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ISBA.2015.7126353},
doi = {10.1109/ISBA.2015.7126353},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/isba/JainMGVS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/OhGLLS15,
author = {Junhyuk Oh and
Xiaoxiao Guo and
Honglak Lee and
Richard L. Lewis and
Satinder Singh},
editor = {Corinna Cortes and
Neil D. Lawrence and
Daniel D. Lee and
Masashi Sugiyama and
Roman Garnett},
title = {Action-Conditional Video Prediction using Deep Networks in Atari Games},
booktitle = {Advances in Neural Information Processing Systems 28: Annual Conference
on Neural Information Processing Systems 2015, December 7-12, 2015,
Montreal, Quebec, Canada},
pages = {2863--2871},
year = {2015},
url = {https://proceedings.neurips.cc/paper/2015/hash/6ba3af5d7b2790e73f0de32e5c8c1798-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/OhGLLS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nsdi/MadhavapeddyLSG15,
author = {Anil Madhavapeddy and
Thomas Leonard and
Magnus Skjegstad and
Thomas Gazagnaire and
David Sheets and
David J. Scott and
Richard Mortier and
Amir Chaudhry and
Balraj Singh and
Jon Ludlam and
Jon Crowcroft and
Ian M. Leslie},
title = {Jitsu: Just-In-Time Summoning of Unikernels},
booktitle = {12th {USENIX} Symposium on Networked Systems Design and Implementation,
{NSDI} 15, Oakland, CA, USA, May 4-6, 2015},
pages = {559--573},
publisher = {{USENIX} Association},
year = {2015},
url = {https://www.usenix.org/conference/nsdi15/technical-sessions/presentation/madhavapeddy},
timestamp = {Tue, 02 Feb 2021 08:05:03 +0100},
biburl = {https://dblp.org/rec/conf/nsdi/MadhavapeddyLSG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trecvid/Yu0XLXCLMGMDCMW15,
author = {Shoou{-}I Yu and
Lu Jiang and
Zhongwen Xu and
Zhenzhong Lan and
Shicheng Xu and
Xiaojun Chang and
Xuanchong Li and
Zexi Mao and
Chuang Gan and
Yajie Miao and
Xingzhong Du and
Yang Cai and
Lara J. Martin and
Nikolas Wolfe and
Anurag Kumar and
Huan Li and
Ming Lin and
Zhigang Ma and
Yi Yang and
Deyu Meng and
Shiguang Shan and
Pinar Duygulu Sahin and
Susanne Burger and
Florian Metze and
Rita Singh and
Bhiksha Raj and
Teruko Mitamura and
Richard M. Stern and
Alexander G. Hauptmann},
editor = {Paul Over and
George Awad and
Jon Fiscus and
Martial Michel and
David Joy and
Alan F. Smeaton and
Wessel Kraaij and
Georges Qu{\'{e}}not and
Roeland Ordelman and
Robin Aly},
title = {{CMU} Informedia@TRECVID 2015: {MED/SIN/LNK/SED}},
booktitle = {2015 {TREC} Video Retrieval Evaluation, {TRECVID} 2015, Gaithersburg,
MD, USA, November 16-18, 2015},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2015},
url = {https://www-nlpir.nist.gov/projects/tvpubs/tv15.papers/cmu.pdf},
timestamp = {Tue, 21 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/trecvid/Yu0XLXCLMGMDCMW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/bio/BhattBSV15,
author = {Himanshu Sharad Bhatt and
Samarth Bharadwaj and
Richa Singh and
Mayank Vatsa},
editor = {Stan Z. Li and
Anil K. Jain},
title = {Plastic Surgery and Face Recognition},
booktitle = {Encyclopedia of Biometrics, Second Edition},
pages = {1257--1261},
publisher = {Springer {US}},
year = {2015},
url = {https://doi.org/10.1007/978-1-4899-7488-4\_9108},
doi = {10.1007/978-1-4899-7488-4\_9108},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/reference/bio/BhattBSV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/bio/NooreSV15,
author = {Afzel Noore and
Richa Singh and
Mayank Vatsa},
editor = {Stan Z. Li and
Anil K. Jain},
title = {Fusion, Sensor Level},
booktitle = {Encyclopedia of Biometrics, Second Edition},
pages = {772--778},
publisher = {Springer {US}},
year = {2015},
url = {https://doi.org/10.1007/978-1-4899-7488-4\_156},
doi = {10.1007/978-1-4899-7488-4\_156},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/reference/bio/NooreSV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/OhGLLS15,
author = {Junhyuk Oh and
Xiaoxiao Guo and
Honglak Lee and
Richard L. Lewis and
Satinder Singh},
title = {Action-Conditional Video Prediction using Deep Networks in Atari Games},
journal = {CoRR},
volume = {abs/1507.08750},
year = {2015},
url = {http://arxiv.org/abs/1507.08750},
eprinttype = {arXiv},
eprint = {1507.08750},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/OhGLLS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ThakurHTLS15,
author = {Chetan Singh Thakur and
Tara Julia Hamilton and
Jonathan Tapson and
Richard F. Lyon and
Andr{\'{e}} van Schaik},
title = {{FPGA} Implementation of the {CAR} Model of the Cochlea},
journal = {CoRR},
volume = {abs/1503.00504},
year = {2015},
url = {http://arxiv.org/abs/1503.00504},
eprinttype = {arXiv},
eprint = {1503.00504},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/ThakurHTLS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/PowellGVSN14,
author = {Brian M. Powell and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {fgCAPTCHA: Genetically Optimized Face Image {CAPTCHA} 5},
journal = {{IEEE} Access},
volume = {2},
pages = {473--484},
year = {2014},
url = {https://doi.org/10.1109/ACCESS.2014.2321001},
doi = {10.1109/ACCESS.2014.2321001},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/PowellGVSN14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SankaranVS14,
author = {Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {Latent fingerprint matching: {A} survey},
journal = {{IEEE} Access},
volume = {2},
pages = {982--1004},
year = {2014},
url = {https://doi.org/10.1109/ACCESS.2014.2349879},
doi = {10.1109/ACCESS.2014.2349879},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/SankaranVS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SinghNSV14,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {On Recognizing Face Images With Weight and Age Variations},
journal = {{IEEE} Access},
volume = {2},
pages = {822--830},
year = {2014},
url = {https://doi.org/10.1109/ACCESS.2014.2344667},
doi = {10.1109/ACCESS.2014.2344667},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/SinghNSV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ais/BhattPS14,
author = {Ashutosh Kumar Bhatt and
Durgesh Pant and
Richa Singh},
title = {An analysis of the performance of Artificial Neural Network technique
for apple classification},
journal = {{AI} Soc.},
volume = {29},
number = {1},
pages = {103--111},
year = {2014},
url = {https://doi.org/10.1007/s00146-012-0425-z},
doi = {10.1007/S00146-012-0425-Z},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ais/BhattPS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biodb/ManasaLRNVGZBSSDCSMIMSO14,
author = {Justen Manasa and
Richard Lessells and
Theresa Rossouw and
Kevindra Naidu and
Cloete Van Vuuren and
Dominique Goedhals and
Gert van Zyl and
Armand Bester and
Andrew Skingsley and
Katharine Stott and
Siva Danaviah and
Terusha Chetty and
Lavanya Singh and
Pravi Moodley and
Collins Iwuji and
Nuala McGrath and
Christopher J. Seebregts and
Tulio de Oliveira},
title = {Southern African Treatment Resistance Network (SATuRN) RegaDB {HIV}
drug resistance and clinical management database: supporting patient
management, surveillance and research in southern Africa},
journal = {Database J. Biol. Databases Curation},
volume = {2014},
year = {2014},
url = {https://doi.org/10.1093/database/bat082},
doi = {10.1093/DATABASE/BAT082},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/biodb/ManasaLRNVGZBSSDCSMIMSO14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/CastellaniMWLAOS14,
author = {Christina A. Castellani and
Melkaye G. Melka and
Andrea E. Wishart and
M. Elizabeth Locke and
Zain Awamleh and
Richard L. O'Reilly and
Shiva M. Singh},
title = {Biological relevance of {CNV} calling methods using familial relatedness
including monozygotic twins},
journal = {{BMC} Bioinform.},
volume = {15},
pages = {114},
year = {2014},
url = {https://doi.org/10.1186/1471-2105-15-114},
doi = {10.1186/1471-2105-15-114},
timestamp = {Sun, 13 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/CastellaniMWLAOS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejivp/BharadwajVS14,
author = {Samarth Bharadwaj and
Mayank Vatsa and
Richa Singh},
title = {Biometric quality: a review of fingerprint, iris, and face},
journal = {{EURASIP} J. Image Video Process.},
volume = {2014},
pages = {34},
year = {2014},
url = {https://doi.org/10.1186/1687-5281-2014-34},
doi = {10.1186/1687-5281-2014-34},
timestamp = {Thu, 01 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ejivp/BharadwajVS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/SharmaRK14,
author = {Richa Sharma and
K. P. S. Rana and
Vineet Kumar},
title = {Performance analysis of fractional order fuzzy {PID} controllers applied
to a robotic manipulator},
journal = {Expert Syst. Appl.},
volume = {41},
number = {9},
pages = {4274--4289},
year = {2014},
url = {https://doi.org/10.1016/j.eswa.2013.12.030},
doi = {10.1016/J.ESWA.2013.12.030},
timestamp = {Mon, 12 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eswa/SharmaRK14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/GoswamiPVSN14,
author = {Gaurav Goswami and
Brian M. Powell and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {FaceDCAPTCHA: Face detection based color image {CAPTCHA}},
journal = {Future Gener. Comput. Syst.},
volume = {31},
pages = {59--68},
year = {2014},
url = {https://doi.org/10.1016/j.future.2012.08.013},
doi = {10.1016/J.FUTURE.2012.08.013},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/fgcs/GoswamiPVSN14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mia/HongDMKSKPSDZN14,
author = {Yi Hong and
Brad Davis and
J. S. Marron and
Roland Kwitt and
Nikhil Singh and
Julia S. Kimbell and
Elizabeth Pitkin and
Richard Superfine and
Stephanie Davis and
Carlton J. Zdanski and
Marc Niethammer},
title = {Statistical atlas construction via weighted functional boxplots},
journal = {Medical Image Anal.},
volume = {18},
number = {4},
pages = {684--698},
year = {2014},
url = {https://doi.org/10.1016/j.media.2014.03.001},
doi = {10.1016/J.MEDIA.2014.03.001},
timestamp = {Mon, 22 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mia/HongDMKSKPSDZN14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mia/SinghFPKMWJ14,
author = {Nikhil Singh and
P. Thomas Fletcher and
J. Samuel Preston and
Richard D. King and
J. S. Marron and
Michael W. Weiner and
Sarang C. Joshi},
title = {Quantifying anatomical shape variations in neurological disorders},
journal = {Medical Image Anal.},
volume = {18},
number = {3},
pages = {616--633},
year = {2014},
url = {https://doi.org/10.1016/j.media.2014.01.001},
doi = {10.1016/J.MEDIA.2014.01.001},
timestamp = {Thu, 24 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mia/SinghFPKMWJ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigpro/AgrawalVS14,
author = {Praful Agrawal and
Mayank Vatsa and
Richa Singh},
title = {Saliency based mass detection from screening mammograms},
journal = {Signal Process.},
volume = {99},
pages = {29--47},
year = {2014},
url = {https://doi.org/10.1016/j.sigpro.2013.12.010},
doi = {10.1016/J.SIGPRO.2013.12.010},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigpro/AgrawalVS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/RahmouneFSKRB14,
author = {Rachid Rahmoune and
Paolo Ferrazzoli and
Yogesh Kumar Singh and
Yann H. Kerr and
Philippe Richaume and
Ahmad Al Bitar},
title = {{SMOS} Retrieval Results Over Forests: Comparisons With Independent
Measurements},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {7},
number = {9},
pages = {3858--3866},
year = {2014},
url = {https://doi.org/10.1109/JSTARS.2014.2321027},
doi = {10.1109/JSTARS.2014.2321027},
timestamp = {Tue, 31 Mar 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/RahmouneFSKRB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tamd/LiuSLQ14,
author = {Bingyao Liu and
Satinder Singh and
Richard L. Lewis and
Shiyin Qin},
title = {Optimal Rewards for Cooperative Agents},
journal = {{IEEE} Trans. Auton. Ment. Dev.},
volume = {6},
number = {4},
pages = {286--297},
year = {2014},
url = {https://doi.org/10.1109/TAMD.2014.2362682},
doi = {10.1109/TAMD.2014.2362682},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tamd/LiuSLQ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/TomarR14,
author = {Vikrant Singh Tomar and
Richard C. Rose},
title = {A Family of Discriminative Manifold Learning Algorithms and Their
Application to Speech Recognition},
journal = {{IEEE} {ACM} Trans. Audio Speech Lang. Process.},
volume = {22},
number = {1},
pages = {161--171},
year = {2014},
url = {https://doi.org/10.1109/TASLP.2013.2286906},
doi = {10.1109/TASLP.2013.2286906},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/taslp/TomarR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/BhattSV14,
author = {Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa},
title = {On Recognizing Faces in Videos Using Clustering-Based Re-Ranking and
Fusion},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {9},
number = {7},
pages = {1056--1068},
year = {2014},
url = {https://doi.org/10.1109/TIFS.2014.2318433},
doi = {10.1109/TIFS.2014.2318433},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/BhattSV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/GoswamiVS14,
author = {Gaurav Goswami and
Mayank Vatsa and
Richa Singh},
title = {{RGB-D} Face Recognition With Texture and Attribute Features},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {9},
number = {10},
pages = {1629--1640},
year = {2014},
url = {https://doi.org/10.1109/TIFS.2014.2343913},
doi = {10.1109/TIFS.2014.2343913},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/GoswamiVS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/YadavKDSVB14,
author = {Daksha Yadav and
Naman Kohli and
James S. Doyle Jr. and
Richa Singh and
Mayank Vatsa and
Kevin W. Bowyer},
title = {Unraveling the Effect of Textured Contact Lenses on Iris Recognition},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {9},
number = {5},
pages = {851--862},
year = {2014},
url = {https://doi.org/10.1109/TIFS.2014.2313025},
doi = {10.1109/TIFS.2014.2313025},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/YadavKDSVB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/BhattSVR14,
author = {Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Improving Cross-Resolution Face Matching Using Ensemble-Based Co-Transfer
Learning},
journal = {{IEEE} Trans. Image Process.},
volume = {23},
number = {12},
pages = {5654--5669},
year = {2014},
url = {https://doi.org/10.1109/TIP.2014.2362658},
doi = {10.1109/TIP.2014.2362658},
timestamp = {Sun, 10 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tip/BhattSVR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/topics/HowesLS14,
author = {Andrew Howes and
Richard L. Lewis and
Satinder Singh},
title = {Utility Maximization and Bounds on Human Information Processing},
journal = {Top. Cogn. Sci.},
volume = {6},
number = {2},
pages = {198--203},
year = {2014},
url = {https://doi.org/10.1111/tops.12089},
doi = {10.1111/TOPS.12089},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/topics/HowesLS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/topics/LewisHS14,
author = {Richard L. Lewis and
Andrew Howes and
Satinder Singh},
title = {Computational Rationality: Linking Mechanism and Behavior Through
Bounded Utility Maximization},
journal = {Top. Cogn. Sci.},
volume = {6},
number = {2},
pages = {279--311},
year = {2014},
url = {https://doi.org/10.1111/tops.12086},
doi = {10.1111/TOPS.12086},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/topics/LewisHS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl-cmcl/ShvartsmanLS14,
author = {Michael Shvartsman and
Richard L. Lewis and
Satinder Singh},
editor = {Vera Demberg and
Timothy O'Donnell},
title = {Computationally Rational Saccadic Control: An Explanation of Spillover
Effects Based on Sampling from Noisy Perception and Memory},
booktitle = {Proceedings of the Fifth Workshop on Cognitive Modeling and Computational
Linguistics, CMCL@ACL 2014, Baltimore, Maryland, USA, June 26, 2014},
pages = {1--9},
publisher = {Association for Computational Linguistics},
year = {2014},
url = {https://doi.org/10.3115/v1/W14-2001},
doi = {10.3115/V1/W14-2001},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl-cmcl/ShvartsmanLS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atal/JiangSL14,
author = {Nan Jiang and
Satinder Singh and
Richard L. Lewis},
editor = {Ana L. C. Bazzan and
Michael N. Huhns and
Alessio Lomuscio and
Paul Scerri},
title = {Improving {UCT} planning via approximate homomorphisms},
booktitle = {International conference on Autonomous Agents and Multi-Agent Systems,
{AAMAS} '14, Paris, France, May 5-9, 2014},
pages = {1289--1296},
publisher = {{IFAAMAS/ACM}},
year = {2014},
url = {http://dl.acm.org/citation.cfm?id=2617453},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/atal/JiangSL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/KimBACCJDS14,
author = {Hyunwoo J. Kim and
Barbara B. Bendlin and
Nagesh Adluru and
Maxwell D. Collins and
Moo K. Chung and
Sterling C. Johnson and
Richard J. Davidson and
Vikas Singh},
title = {Multivariate General Linear Models {(MGLM)} on Riemannian Manifolds
with Applications to Statistical Analysis of Diffusion Weighted Images},
booktitle = {2014 {IEEE} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2014, Columbus, OH, USA, June 23-28, 2014},
pages = {2705--2712},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/CVPR.2014.352},
doi = {10.1109/CVPR.2014.352},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/KimBACCJDS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/BharadwajVS14,
author = {Samarth Bharadwaj and
Mayank Vatsa and
Richa Singh},
title = {Aiding face recognition with social context association rule based
re-ranking},
booktitle = {{IEEE} International Joint Conference on Biometrics, Clearwater, {IJCB}
2014, FL, USA, September 29 - October 2, 2014},
pages = {1--8},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/BTAS.2014.6996266},
doi = {10.1109/BTAS.2014.6996266},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/icb/BharadwajVS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/GoswamiBSV14,
author = {Gaurav Goswami and
Romil Bhardwaj and
Richa Singh and
Mayank Vatsa},
title = {MDLFace: Memorability augmented deep learning for video face recognition},
booktitle = {{IEEE} International Joint Conference on Biometrics, Clearwater, {IJCB}
2014, FL, USA, September 29 - October 2, 2014},
pages = {1--7},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/BTAS.2014.6996299},
doi = {10.1109/BTAS.2014.6996299},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/GoswamiBSV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/MittalJGSV14,
author = {Paritosh Mittal and
Aishwarya Jain and
Gaurav Goswami and
Richa Singh and
Mayank Vatsa},
title = {Recognizing composite sketches with digital face images via {SSD}
dictionary},
booktitle = {{IEEE} International Joint Conference on Biometrics, Clearwater, {IJCB}
2014, FL, USA, September 29 - October 2, 2014},
pages = {1--6},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/BTAS.2014.6996265},
doi = {10.1109/BTAS.2014.6996265},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/MittalJGSV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/SankaranPVS14,
author = {Anush Sankaran and
Prateekshit Pandey and
Mayank Vatsa and
Richa Singh},
title = {On latent fingerprint minutiae extraction using stacked denoising
sparse AutoEncoders},
booktitle = {{IEEE} International Joint Conference on Biometrics, Clearwater, {IJCB}
2014, FL, USA, September 29 - October 2, 2014},
pages = {1--7},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/BTAS.2014.6996300},
doi = {10.1109/BTAS.2014.6996300},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/SankaranPVS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/NigamVS14,
author = {Ishan Nigam and
Mayank Vatsa and
Richa Singh},
title = {Leap signature recognition using {HOOF} and {HOT} features},
booktitle = {2014 {IEEE} International Conference on Image Processing, {ICIP} 2014,
Paris, France, October 27-30, 2014},
pages = {5012--5016},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ICIP.2014.7026015},
doi = {10.1109/ICIP.2014.7026015},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icip/NigamVS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/SharmaVVS14,
author = {Anjali Sharma and
Shalini Verma and
Mayank Vatsa and
Richa Singh},
title = {On cross spectral periocular recognition},
booktitle = {2014 {IEEE} International Conference on Image Processing, {ICIP} 2014,
Paris, France, October 27-30, 2014},
pages = {5007--5011},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ICIP.2014.7026014},
doi = {10.1109/ICIP.2014.7026014},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/SharmaVVS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/DhamechaSSV14,
author = {Tejas Indulal Dhamecha and
Praneet Sharma and
Richa Singh and
Mayank Vatsa},
title = {On Effectiveness of Histogram of Oriented Gradient Features for Visible
to Near Infrared Face Matching},
booktitle = {22nd International Conference on Pattern Recognition, {ICPR} 2014,
Stockholm, Sweden, August 24-28, 2014},
pages = {1788--1793},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/ICPR.2014.314},
doi = {10.1109/ICPR.2014.314},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpr/DhamechaSSV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/GuptaBVS14,
author = {Priyanshu Gupta and
Shipra Behera and
Mayank Vatsa and
Richa Singh},
title = {On Iris Spoofing Using Print Attack},
booktitle = {22nd International Conference on Pattern Recognition, {ICPR} 2014,
Stockholm, Sweden, August 24-28, 2014},
pages = {1681--1686},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/ICPR.2014.296},
doi = {10.1109/ICPR.2014.296},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpr/GuptaBVS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/TomarR14,
author = {Vikrant Singh Tomar and
Richard C. Rose},
editor = {Haizhou Li and
Helen M. Meng and
Bin Ma and
Engsiong Chng and
Lei Xie},
title = {Manifold regularized deep neural networks},
booktitle = {15th Annual Conference of the International Speech Communication Association,
{INTERSPEECH} 2014, Singapore, September 14-18, 2014},
pages = {348--352},
publisher = {{ISCA}},
year = {2014},
url = {https://doi.org/10.21437/Interspeech.2014-82},
doi = {10.21437/INTERSPEECH.2014-82},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/TomarR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/CzechowskiLGRSVD14,
author = {Kenneth Czechowski and
Victor W. Lee and
Ed Grochowski and
Ronny Ronen and
Ronak Singhal and
Richard W. Vuduc and
Pradeep Dubey},
title = {Improving the energy efficiency of Big Cores},
booktitle = {{ACM/IEEE} 41st International Symposium on Computer Architecture,
{ISCA} 2014, Minneapolis, MN, USA, June 14-18, 2014},
pages = {493--504},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/ISCA.2014.6853219},
doi = {10.1109/ISCA.2014.6853219},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isca/CzechowskiLGRSVD14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/ThakurHTSL14,
author = {Chetan Singh Thakur and
Tara Julia Hamilton and
Jonathan Tapson and
Andr{\'{e}} van Schaik and
Richard F. Lyon},
title = {{FPGA} implementation of the {CAR} Model of the cochlea},
booktitle = {{IEEE} International Symposium on Circuits and Systemss, {ISCAS} 2014,
Melbourne, Victoria, Australia, June 1-5, 2014},
pages = {1853--1856},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISCAS.2014.6865519},
doi = {10.1109/ISCAS.2014.6865519},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/ThakurHTSL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/SinghCFHLSSSUWF14,
author = {Anant Singh and
Dario Albino Carnelli and
Altay Falay and
Klaas L. Hofstra and
Fabio Licciardello and
Kia Salimi and
Hugo Santos and
Amin Shokrollahi and
Roger Ulrich and
Christoph Walter and
John Fox and
Peter Hunt and
John Keay and
Richard Simpson and
Andrew Stewart and
Giuseppe Surace and
Harm S. Cronie},
title = {26.3 {A} pin- and power-efficient low-latency 8-to-12Gb/s/wire 8b8w-coded
SerDes link for high-loss channels in 40nm technology},
booktitle = {2014 {IEEE} International Conference on Solid-State Circuits Conference,
{ISSCC} 2014, Digest of Technical Papers, San Francisco, CA, USA,
February 9-13, 2014},
pages = {442--443},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISSCC.2014.6757505},
doi = {10.1109/ISSCC.2014.6757505},
timestamp = {Mon, 09 Aug 2021 14:54:04 +0200},
biburl = {https://dblp.org/rec/conf/isscc/SinghCFHLSSSUWF14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/GuoSLLW14,
author = {Xiaoxiao Guo and
Satinder Singh and
Honglak Lee and
Richard L. Lewis and
Xiaoshi Wang},
editor = {Zoubin Ghahramani and
Max Welling and
Corinna Cortes and
Neil D. Lawrence and
Kilian Q. Weinberger},
title = {Deep Learning for Real-Time Atari Game Play Using Offline Monte-Carlo
Tree Search Planning},
booktitle = {Advances in Neural Information Processing Systems 27: Annual Conference
on Neural Information Processing Systems 2014, December 8-13 2014,
Montreal, Quebec, Canada},
pages = {3338--3346},
year = {2014},
url = {https://proceedings.neurips.cc/paper/2014/hash/8bb88f80d334b1869781beb89f7b73be-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/GuoSLLW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trecvid/Yu0XLXCLMGMDCMW14,
author = {Shoou{-}I Yu and
Lu Jiang and
Zhongwen Xu and
Zhenzhong Lan and
Shicheng Xu and
Xiaojun Chang and
Xuanchong Li and
Zexi Mao and
Chuang Gan and
Yajie Miao and
Xingzhong Du and
Yang Cai and
Lara J. Martin and
Nikolas Wolfe and
Anurag Kumar and
Huan Li and
Ming Lin and
Zhigang Ma and
Yi Yang and
Deyu Meng and
Shiguang Shan and
Pinar Duygulu Sahin and
Susanne Burger and
Florian Metze and
Rita Singh and
Bhiksha Raj and
Teruko Mitamura and
Richard M. Stern and
Alexander G. Hauptmann and
Anil Armagan and
Yicheng Zhao},
editor = {Paul Over and
Jon Fiscus and
Gregory A. Sanders and
David Joy and
Martial Michel and
George Awad and
Alan F. Smeaton and
Wessel Kraaij and
Georges Qu{\'{e}}not},
title = {Informedia @ {TRECVID} 2014},
booktitle = {2014 {TREC} Video Retrieval Evaluation, {TRECVID} 2014, Orlando, FL,
USA, November 10-12, 2014},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2014},
url = {https://www-nlpir.nist.gov/projects/tvpubs/tv14.papers/cmu.pdf},
timestamp = {Tue, 21 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/trecvid/Yu0XLXCLMGMDCMW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsid/DuttaSTACW14,
author = {Anupam Dutta and
Saurabh Sirohi and
Ethirajan Tamilmani and
Harshit Agarwal and
Yogesh Singh Chauhan and
Richard Q. Williams},
title = {{BSIM6} - Benchmarking the Next-Generation {MOSFET} Model for {RF}
Applications},
booktitle = {2014 27th International Conference on {VLSI} Design, {VLSID} 2014,
and 2014 13th International Conference on Embedded Systems, Mumbai,
India, January 5-9, 2014},
pages = {421--426},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/VLSID.2014.79},
doi = {10.1109/VLSID.2014.79},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsid/DuttaSTACW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/GuptaGS14,
author = {Richa Gupta and
Sunny Gupta and
Anuradha Singhal},
title = {Importance and Techniques of Information Hiding : {A} Review},
journal = {CoRR},
volume = {abs/1404.3063},
year = {2014},
url = {http://arxiv.org/abs/1404.3063},
eprinttype = {arXiv},
eprint = {1404.3063},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/GuptaGS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/GuptaGS14a,
author = {Richa Gupta and
Sunny Gupta and
Anuradha Singhal},
title = {Big Data: Overview},
journal = {CoRR},
volume = {abs/1404.4136},
year = {2014},
url = {http://arxiv.org/abs/1404.4136},
eprinttype = {arXiv},
eprint = {1404.4136},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/GuptaGS14a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mktsci/ChintaguntaHHRSS13,
author = {Pradeep Chintagunta and
Dominique M. Hanssens and
John R. Hauser and
Jagmohan Singh Raju and
Kannan Srinivasan and
Richard Staelin},
title = {Editorial - \emph{Marketing Science}: {A} Strategic Review},
journal = {Mark. Sci.},
volume = {32},
number = {1},
pages = {4--7},
year = {2013},
url = {https://doi.org/10.1287/mksc.1120.0763},
doi = {10.1287/MKSC.1120.0763},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mktsci/ChintaguntaHHRSS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mktsci/RaoS13,
author = {Raghunath Singh Rao and
Richard Schaefer},
title = {Conspicuous Consumption and Dynamic Pricing},
journal = {Mark. Sci.},
volume = {32},
number = {5},
pages = {786--804},
year = {2013},
url = {https://doi.org/10.1287/mksc.2013.0797},
doi = {10.1287/MKSC.2013.0797},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mktsci/RaoS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/MortonSS13,
author = {Richard A. Morton and
Jonathan R. Stone and
Rama S. Singh},
title = {Mate Choice and the Origin of Menopause},
journal = {PLoS Comput. Biol.},
volume = {9},
number = {6},
year = {2013},
url = {https://doi.org/10.1371/journal.pcbi.1003092},
doi = {10.1371/JOURNAL.PCBI.1003092},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/MortonSS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/BhattBSV13,
author = {Himanshu S. Bhatt and
Samarth Bharadwaj and
Richa Singh and
Mayank Vatsa},
title = {Recognizing Surgically Altered Face Images Using Multiobjective Evolutionary
Algorithm},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {8},
number = {1},
pages = {89--100},
year = {2013},
url = {https://doi.org/10.1109/TIFS.2012.2223684},
doi = {10.1109/TIFS.2012.2223684},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/BhattBSV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/topics/LewisSS13,
author = {Richard L. Lewis and
Michael Shvartsman and
Satinder Singh},
title = {The Adaptive Nature of Eye Movements in Linguistic Tasks: How Payoff
and Architecture Shape Speed-Accuracy Trade-Offs},
journal = {Top. Cogn. Sci.},
volume = {5},
number = {3},
pages = {581--610},
year = {2013},
url = {https://doi.org/10.1111/tops.12032},
doi = {10.1111/TOPS.12032},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/topics/LewisSS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asplos/MadhavapeddyMRSSGSHC13,
author = {Anil Madhavapeddy and
Richard Mortier and
Charalampos Rotsos and
David J. Scott and
Balraj Singh and
Thomas Gazagnaire and
Steven Smith and
Steven Hand and
Jon Crowcroft},
editor = {Vivek Sarkar and
Rastislav Bod{\'{\i}}k},
title = {Unikernels: library operating systems for the cloud},
booktitle = {Architectural Support for Programming Languages and Operating Systems,
{ASPLOS} 2013, Houston, TX, USA, March 16-20, 2013},
pages = {461--472},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2451116.2451167},
doi = {10.1145/2451116.2451167},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asplos/MadhavapeddyMRSSGSHC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/ChughBSV13,
author = {Tarang Chugh and
Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa},
title = {Matching age separated composite sketches and digital face images},
booktitle = {{IEEE} Sixth International Conference on Biometrics: Theory, Applications
and Systems, {BTAS} 2013, Arlington, VA, USA, September 29 - October
2, 2013},
pages = {1--6},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/BTAS.2013.6712719},
doi = {10.1109/BTAS.2013.6712719},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/btas/ChughBSV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/GoswamiBVS13,
author = {Gaurav Goswami and
Samarth Bharadwaj and
Mayank Vatsa and
Richa Singh},
title = {On {RGB-D} face recognition using Kinect},
booktitle = {{IEEE} Sixth International Conference on Biometrics: Theory, Applications
and Systems, {BTAS} 2013, Arlington, VA, USA, September 29 - October
2, 2013},
pages = {1--6},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/BTAS.2013.6712717},
doi = {10.1109/BTAS.2013.6712717},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/GoswamiBVS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/SankaranVS13,
author = {Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {Automated clarity and quality assessment for latent fingerprints},
booktitle = {{IEEE} Sixth International Conference on Biometrics: Theory, Applications
and Systems, {BTAS} 2013, Arlington, VA, USA, September 29 - October
2, 2013},
pages = {1--6},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/BTAS.2013.6712716},
doi = {10.1109/BTAS.2013.6712716},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/SankaranVS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/TuzaSKM13,
author = {Zolt{\'{a}}n A. Tuza and
Vipul Singhal and
Jongmin Kim and
Richard M. Murray},
title = {An in silico modeling toolbox for rapid prototyping of circuits in
a biomolecular "breadboard" system},
booktitle = {Proceedings of the 52nd {IEEE} Conference on Decision and Control,
{CDC} 2013, Florence, Italy, December 10-13, 2013},
pages = {1404--1410},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/CDC.2013.6760079},
doi = {10.1109/CDC.2013.6760079},
timestamp = {Fri, 11 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cdc/TuzaSKM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/SchenkerS13,
author = {Richard Schenker and
Vivek Singh},
title = {Foundations for scaling beyond 14nm},
booktitle = {Proceedings of the {IEEE} 2013 Custom Integrated Circuits Conference,
{CICC} 2013, San Jose, CA, USA, September 22-25, 2013},
pages = {1--4},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/CICC.2013.6658478},
doi = {10.1109/CICC.2013.6658478},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cicc/SchenkerS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/BharadwajDVS13,
author = {Samarth Bharadwaj and
Tejas I. Dhamecha and
Mayank Vatsa and
Richa Singh},
title = {Computationally Efficient Face Spoofing Detection with Motion Magnification},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
Workshops 2013, Portland, OR, USA, June 23-28, 2013},
pages = {105--110},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/CVPRW.2013.23},
doi = {10.1109/CVPRW.2013.23},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/BharadwajDVS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/BhattSV13,
author = {Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa},
title = {Can Combining Demographics and Biometrics Improve De-duplication Performance?},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
Workshops 2013, Portland, OR, USA, June 23-28, 2013},
pages = {188--193},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/CVPRW.2013.35},
doi = {10.1109/CVPRW.2013.35},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/BhattSV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/YadavVST13,
author = {Daksha Yadav and
Mayank Vatsa and
Richa Singh and
Massimo Tistarelli},
title = {Bacteria Foraging Fusion for Face Recognition across Age Progression},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
Workshops 2013, Portland, OR, USA, June 23-28, 2013},
pages = {173--179},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/CVPRW.2013.33},
doi = {10.1109/CVPRW.2013.33},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/YadavVST13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ercimdl/MenesesBSFS13,
author = {Luis Meneses and
Himanshu Barthwal and
Sanjeev Singh and
Richard Furuta and
Frank Shipman},
editor = {Trond Aalberg and
Christos Papatheodorou and
Milena Dobreva and
Giannis Tsakonas and
Charles J. Farrugia},
title = {Restoring Semantically Incomplete Document Collections Using Lexical
Signatures},
booktitle = {Research and Advanced Technology for Digital Libraries - International
Conference on Theory and Practice of Digital Libraries, {TPDL} 2013,
Valletta, Malta, September 22-26, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8092},
pages = {321--332},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-40501-3\_33},
doi = {10.1007/978-3-642-40501-3\_33},
timestamp = {Fri, 27 Mar 2020 08:46:27 +0100},
biburl = {https://dblp.org/rec/conf/ercimdl/MenesesBSFS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/FearyBCHLSS13,
author = {Michael Feary and
Dorrit Billman and
Xiuli Chen and
Andrew Howes and
Richard L. Lewis and
Lance Sherry and
Satinder Singh},
editor = {Masaaki Kurosu},
title = {Linking Context to Evaluation in the Design of Safety Critical Interfaces},
booktitle = {Human-Computer Interaction. Human-Centred Design Approaches, Methods,
Tools, and Environments - 15th International Conference, {HCI} International
2013, Las Vegas, NV, USA, July 21-26, 2013, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {8004},
pages = {193--202},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-39232-0\_22},
doi = {10.1007/978-3-642-39232-0\_22},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hci/FearyBCHLSS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ic3/SrivastavaSK13,
author = {Richa Srivastava and
Rajiv Singh and
Ashish Khare},
editor = {Manish Parashar and
Albert Y. Zomaya and
Jianer Chen and
Jiannong Cao and
Pascal Bouvry and
Sushil K. Prasad},
title = {Fusion of multifocus noisy images using contourlet transform},
booktitle = {Sixth International Conference on Contemporary Computing, {IC3} 2013,
Noida, India, August 8-10, 2013},
pages = {497--502},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/IC3.2013.6612246},
doi = {10.1109/IC3.2013.6612246},
timestamp = {Tue, 14 Apr 2020 13:23:10 +0200},
biburl = {https://dblp.org/rec/conf/ic3/SrivastavaSK13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/TomarR13,
author = {Vikrant Singh Tomar and
Richard C. Rose},
title = {Efficient manifold learning for speech recognition using locality
sensitive hashing},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2013, Vancouver, BC, Canada, May 26-31, 2013},
pages = {6995--6999},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICASSP.2013.6639018},
doi = {10.1109/ICASSP.2013.6639018},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icassp/TomarR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/TomarR13a,
author = {Vikrant Singh Tomar and
Richard C. Rose},
title = {Noise aware manifold learning for robust speech recognition},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2013, Vancouver, BC, Canada, May 26-31, 2013},
pages = {7087--7091},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICASSP.2013.6639037},
doi = {10.1109/ICASSP.2013.6639037},
timestamp = {Fri, 19 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/TomarR13a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/DhamechaNSV13,
author = {Tejas I. Dhamecha and
Aastha Nigam and
Richa Singh and
Mayank Vatsa},
editor = {Julian Fi{\'{e}}rrez and
Ajay Kumar and
Mayank Vatsa and
Raymond N. J. Veldhuis and
Javier Ortega{-}Garcia},
title = {Disguise detection and face recognition in visible and thermal spectrums},
booktitle = {International Conference on Biometrics, {ICB} 2013, 4-7 June, 2013,
Madrid, Spain},
pages = {1--8},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICB.2013.6613019},
doi = {10.1109/ICB.2013.6613019},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/icb/DhamechaNSV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/KohliYVS13,
author = {Naman Kohli and
Daksha Yadav and
Mayank Vatsa and
Richa Singh},
editor = {Julian Fi{\'{e}}rrez and
Ajay Kumar and
Mayank Vatsa and
Raymond N. J. Veldhuis and
Javier Ortega{-}Garcia},
title = {Revisiting iris recognition with color cosmetic contact lenses},
booktitle = {International Conference on Biometrics, {ICB} 2013, 4-7 June, 2013,
Madrid, Spain},
pages = {1--7},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICB.2013.6613021},
doi = {10.1109/ICB.2013.6613021},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icb/KohliYVS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/BharadwajVS13,
author = {Samarth Bharadwaj and
Mayank Vatsa and
Richa Singh},
title = {Can holistic representations be used for face biometric quality assessment?},
booktitle = {{IEEE} International Conference on Image Processing, {ICIP} 2013,
Melbourne, Australia, September 15-18, 2013},
pages = {2792--2796},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICIP.2013.6738575},
doi = {10.1109/ICIP.2013.6738575},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icip/BharadwajVS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/BhattSV13,
author = {Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa},
title = {On rank aggregation for face recognition from videos},
booktitle = {{IEEE} International Conference on Image Processing, {ICIP} 2013,
Melbourne, Australia, September 15-18, 2013},
pages = {2993--2997},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICIP.2013.6738616},
doi = {10.1109/ICIP.2013.6738616},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/BhattSV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/MittalJSV13,
author = {Paritosh Mittal and
Aishwarya Jain and
Richa Singh and
Mayank Vatsa},
title = {Boosting local descriptors for matching composite and digital face
images},
booktitle = {{IEEE} International Conference on Image Processing, {ICIP} 2013,
Melbourne, Australia, September 15-18, 2013},
pages = {2797--2801},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICIP.2013.6738576},
doi = {10.1109/ICIP.2013.6738576},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/MittalJSV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/RahmouneSFKRBM13,
author = {Rachid Rahmoune and
Yogesh Kumar Singh and
Paolo Ferrazzoli and
Yann Kerr and
Philippe Richaume and
Ahmad Al Bitar and
Christophe Moisy},
title = {{SMOS} {L2} retrieval results over the American continent and comparisons
with independent data sources},
booktitle = {2013 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2013, Melbourne, Australia, July 21-26, 2013},
pages = {3419--3422},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/IGARSS.2013.6723563},
doi = {10.1109/IGARSS.2013.6723563},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/RahmouneSFKRBM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/TomarR13,
author = {Vikrant Singh Tomar and
Richard C. Rose},
editor = {Fr{\'{e}}d{\'{e}}ric Bimbot and
Christophe Cerisara and
C{\'{e}}cile Fougeron and
Guillaume Gravier and
Lori Lamel and
Fran{\c{c}}ois Pellegrino and
Pascal Perrier},
title = {Locality sensitive hashing for fast computation of correlational manifold
learning based feature space transformations},
booktitle = {14th Annual Conference of the International Speech Communication Association,
{INTERSPEECH} 2013, Lyon, France, August 25-29, 2013},
pages = {1776--1780},
publisher = {{ISCA}},
year = {2013},
url = {https://doi.org/10.21437/Interspeech.2013-440},
doi = {10.21437/INTERSPEECH.2013-440},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/TomarR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/AgrawalVS13,
author = {Praful Agrawal and
Mayank Vatsa and
Richa Singh},
editor = {Guorong Wu and
Daoqiang Zhang and
Dinggang Shen and
Pingkun Yan and
Kenji Suzuki and
Fei Wang},
title = {HEp-2 Cell Image Classification: {A} Comparative Analysis},
booktitle = {Machine Learning in Medical Imaging - 4th International Workshop,
{MLMI} 2013, Held in Conjunction with {MICCAI} 2013, Nagoya, Japan,
September 22, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8184},
pages = {195--202},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-319-02267-3\_25},
doi = {10.1007/978-3-319-02267-3\_25},
timestamp = {Sat, 05 Sep 2020 18:06:04 +0200},
biburl = {https://dblp.org/rec/conf/miccai/AgrawalVS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/GuoSL13,
author = {Xiaoxiao Guo and
Satinder Singh and
Richard L. Lewis},
editor = {Christopher J. C. Burges and
L{\'{e}}on Bottou and
Zoubin Ghahramani and
Kilian Q. Weinberger},
title = {Reward Mapping for Transfer in Long-Lived Agents},
booktitle = {Advances in Neural Information Processing Systems 26: 27th Annual
Conference on Neural Information Processing Systems 2013. Proceedings
of a meeting held December 5-8, 2013, Lake Tahoe, Nevada, United States},
pages = {2130--2138},
year = {2013},
url = {https://proceedings.neurips.cc/paper/2013/hash/58c54802a9fb9526cd0923353a34a7ae-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/GuoSL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/socpros/0001RKSMN13,
author = {Vineet Kumar and
K. P. S. Rana and
Amit Kumar and
Richa Sharma and
Puneet Mishra and
Sreejith S. Nair},
editor = {Millie Pant and
Kusum Deep and
Atulya Nagar and
Jagdish Chand Bansal},
title = {Development of a Genetic Algorithm Toolkit in LabVIEW},
booktitle = {Proceedings of the Third International Conference on Soft Computing
for Problem Solving - SocProS 2013, Volume 1, Greater Noida Extension
Centre, {IIT} Roorkee, India, December 26-28, 2013},
series = {Advances in Intelligent Systems and Computing},
volume = {258},
pages = {281--296},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-81-322-1771-8\_25},
doi = {10.1007/978-81-322-1771-8\_25},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/socpros/0001RKSMN13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/socpros/SharmaR013,
author = {Richa Sharma and
K. P. S. Rana and
Vineet Kumar},
editor = {Millie Pant and
Kusum Deep and
Atulya Nagar and
Jagdish Chand Bansal},
title = {Comparative Study of Controller Optimization Techniques for a Robotic
Manipulator},
booktitle = {Proceedings of the Third International Conference on Soft Computing
for Problem Solving - SocProS 2013, Volume 1, Greater Noida Extension
Centre, {IIT} Roorkee, India, December 26-28, 2013},
series = {Advances in Intelligent Systems and Computing},
volume = {258},
pages = {379--393},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-81-322-1771-8\_33},
doi = {10.1007/978-81-322-1771-8\_33},
timestamp = {Tue, 22 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/socpros/SharmaR013.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trecvid/Lan0YGR0XSLWS0M13,
author = {Zhenzhong Lan and
Lu Jiang and
Shoou{-}I Yu and
Chenqiang Gao and
Shourabh Rawat and
Yang Cai and
Shicheng Xu and
Haoquan Shen and
Xuanchong Li and
Yipei Wang and
Waito Sze and
Yan Yan and
Zhigang Ma and
Nicolas Ballas and
Deyu Meng and
Wei Tong and
Yi Yang and
Susanne Burger and
Florian Metze and
Rita Singh and
Bhiksha Raj and
Richard M. Stern and
Teruko Mitamura and
Eric Nyberg and
Alexander G. Hauptmann},
editor = {Paul Over and
Jon Fiscus and
Gregory A. Sanders and
Barbara Shaw and
George Awad and
Martial Michel and
Alan F. Smeaton and
Wessel Kraaij and
Georges Qu{\'{e}}not},
title = {Informedia@TRECVID 2013},
booktitle = {2013 {TREC} Video Retrieval Evaluation, {TRECVID} 2013, Gaithersburg,
MD, USA, November 20-22, 2013},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2013},
url = {https://www-nlpir.nist.gov/projects/tvpubs/tv13.papers/informedia.pdf},
timestamp = {Mon, 10 May 2021 15:09:49 +0200},
biburl = {https://dblp.org/rec/conf/trecvid/Lan0YGR0XSLWS0M13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/BaierCCLMRSSV12,
author = {Moritz Baier and
Jorge E. Carballo and
Alice J. Chang and
Yingdong Lu and
Aleksandra Mojsilovic and
M. Jonathan Richard and
Moninder Singh and
Mark S. Squillante and
Kush R. Varshney},
title = {Sales-force performance analytics and optimization},
journal = {{IBM} J. Res. Dev.},
volume = {56},
number = {6},
pages = {8},
year = {2012},
url = {https://doi.org/10.1147/JRD.2012.2216314},
doi = {10.1147/JRD.2012.2216314},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/BaierCCLMRSSV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/IshchenkoLLWJGCS12,
author = {Alexey Ishchenko and
Zhijie Liu and
Peter Lindblom and
Guosheng Wu and
Kam{-}Chuen Jim and
Richard D. Gregg and
David A. Claremon and
Suresh B. Singh},
title = {Structure-Based Design Technology Contour and Its Application to the
Design of Renin Inhibitors},
journal = {J. Chem. Inf. Model.},
volume = {52},
number = {8},
pages = {2089--2097},
year = {2012},
url = {https://doi.org/10.1021/ci200605k},
doi = {10.1021/CI200605K},
timestamp = {Fri, 06 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcisd/IshchenkoLLWJGCS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/FlicekAB12,
author = {Paul Flicek and
M. Ridwan Amode and
Daniel Barrell and
Kathryn Beal and
Simon Brent and
Denise Carvalho{-}Silva and
Peter Clapham and
Guy Coates and
Susan Fairley and
Stephen Fitzgerald and
Laurent Gil and
Leo Gordon and
Maurice Hendrix and
Thibaut Hourlier and
Nathan Johnson and
Andreas K{\"{a}}h{\"{a}}ri and
Damian Keefe and
Stephen Keenan and
Rhoda Kinsella and
Monika Komorowska and
Gautier Koscielny and
Eugene Kulesha and
Pontus Larsson and
Ian Longden and
William M. McLaren and
Matthieu Muffato and
Bert Overduin and
Miguel Pignatelli and
Bethan Pritchard and
Harpreet Singh Riat and
Graham R. S. Ritchie and
Magali Ruffier and
Michael Schuster and
Daniel Sobral and
Y. Amy Tang and
Kieron R. Taylor and
Stephen J. Trevanion and
Jana Vandrovcova and
Simon White and
Mark Wilson and
Steven P. Wilder and
Bronwen L. Aken and
Ewan Birney and
Fiona Cunningham and
Ian Dunham and
Richard Durbin and
Xos{\'{e}} M. Fern{\'{a}}ndez{-}Su{\'{a}}rez and
Jennifer L. Harrow and
Javier Herrero and
Tim J. P. Hubbard and
Anne Parker and
Glenn Proctor and
Giulietta Spudich and
Jan Vogel and
Andy Yates and
Amonida Zadissa and
Stephen M. J. Searle},
title = {Ensembl 2012},
journal = {Nucleic Acids Res.},
volume = {40},
number = {Database-Issue},
pages = {84--90},
year = {2012},
url = {https://doi.org/10.1093/nar/gkr991},
doi = {10.1093/NAR/GKR991},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/FlicekAB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/SinghalCBMLP12,
author = {Shaloo Singhal and
Jian Chen and
Richard Beare and
Henry Ma and
John Ly and
Thanh G. Phan},
title = {Application of principal component analysis to study topography of
hypoxic-ischemic brain injury},
journal = {NeuroImage},
volume = {62},
number = {1},
pages = {300--306},
year = {2012},
url = {https://doi.org/10.1016/j.neuroimage.2012.04.025},
doi = {10.1016/J.NEUROIMAGE.2012.04.025},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/SinghalCBMLP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/BhattBSV12,
author = {Himanshu S. Bhatt and
Samarth Bharadwaj and
Richa Singh and
Mayank Vatsa},
title = {Memetically Optimized {MCWLD} for Matching Sketches With Digital Face
Images},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {7},
number = {5},
pages = {1522--1535},
year = {2012},
url = {https://doi.org/10.1109/TIFS.2012.2204252},
doi = {10.1109/TIFS.2012.2204252},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/BhattBSV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aamas/BratmanSSL12,
author = {Jeshua Bratman and
Satinder Singh and
Jonathan Sorg and
Richard L. Lewis},
editor = {Wiebe van der Hoek and
Lin Padgham and
Vincent Conitzer and
Michael Winikoff},
title = {Strong mitigation: nesting search for good policies within search
for good reward},
booktitle = {International Conference on Autonomous Agents and Multiagent Systems,
{AAMAS} 2012, Valencia, Spain, June 4-8, 2012 {(3} Volumes)},
pages = {407--414},
publisher = {{IFAAMAS}},
year = {2012},
url = {http://dl.acm.org/citation.cfm?id=2343634},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aamas/BratmanSSL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amlta/SharmaBS12,
author = {Richa N. K. Sharma and
Roheet Bhatnagar and
A. K. Singh},
editor = {Aboul Ella Hassanien and
Abdel{-}Badeeh M. Salem and
Rabie A. Ramadan and
Tai{-}Hoon Kim},
title = {Surface Mining Signal Discrimination Using Landsat {TM} Sensor: An
Empirical Approach},
booktitle = {Advanced Machine Learning Technologies and Applications - First International
Conference, {AMLTA} 2012, Cairo, Egypt, December 8-10, 2012. Proceedings},
series = {Communications in Computer and Information Science},
volume = {322},
pages = {222--233},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-35326-0\_23},
doi = {10.1007/978-3-642-35326-0\_23},
timestamp = {Tue, 29 Dec 2020 18:42:26 +0100},
biburl = {https://dblp.org/rec/conf/amlta/SharmaBS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/AroraVSJ12,
author = {Sunpreet S. Arora and
Mayank Vatsa and
Richa Singh and
Anil K. Jain},
title = {On iris camera interoperability},
booktitle = {{IEEE} Fifth International Conference on Biometrics: Theory, Applications
and Systems, {BTAS} 2012, Arlington, VA, USA, September 23-27, 2012},
pages = {346--352},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/BTAS.2012.6374599},
doi = {10.1109/BTAS.2012.6374599},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/btas/AroraVSJ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/GoswamiSVPN12,
author = {Gaurav Goswami and
Richa Singh and
Mayank Vatsa and
Brian M. Powell and
Afzel Noore},
title = {Face recognition {CAPTCHA}},
booktitle = {{IEEE} Fifth International Conference on Biometrics: Theory, Applications
and Systems, {BTAS} 2012, Arlington, VA, USA, September 23-27, 2012},
pages = {412--417},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/BTAS.2012.6374608},
doi = {10.1109/BTAS.2012.6374608},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/GoswamiSVPN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/KohliSV12,
author = {Naman Kohli and
Richa Singh and
Mayank Vatsa},
title = {Self-similarity representation of Weber faces for kinship classification},
booktitle = {{IEEE} Fifth International Conference on Biometrics: Theory, Applications
and Systems, {BTAS} 2012, Arlington, VA, USA, September 23-27, 2012},
pages = {245--250},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/BTAS.2012.6374584},
doi = {10.1109/BTAS.2012.6374584},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/KohliSV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/SankaranVS12,
author = {Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {Hierarchical fusion for matching simultaneous latent fingerprint},
booktitle = {{IEEE} Fifth International Conference on Biometrics: Theory, Applications
and Systems, {BTAS} 2012, Arlington, VA, USA, September 23-27, 2012},
pages = {377--382},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/BTAS.2012.6374604},
doi = {10.1109/BTAS.2012.6374604},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/SankaranVS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/MehrotraVSM12,
author = {Hunny Mehrotra and
Mayank Vatsa and
Richa Singh and
Banshidhar Majhi},
title = {Biometric match score fusion using {RVM:} {A} case study in multi-unit
iris recognition},
booktitle = {2012 {IEEE} Computer Society Conference on Computer Vision and Pattern
Recognition Workshops, Providence, RI, USA, June 16-21, 2012},
pages = {65--70},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/CVPRW.2012.6239217},
doi = {10.1109/CVPRW.2012.6239217},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/MehrotraVSM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/SinghP12,
author = {Richa Singh and
Mayank Pundir},
editor = {Richard J. LeBlanc and
Ann E. K. Sobel},
title = {Work in progress: On entrance test criteria for {CS} and {IT} {UG}
programs},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2012, Seattle, WA,
USA, October 3-6, 2012},
pages = {1--2},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/FIE.2012.6462524},
doi = {10.1109/FIE.2012.6462524},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fie/SinghP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/SrivastavaS12,
author = {Saket Srivastava and
Richa Singh},
editor = {Richard J. LeBlanc and
Ann E. K. Sobel},
title = {Work in progress: {A} quantitative study of effectiveness in group
learning},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2012, Seattle, WA,
USA, October 3-6, 2012},
pages = {1--2},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/FIE.2012.6462519},
doi = {10.1109/FIE.2012.6462519},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fie/SrivastavaS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/host/YuSSMD12,
author = {Meng{-}Day (Mandel) Yu and
Richard Sowell and
Alok Singh and
David M'Ra{\"{\i}}hi and
Srinivas Devadas},
title = {Performance metrics and empirical results of a {PUF} cryptographic
key generation {ASIC}},
booktitle = {2012 {IEEE} International Symposium on Hardware-Oriented Security
and Trust, {HOST} 2012, San Francisco, CA, USA, June 3-4, 2012},
pages = {108--115},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/HST.2012.6224329},
doi = {10.1109/HST.2012.6224329},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/host/YuSSMD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/AroraVSJ12,
author = {Sunpreet S. Arora and
Mayank Vatsa and
Richa Singh and
Anil K. Jain},
editor = {Anil K. Jain and
Arun Ross and
Salil Prabhakar and
Jaihie Kim},
title = {Iris recognition under alcohol influence: {A} preliminary study},
booktitle = {5th {IAPR} International Conference on Biometrics, {ICB} 2012, New
Delhi, India, March 29 - April 1, 2012},
pages = {336--341},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICB.2012.6199829},
doi = {10.1109/ICB.2012.6199829},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/icb/AroraVSJ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/RotsosMMSM12,
author = {Charalampos Rotsos and
Richard Mortier and
Anil Madhavapeddy and
Balraj Singh and
Andrew W. Moore},
title = {Cost, performance {\&} flexibility in OpenFlow: Pick three},
booktitle = {Proceedings of {IEEE} International Conference on Communications,
{ICC} 2012, Ottawa, ON, Canada, June 10-15, 2012},
pages = {6601--6605},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICC.2012.6364690},
doi = {10.1109/ICC.2012.6364690},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icc/RotsosMMSM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdl-epirob/LiuSLQ12,
author = {Bingyao Liu and
Satinder Singh and
Richard L. Lewis and
Shiyin Qin},
title = {Optimal rewards in multiagent teams},
booktitle = {2012 {IEEE} International Conference on Development and Learning and
Epigenetic Robotics, {ICDL-EPIROB} 2012, San Diego, CA, USA, November
7-9, 2012},
pages = {1--8},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/DevLrn.2012.6400862},
doi = {10.1109/DEVLRN.2012.6400862},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icdl-epirob/LiuSLQ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icer/RadermacherWR12,
author = {Alex Radermacher and
Gursimran S. Walia and
Richard Rummelt},
editor = {Alison Clear and
Kate Sanders and
Beth Simon},
title = {Improving student learning outcomes with pair programming},
booktitle = {International Computing Education Research Conference, {ICER} '12,
Auckland, New Zealand, September 10-12, 2012},
pages = {87--92},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2361276.2361294},
doi = {10.1145/2361276.2361294},
timestamp = {Wed, 05 Oct 2022 13:16:06 +0200},
biburl = {https://dblp.org/rec/conf/icer/RadermacherWR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/BhattSVR12,
author = {Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Matching cross-resolution face images using co-transfer learning},
booktitle = {19th {IEEE} International Conference on Image Processing, {ICIP} 2012,
Lake Buena Vista, Orlando, FL, USA, September 30 - October 3, 2012},
pages = {1453--1456},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICIP.2012.6467144},
doi = {10.1109/ICIP.2012.6467144},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icip/BhattSVR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/LambaDVS12,
author = {Hemank Lamba and
Tejas Indulal Dhamecha and
Mayank Vatsa and
Richa Singh},
title = {Incremental subclass discriminant analysis: {A} case study in face
recognition},
booktitle = {19th {IEEE} International Conference on Image Processing, {ICIP} 2012,
Lake Buena Vista, Orlando, FL, USA, September 30 - October 3, 2012},
pages = {593--596},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICIP.2012.6466929},
doi = {10.1109/ICIP.2012.6466929},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/LambaDVS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icisp/KhareSS12,
author = {Ashish Khare and
Richa Srivastava and
Rajiv Singh},
editor = {Abderrahim Elmoataz and
Driss Mammass and
Olivier Lezoray and
Fathallah Nouboud and
Driss Aboutajdine},
title = {Edge Preserving Image Fusion Based on Contourlet Transform},
booktitle = {Image and Signal Processing - 5th International Conference, {ICISP}
2012, Agadir, Morocco, June 28-30, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7340},
pages = {93--102},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-31254-0\_11},
doi = {10.1007/978-3-642-31254-0\_11},
timestamp = {Tue, 14 May 2019 10:00:40 +0200},
biburl = {https://dblp.org/rec/conf/icisp/KhareSS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icitcs/KumarCSS12,
author = {Tarun Kumar and
Ajay Chaudhary and
Ganesh Singh and
Richa Sharma},
editor = {Kuinam J. Kim and
Kyung{-}Yong Chung},
title = {A Framework of the Wireless Sensor Based Railway Signal System},
booktitle = {Proceedings of the International Conference on {IT} Convergence and
Security, {ICITCS} 2012, Pyeong Chang, Korea, December 5-7, 2012},
series = {Lecture Notes in Electrical Engineering},
volume = {215},
pages = {417--423},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-94-007-5860-5\_51},
doi = {10.1007/978-94-007-5860-5\_51},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icitcs/KumarCSS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/TomarR12,
author = {Vikrant Singh Tomar and
Richard C. Rose},
title = {A Correlational Discriminant Approach to Feature Extraction for Robust
Speech Recognition},
booktitle = {13th Annual Conference of the International Speech Communication Association,
{INTERSPEECH} 2012, Portland, Oregon, USA, September 9-13, 2012},
pages = {555--558},
publisher = {{ISCA}},
year = {2012},
url = {https://doi.org/10.21437/Interspeech.2012-171},
doi = {10.21437/INTERSPEECH.2012-171},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/TomarR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isspa/TomarR12,
author = {Vikrant Singh Tomar and
Richard C. Rose},
title = {Application of a locality preserving discriminant analysis approach
to {ASR}},
booktitle = {11th International Conference on Information Science, Signal Processing
and their Applications, {ISSPA} 2012, Montreal, QC, Canada, July 2-5,
2012},
pages = {103--107},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISSPA.2012.6310443},
doi = {10.1109/ISSPA.2012.6310443},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/isspa/TomarR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/msn/PalanisamyLLST12,
author = {Balaji Palanisamy and
Ling Liu and
Kisung Lee and
Aameek Singh and
Yuzhe Richard Tang},
title = {Location Privacy with Road Network Mix-Zones},
booktitle = {8th International Conference on Mobile Ad-hoc and Sensor Networks,
{MSN} 2012, Chengdu, China, December 14-16, 2012},
pages = {124--131},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/MSN.2012.27},
doi = {10.1109/MSN.2012.27},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/msn/PalanisamyLLST12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/RadermacherWR12,
author = {Alex Radermacher and
Gursimran S. Walia and
Richard Rummelt},
editor = {Laurie A. Smith King and
David R. Musicant and
Tracy Camp and
Paul T. Tymann},
title = {Assigning student programming pairs based on their mental model consistency:
an initial investigation},
booktitle = {Proceedings of the 43rd {ACM} technical symposium on Computer science
education, {SIGCSE} 2012, Raleigh, NC, USA, February 29 - March 3,
2012},
pages = {325--330},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2157136.2157236},
doi = {10.1145/2157136.2157236},
timestamp = {Wed, 10 Mar 2021 13:17:16 +0100},
biburl = {https://dblp.org/rec/conf/sigcse/RadermacherWR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/srii/GoodwinGMSMM12,
author = {Richard Goodwin and
SweeFen Goh and
Pietro Mazzoleni and
Vibha Sinha and
Debdoot Mukherjee and
Senthil Mani},
title = {Effective Content Reuse for Business Consulting Practices},
booktitle = {2012 Annual {SRII} Global Conference, San Jose, CA, USA, July 24-27,
2012},
pages = {682--690},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/SRII.2012.82},
doi = {10.1109/SRII.2012.82},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/srii/GoodwinGMSMM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/srii/GoodwinMGRSMM12,
author = {Richard Goodwin and
Pietro Mazzoleni and
SweeFen Goh and
Aubrey Rember and
Vibha Sinha and
Debdoot Mukherjee and
Senthil Mani},
title = {Improving Service Quality through Use of Standard Workbenches},
booktitle = {2012 Annual {SRII} Global Conference, San Jose, CA, USA, July 24-27,
2012},
pages = {361--368},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/SRII.2012.47},
doi = {10.1109/SRII.2012.47},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/srii/GoodwinMGRSMM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trecvid/YuXDSVLCRSMBJT012,
author = {Shoou{-}I Yu and
Zhongwen Xu and
Duo Ding and
Waito Sze and
Francisco Vicente and
Zhenzhong Lan and
Yang Cai and
Shourabh Rawat and
Peter F. Schulam and
Nisarga Markandaiah and
Sohail Bahmani and
Antonio Ju{\'{a}}rez and
Wei Tong and
Yi Yang and
Susanne Burger and
Florian Metze and
Rita Singh and
Bhiksha Raj and
Richard M. Stern and
Teruko Mitamura and
Eric Nyberg and
Lu Jiang and
Qiang Chen and
Lisa M. Brown and
Ankur Datta and
Quanfu Fan and
Rog{\'{e}}rio Schmidt Feris and
Shuicheng Yan and
Alexander G. Hauptmann and
Sharath Pankanti},
editor = {Paul Over and
Jonathan G. Fiscus and
Gregory A. Sanders and
Barbara Shaw and
George Awad and
Martial Michel and
Alan F. Smeaton and
Wessel Kraaij and
Georges Qu{\'{e}}not},
title = {Informedia @TRECVID 2012},
booktitle = {2012 {TREC} Video Retrieval Evaluation, {TRECVID} 2012, Gaithersburg,
MD, USA, November 26-28, 2012},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2012},
url = {https://www-nlpir.nist.gov/projects/tvpubs/tv12.papers/informedia.pdf},
timestamp = {Mon, 19 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/trecvid/YuXDSVLCRSMBJT012.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1203-3518,
author = {Jonathan Sorg and
Satinder Singh and
Richard L. Lewis},
title = {Variance-Based Rewards for Approximate Bayesian Reinforcement Learning},
journal = {CoRR},
volume = {abs/1203.3518},
year = {2012},
url = {http://arxiv.org/abs/1203.3518},
eprinttype = {arXiv},
eprint = {1203.3518},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1203-3518.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asc/VatsaSNM11,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore and
Keith B. Morris},
title = {Simultaneous latent fingerprint recognition},
journal = {Appl. Soft Comput.},
volume = {11},
number = {7},
pages = {4260--4266},
year = {2011},
url = {https://doi.org/10.1016/j.asoc.2011.02.005},
doi = {10.1016/J.ASOC.2011.02.005},
timestamp = {Thu, 18 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/asc/VatsaSNM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasss/FrankDRSCB11,
author = {Richard Frank and
Vahid Dabbaghian and
Andrew A. Reid and
Suraj K. Singh and
Jonathan Cinnamon and
Patricia L. Brantingham},
title = {Power of Criminal Attractors: Modeling the Pull of Activity Nodes},
journal = {J. Artif. Soc. Soc. Simul.},
volume = {14},
number = {1},
year = {2011},
url = {https://doi.org/10.18564/jasss.1734},
doi = {10.18564/JASSS.1734},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasss/FrankDRSCB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/FlicekAB11,
author = {Paul Flicek and
M. Ridwan Amode and
Daniel Barrell and
Kathryn Beal and
Simon Brent and
Yuan Chen and
Peter Clapham and
Guy Coates and
Susan Fairley and
Stephen Fitzgerald and
Leo Gordon and
Maurice Hendrix and
Thibaut Hourlier and
Nathan Johnson and
Andreas K{\"{a}}h{\"{a}}ri and
Damian Keefe and
Stephen Keenan and
Rhoda Kinsella and
Felix Kokocinski and
Eugene Kulesha and
Pontus Larsson and
Ian Longden and
William M. McLaren and
Bert Overduin and
Bethan Pritchard and
Harpreet Singh Riat and
Daniel Rios and
Graham R. S. Ritchie and
Magali Ruffier and
Michael Schuster and
Daniel Sobral and
Giulietta Spudich and
Y. Amy Tang and
Stephen J. Trevanion and
Jana Vandrovcova and
Albert J. Vilella and
Simon White and
Steven P. Wilder and
Amonida Zadissa and
Jorge Zamora and
Bronwen L. Aken and
Ewan Birney and
Fiona Cunningham and
Ian Dunham and
Richard Durbin and
Xos{\'{e}} M. Fern{\'{a}}ndez{-}Su{\'{a}}rez and
Javier Herrero and
Tim J. P. Hubbard and
Anne Parker and
Glenn Proctor and
Jan Vogel and
Stephen M. J. Searle},
title = {Ensembl 2011},
journal = {Nucleic Acids Res.},
volume = {39},
number = {Database-Issue},
pages = {800--806},
year = {2011},
url = {https://doi.org/10.1093/nar/gkq1064},
doi = {10.1093/NAR/GKQ1064},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/FlicekAB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tosn/SinghKMSC11,
author = {Jaspreet Singh and
Rajesh Kumar and
Upamanyu Madhow and
Subhash Suri and
Richard E. Cagley},
title = {Multiple-Target Tracking With Binary Proximity Sensors},
journal = {{ACM} Trans. Sens. Networks},
volume = {8},
number = {1},
pages = {5:1--5:26},
year = {2011},
url = {https://doi.org/10.1145/1993042.1993047},
doi = {10.1145/1993042.1993047},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tosn/SinghKMSC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/SorgSL11,
author = {Jonathan Sorg and
Satinder Singh and
Richard L. Lewis},
editor = {Wolfram Burgard and
Dan Roth},
title = {Optimal Rewards versus Leaf-Evaluation Heuristics in Planning Agents},
booktitle = {Proceedings of the Twenty-Fifth {AAAI} Conference on Artificial Intelligence,
{AAAI} 2011, San Francisco, California, USA, August 7-11, 2011},
pages = {465--470},
publisher = {{AAAI} Press},
year = {2011},
url = {https://doi.org/10.1609/aaai.v25i1.7931},
doi = {10.1609/AAAI.V25I1.7931},
timestamp = {Mon, 04 Sep 2023 16:05:54 +0200},
biburl = {https://dblp.org/rec/conf/aaai/SorgSL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/BharadwajBVSN11,
author = {Samarth Bharadwaj and
Himanshu S. Bhatt and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Quality assessment based denoising to improve face recognition performance},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
Workshops 2011, Colorado Springs, CO, USA, 20-25 June, 2011},
pages = {140--145},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/CVPRW.2011.5981843},
doi = {10.1109/CVPRW.2011.5981843},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/BharadwajBVSN11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fgr/BhattBSVN11,
author = {Himanshu S. Bhatt and
Samarth Bharadwaj and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Evolutionary granular approach for recognizing faces altered due to
plastic surgery},
booktitle = {Ninth {IEEE} International Conference on Automatic Face and Gesture
Recognition {(FG} 2011), Santa Barbara, CA, USA, 21-25 March 2011},
pages = {720--725},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/FG.2011.5771337},
doi = {10.1109/FG.2011.5771337},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fgr/BhattBSVN11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/KumarRSS11,
author = {Kshitiz Kumar and
Bhiksha Raj and
Rita Singh and
Richard M. Stern},
title = {An iterative least-squares technique for dereverberation},
booktitle = {Proceedings of the {IEEE} International Conference on Acoustics, Speech,
and Signal Processing, {ICASSP} 2011, May 22-27, 2011, Prague Congress
Center, Prague, Czech Republic},
pages = {5488--5491},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ICASSP.2011.5947601},
doi = {10.1109/ICASSP.2011.5947601},
timestamp = {Sun, 04 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/KumarRSS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/KumarSRS11,
author = {Kshitiz Kumar and
Rita Singh and
Bhiksha Raj and
Richard M. Stern},
title = {Gammatone sub-band magnitude-domain dereverberation for {ASR}},
booktitle = {Proceedings of the {IEEE} International Conference on Acoustics, Speech,
and Signal Processing, {ICASSP} 2011, May 22-27, 2011, Prague Congress
Center, Prague, Czech Republic},
pages = {4604--4607},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ICASSP.2011.5947380},
doi = {10.1109/ICASSP.2011.5947380},
timestamp = {Sun, 04 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/KumarSRS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/BhattBSVNR11,
author = {Himanshu S. Bhatt and
Samarth Bharadwaj and
Richa Singh and
Mayank Vatsa and
Afzel Noore and
Arun Ross},
title = {On co-training online biometric classifiers},
booktitle = {2011 {IEEE} International Joint Conference on Biometrics, {IJCB} 2011,
Washington, DC, USA, October 11-13, 2011},
pages = {1--7},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/IJCB.2011.6117519},
doi = {10.1109/IJCB.2011.6117519},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icb/BhattBSVNR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/BhattBVSRN11,
author = {Himanshu S. Bhatt and
Samarth Bharadwaj and
Mayank Vatsa and
Richa Singh and
Arun Ross and
Afzel Noore},
title = {A framework for quality-based biometric classifier selection},
booktitle = {2011 {IEEE} International Joint Conference on Biometrics, {IJCB} 2011,
Washington, DC, USA, October 11-13, 2011},
pages = {1--7},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/IJCB.2011.6117518},
doi = {10.1109/IJCB.2011.6117518},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icb/BhattBVSRN11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/DhamechaSSV11,
author = {Tejas I. Dhamecha and
Anush Sankaran and
Richa Singh and
Mayank Vatsa},
title = {Is gender classification across ethnicity feasible using discriminant
functions?},
booktitle = {2011 {IEEE} International Joint Conference on Biometrics, {IJCB} 2011,
Washington, DC, USA, October 11-13, 2011},
pages = {1--7},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/IJCB.2011.6117524},
doi = {10.1109/IJCB.2011.6117524},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icb/DhamechaSSV11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/LambaSVSN11,
author = {Hemank Lamba and
Ankit Sarkar and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Face recognition for look-alikes: {A} preliminary study},
booktitle = {2011 {IEEE} International Joint Conference on Biometrics, {IJCB} 2011,
Washington, DC, USA, October 11-13, 2011},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/IJCB.2011.6117520},
doi = {10.1109/IJCB.2011.6117520},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icb/LambaSVSN11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/SankaranDVS11,
author = {Anush Sankaran and
Tejas I. Dhamecha and
Mayank Vatsa and
Richa Singh},
title = {On matching latent to latent fingerprints},
booktitle = {2011 {IEEE} International Joint Conference on Biometrics, {IJCB} 2011,
Washington, DC, USA, October 11-13, 2011},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/IJCB.2011.6117525},
doi = {10.1109/IJCB.2011.6117525},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icb/SankaranDVS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/FeinRSMGGBCLSMMSD11,
author = {Elad Fein and
Natalia Razinkov and
Shlomit Shachor and
Pietro Mazzoleni and
SweeFen Goh and
Richard Goodwin and
Manisha Bhandar and
Shyh{-}Kwei Chen and
Juhnyoung Lee and
Vibha Singhal Sinha and
Senthil Mani and
Debdoot Mukherjee and
Biplav Srivastava and
Pankaj Dhoolia},
editor = {Richard N. Taylor and
Harald C. Gall and
Nenad Medvidovic},
title = {Using {MATCON} to generate {CASE} tools that guide deployment of pre-packaged
applications},
booktitle = {Proceedings of the 33rd International Conference on Software Engineering,
{ICSE} 2011, Waikiki, Honolulu , HI, USA, May 21-28, 2011},
pages = {1016--1018},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/1985793.1985981},
doi = {10.1145/1985793.1985981},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icse/FeinRSMGGBCLSMMSD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmetrics/SinghBLBLS11,
author = {Satinder Pal Singh and
Randolph Baden and
Choon Lee and
Bobby Bhattacharjee and
Richard J. La and
Mark A. Shayman},
editor = {Arif Merchant and
Kimberly Keeton and
Dan Rubenstein},
title = {{IP} geolocation in metropolitan areas},
booktitle = {{SIGMETRICS} 2011, Proceedings of the 2011 {ACM} {SIGMETRICS} International
Conference on Measurement and Modeling of Computer Systems, San Jose,
CA, USA, 07-11 June 2011 (Co-located with {FCRC} 2011)},
pages = {155--156},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/1993744.1993803},
doi = {10.1145/1993744.1993803},
timestamp = {Sun, 01 Aug 2021 14:20:40 +0200},
biburl = {https://dblp.org/rec/conf/sigmetrics/SinghBLBLS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/ShahABSMIKMZBAS10,
author = {Anuj R. Shah and
Khushbu Agarwal and
Erin S. Baker and
Mudita Singhal and
Anoop M. Mayampurath and
Yehia M. Ibrahim and
Lars J. Kangas and
Matthew E. Monroe and
Rui Zhao and
Mikhail E. Belov and
Gordon A. Anderson and
Richard D. Smith},
title = {Machine learning based prediction for peptide drift times in ion mobility
spectrometry},
journal = {Bioinform.},
volume = {26},
number = {13},
pages = {1601--1607},
year = {2010},
url = {https://doi.org/10.1093/bioinformatics/btq245},
doi = {10.1093/BIOINFORMATICS/BTQ245},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/ShahABSMIKMZBAS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmis/PowellDSVN10,
author = {Brian M. Powell and
Adam C. Day and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Image-based face detection {CAPTCHA} for improved security},
journal = {Int. J. Multim. Intell. Secur.},
volume = {1},
number = {3},
pages = {269--284},
year = {2010},
url = {https://doi.org/10.1504/IJMIS.2010.037541},
doi = {10.1504/IJMIS.2010.037541},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmis/PowellDSVN10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ivc/SinghVRN10,
author = {Richa Singh and
Mayank Vatsa and
Arun Ross and
Afzel Noore},
title = {Biometric classifier update using online learning: {A} case study
in near infrared face verification},
journal = {Image Vis. Comput.},
volume = {28},
number = {7},
pages = {1098--1105},
year = {2010},
url = {https://doi.org/10.1016/j.imavis.2010.01.009},
doi = {10.1016/J.IMAVIS.2010.01.009},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ivc/SinghVRN10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/BinghamFSCDEMMRS10,
author = {Brian Bingham and
Brendan Foley and
Hanumant Singh and
Richard Camilli and
Katerina Delaporta and
Ryan M. Eustice and
Angelos Mallios and
David A. Mindell and
Christopher N. Roman and
Dimitris Sakellariou},
title = {Robotic tools for deep water archaeology: Surveying an ancient shipwreck
with an autonomous underwater vehicle},
journal = {J. Field Robotics},
volume = {27},
number = {6},
pages = {702--717},
year = {2010},
url = {https://doi.org/10.1002/rob.20350},
doi = {10.1002/ROB.20350},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfr/BinghamFSCDEMMRS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tamd/SinghLBS10,
author = {Satinder Singh and
Richard L. Lewis and
Andrew G. Barto and
Jonathan Sorg},
title = {Intrinsically Motivated Reinforcement Learning: An Evolutionary Perspective},
journal = {{IEEE} Trans. Auton. Ment. Dev.},
volume = {2},
number = {2},
pages = {70--82},
year = {2010},
url = {https://doi.org/10.1109/TAMD.2010.2051031},
doi = {10.1109/TAMD.2010.2051031},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tamd/SinghLBS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/SinghVBBNN10,
author = {Richa Singh and
Mayank Vatsa and
Himanshu S. Bhatt and
Samarth Bharadwaj and
Afzel Noore and
Shahin S. Nooreyezdan},
title = {Plastic surgery: a new dimension to face recognition},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {5},
number = {3},
pages = {441--448},
year = {2010},
url = {https://doi.org/10.1109/TIFS.2010.2054083},
doi = {10.1109/TIFS.2010.2054083},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/SinghVBBNN10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/VatsaSNR10,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore and
Arun Ross},
title = {On the dynamic selection of biometric fusion algorithms},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {5},
number = {3},
pages = {470--479},
year = {2010},
url = {https://doi.org/10.1109/TIFS.2010.2056683},
doi = {10.1109/TIFS.2010.2056683},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/VatsaSNR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/SinghRASB10,
author = {Harmander Singh and
Rahul M. Rao and
Kanak Agarwal and
Dennis Sylvester and
Richard B. Brown},
title = {Dynamically Pulsed {MTCMOS} With Bus Encoding for Reduction of Total
Power and Crosstalk Noise},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {18},
number = {1},
pages = {166--170},
year = {2010},
url = {https://doi.org/10.1109/TVLSI.2009.2031290},
doi = {10.1109/TVLSI.2009.2031290},
timestamp = {Tue, 04 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvlsi/SinghRASB10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl-louhi/BhatiaGDMMD10,
author = {Ramanjot Singh Bhatia and
Amber Graystone and
Ross A. Davies and
Susan McClinton and
Jason Morin and
Richard F. Davies},
editor = {Hercules Dalianis and
Martin Hassel and
Gunnar H. Nilsson},
title = {Extracting Information for Generating {A} Diabetes Report Card from
Free Text in Physicians Notes},
booktitle = {Proceedings of the Second Louhi Workshop on Text and Data Mining of
Health Documents, Louhi@NAACL-HLT 2010, Los Angeles, CA, USA, June
5, 2010},
pages = {8--14},
publisher = {Association for Computational Linguistics},
year = {2010},
url = {https://aclanthology.org/W10-1102/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl-louhi/BhatiaGDMMD10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/BharadwajBSVS10,
author = {Samarth Bharadwaj and
Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa and
Sanjay Kumar Singh},
title = {Face recognition for newborns: {A} preliminary study},
booktitle = {Fourth {IEEE} International Conference on Biometrics: Theory Applications
and Systems, {BTAS} 2010, Washington, DC, USA, 27-29 September, 2010},
pages = {1--6},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/BTAS.2010.5634500},
doi = {10.1109/BTAS.2010.5634500},
timestamp = {Wed, 12 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/BharadwajBSVS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/BharadwajBVS10,
author = {Samarth Bharadwaj and
Himanshu S. Bhatt and
Mayank Vatsa and
Richa Singh},
title = {Periocular biometrics: When iris recognition fails},
booktitle = {Fourth {IEEE} International Conference on Biometrics: Theory Applications
and Systems, {BTAS} 2010, Washington, DC, USA, 27-29 September, 2010},
pages = {1--6},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/BTAS.2010.5634498},
doi = {10.1109/BTAS.2010.5634498},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/BharadwajBVS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/BhattBSV10,
author = {Himanshu S. Bhatt and
Samarth Bharadwaj and
Richa Singh and
Mayank Vatsa},
title = {On matching sketches with digital face images},
booktitle = {Fourth {IEEE} International Conference on Biometrics: Theory Applications
and Systems, {BTAS} 2010, Washington, DC, USA, 27-29 September, 2010},
pages = {1--7},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/BTAS.2010.5634507},
doi = {10.1109/BTAS.2010.5634507},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/BhattBSV10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btas/VatsaSBBN10,
author = {Mayank Vatsa and
Richa Singh and
Samarth Bharadwaj and
Himanshu S. Bhatt and
Afzel Noore},
title = {Matching digital and scanned face images with age variation},
booktitle = {Fourth {IEEE} International Conference on Biometrics: Theory Applications
and Systems, {BTAS} 2010, Washington, DC, USA, 27-29 September, 2010},
pages = {1--6},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/BTAS.2010.5634503},
doi = {10.1109/BTAS.2010.5634503},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btas/VatsaSBBN10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceb2/BhattBSV10,
author = {Himanshu S. Bhatt and
Samarth Bharadwaj and
Richa Singh and
Mayank Vatsa},
editor = {Ajay Kumar and
David Zhang},
title = {Face Recognition and Plastic Surgery: Social, Ethical and Engineering
Challenges},
booktitle = {Ethics and Policy of Biometrics - Third International Conference on
Ethics and Policy of Biometrics and International Data Sharing, {ICEB}
2010, Hong Kong, January 4-5, 2010. Revised Papers},
series = {Lecture Notes in Computer Science},
volume = {6005},
pages = {70--75},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-12595-9\_10},
doi = {10.1007/978-3-642-12595-9\_10},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iceb2/BhattBSV10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceb2/PuriNTVS10,
author = {Charvi Puri and
Kanika Narang and
A. Tiwari and
Mayank Vatsa and
Richa Singh},
editor = {Ajay Kumar and
David Zhang},
title = {On Analysis of Rural and Urban Indian Fingerprint Images},
booktitle = {Ethics and Policy of Biometrics - Third International Conference on
Ethics and Policy of Biometrics and International Data Sharing, {ICEB}
2010, Hong Kong, January 4-5, 2010. Revised Papers},
series = {Lecture Notes in Computer Science},
volume = {6005},
pages = {55--61},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-12595-9\_8},
doi = {10.1007/978-3-642-12595-9\_8},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iceb2/PuriNTVS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/SorgSL10,
author = {Jonathan Sorg and
Satinder Singh and
Richard L. Lewis},
editor = {Johannes F{\"{u}}rnkranz and
Thorsten Joachims},
title = {Internal Rewards Mitigate Agent Boundedness},
booktitle = {Proceedings of the 27th International Conference on Machine Learning
(ICML-10), June 21-24, 2010, Haifa, Israel},
pages = {1007--1014},
publisher = {Omnipress},
year = {2010},
url = {https://icml.cc/Conferences/2010/papers/442.pdf},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/SorgSL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/VatsaSRN10,
author = {Mayank Vatsa and
Richa Singh and
Arun Ross and
Afzel Noore},
title = {Quality-Based Fusion for Multichannel Iris Recognition},
booktitle = {20th International Conference on Pattern Recognition, {ICPR} 2010,
Istanbul, Turkey, 23-26 August 2010},
pages = {1314--1317},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/ICPR.2010.327},
doi = {10.1109/ICPR.2010.327},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpr/VatsaSRN10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/SinghFPHKMWJ10,
author = {Nikhil Singh and
P. Thomas Fletcher and
J. Samuel Preston and
Linh K. Ha and
Richard D. King and
James Stephen Marron and
Michael Wiener and
Sarang C. Joshi},
editor = {Tianzi Jiang and
Nassir Navab and
Josien P. W. Pluim and
Max A. Viergever},
title = {Multivariate Statistical Analysis of Deformation Momenta Relating
Anatomical Shape to Neuropsychological Measures},
booktitle = {Medical Image Computing and Computer-Assisted Intervention - {MICCAI}
2010, 13th International Conference, Beijing, China, September 20-24,
2010, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {6363},
pages = {529--537},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-15711-0\_66},
doi = {10.1007/978-3-642-15711-0\_66},
timestamp = {Thu, 24 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miccai/SinghFPHKMWJ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/SorgSL10,
author = {Jonathan Sorg and
Satinder Singh and
Richard L. Lewis},
editor = {John D. Lafferty and
Christopher K. I. Williams and
John Shawe{-}Taylor and
Richard S. Zemel and
Aron Culotta},
title = {Reward Design via Online Gradient Ascent},
booktitle = {Advances in Neural Information Processing Systems 23: 24th Annual
Conference on Neural Information Processing Systems 2010. Proceedings
of a meeting held 6-9 December 2010, Vancouver, British Columbia,
Canada},
pages = {2190--2198},
publisher = {Curran Associates, Inc.},
year = {2010},
url = {https://proceedings.neurips.cc/paper/2010/hash/168908dd3227b8358eababa07fcaf091-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/SorgSL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ppopp/ChoiSV10,
author = {JeeWhan Choi and
Amik Singh and
Richard W. Vuduc},
editor = {R. Govindarajan and
David A. Padua and
Mary W. Hall},
title = {Model-driven autotuning of sparse matrix-vector multiply on GPUs},
booktitle = {Proceedings of the 15th {ACM} {SIGPLAN} Symposium on Principles and
Practice of Parallel Programming, {PPOPP} 2010, Bangalore, India,
January 9-14, 2010},
pages = {115--126},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1693453.1693471},
doi = {10.1145/1693453.1693471},
timestamp = {Sun, 12 Jun 2022 19:46:08 +0200},
biburl = {https://dblp.org/rec/conf/ppopp/ChoiSV10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uai/SorgSL10,
author = {Jonathan Sorg and
Satinder Singh and
Richard L. Lewis},
editor = {Peter Gr{\"{u}}nwald and
Peter Spirtes},
title = {Variance-Based Rewards for Approximate Bayesian Reinforcement Learning},
booktitle = {{UAI} 2010, Proceedings of the Twenty-Sixth Conference on Uncertainty
in Artificial Intelligence, Catalina Island, CA, USA, July 8-11, 2010},
pages = {564--571},
publisher = {{AUAI} Press},
year = {2010},
url = {https://dslpitt.org/uai/displayArticleDetails.jsp?mmnu=1\&smnu=2\&article\_id=2150\&proceeding\_id=26},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/uai/SorgSL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijar/VatsaSNH09,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore and
Max M. Houck},
title = {Quality-augmented fusion of level-2 and level-3 fingerprint information
using DSm theory},
journal = {Int. J. Approx. Reason.},
volume = {50},
number = {1},
pages = {51--61},
year = {2009},
url = {https://doi.org/10.1016/j.ijar.2008.01.009},
doi = {10.1016/J.IJAR.2008.01.009},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijar/VatsaSNH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijiit/DAubeterreIES09,
author = {Fergle D'Aubeterre and
Lakshmi S. Iyer and
Richard Ehrhardt and
Rahul Singh},
title = {Discovery Process in a {B2B} eMarketplace: {A} Semantic Matchmaking
Approach},
journal = {Int. J. Intell. Inf. Technol.},
volume = {5},
number = {4},
pages = {16--40},
year = {2009},
url = {https://doi.org/10.4018/jiit.2009080702},
doi = {10.4018/JIIT.2009080702},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijiit/DAubeterreIES09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ivc/SinghVN09,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Face recognition with disguise and single gallery images},
journal = {Image Vis. Comput.},
volume = {27},
number = {3},
pages = {245--257},
year = {2009},
url = {https://doi.org/10.1016/j.imavis.2007.06.010},
doi = {10.1016/J.IMAVIS.2007.06.010},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ivc/SinghVN09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ivc/VatsaSN09,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Feature based {RDWT} watermarking for multimodal biometric system},
journal = {Image Vis. Comput.},
volume = {27},
number = {3},
pages = {293--304},
year = {2009},
url = {https://doi.org/10.1016/j.imavis.2007.05.003},
doi = {10.1016/J.IMAVIS.2007.05.003},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ivc/VatsaSN09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/SinghGGPHM09,
author = {Narender Singh and
Rajarshi Guha and
Marc A. Giulianotti and
Clemencia Pinilla and
Richard A. Houghten and
Jos{\'{e}} L. Medina{-}Franco},
title = {Chemoinformatic Analysis of Combinatorial Libraries, Drugs, Natural
Products, and Molecular Libraries Small Molecule Repository},
journal = {J. Chem. Inf. Model.},
volume = {49},
number = {4},
pages = {1010--1024},
year = {2009},
url = {https://doi.org/10.1021/ci800426u},
doi = {10.1021/CI800426U},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcisd/SinghGGPHM09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/KunzMSPSSSRNJECB09,
author = {Clayton Kunz and
Chris Murphy and
Hanumant Singh and
Claire Pontbriand and
Robert A. Sohn and
Sandipa Singh and
Taichi Sato and
Christopher N. Roman and
Ko{-}ichi Nakamura and
Michael V. Jakuba and
Ryan M. Eustice and
Richard Camilli and
John Bailey},
title = {Toward extraplanetary under-ice exploration: Robotic steps in the
Arctic},
journal = {J. Field Robotics},
volume = {26},
number = {4},
pages = {411--429},
year = {2009},
url = {https://doi.org/10.1002/rob.20288},
doi = {10.1002/ROB.20288},
timestamp = {Tue, 06 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfr/KunzMSPSSSRNJECB09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigpro/VatsaSNS09,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore and
Sanjay Kumar Singh},
title = {Combining pores and ridges with minutiae for improved fingerprint
verification},
journal = {Signal Process.},
volume = {89},
number = {12},
pages = {2676--2685},
year = {2009},
url = {https://doi.org/10.1016/j.sigpro.2009.05.009},
doi = {10.1016/J.SIGPRO.2009.05.009},
timestamp = {Wed, 12 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigpro/VatsaSNS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/telsys/SinghVSU09,
author = {Richa Singh and
Mayank Vatsa and
Sanjay Kumar Singh and
Saurabh Upadhyay},
title = {Integrating {SVM} classification with {SVD} watermarking for intelligent
video authentication},
journal = {Telecommun. Syst.},
volume = {40},
number = {1-2},
pages = {5--15},
year = {2009},
url = {https://doi.org/10.1007/s11235-008-9141-x},
doi = {10.1007/S11235-008-9141-X},
timestamp = {Wed, 12 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/telsys/SinghVSU09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/VatsaSN09,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Unification of Evidence-Theoretic Fusion Algorithms: {A} Case Study
in Level-2 and Level-3 Fingerprint Features},
journal = {{IEEE} Trans. Syst. Man Cybern. Part {A}},
volume = {39},
number = {1},
pages = {47--56},
year = {2009},
url = {https://doi.org/10.1109/TSMCA.2008.2007981},
doi = {10.1109/TSMCA.2008.2007981},
timestamp = {Mon, 25 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsmc/VatsaSN09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bncod/HalloranIAFCGGJG09,
author = {John Halloran and
Rahat Iqbal and
Dzmitry Aliakseyeu and
Martinez Fernando and
Richard Cooper and
Adam Grzywaczewski and
Ratvinder Grewal and
Anne E. James and
Chris Greenhalgh},
editor = {Alan P. Sexton},
title = {Design Challenges and Solutions: Review of the 4th International Workshop
on Ubiquitous Computing (iUBICOM 2009)},
booktitle = {Dataspace: The Final Frontier, 26th British National Conference on
Databases, {BNCOD} 26, Birmingham, UK, July 7-9, 2009. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5588},
pages = {234--245},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-02843-4\_26},
doi = {10.1007/978-3-642-02843-4\_26},
timestamp = {Mon, 30 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bncod/HalloranIAFCGGJG09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/SinghVN09,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Effect of plastic surgery on face recognition: {A} preliminary study},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
Workshops 2009, Miami, FL, USA, 20-25 June, 2009},
pages = {72--77},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/CVPRW.2009.5204287},
doi = {10.1109/CVPRW.2009.5204287},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/SinghVN09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icapr/SinghVN09,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Multimodal Medical Image Fusion Using Redundant Discrete Wavelet Transform},
booktitle = {Seventh International Conference on Advances in Pattern Recognition,
{ICAPR} 2009, Kolkata, India, 4-6 February 2009, Proceedings},
pages = {232--235},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ICAPR.2009.97},
doi = {10.1109/ICAPR.2009.97},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icapr/SinghVN09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icapr/VatsaSNS09,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore and
Sanjay Kumar Singh},
title = {Belief Function Theory Based Biometric Match Score Fusion: Case Studies
in Multi-instance and Multi-unit Iris Verification},
booktitle = {Seventh International Conference on Advances in Pattern Recognition,
{ICAPR} 2009, Kolkata, India, 4-6 February 2009, Proceedings},
pages = {433--436},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ICAPR.2009.98},
doi = {10.1109/ICAPR.2009.98},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icapr/VatsaSNS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipcv/SinghVN09,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
editor = {Hamid R. Arabnia and
Gerald Schaefer},
title = {Fingerprint Indexing using Minutiae and Pore Features},
booktitle = {Proceedings of the 2009 International Conference on Image Processing,
Computer Vision, {\&} Pattern Recognition, {IPCV} 2009, July 13-16,
2009, Las Vegas, Nevada, USA, 2 Volumes},
pages = {870--875},
publisher = {{CSREA} Press},
year = {2009},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ipcv/SinghVN09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipcv/VatsaSN09,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
editor = {Hamid R. Arabnia and
Gerald Schaefer},
title = {Denoising and Segmentation of 3D Brain Images},
booktitle = {Proceedings of the 2009 International Conference on Image Processing,
Computer Vision, {\&} Pattern Recognition, {IPCV} 2009, July 13-16,
2009, Las Vegas, Nevada, USA, 2 Volumes},
pages = {561--567},
publisher = {{CSREA} Press},
year = {2009},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ipcv/VatsaSN09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/ChungSKDD09,
author = {Moo K. Chung and
Vikas Singh and
Peter T. Kim and
Kim M. Dalton and
Richard J. Davidson},
editor = {Guang{-}Zhong Yang and
David J. Hawkes and
Daniel Rueckert and
J. Alison Noble and
Christopher J. Taylor},
title = {Topological Characterization of Signal in Brain Images Using Min-Max
Diagrams},
booktitle = {Medical Image Computing and Computer-Assisted Intervention - {MICCAI}
2009, 12th International Conference, London, UK, September 20-24,
2009, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {5762},
pages = {158--166},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-04271-3\_20},
doi = {10.1007/978-3-642-04271-3\_20},
timestamp = {Sat, 30 May 2020 20:06:20 +0200},
biburl = {https://dblp.org/rec/conf/miccai/ChungSKDD09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/MazzoleniGGBCLSMMSDFR09,
author = {Pietro Mazzoleni and
SweeFen Goh and
Richard Goodwin and
Manisha Bhandar and
Shyh{-}Kwei Chen and
Juhnyoung Lee and
Vibha Singhal Sinha and
Senthil Mani and
Debdoot Mukherjee and
Biplav Srivastava and
Pankaj Dhoolia and
Elad Fein and
Natalia Razinkov},
editor = {Shail Arora and
Gary T. Leavens},
title = {Consultant assistant: a tool for collaborative requirements gathering
and business process documentation},
booktitle = {Companion to the 24th Annual {ACM} {SIGPLAN} Conference on Object-Oriented
Programming, Systems, Languages, and Applications, {OOPSLA} 2009,
October 25-29, 2009, Orlando, Florida, {USA}},
pages = {807--808},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1639950.1640025},
doi = {10.1145/1639950.1640025},
timestamp = {Mon, 12 Jul 2021 15:34:15 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/MazzoleniGGBCLSMMSDFR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/premi/VatsaSN09,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
editor = {Santanu Chaudhury and
Sushmita Mitra and
C. A. Murthy and
P. S. Sastry and
Sankar K. Pal},
title = {Context Switching Algorithm for Selective Multibiometric Fusion},
booktitle = {Pattern Recognition and Machine Intelligence, Third International
Conference, PReMI 2009, New Delhi, India, December 16-20, 2009 Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5909},
pages = {452--457},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-11164-8\_73},
doi = {10.1007/978-3-642-11164-8\_73},
timestamp = {Mon, 26 Aug 2024 17:59:32 +0200},
biburl = {https://dblp.org/rec/conf/premi/VatsaSN09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/bio/NooreSV09,
author = {Afzel Noore and
Richa Singh and
Mayank Vatsa},
editor = {Stan Z. Li and
Anil K. Jain},
title = {Fusion, Sensor-Level},
booktitle = {Encyclopedia of Biometrics},
pages = {616--621},
publisher = {Springer {US}},
year = {2009},
url = {https://doi.org/10.1007/978-0-387-73003-5\_156},
doi = {10.1007/978-0-387-73003-5\_156},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/reference/bio/NooreSV09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejasp/SinghTK08,
author = {Manoj Kumar Singh and
Uma Shanker Tiwary and
Young{-}Hoon Kim},
title = {An Adaptively Accelerated Lucy-Richardson Method for Image Deblurring},
journal = {{EURASIP} J. Adv. Signal Process.},
volume = {2008},
year = {2008},
url = {https://doi.org/10.1155/2008/365021},
doi = {10.1155/2008/365021},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ejasp/SinghTK08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/SinghVN08,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Hierarchical fusion of multi-spectral face images for improved recognition
performance},
journal = {Inf. Fusion},
volume = {9},
number = {2},
pages = {200--210},
year = {2008},
url = {https://doi.org/10.1016/j.inffus.2006.06.002},
doi = {10.1016/J.INFFUS.2006.06.002},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/inffus/SinghVN08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/SinghVN08,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Integrated multilevel image fusion and match score fusion of visible
and infrared face images for robust face recognition},
journal = {Pattern Recognit.},
volume = {41},
number = {3},
pages = {880--893},
year = {2008},
url = {https://doi.org/10.1016/j.patcog.2007.06.022},
doi = {10.1016/J.PATCOG.2007.06.022},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pr/SinghVN08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taco/IpekMSCSS08,
author = {Engin Ipek and
Sally A. McKee and
Karan Singh and
Rich Caruana and
Bronis R. de Supinski and
Martin Schulz},
title = {Efficient architectural design space exploration via predictive modeling},
journal = {{ACM} Trans. Archit. Code Optim.},
volume = {4},
number = {4},
pages = {1:1--1:34},
year = {2008},
url = {https://doi.org/10.1145/1328195.1328196},
doi = {10.1145/1328195.1328196},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taco/IpekMSCSS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/SinghRCMDAGWHL08,
author = {Vinit Singh and
Arup Roy and
Richard Castro and
Kelly McClure and
Rongching Dai and
Rajat Agrawal and
Robert J. Greenberg and
James D. Weiland and
Mark S. Humayun and
Gianluca Lazzi},
title = {On the Thermal Elevation of a 60-Electrode Epiretinal Prosthesis for
the Blind},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {2},
number = {4},
pages = {289--300},
year = {2008},
url = {https://doi.org/10.1109/TBCAS.2008.2003430},
doi = {10.1109/TBCAS.2008.2003430},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbcas/SinghRCMDAGWHL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/VatsaSN08,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Improving Iris Recognition Performance Using Segmentation, Quality
Enhancement, Match Score Fusion, and Indexing},
journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
volume = {38},
number = {4},
pages = {1021--1035},
year = {2008},
url = {https://doi.org/10.1109/TSMCB.2008.922059},
doi = {10.1109/TSMCB.2008.922059},
timestamp = {Mon, 18 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsmc/VatsaSN08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/VatsaSRN08,
author = {Mayank Vatsa and
Richa Singh and
Arun Ross and
Afzel Noore},
title = {Likelihood ratio in a {SVM} framework: Fusing linear and non-linear
face classifiers},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
Workshops 2008, Anchorage, AK, USA, 23-28 June, 2008},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/CVPRW.2008.4563103},
doi = {10.1109/CVPRW.2008.4563103},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/VatsaSRN08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/SinghVN08,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Multiclass mv-granular soft support vector machine: {A} case study
in dynamic classifier selection for multispectral face recognition},
booktitle = {19th International Conference on Pattern Recognition {(ICPR} 2008),
December 8-11, 2008, Tampa, Florida, {USA}},
pages = {1--4},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ICPR.2008.4761877},
doi = {10.1109/ICPR.2008.4761877},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpr/SinghVN08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/KunzMCSBEJNRSSW08,
author = {Clayton Kunz and
Chris Murphy and
Richard Camilli and
Hanumant Singh and
John Bailey and
Ryan M. Eustice and
Michael V. Jakuba and
Ko{-}ichi Nakamura and
Christopher N. Roman and
Taichi Sato and
Robert A. Sohn and
Claire Willis},
title = {Deep sea underwater robotic exploration in the ice-covered Arctic
ocean with AUVs},
booktitle = {2008 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, September 22-26, 2008, Acropolis Convention Center, Nice,
France},
pages = {3654--3660},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/IROS.2008.4651097},
doi = {10.1109/IROS.2008.4651097},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/KunzMCSBEJNRSSW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/VatsaSN08,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
editor = {Bhanu Prasad and
S. R. Mahadeva Prasanna},
title = {{SVM} Based Adaptive Biometric Image Enhancement Using Quality Assessment},
booktitle = {Speech, Audio, Image and Biomedical Signal Processing using Neural
Networks},
series = {Studies in Computational Intelligence},
volume = {83},
pages = {351--371},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-75398-8\_16},
doi = {10.1007/978-3-540-75398-8\_16},
timestamp = {Fri, 15 Dec 2023 18:26:01 +0100},
biburl = {https://dblp.org/rec/series/sci/VatsaSN08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/concurrency/SinghIMSSC07,
author = {Karan Singh and
Engin Ipek and
Sally A. McKee and
Bronis R. de Supinski and
Martin Schulz and
Rich Caruana},
title = {Predicting parallel application performance via machine learning approaches},
journal = {Concurr. Comput. Pract. Exp.},
volume = {19},
number = {17},
pages = {2219--2235},
year = {2007},
url = {https://doi.org/10.1002/cpe.1171},
doi = {10.1002/CPE.1171},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/concurrency/SinghIMSSC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieeesp/FerraioloKS07,
author = {David F. Ferraiolo and
D. Richard Kuhn and
Ravi S. Sandhu},
title = {{RBAC} Standard Rationale: Comments on "A Critique of the {ANSI} Standard
on Role-Based Access Control"},
journal = {{IEEE} Secur. Priv.},
volume = {5},
number = {6},
pages = {51--53},
year = {2007},
url = {https://doi.org/10.1109/MSP.2007.173},
doi = {10.1109/MSP.2007.173},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieeesp/FerraioloKS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijns/VatsaSN07,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Integrating Image Quality in 2nu-SVM Biometric Match Score Fusion},
journal = {Int. J. Neural Syst.},
volume = {17},
number = {5},
pages = {343--351},
year = {2007},
url = {https://doi.org/10.1142/S0129065707001196},
doi = {10.1142/S0129065707001196},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijns/VatsaSN07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/NooreSV07,
author = {Afzel Noore and
Richa Singh and
Mayank Vatsa},
title = {Robust memory-efficient data level information fusion of multi-modal
biometric images},
journal = {Inf. Fusion},
volume = {8},
number = {4},
pages = {337--346},
year = {2007},
url = {https://doi.org/10.1016/j.inffus.2005.09.005},
doi = {10.1016/J.INFFUS.2005.09.005},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/inffus/NooreSV07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HensonMSBHF07,
author = {Richard N. Henson and
J{\'{e}}r{\'{e}}mie Mattout and
Krish D. Singh and
Gareth R. Barnes and
Arjan Hillebrand and
Karl J. Friston},
title = {Population-level inferences for distributed {MEG} source localization
under multiple constraints: Application to face-evoked fields},
journal = {NeuroImage},
volume = {38},
number = {3},
pages = {422--438},
year = {2007},
url = {https://doi.org/10.1016/j.neuroimage.2007.07.026},
doi = {10.1016/J.NEUROIMAGE.2007.07.026},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/HensonMSBHF07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigpro/SinghVN07,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Improving verification accuracy by synthesis of locally enhanced biometric
images and deformable model},
journal = {Signal Process.},
volume = {87},
number = {11},
pages = {2746--2764},
year = {2007},
url = {https://doi.org/10.1016/j.sigpro.2007.05.009},
doi = {10.1016/J.SIGPRO.2007.05.009},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigpro/SinghVN07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/SinghVRN07,
author = {Richa Singh and
Mayank Vatsa and
Arun Ross and
Afzel Noore},
title = {A Mosaicing Scheme for Pose-Invariant Face Recognition},
journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
volume = {37},
number = {5},
pages = {1212--1225},
year = {2007},
url = {https://doi.org/10.1109/TSMCB.2007.903537},
doi = {10.1109/TSMCB.2007.903537},
timestamp = {Mon, 18 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsmc/SinghVRN07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aiprf/LabyedKSS07,
author = {Yassin Labyed and
Naima Kaabouch and
Richard R. Schultz and
Brij B. Singh},
editor = {Dimitris A. Karras and
Chunping Li and
Zoran Majkic and
S. R. Mahadeva Prasanna},
title = {Gel Electrophoresis Image Segmentation and Band Detection Based on
the Derivative of the Standard Deviation},
booktitle = {International Conference on Artificial Intelligence and Pattern Recognition,
AIPR-07, Orlando, Florida, USA, July 9-12, 2007},
pages = {31--35},
publisher = {{ISRST}},
year = {2007},
timestamp = {Thu, 07 Feb 2008 15:52:12 +0100},
biburl = {https://dblp.org/rec/conf/aiprf/LabyedKSS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcis/DAubeterreSIE07,
author = {Fergle D'Aubeterre and
Rahul Singh and
Lakshmi S. Iyer and
Richard Ehrhardt},
editor = {John A. Hoxmeier and
Stephen C. Hayne},
title = {Secure Integration of eBusiness Processes in the Extended-Enterprise},
booktitle = {Reaching New Heights. 13th Americas Conference on Information Systems,
{AMCIS} 2007, Keystone, Colorado, USA, August 9-12, 2007},
pages = {331},
publisher = {Association for Information Systems},
year = {2007},
url = {http://aisel.aisnet.org/amcis2007/331},
timestamp = {Thu, 26 Nov 2020 16:35:40 +0100},
biburl = {https://dblp.org/rec/conf/amcis/DAubeterreSIE07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieeevast/JanoosSIMP07,
author = {Firdaus Janoos and
Shantanu Singh and
M. Okan Irfanoglu and
Raghu Machiraju and
Richard E. Parent},
title = {Activity Analysis Using Spatio-Temporal Trajectory Volumes in Surveillance
Applications},
booktitle = {2nd {IEEE} Symposium on Visual Analytics Science and Technology, {IEEE}
{VAST} 2007, Sacramento, CA,USA, October 30 - November 1, 2007},
pages = {3--10},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/VAST.2007.4388990},
doi = {10.1109/VAST.2007.4388990},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ieeevast/JanoosSIMP07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/RaupKAHD07,
author = {Bruce H. Raup and
Siri Jodha S. Khalsa and
Richard Armstrong and
Christopher Helm and
Mark B. Dyurgerov},
title = {{GLIMS:} Progress in mapping the world's glaciers},
booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
{IGARSS} 2007, July 23-28, 2007, Barcelona, Spain, Proceedings},
pages = {3991--3993},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/IGARSS.2007.4423723},
doi = {10.1109/IGARSS.2007.4423723},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/RaupKAHD07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipsn/SinghMKSC07,
author = {Jaspreet Singh and
Upamanyu Madhow and
Rajesh Kumar and
Subhash Suri and
Richard E. Cagley},
editor = {Tarek F. Abdelzaher and
Leonidas J. Guibas and
Matt Welsh},
title = {Tracking multiple targets using binary proximity sensors},
booktitle = {Proceedings of the 6th International Conference on Information Processing
in Sensor Networks, {IPSN} 2007, Cambridge, Massachusetts, USA, April
25-27, 2007},
pages = {529--538},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1236360.1236427},
doi = {10.1145/1236360.1236427},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/ipsn/SinghMKSC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/premi/SinghVNS07,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore and
Sanjay K. Singh},
editor = {Ashish Ghosh and
Rajat K. De and
Sankar K. Pal},
title = {Age Transformation for Improving Face Recognition Performance},
booktitle = {Pattern Recognition and Machine Intelligence, Second International
Conference, PReMI 2007, Kolkata, India, December 18-22, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4815},
pages = {576--583},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-77046-6\_71},
doi = {10.1007/978-3-540-77046-6\_71},
timestamp = {Tue, 14 May 2019 10:00:41 +0200},
biburl = {https://dblp.org/rec/conf/premi/SinghVNS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/AchtnerAA06,
author = {Wolfgang Achtner and
Esma A{\"{\i}}meur and
Sarabjot Singh Anand and
Douglas E. Appelt and
Naveen Ashish and
Tiffany Barnes and
Joseph E. Beck and
M. Bernardine Dias and
Prashant Doshi and
Chris Drummond and
William Elazmeh and
Ariel Felner and
Dayne Freitag and
Hector Geffner and
Christopher W. Geib and
Richard Goodwin and
Robert C. Holte and
Frank Hutter and
Fair Isaac and
Nathalie Japkowicz and
Gal A. Kaminka and
Sven Koenig and
Michail G. Lagoudakis and
David B. Leake and
Lundy Lewis and
Hugo Liu and
Ted Metzler and
Rada Mihalcea and
Bamshad Mobasher and
Pascal Poupart and
David V. Pynadath and
Thomas Roth{-}Berghofer and
Wheeler Ruml and
Stefan Schulz and
Sven Schwarz and
Stephanie Seneff and
Amit P. Sheth and
Ron Sun and
Michael Thielscher and
Afzal Upal and
Jason D. Williams and
Steve J. Young and
Dmitry Zelenko},
title = {Reports on the Twenty-First National Conference on Artificial Intelligence
{(AAAI-06)} Workshop Program},
journal = {{AI} Mag.},
volume = {27},
number = {4},
pages = {92--102},
year = {2006},
url = {https://doi.org/10.1609/aimag.v27i4.1912},
doi = {10.1609/AIMAG.V27I4.1912},
timestamp = {Thu, 24 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aim/AchtnerAA06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/comcom/WuWD06,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
title = {{E-MACSC:} {A} novel dynamic cache tuning technique to reduce information
retrieval roundtrip time over the Internet},
journal = {Comput. Commun.},
volume = {29},
number = {8},
pages = {1094--1109},
year = {2006},
url = {https://doi.org/10.1016/j.comcom.2005.06.022},
doi = {10.1016/J.COMCOM.2005.06.022},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/comcom/WuWD06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/SinghVNS06,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore and
Sanjay K. Singh},
title = {{DS} theory based fingerprint classifier fusion with update rule to
minimize training time},
journal = {{IEICE} Electron. Express},
volume = {3},
number = {20},
pages = {429--435},
year = {2006},
url = {https://doi.org/10.1587/elex.3.429},
doi = {10.1587/ELEX.3.429},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieiceee/SinghVNS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/VatsaSNHM06,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore and
Max M. Houck and
Keith B. Morris},
title = {Robust biometric image watermarking for fingerprint and face template
protection},
journal = {{IEICE} Electron. Express},
volume = {3},
number = {2},
pages = {23--28},
year = {2006},
url = {https://doi.org/10.1587/elex.3.23},
doi = {10.1587/ELEX.3.23},
timestamp = {Thu, 18 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieiceee/VatsaSNHM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sp/PahwaJWBGFSHSBYCCBSWB06,
author = {Jaspreet Singh Pahwa and
Andrew C. Jones and
Richard J. White and
Mikhaila Burgess and
W. A. Gray and
Nick J. Fiddian and
R. O. Smith and
Alex R. Hardisty and
Tim Sutton and
Peter Brewer and
Chris Yesson and
Neil Caithness and
Alastair Culham and
Frank A. Bisby and
Malcolm Scoble and
Paul Williams and
Shonil Bhagwat},
title = {Supporting the construction of workflows for biodiversity problem-solving
accessing secure, distributed resources},
journal = {Sci. Program.},
volume = {14},
number = {3-4},
pages = {195--208},
year = {2006},
url = {https://doi.org/10.1155/2006/256398},
doi = {10.1155/2006/256398},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sp/PahwaJWBGFSHSBYCCBSWB06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tjs/WuWD06,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
title = {CACHE\({}_{\mbox{RP}}\): {A} novel dynamic cache size tuning model
working with relative object popularity for fast web information retrieval},
journal = {J. Supercomput.},
volume = {36},
number = {3},
pages = {283--296},
year = {2006},
url = {https://doi.org/10.1007/s11227-006-8298-x},
doi = {10.1007/S11227-006-8298-X},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tjs/WuWD06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/CromptonMGJWP06,
author = {Shirley Y. Crompton and
B. M. Matthews and
W. A. Gray and
Andrew C. Jones and
Richard J. White and
Jaspreet Singh Pahwa},
title = {{OGSA-DAI} and Bioinformatics Grids: Challenges, Experience and Strategies},
booktitle = {Sixth {IEEE} International Symposium on Cluster Computing and the
Grid (CCGrid 2006), 16-19 May 2006, Singapore},
pages = {193--200},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/CCGRID.2006.75},
doi = {10.1109/CCGRID.2006.75},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ccgrid/CromptonMGJWP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/PahwaBSYBXJWGFBCCSWB06,
author = {Jaspreet Singh Pahwa and
Peter Brewer and
Tim Sutton and
Chris Yesson and
Mikhaila Burgess and
Xuebiao Xu and
Andrew C. Jones and
Richard J. White and
W. A. Gray and
Nick J. Fiddian and
Frank A. Bisby and
Alastair Culham and
Neil Caithness and
Malcolm Scoble and
Paul Williams and
Shonil Bhagwat},
title = {Biodiversity World: {A} Problem-Solving Environment for Analysing
Biodiversity Patterns},
booktitle = {Sixth {IEEE} International Symposium on Cluster Computing and the
Grid (CCGrid 2006), 16-19 May 2006, Singapore},
pages = {201--208},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/CCGRID.2006.23},
doi = {10.1109/CCGRID.2006.23},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ccgrid/PahwaBSYBXJWGFBCCSWB06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dexa/PahwaBGM06,
author = {Jaspreet Singh Pahwa and
Pete Burnap and
W. A. Gray and
John C. Miles},
editor = {St{\'{e}}phane Bressan and
Josef K{\"{u}}ng and
Roland R. Wagner},
title = {{MDSSF} - {A} Federated Architecture for Product Procurement},
booktitle = {Database and Expert Systems Applications, 17th International Conference,
{DEXA} 2006, Krak{\'{o}}w, Poland, September 4-8, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4080},
pages = {812--821},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11827405\_79},
doi = {10.1007/11827405\_79},
timestamp = {Tue, 14 May 2019 10:00:46 +0200},
biburl = {https://dblp.org/rec/conf/dexa/PahwaBGM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ercimdl/SinghFUADM06,
author = {Manas Singh and
Richard Furuta and
Eduardo Urbina and
Neal Audenaert and
Jie Deng and
Carlos Monroy},
editor = {Julio Gonzalo and
Costantino Thanos and
M. Felisa Verdejo and
Rafael C. Carrasco},
title = {Expanding a Humanities Digital Library: Musical References in Cervantes'
Works},
booktitle = {Research and Advanced Technology for Digital Libraries, 10th European
Conference, {ECDL} 2006, Alicante, Spain, September 17-22, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4172},
pages = {158--169},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11863878\_14},
doi = {10.1007/11863878\_14},
timestamp = {Mon, 28 Aug 2023 21:17:44 +0200},
biburl = {https://dblp.org/rec/conf/ercimdl/SinghFUADM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/SinghTBRM06,
author = {Meghna Singh and
Richard Thompson and
Anup Basu and
Jana Rieger and
Mrinal Mandal},
title = {Image Based Temporal Registration of {MRI} Data for Medical Visualization},
booktitle = {Proceedings of the International Conference on Image Processing, {ICIP}
2006, October 8-11, Atlanta, Georgia, {USA}},
pages = {1169--1172},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/ICIP.2006.312765},
doi = {10.1109/ICIP.2006.312765},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/SinghTBRM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icis/SinghRY06,
author = {Rahul Singh and
Richard T. Redmond and
Victoria Y. Yoon},
title = {Design Artifact to Support Knowledge-Driven Predictive and Explanatory
Decision Analytics},
booktitle = {Proceedings of the International Conference on Information Systems,
{ICIS} 2006, Milwaukee, Wisconsin, USA, December 10-13, 2006},
pages = {9},
publisher = {Association for Information Systems},
year = {2006},
url = {http://aisel.aisnet.org/icis2006/9},
timestamp = {Wed, 28 Dec 2011 16:08:44 +0100},
biburl = {https://dblp.org/rec/conf/icis/SinghRY06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icvgip/SinghVNS06,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore and
Sanjay K. Singh},
editor = {Prem Kumar Kalra and
Shmuel Peleg},
title = {Dempster-Shafer Theory Based Classifier Fusion for Improved Fingerprint
Verification Performance},
booktitle = {Computer Vision, Graphics and Image Processing, 5th Indian Conference,
{ICVGIP} 2006, Madurai, India, December 13-16, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4338},
pages = {941--949},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11949619\_84},
doi = {10.1007/11949619\_84},
timestamp = {Tue, 14 May 2019 10:00:37 +0200},
biburl = {https://dblp.org/rec/conf/icvgip/SinghVNS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/islped/DeogunSSBN06,
author = {Harmander Deogun and
Robert M. Senger and
Dennis Sylvester and
Richard B. Brown and
Kevin J. Nowka},
editor = {Wolfgang Nebel and
Mircea R. Stan and
Anand Raghunathan and
J{\"{o}}rg Henkel and
Diana Marculescu},
title = {A dual-V\({}_{\mbox{DD}}\) boosted pulsed bus technique for low power
and low leakage operation},
booktitle = {Proceedings of the 2006 International Symposium on Low Power Electronics
and Design, 2006, Tegernsee, Bavaria, Germany, October 4-6, 2006},
pages = {73--78},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1165573.1165591},
doi = {10.1145/1165573.1165591},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/islped/DeogunSSBN06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mobiquitous/CoenenGJBBGHDLL06,
author = {T. J. M. Coenen and
P. T. H. Goering and
Assed Jehangir and
J. L. van den Berg and
Richard J. Boucherie and
Sonia M. Heemstra de Groot and
Geert J. Heijenk and
Santpal Singh Dhillon and
Weidong Lu and
Anthony C. C. Lo and
Piet Van Mieghem and
Ignas G. Niemegeers},
editor = {Hamid Ahmadi and
Tom La Porta},
title = {Architectural and QoS Aspects of Personal Networks},
booktitle = {3rd Annual International {ICST} Conference on Mobile and Ubiquitous
Systems: Computing, Networking and Services, {MOBIQUITOUS} 2006, San
Jose, California, USA, July 17-21, 2006},
pages = {1--3},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/MOBIQ.2006.340416},
doi = {10.1109/MOBIQ.2006.340416},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mobiquitous/CoenenGJBBGHDLL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/daglib/p/WuWD06,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
editor = {Jo{\~{a}}o Ascenso and
Luminita Vasiu and
Carlos Belo and
M{\'{o}}nica Saramago},
title = {{E-MACSC:} {A} novel dynamic cache tuning technique to maintain the
hit ratio prescribed by the user in internet applications},
booktitle = {e-Business and Telecommunication Networks},
pages = {74--81},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/1-4020-4761-4\_2},
doi = {10.1007/1-4020-4761-4\_2},
timestamp = {Tue, 16 May 2017 14:01:33 +0200},
biburl = {https://dblp.org/rec/books/daglib/p/WuWD06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ThomasRYS05,
author = {Manoj A. Thomas and
Richard T. Redmond and
Victoria Y. Yoon and
Rahul Singh},
title = {A semantic approach to monitor business process},
journal = {Commun. {ACM}},
volume = {48},
number = {12},
pages = {55--59},
year = {2005},
url = {https://doi.org/10.1145/1101779.1101809},
doi = {10.1145/1101779.1101809},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cacm/ThomasRYS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/VatsaSN05,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Improving biometric recognition accuracy and robustness using {DWT}
and {SVM} watermarking},
journal = {{IEICE} Electron. Express},
volume = {2},
number = {12},
pages = {362--367},
year = {2005},
url = {https://doi.org/10.1587/elex.2.362},
doi = {10.1587/ELEX.2.362},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieiceee/VatsaSN05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tamm/SinghS05,
author = {Manoj Prakash Singh and
Richard Stong},
title = {A Prime Summandification of n: 11045},
journal = {Am. Math. Mon.},
volume = {112},
number = {8},
pages = {750--751},
year = {2005},
url = {http://www.jstor.org/stable/30037586},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tamm/SinghS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/ShieldsBLSLASKA05,
author = {Joel Shields and
Richard Bailey and
Brent Lytle and
Jeff Schroeder and
Boris Lurie and
Ahmet Beh{\c{c}}et A{\c{c}}ikmese and
Guru Singh and
Jason Keim and
Asif Ahmed},
title = {System design, modelling, and tracking filter for bearings only analog
camera},
booktitle = {American Control Conference, {ACC} 2005, Portland, OR, USA, 8-10 June,
2005},
pages = {1981--1986},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/ACC.2005.1470260},
doi = {10.1109/ACC.2005.1470260},
timestamp = {Fri, 07 Oct 2022 18:48:01 +0200},
biburl = {https://dblp.org/rec/conf/amcc/ShieldsBLSLASKA05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/autoid/SinghVRN05,
author = {Richa Singh and
Mayank Vatsa and
Arun Ross and
Afzel Noore},
title = {Performance Enhancement of 2D Face Recognition via Mosaicing},
booktitle = {Proceedings of the Fourth {IEEE} Workshop on Automatic Identification
Advanced Technologies (AutoID 2005), 16-18 October 2005, Buffalo,
NY, {USA}},
pages = {63--68},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/AUTOID.2005.39},
doi = {10.1109/AUTOID.2005.39},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/autoid/SinghVRN05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icete/LinWWD05,
author = {Wilfred W. K. Lin and
Allan K. Y. Wong and
Richard S. L. Wu and
Tharam S. Dillon},
editor = {Joaquim Filipe and
Luminita Vasiu},
title = {A Novel real-time self-similar traffic detector/filter to improve
the reliability of a {TCP} based end-to-end client/server interaction
path for shorter roundtrip time},
booktitle = {{ICETE} 2005 - Proceedings of the Second International Conference
on e-Business and Telecommunication Networks, Reading, UK, October
3-7, 2005},
pages = {94--101},
publisher = {{INSTICC} Press},
year = {2005},
timestamp = {Tue, 07 Nov 2006 14:13:57 +0100},
biburl = {https://dblp.org/rec/conf/icete/LinWWD05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icete/LinWWD05a,
author = {Wilfred W. K. Lin and
Allan K. Y. Wong and
Richard S. L. Wu and
Tharam S. Dillon},
editor = {Joaquim Filipe and
Helder Coelhas and
M{\'{o}}nica Saramago},
title = {A Novel Real-Time Self-similar Traffic Detector/Filter to Improve
the Reliability of a {TCP} Based End-to-End Client/Server Interaction
Path for Shorter Roundtrip Time},
booktitle = {E-business and Telecommunication Networks - Second International Conference,
{ICETE} 2005, Reading, UK, October 3-7, 2005. Selected Papers},
series = {Communications in Computer and Information Science},
volume = {3},
pages = {49--61},
year = {2005},
url = {https://doi.org/10.1007/978-3-540-75993-5\_5},
doi = {10.1007/978-3-540-75993-5\_5},
timestamp = {Tue, 16 Aug 2022 23:04:29 +0200},
biburl = {https://dblp.org/rec/conf/icete/LinWWD05a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icita/WuWD05,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
title = {Using Real-Time Traffic Pattern Detection for Dynamic Cache Size Tuning
in Information Retrieval},
booktitle = {Third International Conference on Information Technology and Applications
{(ICITA} 2005), 4-7 July 2005, Sydney, Australia},
pages = {35--40},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ICITA.2005.301},
doi = {10.1109/ICITA.2005.301},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icita/WuWD05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmb/WuDW05,
author = {Richard S. L. Wu and
Tharam S. Dillon and
Allan K. Y. Wong},
title = {{RTPD/MACSC:} {A} Novel Approach for Effective Pervasive Information
Retrieval},
booktitle = {2005 International Conference on Mobile Business {(ICMB} 2005), 11-13
July 2005, Sydney, Australia},
pages = {514--520},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ICMB.2005.86},
doi = {10.1109/ICMB.2005.86},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmb/WuDW05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isqed/DeogunRSBN05,
author = {Harmander Deogun and
Rahul M. Rao and
Dennis Sylvester and
Richard B. Brown and
Kevin J. Nowka},
title = {Dynamically Pulsed {MTCMOS} with Bus Encoding for Total Power and
Crosstalk Minimization},
booktitle = {6th International Symposium on Quality of Electronic Design {(ISQED}
2005), 21-23 March 2005, San Jose, CA, {USA}},
pages = {88--93},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ISQED.2005.49},
doi = {10.1109/ISQED.2005.49},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isqed/DeogunRSBN05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/PrecupSPKS05,
author = {Doina Precup and
Richard S. Sutton and
Cosmin Paduraru and
Anna Koop and
Satinder Singh},
title = {Off-policy Learning with Options and Recognizers},
booktitle = {Advances in Neural Information Processing Systems 18 [Neural Information
Processing Systems, {NIPS} 2005, December 5-8, 2005, Vancouver, British
Columbia, Canada]},
pages = {1097--1104},
year = {2005},
url = {https://proceedings.neurips.cc/paper/2005/hash/f75526659f31040afeb61cb7133e4e6d-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/PrecupSPKS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robio/KwanLLDRRSS05,
author = {Chiman Kwan and
Xiaokun Li and
Debang Lao and
Yunbin Deng and
Zhubing Ren and
Bhiksha Raj and
Rita Singh and
Richard M. Stern},
title = {Voice driven applications in non-stationary and chaotic environment},
booktitle = {{IEEE} International Conference on Robotics and Biomimetics, {ROBIO}
2005, Shatin, {N.T.} China, 5-9 July 2005},
pages = {127--132},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/ROBIO.2005.246250},
doi = {10.1109/ROBIO.2005.246250},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/robio/KwanLLDRRSS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/idea/encyclopediaDB2005/VatsaSGK05,
author = {Mayank Vatsa and
Richa Singh and
Phalguni Gupta and
A. K. Kaushik},
editor = {Laura C. Rivero and
Jorge Horacio Doorn and
Viviana E. Ferraggine},
title = {Biometric Databases},
booktitle = {Encyclopedia of Database Technologies and Applications},
pages = {42--46},
publisher = {Idea Group},
year = {2005},
url = {https://doi.org/10.4018/978-1-59140-560-3.ch008},
doi = {10.4018/978-1-59140-560-3.CH008},
timestamp = {Mon, 16 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/idea/encyclopediaDB2005/VatsaSGK05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csse/WuWD04,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
title = {{RDCT:} {A} novel reconfigurable dynamic cache size tuner to shorten
information retrieval time over the Internet},
journal = {Comput. Syst. Sci. Eng.},
volume = {19},
number = {6},
year = {2004},
timestamp = {Tue, 20 Feb 2007 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/csse/WuWD04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpdc/FosterGG04,
author = {Ian T. Foster and
Jerry Gieraltowski and
Scott Gose and
Natalia Maltsev and
Edward N. May and
Alex A. Rodriguez and
Dinanath Sulakhe and
A. Vaniachine and
Jim Shank and
Saul Youssef and
David Adams and
Richard Baker and
Wensheng Deng and
Jason Smith and
Dantong Yu and
Iosif Legrand and
Suresh Singh and
Conrad Steenberg and
Yang Xia and
M. Anzar Afaq and
Eileen Berman and
James Annis and
L. A. T. Bauerdick and
Michael Ernst and
Ian Fisk and
Lisa Giacchetti and
Gregory E. Graham and
Anne Heavey and
Joseph Kaiser and
Nickolai Kuropatkin and
Ruth Pordes and
Vijay Sekhri and
John Weigand and
Yujun Wu and
Keith Baker and
Lawrence Sorrillo and
John Huth and
Matthew Allen and
Leigh Grundhoefer and
John Hicks and
Fred Luehring and
Steve Peck and
Robert Quick and
Stephen C. Simms and
George Fekete and
Jan vandenBerg and
Kihyeon Cho and
Kihwan Kwon and
Dongchul Son and
Hyoungwoo Park and
Shane Canon and
Keith R. Jackson and
David E. Konerding and
Jason Lee and
Doug Olson and
Iwona Sakrejda and
Brian Tierney and
Mark Green and
Russ Miller and
James Letts and
Terrence Martin and
David Bury and
Catalin Dumitrescu and
Daniel Engh and
Robert W. Gardner and
Marco Mambelli and
Yuri Smirnov and
Jens{-}S. V{\"{o}}ckler and
Michael Wilde and
Yong Zhao and
Xin Zhao and
Paul Avery and
Richard Cavanaugh and
Bockjoo Kim and
Craig Prescott and
Jorge Luis Rodriguez and
Andrew Zahn and
Shawn McKee and
Christopher T. Jordan and
James E. Prewett and
Timothy L. Thomas and
Horst Severini and
Ben Clifford and
Ewa Deelman and
Larry Flon and
Carl Kesselman and
Gaurang Mehta and
Nosa Olomu and
Karan Vahi and
Kaushik De and
Patrick McGuigan and
Mark Sosebee and
Dan Bradley and
Peter Couvares and
Alan DeSmet and
Carey Kireyev and
Erik Paulson and
Alain Roy and
Scott Koranda and
Brian Moe and
Bobby Brown and
Paul Sheldon},
title = {The Grid2003 Production Grid: Principles and Practice},
booktitle = {13th International Symposium on High-Performance Distributed Computing
{(HPDC-13} 2004), 4-6 June 2004, Honolulu, Hawaii, {USA}},
pages = {236--245},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.ieeecomputersociety.org/10.1109/HPDC.2004.36},
doi = {10.1109/HPDC.2004.36},
timestamp = {Tue, 23 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hpdc/FosterGG04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/RajSS04,
author = {Bhiksha Raj and
Rita Singh and
Richard M. Stern},
title = {On tracking noise with linear dynamical system models},
booktitle = {2004 {IEEE} International Conference on Acoustics, Speech, and Signal
Processing, {ICASSP} 2004, Montreal, Quebec, Canada, May 17-21, 2004},
pages = {965--968},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/ICASSP.2004.1326148},
doi = {10.1109/ICASSP.2004.1326148},
timestamp = {Mon, 22 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/RajSS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icba/MeenaVSG04,
author = {Bhola Ram Meena and
Mayank Vatsa and
Richa Singh and
Phalguni Gupta},
editor = {David Zhang and
Anil K. Jain},
title = {Iris Based Human Verification Algorithms},
booktitle = {Biometric Authentication, First International Conference, {ICBA} 2004,
Hong Kong, China, July 15-17, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3072},
pages = {458--466},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-25948-0\_63},
doi = {10.1007/978-3-540-25948-0\_63},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/icba/MeenaVSG04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icete/WuWD04,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
editor = {Jo{\~{a}}o Ascenso and
Carlos Belo and
Luminita Vasiu and
M{\'{o}}nica Saramago and
Helder Coelhas},
title = {{E-MACSC:} {A} Novel Dynamic Cache Tuning Technique to Maintain the
Hit Ratio Prescribed by the User in Internet Applications},
booktitle = {{ICETE} 2004, 1st International Conference on E-Business and Telecommunication
Networks, Set{\'{u}}bal, Portugal, August 24-28, 2004, Proceedings},
pages = {152--159},
publisher = {{INSTICC} Press},
year = {2004},
timestamp = {Mon, 25 Oct 2004 15:24:15 +0200},
biburl = {https://dblp.org/rec/conf/icete/WuWD04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iconip/VatsaSMN04,
author = {Mayank Vatsa and
Richa Singh and
Pabitra Mitra and
Afzel Noore},
editor = {Nikhil R. Pal and
Nikola K. Kasabov and
Rajani K. Mudi and
Srimanta Pal and
Swapan K. Parui},
title = {Signature Verification Using Static and Dynamic Features},
booktitle = {Neural Information Processing, 11th International Conference, {ICONIP}
2004, Calcutta, India, November 22-25, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3316},
pages = {350--355},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30499-9\_53},
doi = {10.1007/978-3-540-30499-9\_53},
timestamp = {Thu, 04 Jun 2020 19:07:58 +0200},
biburl = {https://dblp.org/rec/conf/iconip/VatsaSMN04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icvgip/VatsaSG04,
author = {Mayank Vatsa and
Richa Singh and
Phalguni Gupta},
editor = {Bhabatosh Chanda and
Sharat Chandran and
Larry S. Davis},
title = {Multi Biometric System for Verification with Minimum Training Data},
booktitle = {{ICVGIP} 2004, Proceedings of the Fourth Indian Conference on Computer
Vision, Graphics {\&} Image Processing, Kolkata, India, December
16-18, 2004},
pages = {569--574},
publisher = {Allied Publishers Private Limited},
year = {2004},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icvgip/VatsaSG04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip5-5/JoitaRBPGM04,
author = {Liviu Joita and
Omer F. Rana and
Pete Burnap and
Jaspreet Singh Pahwa and
W. A. Gray and
John C. Miles},
editor = {Luis M. Camarinha{-}Matos},
title = {A Grid-Enabled Security Framework for Collaborative Virtual Organisations},
booktitle = {Virtual Enterprises and Collaborative Networks, {IFIP} 18th World
Computer Congress, {TC5} / {WG5.5} - 5th Working Conference on Virtual
Enterprises, 22-27 August 2004, Toulouse, France},
series = {{IFIP}},
volume = {149},
pages = {415--422},
publisher = {Kluwer/springer},
year = {2004},
url = {https://doi.org/10.1007/1-4020-8139-1\_44},
doi = {10.1007/1-4020-8139-1\_44},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip5-5/JoitaRBPGM04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispa/WuWD04,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
editor = {Jiannong Cao and
Laurence Tianruo Yang and
Minyi Guo and
Francis Chi{-}Moon Lau},
title = {CACHE\({}_{\mbox{RP}}\): {A} Novel Dynamic Cache Size Tuning Model
Working with Relative Object Popularity for Fast Web Information Retrieval},
booktitle = {Parallel and Distributed Processing and Applications, Second InternationalSymposium,
{ISPA} 2004, Hong Kong, China, December 13-15, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3358},
pages = {410--420},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30566-8\_50},
doi = {10.1007/978-3-540-30566-8\_50},
timestamp = {Tue, 14 Apr 2020 13:23:10 +0200},
biburl = {https://dblp.org/rec/conf/ispa/WuWD04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/VatsaSG04,
author = {Mayank Vatsa and
Richa Singh and
Phalguni Gupta},
title = {Face recognition using multiple recognizers},
booktitle = {Proceedings of the {IEEE} International Conference on Systems, Man
{\&} Cybernetics: The Hague, Netherlands, 10-13 October 2004},
pages = {2186--2190},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/ICSMC.2004.1400652},
doi = {10.1109/ICSMC.2004.1400652},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/smc/VatsaSG04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/VatsaSMN04,
author = {Mayank Vatsa and
Richa Singh and
Pabitra Mitra and
Afzel Noore},
title = {Digital watermarking based secure multimodal biometric system},
booktitle = {Proceedings of the {IEEE} International Conference on Systems, Man
{\&} Cybernetics: The Hague, Netherlands, 10-13 October 2004},
pages = {2983--2987},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/ICSMC.2004.1400787},
doi = {10.1109/ICSMC.2004.1400787},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/smc/VatsaSMN04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/SinghHF03,
author = {Suresh B. Singh and
Richard D. Hull and
Eugene M. Fluder},
title = {Text Influenced Molecular Indexing {(TIMI):} {A} Literature Database
Mining Approach that Handles Text and Chemistry},
journal = {J. Chem. Inf. Comput. Sci.},
volume = {43},
number = {3},
pages = {743--752},
year = {2003},
url = {https://doi.org/10.1021/ci025587a},
doi = {10.1021/CI025587A},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/SinghHF03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003},
url = {https://doi.org/10.1145/945546.945549},
doi = {10.1145/945546.945549},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tec/FieldsendES03,
author = {Jonathan E. Fieldsend and
Richard M. Everson and
Sameer Singh},
title = {Using unconstrained elite archives for multiobjective optimization},
journal = {{IEEE} Trans. Evol. Comput.},
volume = {7},
number = {3},
pages = {305--323},
year = {2003},
url = {https://doi.org/10.1109/TEVC.2003.810733},
doi = {10.1109/TEVC.2003.810733},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tec/FieldsendES03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cs-DC-0305066,
author = {Gregory E. Graham and
M. Anzar Afaq and
Shafqat Aziz and
L. A. T. Bauerdick and
Michael Ernst and
Joseph Kaiser and
Natalia Ratnikova and
Hans Wenzel and
Yujun Wu and
Eric Aslakson and
Julian J. Bunn and
Saima Iqbal and
Iosif Legrand and
Harvey B. Newman and
Suresh Singh and
Conrad Steenberg and
James Branson and
Ian Fisk and
James Letts and
Adam Arbree and
Paul Avery and
Dimitri Bourilkov and
Richard Cavanaugh and
Jorge Rodriguez and
Suchindra Kategari and
Peter Couvares and
Alan DeSmet and
Miron Livny and
Alain Roy and
Todd Tannenbaum},
title = {The {CMS} Integration Grid Testbed},
journal = {CoRR},
volume = {cs.DC/0305066},
year = {2003},
url = {http://arxiv.org/abs/cs/0305066},
timestamp = {Tue, 12 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/cs-DC-0305066.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dss/SinghWW02,
author = {Sanjay K. Singh and
Hugh J. Watson and
Richard T. Watson},
title = {{EIS} support for the strategic management process},
journal = {Decis. Support Syst.},
volume = {33},
number = {1},
pages = {71--85},
year = {2002},
url = {https://doi.org/10.1016/S0167-9236(01)00129-4},
doi = {10.1016/S0167-9236(01)00129-4},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dss/SinghWW02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/WalkerHS02,
author = {Matthew J. Walker and
Richard D. Hull and
Suresh B. Singh},
title = {{CKB} - The Compound Knowledge Base: {A} Text Based Chemical Search
System},
journal = {J. Chem. Inf. Comput. Sci.},
volume = {42},
number = {5},
pages = {1293--1295},
year = {2002},
url = {https://doi.org/10.1021/ci0255329},
doi = {10.1021/CI0255329},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/WalkerHS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jds/SinghYR02,
author = {Rahul Singh and
Victoria Y. Yoon and
Richard T. Redmond},
title = {Integrating Data Mining and On-line Analytical Processing for Intelligent
Decision Systems},
journal = {J. Decis. Syst.},
volume = {11},
number = {2},
pages = {185--204},
year = {2002},
url = {https://doi.org/10.3166/jds.11.185-204},
doi = {10.3166/JDS.11.185-204},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jds/SinghYR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/SinghRS02,
author = {Rita Singh and
Bhiksha Raj and
Richard M. Stern},
title = {Automatic generation of subword units for speech recognition systems},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {10},
number = {2},
pages = {89--99},
year = {2002},
url = {https://doi.org/10.1109/89.985546},
doi = {10.1109/89.985546},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taslp/SinghRS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ISCAicis/SinghVSC02,
author = {Sanjay K. Singh and
Mayank Vatsa and
Richa Singh and
D. S. Chauhan},
editor = {Adel Said Elmaghraby and
Robert Dees},
title = {A Comparison of Face Recognition Algorithms (Feature Based, Eigen
Based, Neural Network Based Approaches)},
booktitle = {Proceedings of the 11th Conference on Intelligent Systems: Emerging
Technologies, July 18-20, 2002, Boston, Massachusetts, {USA}},
pages = {227},
publisher = {{ISCA}},
year = {2002},
timestamp = {Mon, 09 Aug 2021 16:17:38 +0200},
biburl = {https://dblp.org/rec/conf/ISCAicis/SinghVSC02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cluster/AlmasiAB02,
author = {George S. Alm{\'{a}}si and
Daniel K. Beece and
Ralph Bellofatto and
Gyan Bhanot and
Randy Bickford and
Matthias A. Blumrich and
Arthur A. Bright and
Jos{\'{e}} R. Brunheroto and
Calin Cascaval and
Jos{\'{e}} G. Casta{\~{n}}os and
Luis Ceze and
Paul Coteus and
Siddhartha Chatterjee and
Dong Chen and
George L.{-}T. Chiu and
Thomas M. Cipolla and
Paul Crumley and
Alina Deutsch and
Marc Boris Dombrowa and
Wilm E. Donath and
Maria Eleftheriou and
Blake G. Fitch and
Joseph Gagliano and
Alan Gara and
Robert S. Germain and
Mark Giampapa and
Manish Gupta and
Fred G. Gustavson and
Shawn Hall and
Ruud A. Haring and
David F. Heidel and
Philip Heidelberger and
Lorraine Herger and
Dirk Hoenicke and
T. Jamal{-}Eddine and
Gerard V. Kopcsay and
Alphonso P. Lanzetta and
Derek Lieber and
M. Lu and
Mark P. Mendell and
Lawrence S. Mok and
Jos{\'{e}} E. Moreira and
Ben J. Nathanson and
Matthew Newton and
Martin Ohmacht and
Rick A. Rand and
Richard D. Regan and
Ramendra K. Sahoo and
Alda Sanomiya and
Eugen Schenfeld and
Sarabjeet Singh and
Peilin Song and
Burkhard D. Steinmacher{-}Burow and
Karin Strauss and
Richard A. Swetz and
Todd Takken and
R. Brett Tremaine and
Mickey Tsao and
Pavlos Vranas and
T. J. Christopher Ward and
Michael E. Wazlowski and
J. Brown and
Thomas A. Liebsch and
A. Schram and
G. Ulsh},
title = {Blue Gene/L, a System-On-A-Chip},
booktitle = {2002 {IEEE} International Conference on Cluster Computing {(CLUSTER}
2002), 23-26 September 2002, Chicago, IL, {USA}},
pages = {349},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/CLUSTR.2002.1137766},
doi = {10.1109/CLUSTR.2002.1137766},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cluster/AlmasiAB02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/LiuSRC02,
author = {Hongzhou Liu and
Amith Singhee and
Rob A. Rutenbar and
L. Richard Carley},
title = {Remembrance of circuits past: macromodeling by data mining in large
analog design spaces},
booktitle = {Proceedings of the 39th Design Automation Conference, {DAC} 2002,
New Orleans, LA, USA, June 10-14, 2002},
pages = {437--442},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/513918.514030},
doi = {10.1145/513918.514030},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dac/LiuSRC02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/LiSS02,
author = {Xiang Li and
Rita Singh and
Richard M. Stern},
editor = {John H. L. Hansen and
Bryan L. Pellom},
title = {Combining search spaces of heterogeneous recognizers for improved
speech recogniton},
booktitle = {7th International Conference on Spoken Language Processing, {ICSLP2002}
- {INTERSPEECH} 2002, Denver, Colorado, USA, September 16-20, 2002},
pages = {405--408},
publisher = {{ISCA}},
year = {2002},
url = {https://doi.org/10.21437/ICSLP.2002-166},
doi = {10.21437/ICSLP.2002-166},
timestamp = {Thu, 22 Jun 2023 16:42:18 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/LiSS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jcis/SinghVSL02,
author = {Sanjay K. Singh and
Mayank Vatsa and
Richa Singh and
R. B. Lokesh},
editor = {H. John Caulfield and
Shu{-}Heng Chen and
Heng{-}Da Cheng and
Richard J. Duro and
Vasant G. Honavar and
Etienne E. Kerre and
Mi Lu and
Manuel Gra{\~{n}}a Romay and
Timothy K. Shih and
Dan Ventura and
Paul P. Wang and
Yuanyuan Yang},
title = {Image Database for Automatic Face Recognition},
booktitle = {Proceedings of the 6th Joint Conference on Information Science, March
8-13, 2002, Research Triangle Park, North Carolina, {USA}},
pages = {704--707},
publisher = {{JCIS} / Association for Intelligent Machinery, Inc.},
year = {2002},
timestamp = {Tue, 25 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/jcis/SinghVSL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lcn/AllardGSR02,
author = {J{\'{e}}r{\'{e}}mie Allard and
Paul Gonin and
Minoo Singh and
Golden G. Richard III},
title = {A User Level Framework for Ad Hoc Routing},
booktitle = {27th Annual {IEEE} Conference on Local Computer Networks {(LCN} 2002),
6-8 November 2002, Tampa, FL, USA, Proceedings},
pages = {13--19},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/LCN.2002.1181758},
doi = {10.1109/LCN.2002.1181758},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/lcn/AllardGSR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pdpta/WuWD02,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
editor = {Hamid R. Arabnia},
title = {Comparing Four Novel Scalable Split/Aggregate Algorithms (Mobile Agent
Based) for Distributes Mining of Multimedia Association Rules over
the Internet},
booktitle = {Proceedings of the International Conference on Parallel and Distributed
Processing Techniques and Applications, {PDPTA} '02, June 24 - 27,
2002, Las Vegas, Nevada, USA, Volume 2},
pages = {760--766},
publisher = {{CSREA} Press},
year = {2002},
timestamp = {Thu, 26 Aug 2004 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pdpta/WuWD02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/AdigaAA02,
author = {Narasimha R. Adiga and
George Alm{\'{a}}si and
George S. Alm{\'{a}}si and
Yariv Aridor and
Rajkishore Barik and
Daniel K. Beece and
Ralph Bellofatto and
Gyan Bhanot and
Randy Bickford and
Matthias A. Blumrich and
Arthur A. Bright and
Jos{\'{e}} R. Brunheroto and
Calin Cascaval and
Jos{\'{e}} G. Casta{\~{n}}os and
Waiman Chan and
Luis Ceze and
Paul Coteus and
Siddhartha Chatterjee and
Dong Chen and
George L.{-}T. Chiu and
Thomas M. Cipolla and
Paul Crumley and
K. M. Desai and
Alina Deutsch and
Tamar Domany and
Marc Boris Dombrowa and
Wilm E. Donath and
Maria Eleftheriou and
C. Christopher Erway and
J. Esch and
Blake G. Fitch and
Joseph Gagliano and
Alan Gara and
Rahul Garg and
Robert S. Germain and
Mark Giampapa and
Balaji Gopalsamy and
John A. Gunnels and
Manish Gupta and
Fred G. Gustavson and
Shawn Hall and
Ruud A. Haring and
David F. Heidel and
Philip Heidelberger and
Lorraine Herger and
Dirk Hoenicke and
R. D. Jackson and
T. Jamal{-}Eddine and
Gerard V. Kopcsay and
Elie Krevat and
Manish P. Kurhekar and
Alphonso P. Lanzetta and
Derek Lieber and
L. K. Liu and
M. Lu and
Mark P. Mendell and
A. Misra and
Yosef Moatti and
Lawrence S. Mok and
Jos{\'{e}} E. Moreira and
Ben J. Nathanson and
Matthew Newton and
Martin Ohmacht and
Adam J. Oliner and
Vinayaka Pandit and
R. B. Pudota and
Rick A. Rand and
Richard D. Regan and
Bradley Rubin and
Albert E. Ruehli and
Silvius Vasile Rus and
Ramendra K. Sahoo and
Alda Sanomiya and
Eugen Schenfeld and
M. Sharma and
Edi Shmueli and
Sarabjeet Singh and
Peilin Song and
Vijay Srinivasan and
Burkhard D. Steinmacher{-}Burow and
Karin Strauss and
Christopher W. Surovic and
Richard A. Swetz and
Todd Takken and
R. Brett Tremaine and
Mickey Tsao and
Arun R. Umamaheshwaran and
P. Verma and
Pavlos Vranas and
T. J. Christopher Ward and
Michael E. Wazlowski and
W. Barrett and
C. Engel and
B. Drehmel and
B. Hilgart and
D. Hill and
F. Kasemkhani and
David J. Krolak and
Chun{-}Tao Li and
Thomas A. Liebsch and
James A. Marcella and
A. Muff and
A. Okomo and
M. Rouse and
A. Schram and
M. Tubbs and
G. Ulsh and
Charles D. Wait and
J. Wittrup and
Myung Bae and
Kenneth A. Dockser and
Lynn Kissel and
Mark K. Seager and
Jeffrey S. Vetter and
K. Yates},
editor = {Roscoe C. Giles and
Daniel A. Reed and
Kathryn Kelley},
title = {An overview of the BlueGene/L Supercomputer},
booktitle = {Proceedings of the 2002 {ACM/IEEE} conference on Supercomputing, Baltimore,
Maryland, USA, November 16-22, 2002, {CD-ROM}},
pages = {7:1--7:22},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/SC.2002.10017},
doi = {10.1109/SC.2002.10017},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/AdigaAA02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/SinghVSC02,
author = {Sanjay K. Singh and
Mayank Vatsa and
Richa Singh and
D. S. Chauhan},
title = {A comparison of face recognition algorithms neural network based {\&}
line based approaches},
booktitle = {{IEEE} International Conference on Systems, Man and Cybernetics: Bridging
the Digital Divide, Yasmine Hammamet, Tunisia, October 6-9, 2002 -
Volume 1},
pages = {6},
publisher = {{IEEE}},
year = {2002},
url = {https://doi.org/10.1109/ICSMC.2002.1175614},
doi = {10.1109/ICSMC.2002.1175614},
timestamp = {Mon, 09 Aug 2021 14:54:04 +0200},
biburl = {https://dblp.org/rec/conf/smc/SinghVSC02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/arobots/SinghVLP01,
author = {Rahul Singh and
Richard M. Voyles and
David Littau and
Nikolaos Papanikolopoulos},
title = {Shape Morphing-Based Control of Robotic Visual Servoing},
journal = {Auton. Robots},
volume = {10},
number = {3},
pages = {317--338},
year = {2001},
url = {https://doi.org/10.1023/A:1011239927178},
doi = {10.1023/A:1011239927178},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/arobots/SinghVLP01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cera/RiedelPB01,
author = {Johann c. k. h. Riedel and
Kulwant Singh Pawar and
Richard J. Barson},
title = {Academic and Industrial User Needs for a Concurrent Engineering Computer
Simulation Game},
journal = {Concurr. Eng. Res. Appl.},
volume = {9},
number = {3},
pages = {223--237},
year = {2001},
url = {https://doi.org/10.1177/1063293X0100900304},
doi = {10.1177/1063293X0100900304},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cera/RiedelPB01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmsj/AllenAA01,
author = {Frances E. Allen and
George S. Alm{\'{a}}si and
Wanda Andreoni and
Daniel K. Beece and
Bruce J. Berne and
Arthur A. Bright and
Jos{\'{e}} R. Brunheroto and
Calin Cascaval and
Jos{\'{e}} G. Casta{\~{n}}os and
Paul Coteus and
Paul Crumley and
Alessandro Curioni and
Monty Denneau and
Wilm E. Donath and
Maria Eleftheriou and
Blake G. Fitch and
Bruce M. Fleischer and
Christos J. Georgiou and
Robert S. Germain and
Mark Giampapa and
Donna L. Gresh and
Manish Gupta and
Ruud A. Haring and
C. T. Howard Ho and
Peter H. Hochschild and
Susan Flynn Hummel and
Tiziana Jonas and
Derek Lieber and
Glenn J. Martyna and
Kiran K. Maturu and
Jos{\'{e}} E. Moreira and
Dennis M. Newns and
Matthew Newton and
Robert Philhower and
Thomas Picunko and
Jed W. Pitera and
Michael Pitman and
Rick A. Rand and
Ajay K. Royyuru and
Valentina Salapura and
Alda Sanomiya and
Rahul S. Shah and
Yuk Yin Sham and
Sarabjeet Singh and
Marc Snir and
Frank Suits and
Richard A. Swetz and
William C. Swope and
Nagesh K. Vishnumurthy and
T. J. Christopher Ward and
Henry S. Warren Jr. and
Ruhong Zhou},
title = {Blue Gene: {A} vision for protein science using a petaflop supercomputer},
journal = {{IBM} Syst. J.},
volume = {40},
number = {2},
pages = {310--327},
year = {2001},
url = {https://doi.org/10.1147/sj.402.0310},
doi = {10.1147/SJ.402.0310},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ibmsj/AllenAA01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iepol/Joseph01,
author = {Richard Joseph},
title = {{J.P.} Singh, Leapfrogging Development?: The Political Economy of
Telecommunications Restructuring, State University of New York Press,
Albany, New York, USA, 1999, {ISBN} 0-7914-4294-2, xxiv+300 pp},
journal = {Inf. Econ. Policy},
volume = {13},
number = {1},
pages = {113--116},
year = {2001},
url = {https://doi.org/10.1016/S0167-6245(00)00032-9},
doi = {10.1016/S0167-6245(00)00032-9},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iepol/Joseph01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tissec/FerraioloSGKC01,
author = {David F. Ferraiolo and
Ravi S. Sandhu and
Serban I. Gavrila and
D. Richard Kuhn and
Ramaswamy Chandramouli},
title = {Proposed {NIST} standard for role-based access control},
journal = {{ACM} Trans. Inf. Syst. Secur.},
volume = {4},
number = {3},
pages = {224--274},
year = {2001},
url = {https://doi.org/10.1145/501978.501980},
doi = {10.1145/501978.501980},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tissec/FerraioloSGKC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/vc/SinghP01,
author = {Karan Singh and
Richard E. Parent},
title = {Joining polyhedral objects using implicitly defined surfaces},
journal = {Vis. Comput.},
volume = {17},
number = {7},
pages = {415--428},
year = {2001},
url = {https://doi.org/10.1007/s003710100115416},
doi = {10.1007/S003710100115416},
timestamp = {Thu, 04 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/vc/SinghP01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/SinghSRS01,
author = {Rita Singh and
Michael L. Seltzer and
Bhiksha Raj and
Richard M. Stern},
title = {Speech in Noisy Environments: robust automatic segmentation, feature
extraction, and hypothesis combination},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} 2001, 7-11 May, 2001, Salt Palace Convention Center, Salt
Lake City, Utah, USA, Proceedings},
pages = {273--276},
publisher = {{IEEE}},
year = {2001},
url = {https://doi.org/10.1109/ICASSP.2001.940820},
doi = {10.1109/ICASSP.2001.940820},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/SinghSRS01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/im/BronsteinDDFKMSC01,
author = {Alexandre Bronstein and
Joydip Das and
Marsha Duro and
Rich Friedrich and
Gary Kleyner and
Martin Mueller and
Sharad Singhal and
Ira Cohen},
editor = {George Pavlou and
Nikos Anerousis and
Antonio Liotta},
title = {Self-Aware Services: Using Bayesian Networks for Detecting Anomalies
in Internet-Based Services},
booktitle = {2001 {IEEE/IFIP} International Symposium on Integrated Network Management,
{IM} 2001, Seattle, USA, May 14-18, 2001. Proceedings},
pages = {623--638},
publisher = {{IEEE}},
year = {2001},
url = {https://doi.org/10.1109/INM.2001.918070},
doi = {10.1109/INM.2001.918070},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/im/BronsteinDDFKMSC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LittmanSS01,
author = {Michael L. Littman and
Richard S. Sutton and
Satinder Singh},
editor = {Thomas G. Dietterich and
Suzanna Becker and
Zoubin Ghahramani},
title = {Predictive Representations of State},
booktitle = {Advances in Neural Information Processing Systems 14 [Neural Information
Processing Systems: Natural and Synthetic, {NIPS} 2001, December 3-8,
2001, Vancouver, British Columbia, Canada]},
pages = {1555--1561},
publisher = {{MIT} Press},
year = {2001},
url = {https://proceedings.neurips.cc/paper/2001/hash/1e4d36177d71bbb3558e43af9577d70e-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/LittmanSS01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sacmat/SandhuBJKL01,
author = {Ravi S. Sandhu and
Elisa Bertino and
Trent Jaeger and
D. Richard Kuhn and
Carl E. Landwehr},
editor = {Ravi S. Sandhu and
Trent Jaeger},
title = {Panel: The next generation of acess control models (panel session):
do we need them and what should they be?},
booktitle = {6th {ACM} Symposium on Access Control Models and Technologies, {SACMAT}
2001, Litton-TASC, Chantilly, Virginia, USA, May 3-4, 2001},
pages = {53},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/373256.373262},
doi = {10.1145/373256.373262},
timestamp = {Tue, 09 Feb 2021 08:50:30 +0100},
biburl = {https://dblp.org/rec/conf/sacmat/SandhuBJKL01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/HaqueBBP00,
author = {Badr U. Haque and
Roxana Belecheanu and
Richard J. Barson and
Kulwant Singh Pawar},
title = {Towards the application of case based reasoning to decision-making
in concurrent product development (concurrent engineering)},
journal = {Knowl. Based Syst.},
volume = {13},
number = {2-3},
pages = {101--112},
year = {2000},
url = {https://doi.org/10.1016/S0950-7051(00)00051-4},
doi = {10.1016/S0950-7051(00)00051-4},
timestamp = {Tue, 25 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/kbs/HaqueBBP00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/McPartlandLHSMK00,
author = {Richard J. McPartland and
D. J. Loeper and
Frank P. Higgins and
Raj Singh and
G. MacDonald and
Goh Komoriya and
S. Aymeloglu and
M. V. DePaolis and
C. W. Leung},
title = {{SRAM} embedded memory with low cost, flash EEPROM-switch-controlled
redundancy},
booktitle = {Proceedings of the {IEEE} 2000 Custom Integrated Circuits Conference,
{CICC} 2000, Orlando, FL, USA, May 21-24, 2000},
pages = {287--289},
publisher = {{IEEE}},
year = {2000},
url = {https://doi.org/10.1109/CICC.2000.852668},
doi = {10.1109/CICC.2000.852668},
timestamp = {Mon, 10 Oct 2022 09:13:21 +0200},
biburl = {https://dblp.org/rec/conf/cicc/McPartlandLHSMK00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/SinghRS00,
author = {Rita Singh and
Bhiksha Raj and
Richard M. Stern},
title = {Automatic generation of phone sets and lexical transcriptions},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing.
{ICASSP} 2000, 5-9 June, 2000, Hilton Hotel and Convention Center,
Istanbul, Turkey},
pages = {1691--1694},
publisher = {{IEEE}},
year = {2000},
url = {https://doi.org/10.1109/ICASSP.2000.862076},
doi = {10.1109/ICASSP.2000.862076},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/SinghRS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/PrecupSS00,
author = {Doina Precup and
Richard S. Sutton and
Satinder Singh},
editor = {Pat Langley},
title = {Eligibility Traces for Off-Policy Policy Evaluation},
booktitle = {Proceedings of the Seventeenth International Conference on Machine
Learning {(ICML} 2000), Stanford University, Stanford, CA, USA, June
29 - July 2, 2000},
pages = {759--766},
publisher = {Morgan Kaufmann},
year = {2000},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/PrecupSS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/NedelSS00,
author = {Jon P. Nedel and
Rita Singh and
Richard M. Stern},
title = {Phone transition acoustic modeling: application to speaker independent
and spontaneous speech systems},
booktitle = {Sixth International Conference on Spoken Language Processing, {ICSLP}
2000 / {INTERSPEECH} 2000, Beijing, China, October 16-20, 2000},
pages = {572--575},
publisher = {{ISCA}},
year = {2000},
url = {https://doi.org/10.21437/ICSLP.2000-876},
doi = {10.21437/ICSLP.2000-876},
timestamp = {Thu, 22 Jun 2023 16:42:19 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/NedelSS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/NedelSS00a,
author = {Jon P. Nedel and
Rita Singh and
Richard M. Stern},
title = {Automatic subword unit refinement for spontaneous speech recognition
via phone splitting},
booktitle = {Sixth International Conference on Spoken Language Processing, {ICSLP}
2000 / {INTERSPEECH} 2000, Beijing, China, October 16-20, 2000},
pages = {588--591},
publisher = {{ISCA}},
year = {2000},
url = {https://doi.org/10.21437/ICSLP.2000-880},
doi = {10.21437/ICSLP.2000-880},
timestamp = {Thu, 22 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/NedelSS00a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/SinghRS00,
author = {Rita Singh and
Bhiksha Raj and
Richard M. Stern},
title = {Structured redefinition of sound units by merging and splitting for
improved speech recognition},
booktitle = {Sixth International Conference on Spoken Language Processing, {ICSLP}
2000 / {INTERSPEECH} 2000, Beijing, China, October 16-20, 2000},
pages = {151--154},
publisher = {{ISCA}},
year = {2000},
url = {https://doi.org/10.21437/ICSLP.2000-500},
doi = {10.21437/ICSLP.2000-500},
timestamp = {Thu, 22 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/SinghRS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rbac/SandhuFK00,
author = {Ravi S. Sandhu and
David F. Ferraiolo and
D. Richard Kuhn},
editor = {Klaus Rebensburg and
Charles E. Youman and
Vijay Atluri},
title = {The {NIST} model for role-based access control: towards a unified
standard},
booktitle = {Fifth {ACM} Workshop on Role-Based Access Control, {RBAC} 2000, Berlin,
Germany, July 26-27, 2000},
pages = {47--63},
publisher = {{ACM}},
year = {2000},
url = {https://doi.org/10.1145/344287.344301},
doi = {10.1145/344287.344301},
timestamp = {Tue, 06 Nov 2018 16:59:23 +0100},
biburl = {https://dblp.org/rec/conf/rbac/SandhuFK00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robocup/StoneSS00,
author = {Peter Stone and
Richard S. Sutton and
Satinder Singh},
editor = {Peter Stone and
Tucker R. Balch and
Gerhard K. Kraetzschmar},
title = {Reinforcement Learning for 3 vs. 2 Keepaway},
booktitle = {RoboCup 2000: Robot Soccer World Cup {IV}},
series = {Lecture Notes in Computer Science},
volume = {2019},
pages = {249--258},
publisher = {Springer},
year = {2000},
url = {https://doi.org/10.1007/3-540-45324-5\_23},
doi = {10.1007/3-540-45324-5\_23},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/robocup/StoneSS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ai/SuttonPS99,
author = {Richard S. Sutton and
Doina Precup and
Satinder Singh},
title = {Between MDPs and Semi-MDPs: {A} Framework for Temporal Abstraction
in Reinforcement Learning},
journal = {Artif. Intell.},
volume = {112},
number = {1-2},
pages = {181--211},
year = {1999},
url = {https://doi.org/10.1016/S0004-3702(99)00052-1},
doi = {10.1016/S0004-3702(99)00052-1},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ai/SuttonPS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/SinghRS99,
author = {Rita Singh and
Bhiksha Raj and
Richard M. Stern},
title = {Automatic clustering and generation of contextual questions for tied
states in hidden Markov models},
booktitle = {Proceedings of the 1999 {IEEE} International Conference on Acoustics,
Speech, and Signal Processing, {ICASSP} '99, Phoenix, Arizona, USA,
March 15-19, 1999},
pages = {117--120},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/ICASSP.1999.758076},
doi = {10.1109/ICASSP.1999.758076},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icassp/SinghRS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/SinghRS99,
author = {Rita Singh and
Bhiksha Raj and
Richard M. Stern},
title = {Domain adduced state tying for cross-domain acoustic modelling},
booktitle = {Sixth European Conference on Speech Communication and Technology,
{EUROSPEECH} 1999, Budapest, Hungary, September 5-9, 1999},
pages = {1707--1710},
publisher = {{ISCA}},
year = {1999},
url = {https://doi.org/10.21437/Eurospeech.1999-352},
doi = {10.21437/EUROSPEECH.1999-352},
timestamp = {Wed, 18 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/SinghRS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/SuttonMSM99,
author = {Richard S. Sutton and
David A. McAllester and
Satinder Singh and
Yishay Mansour},
editor = {Sara A. Solla and
Todd K. Leen and
Klaus{-}Robert M{\"{u}}ller},
title = {Policy Gradient Methods for Reinforcement Learning with Function Approximation},
booktitle = {Advances in Neural Information Processing Systems 12, {[NIPS} Conference,
Denver, Colorado, USA, November 29 - December 4, 1999]},
pages = {1057--1063},
publisher = {The {MIT} Press},
year = {1999},
url = {http://papers.nips.cc/paper/1713-policy-gradient-methods-for-reinforcement-learning-with-function-approximation},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/SuttonMSM99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecml/PrecupSS98,
author = {Doina Precup and
Richard S. Sutton and
Satinder Singh},
editor = {Claire Nedellec and
C{\'{e}}line Rouveirol},
title = {Theoretical Results on Reinforcement Learning with Temporally Abstract
Options},
booktitle = {Machine Learning: ECML-98, 10th European Conference on Machine Learning,
Chemnitz, Germany, April 21-23, 1998, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1398},
pages = {382--393},
publisher = {Springer},
year = {1998},
url = {https://doi.org/10.1007/BFb0026709},
doi = {10.1007/BFB0026709},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ecml/PrecupSS98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/SuttonPS98,
author = {Richard S. Sutton and
Doina Precup and
Satinder Singh},
editor = {Jude W. Shavlik},
title = {Intra-Option Learning about Temporally Abstract Actions},
booktitle = {Proceedings of the Fifteenth International Conference on Machine Learning
{(ICML} 1998), Madison, Wisconsin, USA, July 24-27, 1998},
pages = {556--564},
publisher = {Morgan Kaufmann},
year = {1998},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/SuttonPS98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/RajSS98,
author = {Bhiksha Raj and
Rita Singh and
Richard M. Stern},
title = {Inference of missing spectrographic features for robust speech recognition},
booktitle = {The 5th International Conference on Spoken Language Processing, Incorporating
The 7th Australian International Speech Science and Technology Conference,
Sydney Convention Centre, Sydney, Australia, 30th November - 4th December
1998},
publisher = {{ISCA}},
year = {1998},
url = {https://doi.org/10.21437/ICSLP.1998-336},
doi = {10.21437/ICSLP.1998-336},
timestamp = {Thu, 22 Jun 2023 16:42:19 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/RajSS98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/SinghVLP98,
author = {Rahul Singh and
Richard M. Voyles and
David Littau and
Nikolaos P. Papanikolopoulos},
title = {Pose alignment of an eye-in-hand system using image morphing},
booktitle = {Proceedings 1998 {IEEE/RSJ} International Conference on Intelligent
Robots and Systems. Innovations in Theory, Practice and Applications,
October 13-17, 1998, Victoria, BC, Canada},
pages = {698--704},
publisher = {{IEEE}},
year = {1998},
url = {https://doi.org/10.1109/IROS.1998.727272},
doi = {10.1109/IROS.1998.727272},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iros/SinghVLP98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/SuttonSPR98,
author = {Richard S. Sutton and
Satinder Singh and
Doina Precup and
Balaraman Ravindran},
editor = {Michael J. Kearns and
Sara A. Solla and
David A. Cohn},
title = {Improved Switching among Temporally Abstract Actions},
booktitle = {Advances in Neural Information Processing Systems 11, {[NIPS} Conference,
Denver, Colorado, USA, November 30 - December 5, 1998]},
pages = {1066--1072},
publisher = {The {MIT} Press},
year = {1998},
url = {http://papers.nips.cc/paper/1607-improved-switching-among-temporally-abstract-actions},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/SuttonSPR98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/comcom/JirachiefpattanaCDL97,
author = {Ajin Jirachiefpattana and
Phil County and
Tharam S. Dillon and
Richard Lai},
title = {Performance evaluation of {PC} routers using a single-server multi-queue
system with a reflection technique},
journal = {Comput. Commun.},
volume = {20},
number = {1},
pages = {1--10},
year = {1997},
url = {https://doi.org/10.1016/S0140-3664(97)83569-4},
doi = {10.1016/S0140-3664(97)83569-4},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/comcom/JirachiefpattanaCDL97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieeecc/RichardS97,
author = {Golden G. Richard III and
Mukesh Singhal},
title = {Using vector time to handle multiple failures in distributed systems},
journal = {{IEEE} Concurrency},
volume = {5},
number = {2},
pages = {50--59},
year = {1997},
url = {https://doi.org/10.1109/4434.588294},
doi = {10.1109/4434.588294},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieeecc/RichardS97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpdc/SinghalNRNF97,
author = {Sandeep K. Singhal and
Binh Q. Nguyen and
Richard Redpath and
Jimmy Nguyen and
Michael Fraenkel},
title = {InVerse: Designing an Interactive Universe Architecture for Scalability
and Extensibility},
booktitle = {Proceedings of the 6th International Symposium on High Performance
Distributed Computing, {HPDC} '97, Portland, OR, USA, August 5-8,
1997},
pages = {61--70},
publisher = {{IEEE} Computer Society},
year = {1997},
url = {https://doi.org/10.1109/HPDC.1997.622363},
doi = {10.1109/HPDC.1997.622363},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpdc/SinghalNRNF97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/SinghalNFRN97,
author = {Sandeep K. Singhal and
Binh Q. Nguyen and
Michael Fraenkel and
Richard Redpath and
Jimmy Nguyen},
editor = {Jim Haungs},
title = {Building high-performance applications and services in Java: an experiential
study},
booktitle = {Addendum to the 1997 {ACM} {SIGPLAN} Conference on Object-Oriented
Programming, Systems, Languages, and Applications, {OOPSLA} Addendum
1997, Atlanta, Georgia, USA, October 5-9, 1997},
pages = {16--20},
publisher = {{ACM}},
year = {1997},
url = {https://doi.org/10.1145/274567.274571},
doi = {10.1145/274567.274571},
timestamp = {Wed, 25 May 2022 14:51:23 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/SinghalNFRN97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/prs/RichardS97,
author = {Jim Richard and
Jaswinder Pal Singh},
editor = {James S. Painter and
Gordon Stoll and
Kwa{-}Liu Ma},
title = {Parallel hierarchical computation of specular radiosity},
booktitle = {Proceedings of the {IEEE} Symposium on Parallel Rendering, {PRS} 1997,
Phoenix, Arizona, USA, October 20-21, 1997},
pages = {59--69},
publisher = {{ACM}},
year = {1997},
url = {https://doi.org/10.1145/266638.266653},
doi = {10.1145/266638.266653},
timestamp = {Tue, 24 May 2022 15:19:03 +0200},
biburl = {https://dblp.org/rec/conf/prs/RichardS97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcs/AmmannLS96,
author = {Paul Ammann and
Richard J. Lipton and
Ravi S. Sandhu},
title = {The Expressive Power of Multi-parent Creation in Monotonic Access
Control Models},
journal = {J. Comput. Secur.},
volume = {4},
number = {2/3},
pages = {149--166},
year = {1996},
url = {https://doi.org/10.3233/JCS-1996-42-303},
doi = {10.3233/JCS-1996-42-303},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcs/AmmannLS96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HughesMRBRBS96,
author = {John B. Hughes and
Kenneth W. Moulding and
Judith Richardson and
John Bennett and
William Redman{-}White and
Mark Bracey and
Randeep Singh Soin},
title = {Automated design of switched-current filters},
journal = {{IEEE} J. Solid State Circuits},
volume = {31},
number = {7},
pages = {898--907},
year = {1996},
url = {https://doi.org/10.1109/4.508201},
doi = {10.1109/4.508201},
timestamp = {Mon, 18 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HughesMRBRBS96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ml/SinghS96,
author = {Satinder P. Singh and
Richard S. Sutton},
title = {Reinforcement Learning with Replacing Eligibility Traces},
journal = {Mach. Learn.},
volume = {22},
number = {1-3},
pages = {123--158},
year = {1996},
url = {https://doi.org/10.1023/A:1018012322525},
doi = {10.1023/A:1018012322525},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ml/SinghS96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dss/WatsonWSH95,
author = {Hugh J. Watson and
Richard T. Watson and
Sanjay K. Singh and
David Holmes},
title = {Development practices for executive information systems: findings
of a field study},
journal = {Decis. Support Syst.},
volume = {14},
number = {2},
pages = {171--184},
year = {1995},
url = {https://doi.org/10.1016/0167-9236(94)00010-P},
doi = {10.1016/0167-9236(94)00010-P},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dss/WatsonWSH95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/SinghalPRB95,
author = {Vigyan Singhal and
Carl Pixley and
Richard L. Rudell and
Robert K. Brayton},
editor = {Bryan Preas},
title = {The Validity of Retiming Sequential Circuits},
booktitle = {Proceedings of the 32st Conference on Design Automation, San Francisco,
California, USA, Moscone Center, June 12-16, 1995},
pages = {316--321},
publisher = {{ACM} Press},
year = {1995},
url = {https://doi.org/10.1145/217474.217548},
doi = {10.1145/217474.217548},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dac/SinghalPRB95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vr/SinghOP95,
author = {Karansher Singh and
Jun Ohya and
Richard E. Parent},
title = {Human figure synthesis and animation for virtual space teleconferencing},
booktitle = {1995 Virtual Reality Annual International Symposium, {VRAIS} '95,
Research Triangle Park, North Carolina, USA, March 11-15, 1995},
pages = {118--126},
publisher = {{IEEE} Computer Society},
year = {1995},
url = {https://doi.org/10.1109/VRAIS.1995.512487},
doi = {10.1109/VRAIS.1995.512487},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vr/SinghOP95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ml/SinghY94,
author = {Satinder P. Singh and
Richard C. Yee},
title = {An Upper Bound on the Loss from Approximate Optimal-Value Functions},
journal = {Mach. Learn.},
volume = {16},
number = {3},
pages = {227--233},
year = {1994},
url = {https://doi.org/10.1007/BF00993308},
doi = {10.1007/BF00993308},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ml/SinghY94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmod/PissinouSEMOPSTD94,
author = {Niki Pissinou and
Richard T. Snodgrass and
Ramez Elmasri and
Inderpal Singh Mumick and
M. Tamer {\"{O}}zsu and
Barbara Pernici and
Arie Segev and
Babis Theodoulidis and
Umeshwar Dayal},
title = {Towards an Infrastructure for Temporal Databases: Report of an Invitational
{ARPA/NSF} Workshop},
journal = {{SIGMOD} Rec.},
volume = {23},
number = {1},
pages = {35--51},
year = {1994},
url = {https://doi.org/10.1145/181550.181557},
doi = {10.1145/181550.181557},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigmod/PissinouSEMOPSTD94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spe/AdelsteinRSPS94,
author = {Frank Adelstein and
Golden G. Richard III and
Loren Schwiebert and
Rick Parent and
Mukesh Singhal},
title = {A Distributed Graphics Library System},
journal = {Softw. Pract. Exp.},
volume = {24},
number = {4},
pages = {363--376},
year = {1994},
url = {https://doi.org/10.1002/spe.4380240403},
doi = {10.1002/SPE.4380240403},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/spe/AdelsteinRSPS94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asplos/HeinrichKOHBSSGNHGRH94,
author = {Mark A. Heinrich and
Jeffrey Kuskin and
David Ofelt and
John Heinlein and
Joel Baxter and
Jaswinder Pal Singh and
Richard Simoni and
Kourosh Gharachorloo and
David Nakahira and
Mark Horowitz and
Anoop Gupta and
Mendel Rosenblum and
John L. Hennessy},
editor = {Forest Baskett and
Douglas W. Clark},
title = {The Performance Impact of Flexibility in the Stanford {FLASH} Multiprocessor},
booktitle = {{ASPLOS-VI} Proceedings - Sixth International Conference on Architectural
Support for Programming Languages and Operating Systems, San Jose,
California, USA, October 4-7, 1994},
pages = {274--285},
publisher = {{ACM} Press},
year = {1994},
url = {https://doi.org/10.1145/195473.195569},
doi = {10.1145/195473.195569},
timestamp = {Wed, 07 Jul 2021 13:23:09 +0200},
biburl = {https://dblp.org/rec/conf/asplos/HeinrichKOHBSSGNHGRH94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vbc/HentschelEFFBLL94,
author = {Dietmar Hentschel and
Jay Ezrielev and
Richard Fisler and
Carolyn Flanders and
Ali R. Bani{-}Hashemi and
Cheng{-}Chung Liang and
Shih{-}Ping Liou and
Sumitro Samaddar and
Ajit Singh and
Derek R. Ney},
editor = {Richard A. Robb},
title = {Techniques for editing and visualizing CT-angiographic data},
booktitle = {Visualization in Biomedical Computing 1994, Rochester, MN, USA, 4-7
October 1994},
series = {{SPIE} Proceedings},
volume = {2359},
publisher = {{SPIE}},
year = {1994},
url = {https://doi.org/10.1117/12.185191},
doi = {10.1117/12.185191},
timestamp = {Thu, 23 Aug 2018 12:58:00 +0200},
biburl = {https://dblp.org/rec/conf/vbc/HentschelEFFBLL94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icci/LiLD93,
author = {Xiaobo Li and
Richard Lai and
Tharam S. Dillon},
editor = {Osman Abou{-}Rabia and
Carl K. Chang and
Waldemar W. Koczkodaj},
title = {A New Decomposition Method to Relieve the State Space Explosion Problem},
booktitle = {Computing and Information - ICCI'93, Fifth International Conference
on Computing and Information, Sudbury, Ontario, Canada, May 27-29,
1993, Proceedings},
pages = {150--154},
publisher = {{IEEE} Computer Society},
year = {1993},
timestamp = {Wed, 31 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icci/LiLD93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/srds/RichardS93,
author = {Golden G. Richard III and
Mukesh Singhal},
title = {Using Logging and Asynchronous Checkpointing to Implement Recoverable
Distributed Shared Memory},
booktitle = {12th Symposium on Reliable Distributed Systems, {SRDS} 1993, Princeton,
New Jersey, USA, October 6-8, 1993, Proceedings},
pages = {58--67},
publisher = {{IEEE} Computer Society},
year = {1993},
url = {https://doi.org/10.1109/RELDIS.1993.393473},
doi = {10.1109/RELDIS.1993.393473},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/srds/RichardS93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csfw/AmmannLS92,
author = {Paul Ammann and
Richard J. Lipton and
Ravi S. Sandhu},
title = {The Expressive Power of Multi-Parent Creation in a Monotonic Access
Control Model},
booktitle = {5th {IEEE} Computer Security Foundations Workshop - CSFW'92, Franconia,
New Hampshire, USA, June 16-18, 1992, Proceedings},
pages = {148--156},
publisher = {{IEEE} Computer Society},
year = {1992},
url = {https://doi.org/10.1109/CSFW.1992.236780},
doi = {10.1109/CSFW.1992.236780},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/csfw/AmmannLS92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icci/LiLD92,
author = {Xiaobo Li and
Richard Lai and
Tharam S. Dillon},
editor = {Waldemar W. Koczkodaj and
Peter E. Lauer and
Anestis A. Toptsis},
title = {Theory of Deductive Systems for Protocol Verification},
booktitle = {Computing and Information - ICCI'92, Fourth International Conference
on Computing and Information, Toronto, Ontario, Canada, May 28-30,
1992, Proceedings},
pages = {422--425},
publisher = {{IEEE} Computer Society},
year = {1992},
timestamp = {Wed, 31 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icci/LiLD92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pnpm/ZurawskiD91,
author = {Richard Zurawski and
Tharam S. Dillon},
title = {Systematic Construction of Functional Abstractions of Petri Net Models
of Typical Components of Flexible Manufacturing Systems},
booktitle = {Proceedings of the Fourth International Workshop on Petri Nets and
Performance Models, {PNPM} 1991, Melbourne, Victoria, Australia, December
2-5, 1991},
pages = {248--257},
publisher = {{IEEE} Computer Society},
year = {1991},
url = {https://doi.org/10.1109/PNPM.1991.238795},
doi = {10.1109/PNPM.1991.238795},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pnpm/ZurawskiD91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cav/LaiPD90,
author = {Richard Lai and
Ken R. Parker and
Tharam S. Dillon},
editor = {Edmund M. Clarke and
Robert P. Kurshan},
title = {On Using Protean To Verify {ISO} {FTAM} Protocol},
booktitle = {Computer Aided Verification, 2nd International Workshop, {CAV} '90,
New Brunswick, NJ, USA, June 18-21, 1990, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {531},
pages = {126--135},
publisher = {Springer},
year = {1990},
url = {https://doi.org/10.1007/BFb0023726},
doi = {10.1007/BFB0023726},
timestamp = {Tue, 23 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cav/LaiPD90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pstv/LaiDP89,
author = {Richard Lai and
Tharam S. Dillon and
Ken R. Parker},
editor = {Ed Brinksma and
Giuseppe Scollo and
Chris A. Vissers},
title = {Verification Results for {ISO} {FTAM} Basic Protocol},
booktitle = {Protocol Specification, Testing and Verification IX, Proceedings of
the {IFIP} {WG6.1} Ninth International Symposium on Protocol Specification,
Testing and Verification, Enschede, The Netherlands, 6-9 June, 1989},
pages = {223--234},
publisher = {North-Holland},
year = {1989},
timestamp = {Tue, 23 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pstv/LaiDP89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/SegallSSJS83,
author = {Zary Segall and
Ajay Singh and
Richard T. Snodgrass and
Anita K. Jones and
Daniel P. Siewiorek},
title = {An Integrated Instrumentation Environment for Multiprocessors},
journal = {{IEEE} Trans. Computers},
volume = {32},
number = {1},
pages = {4--14},
year = {1983},
url = {https://doi.org/10.1109/TC.1983.1676119},
doi = {10.1109/TC.1983.1676119},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/SegallSSJS83.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-10-06 03:22 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
