default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Richa Singh"
download as .bib file
@article{DBLP:journals/bspc/KhurshidAVS24,
author = {Mahapara Khurshid and
Yasmeena Akhter and
Mayank Vatsa and
Richa Singh},
title = {AssistDistil for Medical Image Segmentation},
journal = {Biomed. Signal Process. Control.},
volume = {97},
pages = {106568},
year = {2024}
}
@article{DBLP:journals/csm/CedergrenLFFKKLMOPSSSTV24,
author = {Andreas Cedergren and
Fabian de Laval and
Sorour Falahati and
Lars Falk and
Du Ho Kang and
Robert S. Karlsson and
Yazid Lyazidi and
Aliakbar Mirzaei and
Jonas Olsson and
Jose Luis Pradas and
Paul Schliwa{-}Bertling and
Nianshan Shi and
Bikramjit Singh and
Richard Tano and
Andra M. Voicu},
title = {5G Networks Evolution for Extended Reality},
journal = {{IEEE} Commun. Stand. Mag.},
volume = {8},
number = {3},
pages = {54--59},
year = {2024}
}
@article{DBLP:journals/esi/VermaMkSSSHSTKS24,
author = {Nitin Verma and
Satya Prakash Maurya and
Ravi Kant and
K. H. Singh and
Raghav Singh and
A. P. Singh and
G. Hema and
M. K. Srivastava and
Alok K. Tiwari and
Pradeep Kumar Kushwaha and
Richa Singh},
title = {Comparison of neural networks techniques to predict subsurface parameters
based on seismic inversion: a machine learning approach},
journal = {Earth Sci. Informatics},
volume = {17},
number = {2},
pages = {1031--1052},
year = {2024}
}
@article{DBLP:journals/fdata/AkhterSV24,
author = {Yasmeena Akhter and
Richa Singh and
Mayank Vatsa},
title = {AI-based radiodiagnosis using chest X-rays: {A} review},
journal = {Frontiers Big Data},
volume = {6},
year = {2024}
}
@article{DBLP:journals/ijesdf/SinghalV24,
author = {Divya Singhal and
Richa Vijay},
title = {Predictive modelling for fake news detection using {TF-IDF} and count
vectorizers},
journal = {Int. J. Electron. Secur. Digit. Forensics},
volume = {16},
number = {4},
pages = {503--519},
year = {2024}
}
@article{DBLP:journals/iotm/KaushikSLLDSASSR24,
author = {Aryan Kaushik and
Rohit Singh and
Ming Li and
Honghao Luo and
Shalanika Dayarathna and
Rajitha Senanayake and
Xueli An and
Richard A. Stirling{-}Gallacher and
Wonjae Shin and
Marco Di Renzo},
title = {Integrated Sensing and Communications for IoT: Synergies with Key
6G Technology Enablers},
journal = {{IEEE} Internet Things Mag.},
volume = {7},
number = {5},
pages = {136--143},
year = {2024}
}
@article{DBLP:journals/kais/ChaudhariPJPS24,
author = {Jyoti Kant Chaudhari and
Shubham Pant and
Richa Jha and
Rajesh Kumar Pathak and
Dev Bukhsh Singh},
title = {Biological big-data sources, problems of storage, computational issues,
and applications: a comprehensive review},
journal = {Knowl. Inf. Syst.},
volume = {66},
number = {6},
pages = {3159--3209},
year = {2024}
}
@article{DBLP:journals/nn/AgarwalVSR24,
author = {Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Corruption depth: Analysis of {DNN} depth for misclassification},
journal = {Neural Networks},
volume = {172},
pages = {106013},
year = {2024}
}
@article{DBLP:journals/saem/MohantySGBK24,
author = {Sachi Nandan Mohanty and
Tilottama Singh and
Richa Goel and
Sukanta Kumar Baral and
Rakesh Kumar},
title = {A study on building awareness in cyber security for educational system
in India using interpretive structural modellings},
journal = {Int. J. Syst. Assur. Eng. Manag.},
volume = {15},
number = {6},
pages = {2518--2528},
year = {2024}
}
@article{DBLP:journals/tai/ChhabraTMVS24,
author = {Saheb Chhabra and
Kartik Thakral and
Surbhi Mittal and
Mayank Vatsa and
Richa Singh},
title = {Low-Quality Deepfake Detection via Unseen Artifacts},
journal = {{IEEE} Trans. Artif. Intell.},
volume = {5},
number = {4},
pages = {1573--1585},
year = {2024}
}
@article{DBLP:journals/tbbis/ManchandaBBACDCVS24,
author = {Sunny Manchanda and
Kaushik Bhagwatkar and
Kavita Balutia and
Shivang Agarwal and
Jyoti Chaudhary and
Muskan Dosi and
Chiranjeev Chiranjeev and
Mayank Vatsa and
Richa Singh},
title = {{D-LORD:} {DYSL-AI} Database for Low-Resolution Disguised Face Recognition},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {6},
number = {2},
pages = {147--157},
year = {2024}
}
@article{DBLP:journals/tecs/SinghISS24,
author = {Richa Singh and
Saad Islam and
Berk Sunar and
Patrick Schaumont},
title = {Analysis of {EM} Fault Injection on Bit-sliced Number Theoretic Transform
Software in Dilithium},
journal = {{ACM} Trans. Embed. Comput. Syst.},
volume = {23},
number = {2},
pages = {32:1--32:27},
year = {2024}
}
@article{DBLP:journals/tifs/MalhotraVSMN24,
author = {Aakarsh Malhotra and
Mayank Vatsa and
Richa Singh and
Keith B. Morris and
Afzel Noore},
title = {Multi-Surface Multi-Technique {(MUST)} Latent Fingerprint Database},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {19},
pages = {1041--1055},
year = {2024}
}
@inproceedings{DBLP:conf/aaai/KshitizSDDV0ASP24,
author = {Kshitiz and
Sonu Shreshtha and
Bikash Dutta and
Muskan Dosi and
Mayank Vatsa and
Richa Singh and
Saket Anand and
Sudeep Sarkar and
Sevaram Mali Parihar},
title = {BirdCollect: {A} Comprehensive Benchmark for Analyzing Dense Bird
Flock Attributes},
booktitle = {{AAAI}},
pages = {21879--21887},
publisher = {{AAAI} Press},
year = {2024}
}
@inproceedings{DBLP:conf/aaai/VatsaJ024,
author = {Mayank Vatsa and
Anubhooti Jain and
Richa Singh},
title = {Adventures of Trustworthy Vision-Language Models: {A} Survey},
booktitle = {{AAAI}},
pages = {22658--22659},
publisher = {{AAAI} Press},
year = {2024}
}
@inproceedings{DBLP:conf/aaaiss/VedadiDMSAM24,
author = {Elahe Vedadi and
Joshua V. Dillon and
Philip Andrew Mansfield and
Karan Singhal and
Arash Afkanpour and
Warren Richard Morningstar},
title = {Federated Variational Inference: Towards Improved Personalization
and Generalization},
booktitle = {{AAAI} Spring Symposia},
pages = {323--327},
publisher = {{AAAI} Press},
year = {2024}
}
@inproceedings{DBLP:conf/chi/KnowlesSABLPVW24,
author = {Bran Knowles and
Aneesha Singh and
Aloha May Hufana Ambe and
Robin N. Brewer and
Amanda Lazar and
Helen Petrie and
John Vines and
Jenny Waycott},
title = {{HCI} and Aging: New Directions, New Principles},
booktitle = {{CHI} Extended Abstracts},
pages = {473:1--473:5},
publisher = {{ACM}},
year = {2024}
}
@inproceedings{DBLP:conf/cvpr/SpencerTPA0HBZL22,
author = {Jaime Spencer and
Fabio Tosi and
Matteo Poggi and
Ripudaman Singh Arora and
Chris Russell and
Simon Hadfield and
Richard Bowden and
GuangYuan Zhou and
ZhengXin Li and
Qiang Rao and
YiPing Bao and
Xiao Liu and
Dohyeong Kim and
Jinseong Kim and
Myunghyun Kim and
Mykola Lavreniuk and
Rui Li and
Qing Mao and
Jiang Wu and
Yu Zhu and
Jinqiu Sun and
Yanning Zhang and
Suraj Patni and
Aradhye Agarwal and
Chetan Arora and
Pihai Sun and
Kui Jiang and
Gang Wu and
Jian Liu and
Xianming Liu and
Junjun Jiang and
Xidan Zhang and
Jianing Wei and
Fangjun Wang and
Zhiming Tan and
Jiabao Wang and
Albert Luginov and
Muhammad Shahzad and
Seyed Hosseini and
Aleksander Trajcevski and
James H. Elder},
title = {The Third Monocular Depth Estimation Challenge},
booktitle = {{CVPR} Workshops},
pages = {1--14},
publisher = {{IEEE}},
year = {2024}
}
@inproceedings{DBLP:conf/cvpr/ThakralPAV024,
author = {Kartik Thakral and
Shashikant Prasad and
Stuti Aswani and
Mayank Vatsa and
Richa Singh},
title = {ToonerGAN: Reinforcing GANs for Obfuscating Automated Facial Indexing},
booktitle = {{CVPR}},
pages = {10875--10884},
publisher = {{IEEE}},
year = {2024}
}
@inproceedings{DBLP:conf/flairs/WuSZBCP24,
author = {Annie Wu and
Eashan Singh and
Ivy Zhang and
Anika Bilal and
Anna Casu and
Richard Pratley},
title = {Machine learning prediction of severity and duration of hypoglycemic
events in type 1 diabetes patients},
booktitle = {{FLAIRS}},
publisher = {{AAAI} Press},
year = {2024}
}
@inproceedings{DBLP:conf/iclr/YangYXS0CT024,
author = {Zhaoyuan Yang and
Zhengyang Yu and
Zhiwei Xu and
Jaskirat Singh and
Jing Zhang and
Dylan Campbell and
Peter H. Tu and
Richard Hartley},
title = {{IMPUS:} Image Morphing with Perceptually-Uniform Sampling Using Diffusion
Models},
booktitle = {{ICLR}},
publisher = {OpenReview.net},
year = {2024}
}
@inproceedings{DBLP:conf/icsa/GsturKSK24,
author = {Moritz Gst{\"{u}}r and
Yves Richard Kirschner and
Snigdha Singh and
Anne Koziolek},
title = {MoCoRe - {A} Generic Model-Driven Composition and Rule-Based Refinement
Framework},
booktitle = {{ICSA-C}},
pages = {273--280},
publisher = {{IEEE}},
year = {2024}
}
@inproceedings{DBLP:conf/igarss/SenarasHDWRGJ24,
author = {{\c{C}}aglar Senaras and
Piers Holden and
Timothy Davis and
Annett Wania and
Akhil Singh Rana and
Helen M. Grady and
Richard de Jeu},
title = {Early-Season Crop Classification with Planet Fusion},
booktitle = {{IGARSS}},
pages = {4145--4149},
publisher = {{IEEE}},
year = {2024}
}
@inproceedings{DBLP:conf/ijcnn/KumarSRNR24,
author = {Deepak Kumar and
Pradeep Singh and
Richa and
Kishore Babu Nampalle and
Balasubramanian Raman},
title = {Integrating Physiological Signals with Dynamical Attention Networks
for Personality Trait Analysis},
booktitle = {{IJCNN}},
pages = {1--8},
publisher = {{IEEE}},
year = {2024}
}
@inproceedings{DBLP:conf/isbi/AkhterRSV24,
author = {Yasmeena Akhter and
Rishabh Ranjan and
Richa Singh and
Mayank Vatsa},
title = {Low-Resolution Chest X-Ray Classification Via Knowledge Distillation
and Multi-Task Learning},
booktitle = {{ISBI}},
pages = {1--5},
publisher = {{IEEE}},
year = {2024}
}
@inproceedings{DBLP:conf/isbi/KhurshidVS24,
author = {Mahapara Khurshid and
Mayank Vatsa and
Richa Singh},
title = {Optimizing Skin Lesion Classification Via Multimodal Data and Auxiliary
Task Integration},
booktitle = {{ISBI}},
pages = {1--5},
publisher = {{IEEE}},
year = {2024}
}
@inproceedings{DBLP:conf/miccai/KhanSVS24,
author = {Misaal Khan and
Richa Singh and
Mayank Vatsa and
Kuldeep Singh},
title = {DomainAdapt: Leveraging Multitask Learning and Domain Insights for
Children's Nutritional Status Assessment},
booktitle = {{MICCAI} {(3)}},
series = {Lecture Notes in Computer Science},
volume = {15003},
pages = {606--616},
publisher = {Springer},
year = {2024}
}
@inproceedings{DBLP:conf/nsdi/LiuSTFGAAABCGLO24,
author = {Bingzhe Liu and
Colin Scott and
Mukarram Tariq and
Andrew D. Ferguson and
Phillipa Gill and
Richard Alimi and
Omid Alipourfard and
Deepak Arulkannan and
Virginia Beauregard and
Patrick Conner and
Philip Brighten Godfrey and
Xander Lin and
Joon Ong and
Mayur Patel and
Amr Sabaa and
Arjun Singh and
Alex Smirnov and
Manish Verma and
Prerepa V. Viswanadham and
Amin Vahdat},
title = {{CAPA:} An Architecture For Operating Cluster Networks With High Availability},
booktitle = {{NSDI}},
publisher = {{USENIX} Association},
year = {2024}
}
@inproceedings{DBLP:conf/siggraph/SinghGB24,
author = {Ishaan Singh and
Jay Goodman and
Richard Burgess{-}Dawson},
title = {College Football is {HUGE:} Delivering a {AAA} Sports Game at Scale},
booktitle = {{SIGGRAPH} Talks},
pages = {1},
publisher = {{ACM}},
year = {2024}
}
@inproceedings{DBLP:conf/wacv/SinghBV0B24,
author = {Jaisidh Singh and
Harshil Bhatia and
Mayank Vatsa and
Richa Singh and
Aparna Bharati},
title = {SynthProv: Interpretable Framework for Profiling Identity Leakage},
booktitle = {{WACV}},
pages = {4734--4744},
publisher = {{IEEE}},
year = {2024}
}
@proceedings{DBLP:conf/comad/2024,
editor = {Sriraam Natarajan and
Indrajit Bhattacharya and
Richa Singh and
Arun Kumar and
Sayan Ranu and
Kalika Bali and
Abinaya K},
title = {Proceedings of the 7th Joint International Conference on Data Science
{\&} Management of Data (11th {ACM} {IKDD} {CODS} and 29th COMAD),
Bangalore, India, January 4-7, 2024},
publisher = {{ACM}},
year = {2024}
}
@article{DBLP:journals/corr/abs-2402-01761,
author = {Chandan Singh and
Jeevana Priya Inala and
Michel Galley and
Rich Caruana and
Jianfeng Gao},
title = {Rethinking Interpretability in the Era of Large Language Models},
journal = {CoRR},
volume = {abs/2402.01761},
year = {2024}
}
@article{DBLP:journals/corr/abs-2402-06463,
author = {Abdoul{-}aziz Amadou and
Laura Peralta Pereira and
Paul Dryburgh and
Paul Klein and
Kaloian Petkov and
Richard James Housden and
Vivek Singh and
Rui Liao and
Young{-}Ho Kim and
Florin{-}Cristian Ghesu and
Tommaso Mansi and
Ronak Rajani and
Alistair A. Young and
Kawal S. Rhode},
title = {Cardiac ultrasound simulation for autonomous ultrasound navigation},
journal = {CoRR},
volume = {abs/2402.06463},
year = {2024}
}
@article{DBLP:journals/corr/abs-2402-10454,
author = {Mahapara Khurshid and
Mayank Vatsa and
Richa Singh},
title = {Optimizing Skin Lesion Classification via Multimodal Data and Auxiliary
Task Integration},
journal = {CoRR},
volume = {abs/2402.10454},
year = {2024}
}
@article{DBLP:journals/corr/abs-2403-05726,
author = {Warren R. Morningstar and
Alex Bijamov and
Chris Duvarney and
Luke Friedman and
Neha Mukund Kalibhat and
Luyang Liu and
Philip Andrew Mansfield and
Renan A. Rojas{-}Gomez and
Karan Singhal and
Bradley Green and
Sushant Prakash},
title = {Augmentations vs Algorithms: What Works in Self-Supervised Learning},
journal = {CoRR},
volume = {abs/2403.05726},
year = {2024}
}
@article{DBLP:journals/corr/abs-2403-20312,
author = {Jaisidh Singh and
Ishaan Shrivastava and
Mayank Vatsa and
Richa Singh and
Aparna Bharati},
title = {Learn "No" to Say "Yes" Better: Improving Vision-Language Models via
Negations},
journal = {CoRR},
volume = {abs/2403.20312},
year = {2024}
}
@article{DBLP:journals/corr/abs-2404-16831,
author = {Jaime Spencer and
Fabio Tosi and
Matteo Poggi and
Ripudaman Singh Arora and
Chris Russell and
Simon Hadfield and
Richard Bowden and
GuangYuan Zhou and
ZhengXin Li and
Qiang Rao and
YiPing Bao and
Xiao Liu and
Dohyeong Kim and
Jinseong Kim and
Myunghyun Kim and
Mykola Lavreniuk and
Rui Li and
Qing Mao and
Jiang Wu and
Yu Zhu and
Jinqiu Sun and
Yanning Zhang and
Suraj Patni and
Aradhye Agarwal and
Chetan Arora and
Pihai Sun and
Kui Jiang and
Gang Wu and
Jian Liu and
Xianming Liu and
Junjun Jiang and
Xidan Zhang and
Jianing Wei and
Fangjun Wang and
Zhiming Tan and
Jiabao Wang and
Albert Luginov and
Muhammad Shahzad and
Seyed Hosseini and
Aleksander Trajcevski and
James H. Elder},
title = {The Third Monocular Depth Estimation Challenge},
journal = {CoRR},
volume = {abs/2404.16831},
year = {2024}
}
@article{DBLP:journals/corr/abs-2405-13370,
author = {Yasmeena Akhter and
Rishabh Ranjan and
Richa Singh and
Mayank Vatsa},
title = {Low-Resolution Chest X-ray Classification via Knowledge Distillation
and Multi-task Learning},
journal = {CoRR},
volume = {abs/2405.13370},
year = {2024}
}
@article{DBLP:journals/corr/abs-2405-16714,
author = {Vinamra Benara and
Chandan Singh and
John X. Morris and
Richard Antonello and
Ion Stoica and
Alexander G. Huth and
Jianfeng Gao},
title = {Crafting Interpretable Embeddings by Asking LLMs Questions},
journal = {CoRR},
volume = {abs/2405.16714},
year = {2024}
}
@article{DBLP:journals/corr/abs-2408-00283,
author = {Surbhi Mittal and
Arnav Sudan and
Mayank Vatsa and
Richa Singh and
Tamar Glaser and
Tal Hassner},
title = {Navigating Text-to-Image Generative Bias across Indic Languages},
journal = {CoRR},
volume = {abs/2408.00283},
year = {2024}
}
@article{DBLP:journals/corr/abs-2408-02494,
author = {Chiranjeev Chiranjeev and
Muskan Dosi and
Kartik Thakral and
Mayank Vatsa and
Richa Singh},
title = {HyperSpaceX: Radial and Angular Exploration of HyperSpherical Dimensions},
journal = {CoRR},
volume = {abs/2408.02494},
year = {2024}
}
@article{DBLP:journals/corr/abs-2408-08577,
author = {Pavan K. Inguva and
Saikat Mukherjee and
Pierre J. Walker and
Mona A. Kanso and
Jie Wang and
Yanchen Wu and
Vico Tenberg and
Srimanta Santra and
Shalini Singh and
Shin Hyuk Kim and
Bernhardt L. Trout and
Martin Z. Bazant and
Allan S. Myerson and
Richard D. Braatz},
title = {Mechanistic Modeling of Lipid Nanoparticle Formation for the Delivery
of Nucleic Acid Therapeutics},
journal = {CoRR},
volume = {abs/2408.08577},
year = {2024}
}
@article{DBLP:journals/corr/abs-2409-19619,
author = {Anubhooti Jain and
Susim Roy and
Kwanit Gupta and
Mayank Vatsa and
Richa Singh},
title = {Discerning the Chaos: Detecting Adversarial Perturbations while Disentangling
Intentional from Unintentional Noises},
journal = {CoRR},
volume = {abs/2409.19619},
year = {2024}
}
@article{DBLP:journals/corr/abs-2410-00812,
author = {Richard Antonello and
Chandan Singh and
Shailee Jain and
Aliyah R. Hsu and
Jianfeng Gao and
Bin Yu and
Alexander Huth},
title = {A generative framework to bridge data-driven models and scientific
theories in language neuroscience},
journal = {CoRR},
volume = {abs/2410.00812},
year = {2024}
}
@article{DBLP:journals/computers/SinghIV23,
author = {Avinash Singh and
Richard Adeyemi Ikuesan and
Hein S. Venter},
title = {MalFe - Malware Feature Engineering Generation Platform},
journal = {Comput.},
volume = {12},
number = {10},
pages = {201},
year = {2023}
}
@article{DBLP:journals/fcomp/TuYHXZFCSW23,
author = {Peter H. Tu and
Zhaoyuan Yang and
Richard I. Hartley and
Zhiwei Xu and
Jing Zhang and
Yiwei Fu and
Dylan Campbell and
Jaskirat Singh and
Tianyu Wang},
title = {Probabilistic and semantic descriptions of image manifolds and their
applications},
journal = {Frontiers Comput. Sci.},
volume = {5},
year = {2023}
}
@article{DBLP:journals/fdata/SinghU23,
author = {Richa Singh and
R. L. Ujjwal},
title = {Hybridized bio-inspired intrusion detection system for Internet of
Things},
journal = {Frontiers Big Data},
volume = {6},
year = {2023}
}
@article{DBLP:journals/ijsose/SinghGSSSG23,
author = {Narendra Singh and
Priyanka Gupta and
Richa Sharma and
Pushpa Singh and
Rajnesh Singh and
Sunil Gupta},
title = {Managing Employees Attendance using Real Time Face Recognition},
journal = {Int. J. Syst. Syst. Eng.},
volume = {13},
number = {4},
year = {2023}
}
@article{DBLP:journals/ijsose/SinghSSGSG23,
author = {Rajnesh Singh and
Pushpa Singh and
Richa Kumari Sharma and
Priyanka Gupta and
Narendra Singh and
Sunil Gupta},
title = {Managing employee attendance using real-time face recognition},
journal = {Int. J. Syst. Syst. Eng.},
volume = {13},
number = {4},
pages = {407--418},
year = {2023}
}
@article{DBLP:journals/inffus/AgarwalVSR23,
author = {Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Parameter agnostic stacked wavelet transformer for detecting singularities},
journal = {Inf. Fusion},
volume = {95},
pages = {415--425},
year = {2023}
}
@article{DBLP:journals/information/Jain0SSMA23,
author = {Parth Jain and
Vivek Kumar and
Jim Samuel and
Sushmita Singh and
Abhinay Mannepalli and
Richard Anderson},
title = {Artificially Intelligent Readers: An Adaptive Framework for Original
Handwritten Numerical Digits Recognition with {OCR} Methods},
journal = {Inf.},
volume = {14},
number = {6},
pages = {305},
year = {2023}
}
@article{DBLP:journals/jstsp/DosiCACMBBVS23,
author = {Muskan Dosi and
Chiranjeev Chiranjeev and
Shivang Agarwal and
Jyoti Chaudhary and
Sunny Manchanda and
Kavita Balutia and
Kaushik Bhagwatkar and
Mayank Vatsa and
Richa Singh},
title = {Seg-DGDNet: Segmentation Based Disguise Guided Dropout Network for
Low Resolution Face Recognition},
journal = {{IEEE} J. Sel. Top. Signal Process.},
volume = {17},
number = {6},
pages = {1264--1276},
year = {2023}
}
@article{DBLP:journals/nar/OlsonABCCDDDDKKLLMMMNNOOPPPPSSSTTVV23,
author = {Robert D. Olson and
Rida Assaf and
Thomas S. Brettin and
Neal Conrad and
Clark Cucinell and
James J. Davis and
Donald M. Dempsey and
Allan Dickerman and
Emily M. Dietrich and
Ronald W. Kenyon and
Mehmet Kuscuoglu and
Elliot J. Lefkowitz and
Jian Lu and
Dustin Machi and
Catherine Macken and
Chunhong Mao and
Anna Maria Niewiadomska and
Marcus Nguyen and
Gary J. Olsen and
Jamie C. Overbeek and
Bruce D. Parrello and
Victoria Parrello and
Jacob s Porter and
Gordon D. Pusch and
Maulik Shukla and
Indresh Singh and
Lucy Stewart and
Gene Tan and
Chris Thomas and
Margo VanOeffelen and
Veronika Vonstein and
Zachary S. Wallace and
Andrew S. Warren and
Alice R. Wattam and
Fangfang Xia and
Hyun Seung Yoo and
Yun Zhang and
Christian M. Zmasek and
Richard H. Scheuermann and
Rick L. Stevens},
title = {Introducing the Bacterial and Viral Bioinformatics Resource Center
{(BV-BRC):} a resource combining PATRIC, {IRD} and ViPR},
journal = {Nucleic Acids Res.},
volume = {51},
number = {{D1}},
pages = {678--689},
year = {2023}
}
@article{DBLP:journals/natmi/SandersSYQMBHRMHCKKABBBBDGGHHHJJK23,
author = {Lauren M. Sanders and
Ryan T. Scott and
Jason H. Yang and
Amina Ann Qutub and
H{\'{e}}ctor Garc{\'{\i}}a Mart{\'{\i}}n and
Daniel C. Berrios and
Jaden J. A. Hastings and
Jon Rask and
Graham Mackintosh and
Adrienne L. Hoarfrost and
Stuart J. Chalk and
John Kalantari and
Kia Khezeli and
Erik L. Antonsen and
Joel Babdor and
Richard Barker and
Sergio E. Baranzini and
Afshin Beheshti and
Guillermo M. Delgado{-}Aparicio and
Benjamin S. Glicksberg and
Casey S. Greene and
Melissa A. Haendel and
Arif A. Hamid and
Philip Heller and
Daniel Jamieson and
Katelyn J. Jarvis and
Svetlana V. Komarova and
Matthieu Komorowski and
Prachi Kothiyal and
Ashish Mahabal and
Uri Manor and
Christopher E. Mason and
Mona Matar and
George I. Mias and
Jack Miller and
Jerry G. Myers Jr. and
Charlotte A. Nelson and
Jonathan Oribello and
Seung{-}Min Park and
Patricia Parsons{-}Wingerter and
R. K. Prabhu and
Robert J. Reynolds and
Amanda Saravia{-}Butler and
Suchi Saria and
Aenor Sawyer and
Nitin Kumar Singh and
Michael Snyder and
Frank Soboczenski and
Karthik Soman and
Corey A. Theriot and
David Van Valen and
Kasthuri Venkateswaran and
Liz Warren and
Liz Worthey and
Marinka Zitnik and
Sylvain V. Costes},
title = {Biological research and self-driving labs in deep space supported
by artificial intelligence},
journal = {Nat. Mac. Intell.},
volume = {5},
number = {3},
pages = {208--219},
year = {2023}
}
@article{DBLP:journals/natmi/ScottSAHPMRHSGGTBMBBBBCDHHHJJKKKK23,
author = {Ryan T. Scott and
Lauren M. Sanders and
Erik L. Antonsen and
Jaden J. A. Hastings and
Seung{-}Min Park and
Graham Mackintosh and
Robert J. Reynolds and
Adrienne L. Hoarfrost and
Aenor Sawyer and
Casey S. Greene and
Benjamin S. Glicksberg and
Corey A. Theriot and
Daniel C. Berrios and
Jack Miller and
Joel Babdor and
Richard Barker and
Sergio E. Baranzini and
Afshin Beheshti and
Stuart J. Chalk and
Guillermo M. Delgado{-}Aparicio and
Melissa A. Haendel and
Arif A. Hamid and
Philip Heller and
Daniel Jamieson and
Katelyn J. Jarvis and
John Kalantari and
Kia Khezeli and
Svetlana V. Komarova and
Matthieu Komorowski and
Prachi Kothiyal and
Ashish Mahabal and
Uri Manor and
H{\'{e}}ctor Garc{\'{\i}}a Mart{\'{\i}}n and
Christopher E. Mason and
Mona Matar and
George I. Mias and
Jerry G. Myers Jr. and
Charlotte A. Nelson and
Jonathan Oribello and
Patricia Parsons{-}Wingerter and
R. K. Prabhu and
Amina Ann Qutub and
Jon Rask and
Amanda Saravia{-}Butler and
Suchi Saria and
Nitin Kumar Singh and
Michael Snyder and
Frank Soboczenski and
Karthik Soman and
David Van Valen and
Kasthuri Venkateswaran and
Liz Warren and
Liz Worthey and
Jason H. Yang and
Marinka Zitnik and
Sylvain V. Costes},
title = {Biomonitoring and precision health in deep space supported by artificial
intelligence},
journal = {Nat. Mac. Intell.},
volume = {5},
number = {3},
pages = {196--207},
year = {2023}
}
@article{DBLP:journals/pr/MajumdarVS23,
author = {Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Uniform misclassification loss for unbiased model prediction},
journal = {Pattern Recognit.},
volume = {144},
pages = {109689},
year = {2023}
}
@article{DBLP:journals/saem/SharmaSSS23,
author = {Richa Sharma and
Purushottam Sharma and
Anshuman Singh and
Veer Srivastava},
title = {An approach to optimize performance of controller in networked control
system},
journal = {Int. J. Syst. Assur. Eng. Manag.},
volume = {14},
number = {5},
pages = {1639--1646},
year = {2023}
}
@article{DBLP:journals/sensors/00420ZP23,
author = {Jie Wang and
Richard Chang and
Ziyuan Zhao and
Ramanpreet Singh Pahwa},
title = {Robust Detection, Segmentation, and Metrology of High Bandwidth Memory
3D Scans Using an Improved Semi-Supervised Deep Learning Approach},
journal = {Sensors},
volume = {23},
number = {12},
pages = {5470},
year = {2023}
}
@article{DBLP:journals/sensors/SinghPKSBH23,
author = {Mehar Singh and
Prithvi Prakash and
Rachneet Kaur and
Richard B. Sowers and
James Robert Brasic and
Manuel Enrique Hernandez},
title = {A Deep Learning Approach for Automatic and Objective Grading of the
Motor Impairment Severity in Parkinson's Disease for Use in Tele-Assessments},
journal = {Sensors},
volume = {23},
number = {21},
pages = {9004},
year = {2023}
}
@article{DBLP:journals/sncs/GoelSGNSK23,
author = {Navansh Goel and
Mohanapriya Singaravelu and
Shivani Gupta and
Sriram Namana and
Richa Singh and
Ranjeet Kumar},
title = {Parameterized Clustering Cleaning Approach for High-Dimensional Datasets
with Class Overlap and Imbalance},
journal = {{SN} Comput. Sci.},
volume = {4},
number = {5},
pages = {464},
year = {2023}
}
@article{DBLP:journals/sncs/GuptaSKJ23,
author = {Shivani Gupta and
Richa Singh and
Ranjeet Kumar and
Kusum Lata Jain},
title = {Combat with Class Overlapping in Software Defect Prediction Using
Neighbourhood Metric},
journal = {{SN} Comput. Sci.},
volume = {4},
number = {5},
pages = {695},
year = {2023}
}
@article{DBLP:journals/tai/AgarwalSVR23,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {IBAttack: Being Cautious About Data Labels},
journal = {{IEEE} Trans. Artif. Intell.},
volume = {4},
number = {6},
pages = {1484--1493},
year = {2023}
}
@article{DBLP:journals/tai/ChhabraMVS23,
author = {Saheb Chhabra and
Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Feature-Guided Perturbation for Facial Attribute Classification},
journal = {{IEEE} Trans. Artif. Intell.},
volume = {4},
number = {6},
pages = {1739--1751},
year = {2023}
}
@article{DBLP:journals/tbbis/JackPTVCPS23,
author = {Rachael E. Jack and
Vishal M. Patel and
Pavan K. Turaga and
Mayank Vatsa and
Rama Chellappa and
Alex Pentland and
Richa Singh},
title = {Best Paper Section {IEEE} International Conference on Automatic Face
and Gesture Recognition 2021},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {5},
number = {3},
pages = {305--307},
year = {2023}
}
@article{DBLP:journals/tbbis/MehraAVS23,
author = {Aman Mehra and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {Motion Magnified 3-D Residual-in-Dense Network for DeepFake Detection},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {5},
number = {1},
pages = {39--52},
year = {2023}
}
@article{DBLP:journals/tbbis/NagpalS0V23,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa},
title = {Detox Loss: Fairness Constraints for Learning With Imbalanced Data},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {5},
number = {2},
pages = {244--254},
year = {2023}
}
@article{DBLP:journals/tcbb/BaileySSDK23,
author = {Richard Bailey and
Aisharjya Sarkar and
Aaditya Singh and
Alin Dobra and
Tamer Kahveci},
title = {Optimal Supervised Reduction of High Dimensional Transcription Data},
journal = {{IEEE} {ACM} Trans. Comput. Biol. Bioinform.},
volume = {20},
number = {5},
pages = {3093--3105},
year = {2023}
}
@article{DBLP:journals/tcbb/DhanukaST23,
author = {Richa Dhanuka and
Jyoti Prakash Singh and
Anushree Tripathi},
title = {A Comprehensive Survey of Deep Learning Techniques in Protein Function
Prediction},
journal = {{IEEE} {ACM} Trans. Comput. Biol. Bioinform.},
volume = {20},
number = {3},
pages = {2291--2301},
year = {2023}
}
@article{DBLP:journals/tci/AliMSDBDD23,
author = {Rehman Ali and
Trevor M. Mitcham and
Melanie Singh and
Marvin M. Doyley and
Richard R. Bouchard and
Jeremy J. Dahl and
Nebojsa Duric},
title = {Sound Speed Estimation for Distributed Aberration Correction in Laterally
Varying Media},
journal = {{IEEE} Trans. Computational Imaging},
volume = {9},
pages = {367--382},
year = {2023}
}
@article{DBLP:journals/tmlr/MalhotraVS23,
author = {Aakarsh Malhotra and
Mayank Vatsa and
Richa Singh},
title = {Dropped Scheduled Task: Mitigating Negative Transfer in Multi-task
Learning using Dynamic Task Dropping},
journal = {Trans. Mach. Learn. Res.},
volume = {2023},
year = {2023}
}
@article{DBLP:journals/tmlr/SrivastavaRRSAF23,
author = {Aarohi Srivastava and
Abhinav Rastogi and
Abhishek Rao and
Abu Awal Md Shoeb and
Abubakar Abid and
Adam Fisch and
Adam R. Brown and
Adam Santoro and
Aditya Gupta and
Adri{\`{a}} Garriga{-}Alonso and
Agnieszka Kluska and
Aitor Lewkowycz and
Akshat Agarwal and
Alethea Power and
Alex Ray and
Alex Warstadt and
Alexander W. Kocurek and
Ali Safaya and
Ali Tazarv and
Alice Xiang and
Alicia Parrish and
Allen Nie and
Aman Hussain and
Amanda Askell and
Amanda Dsouza and
Ambrose Slone and
Ameet Rahane and
Anantharaman S. Iyer and
Anders Andreassen and
Andrea Madotto and
Andrea Santilli and
Andreas Stuhlm{\"{u}}ller and
Andrew M. Dai and
Andrew La and
Andrew K. Lampinen and
Andy Zou and
Angela Jiang and
Angelica Chen and
Anh Vuong and
Animesh Gupta and
Anna Gottardi and
Antonio Norelli and
Anu Venkatesh and
Arash Gholamidavoodi and
Arfa Tabassum and
Arul Menezes and
Arun Kirubarajan and
Asher Mullokandov and
Ashish Sabharwal and
Austin Herrick and
Avia Efrat and
Aykut Erdem and
Ayla Karakas and
B. Ryan Roberts and
Bao Sheng Loe and
Barret Zoph and
Bartlomiej Bojanowski and
Batuhan {\"{O}}zyurt and
Behnam Hedayatnia and
Behnam Neyshabur and
Benjamin Inden and
Benno Stein and
Berk Ekmekci and
Bill Yuchen Lin and
Blake Howald and
Bryan Orinion and
Cameron Diao and
Cameron Dour and
Catherine Stinson and
Cedrick Argueta and
C{\`{e}}sar Ferri Ram{\'{\i}}rez and
Chandan Singh and
Charles Rathkopf and
Chenlin Meng and
Chitta Baral and
Chiyu Wu and
Chris Callison{-}Burch and
Chris Waites and
Christian Voigt and
Christopher D. Manning and
Christopher Potts and
Cindy Ramirez and
Clara E. Rivera and
Clemencia Siro and
Colin Raffel and
Courtney Ashcraft and
Cristina Garbacea and
Damien Sileo and
Dan Garrette and
Dan Hendrycks and
Dan Kilman and
Dan Roth and
Daniel Freeman and
Daniel Khashabi and
Daniel Levy and
Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and
Danielle Perszyk and
Danny Hernandez and
Danqi Chen and
Daphne Ippolito and
Dar Gilboa and
David Dohan and
David Drakard and
David Jurgens and
Debajyoti Datta and
Deep Ganguli and
Denis Emelin and
Denis Kleyko and
Deniz Yuret and
Derek Chen and
Derek Tam and
Dieuwke Hupkes and
Diganta Misra and
Dilyar Buzan and
Dimitri Coelho Mollo and
Diyi Yang and
Dong{-}Ho Lee and
Dylan Schrader and
Ekaterina Shutova and
Ekin Dogus Cubuk and
Elad Segal and
Eleanor Hagerman and
Elizabeth Barnes and
Elizabeth Donoway and
Ellie Pavlick and
Emanuele Rodol{\`{a}} and
Emma Lam and
Eric Chu and
Eric Tang and
Erkut Erdem and
Ernie Chang and
Ethan A. Chi and
Ethan Dyer and
Ethan J. Jerzak and
Ethan Kim and
Eunice Engefu Manyasi and
Evgenii Zheltonozhskii and
Fanyue Xia and
Fatemeh Siar and
Fernando Mart{\'{\i}}nez{-}Plumed and
Francesca Happ{\'{e}} and
Fran{\c{c}}ois Chollet and
Frieda Rong and
Gaurav Mishra and
Genta Indra Winata and
Gerard de Melo and
Germ{\'{a}}n Kruszewski and
Giambattista Parascandolo and
Giorgio Mariani and
Gloria Wang and
Gonzalo Jaimovitch{-}L{\'{o}}pez and
Gregor Betz and
Guy Gur{-}Ari and
Hana Galijasevic and
Hannah Kim and
Hannah Rashkin and
Hannaneh Hajishirzi and
Harsh Mehta and
Hayden Bogar and
Henry Shevlin and
Hinrich Sch{\"{u}}tze and
Hiromu Yakura and
Hongming Zhang and
Hugh Mee Wong and
Ian Ng and
Isaac Noble and
Jaap Jumelet and
Jack Geissinger and
Jackson Kernion and
Jacob Hilton and
Jaehoon Lee and
Jaime Fern{\'{a}}ndez Fisac and
James B. Simon and
James Koppel and
James Zheng and
James Zou and
Jan Kocon and
Jana Thompson and
Janelle Wingfield and
Jared Kaplan and
Jarema Radom and
Jascha Sohl{-}Dickstein and
Jason Phang and
Jason Wei and
Jason Yosinski and
Jekaterina Novikova and
Jelle Bosscher and
Jennifer Marsh and
Jeremy Kim and
Jeroen Taal and
Jesse H. Engel and
Jesujoba Alabi and
Jiacheng Xu and
Jiaming Song and
Jillian Tang and
Joan Waweru and
John Burden and
John Miller and
John U. Balis and
Jonathan Batchelder and
Jonathan Berant and
J{\"{o}}rg Frohberg and
Jos Rozen and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Joseph Boudeman and
Joseph Guerr and
Joseph Jones and
Joshua B. Tenenbaum and
Joshua S. Rule and
Joyce Chua and
Kamil Kanclerz and
Karen Livescu and
Karl Krauth and
Karthik Gopalakrishnan and
Katerina Ignatyeva and
Katja Markert and
Kaustubh D. Dhole and
Kevin Gimpel and
Kevin Omondi and
Kory Mathewson and
Kristen Chiafullo and
Ksenia Shkaruta and
Kumar Shridhar and
Kyle McDonell and
Kyle Richardson and
Laria Reynolds and
Leo Gao and
Li Zhang and
Liam Dugan and
Lianhui Qin and
Lidia Contreras Ochando and
Louis{-}Philippe Morency and
Luca Moschella and
Lucas Lam and
Lucy Noble and
Ludwig Schmidt and
Luheng He and
Luis Oliveros Col{\'{o}}n and
Luke Metz and
L{\"{u}}tfi Kerem Senel and
Maarten Bosma and
Maarten Sap and
Maartje ter Hoeve and
Maheen Farooqi and
Manaal Faruqui and
Mantas Mazeika and
Marco Baturan and
Marco Marelli and
Marco Maru and
Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and
Marie Tolkiehn and
Mario Giulianelli and
Martha Lewis and
Martin Potthast and
Matthew L. Leavitt and
Matthias Hagen and
M{\'{a}}ty{\'{a}}s Schubert and
Medina Baitemirova and
Melody Arnaud and
Melvin McElrath and
Michael A. Yee and
Michael Cohen and
Michael Gu and
Michael I. Ivanitskiy and
Michael Starritt and
Michael Strube and
Michal Swedrowski and
Michele Bevilacqua and
Michihiro Yasunaga and
Mihir Kale and
Mike Cain and
Mimee Xu and
Mirac Suzgun and
Mitch Walker and
Mo Tiwari and
Mohit Bansal and
Moin Aminnaseri and
Mor Geva and
Mozhdeh Gheini and
Mukund Varma T. and
Nanyun Peng and
Nathan A. Chi and
Nayeon Lee and
Neta Gur{-}Ari Krakover and
Nicholas Cameron and
Nicholas Roberts and
Nick Doiron and
Nicole Martinez and
Nikita Nangia and
Niklas Deckers and
Niklas Muennighoff and
Nitish Shirish Keskar and
Niveditha Iyer and
Noah Constant and
Noah Fiedel and
Nuan Wen and
Oliver Zhang and
Omar Agha and
Omar Elbaghdadi and
Omer Levy and
Owain Evans and
Pablo Antonio Moreno Casares and
Parth Doshi and
Pascale Fung and
Paul Pu Liang and
Paul Vicol and
Pegah Alipoormolabashi and
Peiyuan Liao and
Percy Liang and
Peter Chang and
Peter Eckersley and
Phu Mon Htut and
Pinyu Hwang and
Piotr Milkowski and
Piyush Patil and
Pouya Pezeshkpour and
Priti Oli and
Qiaozhu Mei and
Qing Lyu and
Qinlang Chen and
Rabin Banjade and
Rachel Etta Rudolph and
Raefer Gabriel and
Rahel Habacker and
Ramon Risco and
Rapha{\"{e}}l Milli{\`{e}}re and
Rhythm Garg and
Richard Barnes and
Rif A. Saurous and
Riku Arakawa and
Robbe Raymaekers and
Robert Frank and
Rohan Sikand and
Roman Novak and
Roman Sitelew and
Ronan LeBras and
Rosanne Liu and
Rowan Jacobs and
Rui Zhang and
Ruslan Salakhutdinov and
Ryan Chi and
Ryan Lee and
Ryan Stovall and
Ryan Teehan and
Rylan Yang and
Sahib Singh and
Saif M. Mohammad and
Sajant Anand and
Sam Dillavou and
Sam Shleifer and
Sam Wiseman and
Samuel Gruetter and
Samuel R. Bowman and
Samuel S. Schoenholz and
Sanghyun Han and
Sanjeev Kwatra and
Sarah A. Rous and
Sarik Ghazarian and
Sayan Ghosh and
Sean Casey and
Sebastian Bischoff and
Sebastian Gehrmann and
Sebastian Schuster and
Sepideh Sadeghi and
Shadi Hamdan and
Sharon Zhou and
Shashank Srivastava and
Sherry Shi and
Shikhar Singh and
Shima Asaadi and
Shixiang Shane Gu and
Shubh Pachchigar and
Shubham Toshniwal and
Shyam Upadhyay and
Shyamolima (Shammie) Debnath and
Siamak Shakeri and
Simon Thormeyer and
Simone Melzi and
Siva Reddy and
Sneha Priscilla Makini and
Soo{-}Hwan Lee and
Spencer Torene and
Sriharsha Hatwar and
Stanislas Dehaene and
Stefan Divic and
Stefano Ermon and
Stella Biderman and
Stephanie Lin and
Stephen Prasad and
Steven T. Piantadosi and
Stuart M. Shieber and
Summer Misherghi and
Svetlana Kiritchenko and
Swaroop Mishra and
Tal Linzen and
Tal Schuster and
Tao Li and
Tao Yu and
Tariq Ali and
Tatsu Hashimoto and
Te{-}Lin Wu and
Th{\'{e}}o Desbordes and
Theodore Rothschild and
Thomas Phan and
Tianle Wang and
Tiberius Nkinyili and
Timo Schick and
Timofei Kornev and
Titus Tunduny and
Tobias Gerstenberg and
Trenton Chang and
Trishala Neeraj and
Tushar Khot and
Tyler Shultz and
Uri Shaham and
Vedant Misra and
Vera Demberg and
Victoria Nyamai and
Vikas Raunak and
Vinay V. Ramasesh and
Vinay Uday Prabhu and
Vishakh Padmakumar and
Vivek Srikumar and
William Fedus and
William Saunders and
William Zhang and
Wout Vossen and
Xiang Ren and
Xiaoyu Tong and
Xinran Zhao and
Xinyi Wu and
Xudong Shen and
Yadollah Yaghoobzadeh and
Yair Lakretz and
Yangqiu Song and
Yasaman Bahri and
Yejin Choi and
Yichi Yang and
Yiding Hao and
Yifu Chen and
Yonatan Belinkov and
Yu Hou and
Yufang Hou and
Yuntao Bai and
Zachary Seid and
Zhuoye Zhao and
Zijian Wang and
Zijie J. Wang and
Zirui Wang and
Ziyi Wu},
title = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities
of language models},
journal = {Trans. Mach. Learn. Res.},
volume = {2023},
year = {2023}
}
@article{DBLP:journals/wc/SoltaniQHYMSLACKSBCBASTPSEECPWHS23,
author = {Mohammad Dehghani Soltani and
Ahmad Adnan Qidan and
Shenjie Huang and
Barzan A. Yosuf and
Sanaa H. Mohamed and
Ravinder Singh and
Yi Liu and
Wajahat Ali and
Rui Chen and
Hossein Kazemi and
Elham Sarbazi and
Bela Berde and
Dominique Chiaroni and
Bastien B{\'{e}}chadergue and
Fathi Abdeldayem and
Hardik Soni and
Jose Tabu and
Micheline Perrufel and
Nikola Serafimovski and
Taisir E. H. El{-}Gorashi and
Jaafar M. H. Elmirghani and
Michael J. Crisp and
Richard V. Penty and
Ian H. White and
Harald Haas and
Majid Safari},
title = {Terabit Indoor Laser-Based Wireless Communications: Lifi 2.0 For 6G},
journal = {{IEEE} Wirel. Commun.},
volume = {30},
number = {5},
pages = {36--43},
year = {2023}
}
@article{DBLP:journals/wpc/GangwarSMP23,
author = {Amisha Gangwar and
Sudhakar Singh and
Richa Mishra and
Shiv Prakash},
title = {The State-of-the-Art in Air Pollution Monitoring and Forecasting Systems
Using IoT, Big Data, and Machine Learning},
journal = {Wirel. Pers. Commun.},
volume = {130},
number = {3},
pages = {1699--1729},
year = {2023}
}
@article{DBLP:journals/wsarai/ChangJTP23,
author = {Richard Chang and
Wang Jie and
Namrata Thakur and
Ramanpreet Singh Pahwa},
title = {AI-based 3D Metrology and Defect Detection of HBMs in {XRM} Scans},
journal = {World Sci. Annu. Rev. Artif. Intell.},
volume = {1},
pages = {2440002:1--2440002:31},
year = {2023}
}
@inproceedings{DBLP:conf/aaai/BhatiaSSB0V23,
author = {Harshil Bhatia and
Jaisidh Singh and
Gaurav Sangwan and
Aparna Bharati and
Richa Singh and
Mayank Vatsa},
title = {IdProv: Identity-Based Provenance for Synthetic Image Generation (Student
Abstract)},
booktitle = {{AAAI}},
pages = {16164--16165},
publisher = {{AAAI} Press},
year = {2023}
}
@inproceedings{DBLP:conf/acl/FitzGeraldHPMRS23,
author = {Jack FitzGerald and
Christopher Hench and
Charith Peris and
Scott Mackie and
Kay Rottmann and
Ana Sanchez and
Aaron Nash and
Liam Urbach and
Vishesh Kakarala and
Richa Singh and
Swetha Ranganath and
Laurie Crist and
Misha Britan and
Wouter Leeuwis and
G{\"{o}}khan T{\"{u}}r and
Prem Natarajan},
title = {{MASSIVE:} {A} 1M-Example Multilingual Natural Language Understanding
Dataset with 51 Typologically-Diverse Languages},
booktitle = {{ACL} {(1)}},
pages = {4277--4302},
publisher = {Association for Computational Linguistics},
year = {2023}
}
@inproceedings{DBLP:conf/aied/MooreTSLHLLCKDB23,
author = {Steven Moore and
Richard Jiarui Tong and
Anjali Singh and
Zitao Liu and
Xiangen Hu and
Yu Lu and
Joleen Liang and
Chen Cao and
Hassan Khosravi and
Paul Denny and
Christopher Brooks and
John C. Stamper},
title = {Empowering Education with LLMs - The Next-Gen Interface and Content
Generation},
booktitle = {{AIED} (Posters/Late Breaking Results/...)},
series = {Communications in Computer and Information Science},
volume = {1831},
pages = {32--37},
publisher = {Springer},
year = {2023}
}
@inproceedings{DBLP:conf/cvpr/AgarwalRSV23,
author = {Akshay Agarwal and
Nalini K. Ratha and
Richa Singh and
Mayank Vatsa},
title = {Robustness Against Gradient based Attacks through Cost Effective Network
Fine-Tuning},
booktitle = {{CVPR} Workshops},
pages = {28--37},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/cvpr/NarayanATMV023,
author = {Kartik Narayan and
Harsh Agarwal and
Kartik Thakral and
Surbhi Mittal and
Mayank Vatsa and
Richa Singh},
title = {DF-Platter: Multi-Face Heterogeneous Deepfake Dataset},
booktitle = {{CVPR}},
pages = {9739--9748},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/fat/NorvalCS23,
author = {Chris Norval and
Richard Cloete and
Jatinder Singh},
title = {Navigating the Audit Landscape: {A} Framework for Developing Transparent
and Auditable {XR}},
booktitle = {FAccT},
pages = {1418--1431},
publisher = {{ACM}},
year = {2023}
}
@inproceedings{DBLP:conf/fgr/MittalTMVS23,
author = {Surbhi Mittal and
Kartik Thakral and
Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Are Face Detection Models Biased?},
booktitle = {{FG}},
pages = {1--7},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/fgr/ThakralMVS23,
author = {Kartik Thakral and
Surbhi Mittal and
Mayank Vatsa and
Richa Singh},
title = {PhygitalNet: Unified Face Presentation Attack Detection via One-Class
Isolation Learning},
booktitle = {{FG}},
pages = {1--6},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/icb/AgarwalCSSVSARAM23,
author = {Shivang Agarwal and
Jyoti Chaudhary and
Hard Savani and
Shivam Sharma and
Mayank Vatsa and
Richa Singh and
Shyam Prasad Adhikari and
Sangeeth Reddy and
Kshitij Agrawal and
Hemant Misra},
title = {Leveraging Synthetic Data and Hard Pair Mining for Selfie vs {ID}
Face Verification},
booktitle = {{IJCB}},
pages = {1--9},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/icb/DosiCSV23,
author = {Muskan Dosi and
Chiranjeev Chiranjeev and
Richa Singh and
Mayank Vatsa},
title = {UG-LDFace: Unified and Generalized Framework for Long-Range Disguised
Face Recognition},
booktitle = {{IJCB}},
pages = {1--9},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/icb/RanjanVS23,
author = {Rishabh Ranjan and
Mayank Vatsa and
Richa Singh},
title = {SV-DeiT: Speaker Verification with DeiTCap Spoofing Detection},
booktitle = {{IJCB}},
pages = {1--10},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/iclr/CarvalhoFLL023,
author = {Wilka Carvalho and
Angelos Filos and
Richard L. Lewis and
Honglak Lee and
Satinder Singh},
title = {Composing Task Knowledge With Modular Successor Feature Approximators},
booktitle = {{ICLR}},
publisher = {OpenReview.net},
year = {2023}
}
@inproceedings{DBLP:conf/iclr/GoswamiARSV23,
author = {Gaurav Goswami and
Akshay Agarwal and
Nalini K. Ratha and
Richa Singh and
Mayank Vatsa},
title = {Federated Learning for Local and Global Data Distribution},
booktitle = {Tiny Papers @ {ICLR}},
publisher = {OpenReview.net},
year = {2023}
}
@inproceedings{DBLP:conf/iclr/RuanSMAIFD23,
author = {Yangjun Ruan and
Saurabh Singh and
Warren Richard Morningstar and
Alexander A. Alemi and
Sergey Ioffe and
Ian Fischer and
Joshua V. Dillon},
title = {Weighted Ensemble Self-Supervised Learning},
booktitle = {{ICLR}},
publisher = {OpenReview.net},
year = {2023}
}
@inproceedings{DBLP:conf/iclr/ThakralMUGVS23,
author = {Kartik Thakral and
Surbhi Mittal and
Utkarsh Uppal and
Bharat Giddwani and
Mayank Vatsa and
Richa Singh},
title = {Self-Supervised Continual Learning},
booktitle = {Tiny Papers @ {ICLR}},
publisher = {OpenReview.net},
year = {2023}
}
@inproceedings{DBLP:conf/ijcai/AkhterR0VC23,
author = {Yasmeena Akhter and
Rishabh Ranjan and
Richa Singh and
Mayank Vatsa and
Santanu Chaudhury},
title = {On AI-Assisted Pneumoconiosis Detection from Chest X-rays},
booktitle = {{IJCAI}},
pages = {6353--6361},
publisher = {ijcai.org},
year = {2023}
}
@inproceedings{DBLP:conf/ijcai/KhanAV0S23,
author = {Misaal Khan and
Shivang Agarwal and
Mayank Vatsa and
Richa Singh and
Kuldeep Singh},
title = {NutriAI: AI-Powered Child Malnutrition Assessment in Low-Resource
Environments},
booktitle = {{IJCAI}},
pages = {6378--6385},
publisher = {ijcai.org},
year = {2023}
}
@inproceedings{DBLP:conf/ijcai/KshitizSMV0ASP23,
author = {Kshitiz and
Sonu Shreshtha and
Ramy Mounir and
Mayank Vatsa and
Richa Singh and
Saket Anand and
Sudeep Sarkar and
Sevaram Mali Parihar},
title = {Long-term Monitoring of Bird Flocks in the Wild},
booktitle = {{IJCAI}},
pages = {6344--6352},
publisher = {ijcai.org},
year = {2023}
}
@inproceedings{DBLP:conf/ijcai/RanjanV023,
author = {Rishabh Ranjan and
Mayank Vatsa and
Richa Singh},
title = {Uncovering the Deceptions: An Analysis on Audio Spoofing Detection
and Future Prospects},
booktitle = {{IJCAI}},
pages = {6750--6758},
publisher = {ijcai.org},
year = {2023}
}
@inproceedings{DBLP:conf/interact/SoubuttsSKADSMSSFPHR23,
author = {Ewan Soubutts and
Aneesha Singh and
Bran Knowles and
Amid Ayobi and
Nervo Verdezeto Dias and
Britta F. Schulte and
Julia McDowell and
Caroline Swarbrick and
Andrew Steptoe and
Jasmine Fledderjohann and
Helen Petrie and
Richard Harper and
Yvonne Rogers},
title = {Playful, Curious, Creative, Equitable: Exploring Opportunities for
{AI} Technologies with Older Adults},
booktitle = {{INTERACT} {(4)}},
series = {Lecture Notes in Computer Science},
volume = {14145},
pages = {662--667},
publisher = {Springer},
year = {2023}
}
@inproceedings{DBLP:conf/iwbf/MalhotraVS23,
author = {Aakarsh Malhotra and
Mayank Vatsa and
Richa Singh},
title = {{MMFV:} {A} Multi-Movement Finger-Video Database for Contactless Fingerprint
Recognition},
booktitle = {{IWBF}},
pages = {1--6},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/nips/BrooksWL023,
author = {Ethan A. Brooks and
Logan Walls and
Richard L. Lewis and
Satinder Singh},
title = {Large Language Models can Implement Policy Iteration},
booktitle = {NeurIPS},
year = {2023}
}
@inproceedings{DBLP:conf/nips/Carvalho0FLMLL023,
author = {Wilka Carvalho and
Andre Saraiva and
Angelos Filos and
Andrew K. Lampinen and
Loic Matthey and
Richard L. Lewis and
Honglak Lee and
Satinder Singh and
Danilo Jimenez Rezende and
Daniel Zoran},
title = {Combining Behaviors with the Successor Features Keyboard},
booktitle = {NeurIPS},
year = {2023}
}
@inproceedings{DBLP:conf/nips/DesaiBMMSPLDLCB23,
author = {Aashaka Desai and
Lauren Berger and
Fyodor Minakov and
Nessa Milano and
Chinmay Singh and
Kriston Pumphrey and
Richard E. Ladner and
Hal Daum{\'{e}} III and
Alex X. Lu and
Naomi Caselli and
Danielle Bragg},
title = {{ASL} Citizen: {A} Community-Sourced Dataset for Advancing Isolated
Sign Language Recognition},
booktitle = {NeurIPS},
year = {2023}
}
@inproceedings{DBLP:conf/secdev/MurphyMSC23,
author = {Sinnott Murphy and
Richard Macwan and
Vivek Kumar Singh and
Chin{-}Yao Chang},
title = {A randomization-based, zero-trust cyberattack detection method for
hierarchical systems},
booktitle = {SecDev},
pages = {145--155},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/sigcomm/EasonHCNBAL23,
author = {John P. Eason and
Xueqi He and
Richard Cziva and
Max Noormohammadpour and
Srivatsan Balasubramanian and
Satyajeet Singh Ahuja and
Biao Lu},
title = {Hose-based cross-layer backbone network design with Benders decomposition},
booktitle = {{SIGCOMM}},
pages = {333--345},
publisher = {{ACM}},
year = {2023}
}
@inproceedings{DBLP:conf/siggraph/ParmarS0LLZ23,
author = {Gaurav Parmar and
Krishna Kumar Singh and
Richard Zhang and
Yijun Li and
Jingwan Lu and
Jun{-}Yan Zhu},
title = {Zero-shot Image-to-Image Translation},
booktitle = {{SIGGRAPH} (Conference Paper Track)},
pages = {11:1--11:11},
publisher = {{ACM}},
year = {2023}
}
@inproceedings{DBLP:conf/wacv/AgarwalRNSV23,
author = {Akshay Agarwal and
Nalini K. Ratha and
Afzel Noore and
Richa Singh and
Mayank Vatsa},
title = {Misclassifications of Contact Lens Iris {PAD} Algorithms: Is it Gender
Bias or Environmental Conditions?},
booktitle = {{WACV}},
pages = {961--970},
publisher = {{IEEE}},
year = {2023}
}
@proceedings{DBLP:conf/aied/2023llm,
editor = {Steven Moore and
John C. Stamper and
Richard Jiarui Tong and
Chen Cao and
Zitao Liu and
Xiangen Hu and
Yu Lu and
Joleen Liang and
Hassan Khosravi and
Paul Denny and
Anjali Singh and
Christopher Brooks},
title = {Proceedings of the Workshop on Empowering Education with LLMs - the
Next-Gen Interface and Content Generation 2023 co-located with 24th
International Conference on Artificial Intelligence in Education {(AIED}
2023), Tokyo, Japan, July 7, 2023},
series = {{CEUR} Workshop Proceedings},
volume = {3487},
publisher = {CEUR-WS.org},
year = {2023}
}
@article{DBLP:journals/corr/abs-2301-12305,
author = {Wilka Carvalho and
Angelos Filos and
Richard L. Lewis and
Honglak Lee and
Satinder Singh},
title = {Composing Task Knowledge with Modular Successor Feature Approximators},
journal = {CoRR},
volume = {abs/2301.12305},
year = {2023}
}
@article{DBLP:journals/corr/abs-2302-03027,
author = {Gaurav Parmar and
Krishna Kumar Singh and
Richard Zhang and
Yijun Li and
Jingwan Lu and
Jun{-}Yan Zhu},
title = {Zero-shot Image-to-Image Translation},
journal = {CoRR},
volume = {abs/2302.03027},
year = {2023}
}
@article{DBLP:journals/corr/abs-2304-05934,
author = {Aashaka Desai and
Lauren Berger and
Fyodor O. Minakov and
Vanessa Milan and
Chinmay Singh and
Kriston Pumphrey and
Richard E. Ladner and
Hal Daum{\'{e}} III and
Alex X. Lu and
Naomi Caselli and
Danielle Bragg},
title = {{ASL} Citizen: {A} Community-Sourced Dataset for Advancing Isolated
Sign Language Recognition},
journal = {CoRR},
volume = {abs/2304.05934},
year = {2023}
}
@article{DBLP:journals/corr/abs-2304-09574,
author = {Amisha Gangwar and
Sudhakar Singh and
Richa Mishra and
Shiv Prakash},
title = {The State-of-the-Art in Air Pollution Monitoring and Forecasting Systems
using IoT, Big Data, and Machine Learning},
journal = {CoRR},
volume = {abs/2304.09574},
year = {2023}
}
@article{DBLP:journals/corr/abs-2305-09863,
author = {Chandan Singh and
Aliyah R. Hsu and
Richard Antonello and
Shailee Jain and
Alexander G. Huth and
Bin Yu and
Jianfeng Gao},
title = {Explaining black box text modules in natural language with language
models},
journal = {CoRR},
volume = {abs/2305.09863},
year = {2023}
}
@article{DBLP:journals/corr/abs-2305-11896,
author = {Ayush Singh Rajput and
Richa Gupta},
title = {Hyper-automation-The next peripheral for automation in {IT} industries},
journal = {CoRR},
volume = {abs/2305.11896},
year = {2023}
}
@article{DBLP:journals/corr/abs-2305-13672,
author = {Elahe Vedadi and
Joshua V. Dillon and
Philip Andrew Mansfield and
Karan Singhal and
Arash Afkanpour and
Warren Richard Morningstar},
title = {Federated Variational Inference: Towards Improved Personalization
and Generalization},
journal = {CoRR},
volume = {abs/2305.13672},
year = {2023}
}
@article{DBLP:journals/corr/abs-2307-02881,
author = {Peter H. Tu and
Zhaoyuan Yang and
Richard I. Hartley and
Zhiwei Xu and
Jing Zhang and
Dylan Campbell and
Jaskirat Singh and
Tianyu Wang},
title = {Probabilistic and Semantic Descriptions of Image Manifolds and Their
Applications},
journal = {CoRR},
volume = {abs/2307.02881},
year = {2023}
}
@article{DBLP:journals/corr/abs-2307-06669,
author = {Rishabh Ranjan and
Mayank Vatsa and
Richa Singh},
title = {Uncovering the Deceptions: An Analysis on Audio Spoofing Detection
and Future Prospects},
journal = {CoRR},
volume = {abs/2307.06669},
year = {2023}
}
@article{DBLP:journals/corr/abs-2309-05213,
author = {Pengfei Guo and
Warren Richard Morningstar and
Raviteja Vemulapalli and
Karan Singhal and
Vishal M. Patel and
Philip Andrew Mansfield},
title = {Towards Federated Learning Under Resource Constraints via Layer-wise
Training and Depth Dropout},
journal = {CoRR},
volume = {abs/2309.05213},
year = {2023}
}
@article{DBLP:journals/corr/abs-2309-13542,
author = {Aryan Kaushik and
Rohit Singh and
Ming Li and
Honghao Luo and
Shalanika Dayarathna and
Rajitha Senanayake and
Xueli An and
Richard A. Stirling{-}Gallacher and
Wonjae Shin and
Marco Di Renzo},
title = {Integrated Sensing and Communications for IoT: Synergies with Key
6G Technology Enablers},
journal = {CoRR},
volume = {abs/2309.13542},
year = {2023}
}
@article{DBLP:journals/corr/abs-2310-07209,
author = {Mahapara Khurshid and
Mayank Vatsa and
Richa Singh},
title = {Multi-task Explainable Skin Lesion Classification},
journal = {CoRR},
volume = {abs/2310.07209},
year = {2023}
}
@article{DBLP:journals/corr/abs-2310-15848,
author = {Surbhi Mittal and
Kartik Thakral and
Richa Singh and
Mayank Vatsa and
Tamar Glaser and
Cristian Canton{-}Ferrer and
Tal Hassner},
title = {On Responsible Machine Learning Datasets with Fairness, Privacy, and
Regulatory Norms},
journal = {CoRR},
volume = {abs/2310.15848},
year = {2023}
}
@article{DBLP:journals/corr/abs-2310-15940,
author = {Wilka Carvalho and
Andre Saraiva and
Angelos Filos and
Andrew Kyle Lampinen and
Loic Matthey and
Richard L. Lewis and
Honglak Lee and
Satinder Singh and
Danilo J. Rezende and
Daniel Zoran},
title = {Combining Behaviors with the Successor Features Keyboard},
journal = {CoRR},
volume = {abs/2310.15940},
year = {2023}
}
@article{DBLP:journals/corr/abs-2310-20081,
author = {Christopher Richardson and
Yao Zhang and
Kellen Gillespie and
Sudipta Kar and
Arshdeep Singh and
Zeynab Raeesy and
Omar Zia Khan and
Abhinav Sethy},
title = {Integrating Summarization and Retrieval for Enhanced Personalization
via Large Language Models},
journal = {CoRR},
volume = {abs/2310.20081},
year = {2023}
}
@article{DBLP:journals/corr/abs-2311-03425,
author = {Faris F. Gulamali and
Ashwin S. Sawant and
Lora Liharska and
Carol R. Horowitz and
Lili Chan and
Patricia H. Kovatch and
Ira Hofer and
Karandeep Singh and
Lynne D. Richardson and
Emmanuel Mensah and
Alexander W. Charney and
David L. Reich and
Jianying Hu and
Girish N. Nadkarni},
title = {An AI-Guided Data Centric Strategy to Detect and Mitigate Biases in
Healthcare Datasets},
journal = {CoRR},
volume = {abs/2311.03425},
year = {2023}
}
@article{DBLP:journals/corr/abs-2311-03629,
author = {Philip Andrew Mansfield and
Arash Afkanpour and
Warren Richard Morningstar and
Karan Singhal},
title = {Random Field Augmentations for Self-Supervised Representation Learning},
journal = {CoRR},
volume = {abs/2311.03629},
year = {2023}
}
@article{DBLP:journals/corr/abs-2311-06792,
author = {Zhaoyuan Yang and
Zhengyang Yu and
Zhiwei Xu and
Jaskirat Singh and
Jing Zhang and
Dylan Campbell and
Peter H. Tu and
Richard I. Hartley},
title = {{IMPUS:} Image Morphing with Perceptually-Uniform Sampling Using Diffusion
Models},
journal = {CoRR},
volume = {abs/2311.06792},
year = {2023}
}
@article{DBLP:journals/corr/abs-2312-01187,
author = {Renan A. Rojas{-}Gomez and
Karan Singhal and
Ali Etemad and
Alex Bijamov and
Warren R. Morningstar and
Philip Andrew Mansfield},
title = {{SASSL:} Enhancing Self-Supervised Learning via Neural Style Transfer},
journal = {CoRR},
volume = {abs/2312.01187},
year = {2023}
}
@article{DBLP:journals/corr/abs-2312-02205,
author = {Neha Mukund Kalibhat and
Warren R. Morningstar and
Alex Bijamov and
Luyang Liu and
Karan Singhal and
Philip Andrew Mansfield},
title = {Disentangling the Effects of Data Augmentation and Format Transform
in Self-Supervised Learning of Image Representations},
journal = {CoRR},
volume = {abs/2312.02205},
year = {2023}
}
@article{DBLP:journals/corr/abs-2312-04231,
author = {Mayank Vatsa and
Anubhooti Jain and
Richa Singh},
title = {Adventures of Trustworthy Vision-Language Models: {A} Survey},
journal = {CoRR},
volume = {abs/2312.04231},
year = {2023}
}
@article{DBLP:journals/corr/abs-2312-05461,
author = {Ryan J. Urbanowicz and
Harsh Bandhey and
Brendan T. Keenan and
Greg Maislin and
Sy Hwang and
Danielle L. Mowery and
Shannon M. Lynch and
Diego R. Mazzotti and
Fang Han and
Qing Yun Li and
Thomas Penzel and
Sergio Tufik and
Lia Bittencourt and
Thorarinn Gislason and
Philip de Chazal and
Bhajan Singh and
Nigel McArdle and
Ning{-}Hung Chen and
Allan Pack and
Richard J. Schwab and
Peter A. Cistulli and
Ulysses J. Magalang},
title = {{STREAMLINE:} An Automated Machine Learning Pipeline for Biomedicine
Applied to Examine the Utility of Photography-Based Phenotypes for
{OSA} Prediction Across International Sleep Centers},
journal = {CoRR},
volume = {abs/2312.05461},
year = {2023}
}
@article{DBLP:journals/aamas/VamplewSKRRRHHM22,
author = {Peter Vamplew and
Benjamin J. Smith and
Johan K{\"{a}}llstr{\"{o}}m and
Gabriel de Oliveira Ramos and
Roxana Radulescu and
Diederik M. Roijers and
Conor F. Hayes and
Fredrik Heintz and
Patrick Mannion and
Pieter J. K. Libin and
Richard Dazeley and
Cameron Foale},
title = {Scalar reward is not enough: a response to Silver, Singh, Precup and
Sutton {(2021)}},
journal = {Auton. Agents Multi Agent Syst.},
volume = {36},
number = {2},
pages = {41},
year = {2022}
}
@article{DBLP:journals/access/SinghIV22,
author = {Avinash Singh and
Richard Adeyemi Ikuesan and
Hein S. Venter},
title = {Secure Storage Model for Digital Forensic Readiness},
journal = {{IEEE} Access},
volume = {10},
pages = {19469--19480},
year = {2022}
}
@article{DBLP:journals/candc/SinghMKSYRKSS22,
author = {Vishal Kumar Singh and
Richa Mishra and
Priyanka Kumari and
Anup Som and
Aditya K. Yadav and
Nand K. Ram and
Pradeep Kumar and
Dominique Schols and
Ramendra K. Singh},
title = {\emph{In silico} design, synthesis and anti-HIV activity of quinoline
derivatives as non-nucleoside reverse transcriptase inhibitors (NNRTIs)},
journal = {Comput. Biol. Chem.},
volume = {98},
pages = {107675},
year = {2022}
}
@article{DBLP:journals/cviu/TripathiAKLKVS22,
author = {Pavani Tripathi and
Yasmeena Akhter and
Mahapara Khurshid and
Aditya Lakra and
Rohit Keshari and
Mayank Vatsa and
Richa Singh},
title = {{MTCD:} Cataract detection via near infrared eye images},
journal = {Comput. Vis. Image Underst.},
volume = {214},
pages = {103303},
year = {2022}
}
@article{DBLP:journals/electronicmarkets/MisraMSKR22,
author = {Richa Misra and
Renuka Mahajan and
Nidhi Singh and
Sangeeta Khorana and
Nripendra P. Rana},
title = {Factors impacting behavioural intentions to adopt the electronic marketplace:
findings from small businesses in India},
journal = {Electron. Mark.},
volume = {32},
number = {3},
pages = {1639--1660},
year = {2022}
}
@article{DBLP:journals/epjds/BuskirkBEMSY22,
author = {Trent Buskirk and
Brian P. Blakely and
Adam Eck and
Richard McGrath and
Ravinder Singh and
Youzhi Yu},
title = {Sweet tweets! Evaluating a new approach for probability-based sampling
of Twitter},
journal = {{EPJ} Data Sci.},
volume = {11},
number = {1},
pages = {9},
year = {2022}
}
@article{DBLP:journals/fdata/AgarwalSVN22,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Boosting Face Presentation Attack Detection in Multi-Spectral Videos
Through Score Fusion of Wavelet Partition Images},
journal = {Frontiers Big Data},
volume = {5},
year = {2022}
}
@article{DBLP:journals/fdata/MilneSBKLNSMH22,
author = {Richard Milne and
Mark Sheehan and
Brendan Barnes and
Janek Kapper and
Nathan Lea and
James N'Dow and
Gurparkash Singh and
Amelia Mart{\'{\i}}n{-}Uranga and
Nigel Hughes},
title = {A concentric circles view of health data relations facilitates understanding
of sociotechnical challenges for learning health systems and the role
of federated data networks},
journal = {Frontiers Big Data},
volume = {5},
year = {2022}
}
@article{DBLP:journals/fdgth/PaulRTKJSIM0BHM22,
author = {Tanmoy Paul and
Md Kamruz Zaman Rana and
Preethi Aishwarya Tautam and
Teja Venkat Pavan Kotapati and
Yaswitha Jampani and
Nitesh Singh and
Humayera Islam and
Vasanthi Mandhadi and
Vishakha Sharma and
Michael Barnes and
Richard D. Hammer and
Abu Saleh Mohammad Mosa},
title = {Investigation of the Utility of Features in a Clinical De-identification
Model: {A} Demonstration Using {EHR} Pathology Reports for Advanced
{NSCLC} Patients},
journal = {Frontiers Digit. Health},
volume = {4},
pages = {728922},
year = {2022}
}
@article{DBLP:journals/ijaip/SharmaVS22,
author = {Richa Sharma and
Vasudha Vashisht and
Umang Singh},
title = {eeFFA/DE - a fuzzy-based clustering algorithm using hybrid technique
for wireless sensor networks},
journal = {Int. J. Adv. Intell. Paradigms},
volume = {21},
number = {1/2},
pages = {129--157},
year = {2022}
}
@article{DBLP:journals/ijesma/MisraMS22,
author = {Richa Misra and
Renuka Mahajan and
Nidhi Singh},
title = {Analysis of Factors Affecting Intent to Use Mobile Commerce Services
in India},
journal = {Int. J. {E} Serv. Mob. Appl.},
volume = {14},
number = {1},
pages = {1--21},
year = {2022}
}
@article{DBLP:journals/ijiit/SinghDK22,
author = {Richa Singh and
Ashwani Kumar Dubey and
Rajiv Kapoor},
title = {Deep Neural Network Regularization {(DNNR)} on Denoised Image},
journal = {Int. J. Intell. Inf. Technol.},
volume = {18},
number = {1},
pages = {1--16},
year = {2022}
}
@article{DBLP:journals/ijissc/RastogiCRCAAS22,
author = {Rohit Rastogi and
Devendra K. Chaturvedi and
Mukund K. Rastogi and
Saransh Chauhan and
Vaibhav Aggarwal and
Utkarsh Agrawal and
Richa Singh},
title = {Examining Vedic Yajna's Effects on the {AQI} of India in the Second
Wave of the {COVID-19} Pandemic: An Healthcare 4.0 Concept for Smart
Cities 5.0},
journal = {Int. J. Inf. Syst. Soc. Chang.},
volume = {13},
number = {1},
pages = {1--20},
year = {2022}
}
@article{DBLP:journals/ijoe/RichaKS22,
author = {Richa and
Karamjit Kaur and
Priti Singh},
title = {A Novel {MRI} And {CT} Image Fusion Based on Discrete Wavelet Transform
and Principal Component Analysis for Enhanced Clinical Diagnosis},
journal = {Int. J. Online Biomed. Eng.},
volume = {18},
number = {10},
pages = {64--82},
year = {2022}
}
@article{DBLP:journals/ijpe/SharmaS22,
author = {Richa Sharma and
Shailendra Narayan Singh},
title = {Towards Accurate Heart Disease Prediction System: An Enhanced Machine
Learning Approach},
journal = {Int. J. Perform. Eng.},
volume = {18},
number = {2},
pages = {136},
year = {2022}
}
@article{DBLP:journals/ijwbc/MisraMS22,
author = {Richa Misra and
Renuka Mahajan and
Nidhi Singh},
title = {Demystifying social media usage for insurance-related purchase intentions
among senior users in the pandemic period},
journal = {Int. J. Web Based Communities},
volume = {18},
number = {1},
pages = {64--86},
year = {2022}
}
@article{DBLP:journals/jksucis/SharmaVS22,
author = {Richa Sharma and
Vasudha Vashisht and
Umang Singh},
title = {Fuzzy modelling based energy aware clustering in wireless sensor networks
using modified invasive weed optimization},
journal = {J. King Saud Univ. Comput. Inf. Sci.},
volume = {34},
number = {5},
pages = {1884--1894},
year = {2022}
}
@article{DBLP:journals/lgrs/SinghCNCY22,
author = {Anirudh Singh and
Amit Chougule and
Pratik Narang and
Vinay Chamola and
F. Richard Yu},
title = {Low-Light Image Enhancement for UAVs With Multi-Feature Fusion Deep
Neural Networks},
journal = {{IEEE} Geosci. Remote. Sens. Lett.},
volume = {19},
pages = {1--5},
year = {2022}
}
@article{DBLP:journals/mia/LuCKLSWCM22,
author = {Ming Y. Lu and
Richard J. Chen and
Dehan Kong and
Jana Lipkov{\'{a}} and
Rajendra Singh and
Drew F. K. Williamson and
Tiffany Y. Chen and
Faisal Mahmood},
title = {Federated learning for computational pathology on gigapixel whole
slide images},
journal = {Medical Image Anal.},
volume = {76},
pages = {102298},
year = {2022}
}
@article{DBLP:journals/pami/SinghNSV22,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {DeriveNet for (Very) Low Resolution Image Classification},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {44},
number = {10},
pages = {6569--6577},
year = {2022}
}
@article{DBLP:journals/ploscb/JiangSWHP22,
author = {Richard M. Jiang and
Prashant Singh and
Fredrik Wrede and
Andreas Hellander and
Linda R. Petzold},
title = {Identification of dynamic mass-action biochemical reaction networks
using sparse Bayesian methods},
journal = {PLoS Comput. Biol.},
volume = {18},
number = {1},
year = {2022}
}
@article{DBLP:journals/pr/MalhotraMMCTVSC22,
author = {Aakarsh Malhotra and
Surbhi Mittal and
Puspita Majumdar and
Saheb Chhabra and
Kartik Thakral and
Mayank Vatsa and
Richa Singh and
Santanu Chaudhury and
Ashwin Pudrod and
Anjali Agrawal},
title = {Multi-task driven explainable diagnosis of {COVID-19} using chest
X-ray images},
journal = {Pattern Recognit.},
volume = {122},
pages = {108243},
year = {2022}
}
@article{DBLP:journals/prl/AgarwalNVS22,
author = {Akshay Agarwal and
Afzel Noore and
Mayank Vatsa and
Richa Singh},
title = {Enhanced iris presentation attack detection via contraction-expansion
{CNN}},
journal = {Pattern Recognit. Lett.},
volume = {159},
pages = {61--69},
year = {2022}
}
@article{DBLP:journals/saem/SinghDK22,
author = {Richa Singh and
Ashwani Kumar Dubey and
Rajiv Kapoor},
title = {Image dehazing using autoencoder convolutional neural network},
journal = {Int. J. Syst. Assur. Eng. Manag.},
volume = {13},
number = {6},
pages = {3002--3016},
year = {2022}
}
@article{DBLP:journals/tbbis/AgarwalNVS22,
author = {Akshay Agarwal and
Afzel Noore and
Mayank Vatsa and
Richa Singh},
title = {Generalized Contact Lens Iris Presentation Attack Detection},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {4},
number = {3},
pages = {373--385},
year = {2022}
}
@article{DBLP:journals/tbbis/GhoshVS22,
author = {Soumyadeep Ghosh and
Mayank Vatsa and
Richa Singh},
title = {{SUPREAR-NET:} Supervised Resolution Enhancement and Recognition Network},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {4},
number = {2},
pages = {185--196},
year = {2022}
}
@article{DBLP:journals/tcsv/SinghNSV22,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {Disguise Resilient Face Verification},
journal = {{IEEE} Trans. Circuits Syst. Video Technol.},
volume = {32},
number = {6},
pages = {3895--3905},
year = {2022}
}
@article{DBLP:journals/tip/AgarwalRVS22,
author = {Akshay Agarwal and
Nalini K. Ratha and
Mayank Vatsa and
Richa Singh},
title = {Crafting Adversarial Perturbations via Transformed Image Component
Swapping},
journal = {{IEEE} Trans. Image Process.},
volume = {31},
pages = {7338--7349},
year = {2022}
}
@article{DBLP:journals/titb/DhanukaTS22,
author = {Richa Dhanuka and
Anushree Tripathi and
Jyoti Prakash Singh},
title = {A Semi-Supervised Autoencoder-Based Approach for Protein Function
Prediction},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {26},
number = {10},
pages = {4957--4965},
year = {2022}
}
@article{DBLP:journals/tnn/AgarwalGVSR22,
author = {Akshay Agarwal and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {{DAMAD:} Database, Attack, and Model Agnostic Adversarial Perturbation
Detector},
journal = {{IEEE} Trans. Neural Networks Learn. Syst.},
volume = {33},
number = {8},
pages = {3277--3289},
year = {2022}
}
@article{DBLP:journals/tvt/SmithSDCG22,
author = {Peter J. Smith and
Ikram Singh and
Pawel A. Dmochowski and
Justin P. Coon and
Richard D. Green},
title = {Flexible Mobility Models Using Stochastic Differential Equations},
journal = {{IEEE} Trans. Veh. Technol.},
volume = {71},
number = {4},
pages = {4312--4321},
year = {2022}
}
@inproceedings{DBLP:conf/aaai/0001MMV22,
author = {Richa Singh and
Puspita Majumdar and
Surbhi Mittal and
Mayank Vatsa},
title = {Anatomizing Bias in Facial Analysis},
booktitle = {{AAAI}},
pages = {12351--12358},
publisher = {{AAAI} Press},
year = {2022}
}
@inproceedings{DBLP:conf/aaai/AryaBCDHHHLLMMP22,
author = {Vijay Arya and
Rachel K. E. Bellamy and
Pin{-}Yu Chen and
Amit Dhurandhar and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Q. Vera Liao and
Ronny Luss and
Aleksandra Mojsilovic and
Sami Mourad and
Pablo Pedemonte and
Ramya Raghavendra and
John T. Richards and
Prasanna Sattigeri and
Karthikeyan Shanmugam and
Moninder Singh and
Kush R. Varshney and
Dennis Wei and
Yunfeng Zhang},
title = {{AI} Explainability 360: Impact and Design},
booktitle = {{AAAI}},
pages = {12651--12657},
publisher = {{AAAI} Press},
year = {2022}
}
@inproceedings{DBLP:conf/aaai/ZhengVL022,
author = {Zeyu Zheng and
Risto Vuorio and
Richard L. Lewis and
Satinder Singh},
title = {Adaptive Pairwise Weights for Temporal Credit Assignment},
booktitle = {{AAAI}},
pages = {9225--9232},
publisher = {{AAAI} Press},
year = {2022}
}
@inproceedings{DBLP:conf/bcb/SarkarSBDK22,
author = {Aisharjya Sarkar and
Aaditya Singh and
Richard Bailey and
Alin Dobra and
Tamer Kahveci},
title = {Optimal separation of high dimensional transcriptome for complex multigenic
traits},
booktitle = {{BCB}},
pages = {32:1--32:5},
publisher = {{ACM}},
year = {2022}
}
@inproceedings{DBLP:conf/bmvc/ZhaoXQP022,
author = {Ziyuan Zhao and
Mingxi Xu and
Peisheng Qian and
Ramanpreet Singh Pahwa and
Richard Chang},
title = {{DA-CIL:} Towards Domain Adaptive Class-Incremental 3D Object Detection},
booktitle = {{BMVC}},
pages = {916},
publisher = {{BMVA} Press},
year = {2022}
}
@inproceedings{DBLP:conf/centeris/McubaSIV22,
author = {Mvelo Mcuba and
Avinash Singh and
Richard Adeyemi Ikuesan and
Hein S. Venter},
title = {The Effect of Deep Learning Methods on Deepfake Audio Detection for
Digital Investigation},
booktitle = {CENTERIS/ProjMAN/HCist},
series = {Procedia Computer Science},
volume = {219},
pages = {211--219},
publisher = {Elsevier},
year = {2022}
}
@inproceedings{DBLP:conf/centeris/MunkhondyaISV22,
author = {Howard Munkhondya and
Richard Adeyemi Ikuesan and
Avinash Singh and
Hein S. Venter},
title = {Understanding Issues and Challenges of {DFR} Implementation in {SDN}
Platform},
booktitle = {CENTERIS/ProjMAN/HCist},
series = {Procedia Computer Science},
volume = {219},
pages = {286--293},
publisher = {Elsevier},
year = {2022}
}
@inproceedings{DBLP:conf/chi/SinghalNBK22,
author = {Yatharth Singhal and
Richard Huynh Noeske and
Ayush Bhardwaj and
Jin Ryong Kim},
title = {Improving Finger Stroke Recognition Rate for Eyes-Free Mid-Air Typing
in {VR}},
booktitle = {{CHI}},
pages = {346:1--346:9},
publisher = {{ACM}},
year = {2022}
}
@inproceedings{DBLP:conf/cvmi/RakeshLMUCGDKSS22,
author = {Sumit Rakesh and
Foteini Liwicki and
Hamam Mokayed and
Richa Upadhyay and
Prakash Chandra Chhipa and
Vibha Gupta and
Kanjar De and
Gy{\"{o}}rgy Kov{\'{a}}cs and
Dinesh Singh and
Rajkumar Saini},
title = {Emotions Classification Using {EEG} in Health Care},
booktitle = {{CVMI}},
series = {Lecture Notes in Networks and Systems},
volume = {586},
pages = {37--49},
publisher = {Springer},
year = {2022}
}
@inproceedings{DBLP:conf/cvpr/0001RV022,
author = {Akshay Agarwal and
Nalini K. Ratha and
Mayank Vatsa and
Richa Singh},
title = {Exploring Robustness Connection between Artificial and Natural Adversarial
Examples},
booktitle = {{CVPR} Workshops},
pages = {178--185},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/cvpr/NarayanAMTKV022,
author = {Kartik Narayan and
Harsh Agarwal and
Surbhi Mittal and
Kartik Thakral and
Suman Kundu and
Mayank Vatsa and
Richa Singh},
title = {DeSI: Deepfake Source Identifier for Social Media},
booktitle = {{CVPR} Workshops},
pages = {2857--2866},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/cvpr/ParmarLL0ZS22,
author = {Gaurav Parmar and
Yijun Li and
Jingwan Lu and
Richard Zhang and
Jun{-}Yan Zhu and
Krishna Kumar Singh},
title = {Spatially-Adaptive Multilayer Selection for {GAN} Inversion and Editing},
booktitle = {{CVPR}},
pages = {11389--11399},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/eccv/AgarwalRVS22,
author = {Akshay Agarwal and
Nalini K. Ratha and
Mayank Vatsa and
Richa Singh},
title = {Benchmarking Robustness Beyond l\({}_{\mbox{p}}\) Norm Adversaries},
booktitle = {{ECCV} Workshops {(1)}},
series = {Lecture Notes in Computer Science},
volume = {13801},
pages = {342--359},
publisher = {Springer},
year = {2022}
}
@inproceedings{DBLP:conf/eurosp/IslamMSSS22,
author = {Saad Islam and
Koksal Mus and
Richa Singh and
Patrick Schaumont and
Berk Sunar},
title = {Signature Correction Attack on Dilithium Signature Scheme},
booktitle = {EuroS{\&}P},
pages = {647--663},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/ic3i/SrivastavRSGS22,
author = {Gaurav Srivastav and
Mamoon Rashid and
Richa Singh and
Anita Gehlot and
Neha Sharma},
title = {Breast Cancer Detection in Mammogram Images using Machine Learning
Methods and {CLAHE} Algorithm},
booktitle = {{IC3I}},
pages = {1187--1192},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/icassp/NwePCMWLLPD22,
author = {Tin Lay Nwe and
Ramanpreet Singh Pahwa and
Richard Chang and
Oo Zaw Min and
Jie Wang and
Yiqun Li and
Dongyun Lin and
Shitala Prasad and
Sheng Dong},
title = {On the Use of Component Structural Characteristics for Voxel Segmentation
in Semicon 3D Images},
booktitle = {{ICASSP}},
pages = {2694--2698},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/icassp/SinghCMSV22,
author = {Aditya Singh and
Saheb Chhabra and
Puspita Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Mannet: {A} Large-Scale Manipulated Image Detection Dataset And Baseline
Evaluations},
booktitle = {{ICASSP}},
pages = {1780--1784},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/icb/BharatiCVSB22,
author = {Aparna Bharati and
Emma Connors and
Mayank Vatsa and
Richa Singh and
Kevin W. Bowyer},
title = {In-group and Out-group Performance Bias in Facial Retouching Detection},
booktitle = {{IJCB}},
pages = {1--10},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/icb/NarayanATMVS22,
author = {Kartik Narayan and
Harsh Agarwal and
Kartik Thakral and
Surbhi Mittal and
Mayank Vatsa and
Richa Singh},
title = {DeePhy: On Deepfake Phylogeny},
booktitle = {{IJCB}},
pages = {1--10},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/icb/RanjanVS22,
author = {Rishabh Ranjan and
Mayank Vatsa and
Richa Singh},
title = {STATNet: Spectral and Temporal features based Multi-Task Network for
Audio Spoofing Detection},
booktitle = {{IJCB}},
pages = {1--9},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/icip/CaiPXW0ZF22,
author = {Lile Cai and
Ramanpreet Singh Pahwa and
Xun Xu and
Jie Wang and
Richard Chang and
Lining Zhang and
Chuan{-}Sheng Foo},
title = {Exploring Active Learning for Semiconductor Defect Segmentation},
booktitle = {{ICIP}},
pages = {1796--1800},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/iclr/0002MNS22,
author = {Honglin Yuan and
Warren Richard Morningstar and
Lin Ning and
Karan Singhal},
title = {What Do We Mean by Generalization in Federated Learning?},
booktitle = {{ICLR}},
publisher = {OpenReview.net},
year = {2022}
}
@inproceedings{DBLP:conf/icmla/KabraXLLLYYSGTAVGB22,
author = {Krish Kabra and
Alexander Xiong and
Wenbin Li and
Minxuan Luo and
William Lu and
Tianjiao Yu and
Jiahui Yu and
Dhananjay Singh and
Raul Garcia and
Maojie Tang and
Hank Arnold and
Anna Vallery and
Richard Gibbons and
Arko Barman},
title = {Deep object detection for waterbird monitoring using aerial imagery},
booktitle = {{ICMLA}},
pages = {455--460},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/icpr/Jain00VR22,
author = {Vishi Jain and
Akshay Agarwal and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Robust {IRIS} Presentation Attack Detection Through Stochastic Filter
Noise},
booktitle = {{ICPR}},
pages = {1134--1140},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/ijcnn/WredeEJPEHS22,
author = {Fredrik Wrede and
Robin Eriksson and
Richard M. Jiang and
Linda R. Petzold and
Stefan Engblom and
Andreas Hellander and
Prashant Singh},
title = {Robust and integrative Bayesian neural networks for likelihood-free
parameter inference},
booktitle = {{IJCNN}},
pages = {1--10},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/naacl/KhashabiLMQ0WHK22,
author = {Daniel Khashabi and
Xinxi Lyu and
Sewon Min and
Lianhui Qin and
Kyle Richardson and
Sean Welleck and
Hannaneh Hajishirzi and
Tushar Khot and
Ashish Sabharwal and
Sameer Singh and
Yejin Choi},
title = {Prompt Waywardness: The Curious Case of Discretized Interpretation
of Continuous Prompts},
booktitle = {{NAACL-HLT}},
pages = {3631--3643},
publisher = {Association for Computational Linguistics},
year = {2022}
}
@incollection{DBLP:books/sp/22/Majumdar0V022,
author = {Puspita Majumdar and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {Facial Retouching and Alteration Detection},
booktitle = {Handbook of Digital Face Manipulation and Detection},
series = {Advances in Computer Vision and Pattern Recognition},
pages = {367--387},
publisher = {Springer},
year = {2022}
}
@proceedings{DBLP:conf/icmi/2022,
editor = {Raj Tumuluri and
Nicu Sebe and
Gopal Pingali and
Dinesh Babu Jayagopi and
Abhinav Dhall and
Richa Singh and
Lisa Anthony and
Albert Ali Salah},
title = {International Conference on Multimodal Interaction, {ICMI} 2022, Bengaluru,
India, November 7-11, 2022},
publisher = {{ACM}},
year = {2022}
}
@proceedings{DBLP:conf/icmi/2022c,
editor = {Raj Tumuluri and
Nicu Sebe and
Gopal Pingali and
Dinesh Babu Jayagopi and
Abhinav Dhall and
Richa Singh and
Lisa Anthony and
Albert Ali Salah},
title = {International Conference on Multimodal Interaction, {ICMI} 2022, Companion
Volume, Bengaluru, India, November 7-11, 2022},
publisher = {{ACM}},
year = {2022}
}
@article{DBLP:journals/corr/abs-2201-01486,
author = {Sharvani Srivastava and
Amisha Gangwar and
Richa Mishra and
Sudhakar Singh},
title = {Sign Language Recognition System using TensorFlow Object Detection
{API}},
journal = {CoRR},
volume = {abs/2201.01486},
year = {2022}
}
@article{DBLP:journals/corr/abs-2201-03052,
author = {Richard Apaua and
Harjinder Singh Lallie},
title = {Measuring User Perceived Security of Mobile Banking Applications},
journal = {CoRR},
volume = {abs/2201.03052},
year = {2022}
}
@article{DBLP:journals/corr/abs-2202-04772,
author = {Vivek Veeriah and
Zeyu Zheng and
Richard L. Lewis and
Satinder Singh},
title = {GrASP: Gradient-Based Affordance Selection for Planning},
journal = {CoRR},
volume = {abs/2202.04772},
year = {2022}
}
@article{DBLP:journals/corr/abs-2203-00637,
author = {Saad Islam and
Koksal Mus and
Richa Singh and
Patrick Schaumont and
Berk Sunar},
title = {Signature Correction Attack on Dilithium Signature Scheme},
journal = {CoRR},
volume = {abs/2203.00637},
year = {2022}
}
@article{DBLP:journals/corr/abs-2203-00715,
author = {Avishkar Bhoopchand and
Bethanie Brownfield and
Adrian Collister and
Agustin Dal Lago and
Ashley Edwards and
Richard Everett and
Alexandre Fr{\'{e}}chette and
Yanko Gitahy Oliveira and
Edward Hughes and
Kory W. Mathewson and
Piermaria Mendolicchio and
Julia Pawar and
Miruna Pislar and
Alex Platonov and
Evan Senter and
Sukhdeep Singh and
Alexander Zacherl and
Lei M. Zhang},
title = {Learning Robust Real-Time Cultural Transmission without Human Data},
journal = {CoRR},
volume = {abs/2203.00715},
year = {2022}
}
@article{DBLP:journals/corr/abs-2203-16871,
author = {Avinash Singh and
Richard Adeyemi Ikuesan and
Hein S. Venter},
title = {Ransomware Detection using Process Memory},
journal = {CoRR},
volume = {abs/2203.16871},
year = {2022}
}
@article{DBLP:journals/corr/abs-2204-06153,
author = {Richa Singh and
Saad Islam and
Berk Sunar and
Patrick Schaumont},
title = {An End-to-End Analysis of {EMFI} on Bit-sliced Post-Quantum Implementations},
journal = {CoRR},
volume = {abs/2204.06153},
year = {2022}
}
@article{DBLP:journals/corr/abs-2204-08582,
author = {Jack FitzGerald and
Christopher Hench and
Charith Peris and
Scott Mackie and
Kay Rottmann and
Ana Sanchez and
Aaron Nash and
Liam Urbach and
Vishesh Kakarala and
Richa Singh and
Swetha Ranganath and
Laurie Crist and
Misha Britan and
Wouter Leeuwis and
G{\"{o}}khan T{\"{u}}r and
Prem Natarajan},
title = {{MASSIVE:} {A} 1M-Example Multilingual Natural Language Understanding
Dataset with 51 Typologically-Diverse Languages},
journal = {CoRR},
volume = {abs/2204.08582},
year = {2022}
}
@article{DBLP:journals/corr/abs-2205-05882,
author = {Arpit Khare and
Sudhakar Singh and
Richa Mishra and
Shiv Prakash and
Pratibha Dixit},
title = {E-Mail Assistant - Automation of E-Mail Handling and Management using
Robotic Process Automation},
journal = {CoRR},
volume = {abs/2205.05882},
year = {2022}
}
@article{DBLP:journals/corr/abs-2206-04615,
author = {Aarohi Srivastava and
Abhinav Rastogi and
Abhishek Rao and
Abu Awal Md Shoeb and
Abubakar Abid and
Adam Fisch and
Adam R. Brown and
Adam Santoro and
Aditya Gupta and
Adri{\`{a}} Garriga{-}Alonso and
Agnieszka Kluska and
Aitor Lewkowycz and
Akshat Agarwal and
Alethea Power and
Alex Ray and
Alex Warstadt and
Alexander W. Kocurek and
Ali Safaya and
Ali Tazarv and
Alice Xiang and
Alicia Parrish and
Allen Nie and
Aman Hussain and
Amanda Askell and
Amanda Dsouza and
Ambrose Slone and
Ameet Rahane and
Anantharaman S. Iyer and
Anders Andreassen and
Andrea Madotto and
Andrea Santilli and
Andreas Stuhlm{\"{u}}ller and
Andrew M. Dai and
Andrew La and
Andrew K. Lampinen and
Andy Zou and
Angela Jiang and
Angelica Chen and
Anh Vuong and
Animesh Gupta and
Anna Gottardi and
Antonio Norelli and
Anu Venkatesh and
Arash Gholamidavoodi and
Arfa Tabassum and
Arul Menezes and
Arun Kirubarajan and
Asher Mullokandov and
Ashish Sabharwal and
Austin Herrick and
Avia Efrat and
Aykut Erdem and
Ayla Karakas and
B. Ryan Roberts and
Bao Sheng Loe and
Barret Zoph and
Bartlomiej Bojanowski and
Batuhan {\"{O}}zyurt and
Behnam Hedayatnia and
Behnam Neyshabur and
Benjamin Inden and
Benno Stein and
Berk Ekmekci and
Bill Yuchen Lin and
Blake Howald and
Bryan Orinion and
Cameron Diao and
Cameron Dour and
Catherine Stinson and
Cedrick Argueta and
C{\`{e}}sar Ferri Ram{\'{\i}}rez and
Chandan Singh and
Charles Rathkopf and
Chenlin Meng and
Chitta Baral and
Chiyu Wu and
Chris Callison{-}Burch and
Chris Waites and
Christian Voigt and
Christopher D. Manning and
Christopher Potts and
Cindy Ramirez and
Clara E. Rivera and
Clemencia Siro and
Colin Raffel and
Courtney Ashcraft and
Cristina Garbacea and
Damien Sileo and
Dan Garrette and
Dan Hendrycks and
Dan Kilman and
Dan Roth and
Daniel Freeman and
Daniel Khashabi and
Daniel Levy and
Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and
Danielle Perszyk and
Danny Hernandez and
Danqi Chen and
Daphne Ippolito and
Dar Gilboa and
David Dohan and
David Drakard and
David Jurgens and
Debajyoti Datta and
Deep Ganguli and
Denis Emelin and
Denis Kleyko and
Deniz Yuret and
Derek Chen and
Derek Tam and
Dieuwke Hupkes and
Diganta Misra and
Dilyar Buzan and
Dimitri Coelho Mollo and
Diyi Yang and
Dong{-}Ho Lee and
Dylan Schrader and
Ekaterina Shutova and
Ekin Dogus Cubuk and
Elad Segal and
Eleanor Hagerman and
Elizabeth Barnes and
Elizabeth Donoway and
Ellie Pavlick and
Emanuele Rodol{\`{a}} and
Emma Lam and
Eric Chu and
Eric Tang and
Erkut Erdem and
Ernie Chang and
Ethan A. Chi and
Ethan Dyer and
Ethan J. Jerzak and
Ethan Kim and
Eunice Engefu Manyasi and
Evgenii Zheltonozhskii and
Fanyue Xia and
Fatemeh Siar and
Fernando Mart{\'{\i}}nez{-}Plumed and
Francesca Happ{\'{e}} and
Fran{\c{c}}ois Chollet and
Frieda Rong and
Gaurav Mishra and
Genta Indra Winata and
Gerard de Melo and
Germ{\'{a}}n Kruszewski and
Giambattista Parascandolo and
Giorgio Mariani and
Gloria Wang and
Gonzalo Jaimovitch{-}L{\'{o}}pez and
Gregor Betz and
Guy Gur{-}Ari and
Hana Galijasevic and
Hannah Kim and
Hannah Rashkin and
Hannaneh Hajishirzi and
Harsh Mehta and
Hayden Bogar and
Henry Shevlin and
Hinrich Sch{\"{u}}tze and
Hiromu Yakura and
Hongming Zhang and
Hugh Mee Wong and
Ian Ng and
Isaac Noble and
Jaap Jumelet and
Jack Geissinger and
Jackson Kernion and
Jacob Hilton and
Jaehoon Lee and
Jaime Fern{\'{a}}ndez Fisac and
James B. Simon and
James Koppel and
James Zheng and
James Zou and
Jan Kocon and
Jana Thompson and
Janelle Wingfield and
Jared Kaplan and
Jarema Radom and
Jascha Sohl{-}Dickstein and
Jason Phang and
Jason Wei and
Jason Yosinski and
Jekaterina Novikova and
Jelle Bosscher and
Jennifer Marsh and
Jeremy Kim and
Jeroen Taal and
Jesse H. Engel and
Jesujoba Alabi and
Jiacheng Xu and
Jiaming Song and
Jillian Tang and
Joan Waweru and
John Burden and
John Miller and
John U. Balis and
Jonathan Batchelder and
Jonathan Berant and
J{\"{o}}rg Frohberg and
Jos Rozen and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Joseph Boudeman and
Joseph Guerr and
Joseph Jones and
Joshua B. Tenenbaum and
Joshua S. Rule and
Joyce Chua and
Kamil Kanclerz and
Karen Livescu and
Karl Krauth and
Karthik Gopalakrishnan and
Katerina Ignatyeva and
Katja Markert and
Kaustubh D. Dhole and
Kevin Gimpel and
Kevin Omondi and
Kory Mathewson and
Kristen Chiafullo and
Ksenia Shkaruta and
Kumar Shridhar and
Kyle McDonell and
Kyle Richardson and
Laria Reynolds and
Leo Gao and
Li Zhang and
Liam Dugan and
Lianhui Qin and
Lidia Contreras Ochando and
Louis{-}Philippe Morency and
Luca Moschella and
Lucas Lam and
Lucy Noble and
Ludwig Schmidt and
Luheng He and
Luis Oliveros Col{\'{o}}n and
Luke Metz and
L{\"{u}}tfi Kerem Senel and
Maarten Bosma and
Maarten Sap and
Maartje ter Hoeve and
Maheen Farooqi and
Manaal Faruqui and
Mantas Mazeika and
Marco Baturan and
Marco Marelli and
Marco Maru and
Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and
Marie Tolkiehn and
Mario Giulianelli and
Martha Lewis and
Martin Potthast and
Matthew L. Leavitt and
Matthias Hagen and
M{\'{a}}ty{\'{a}}s Schubert and
Medina Baitemirova and
Melody Arnaud and
Melvin McElrath and
Michael A. Yee and
Michael Cohen and
Michael Gu and
Michael I. Ivanitskiy and
Michael Starritt and
Michael Strube and
Michal Swedrowski and
Michele Bevilacqua and
Michihiro Yasunaga and
Mihir Kale and
Mike Cain and
Mimee Xu and
Mirac Suzgun and
Mitch Walker and
Mo Tiwari and
Mohit Bansal and
Moin Aminnaseri and
Mor Geva and
Mozhdeh Gheini and
Mukund Varma T. and
Nanyun Peng and
Nathan A. Chi and
Nayeon Lee and
Neta Gur{-}Ari Krakover and
Nicholas Cameron and
Nicholas Roberts and
Nick Doiron and
Nicole Martinez and
Nikita Nangia and
Niklas Deckers and
Niklas Muennighoff and
Nitish Shirish Keskar and
Niveditha Iyer and
Noah Constant and
Noah Fiedel and
Nuan Wen and
Oliver Zhang and
Omar Agha and
Omar Elbaghdadi and
Omer Levy and
Owain Evans and
Pablo Antonio Moreno Casares and
Parth Doshi and
Pascale Fung and
Paul Pu Liang and
Paul Vicol and
Pegah Alipoormolabashi and
Peiyuan Liao and
Percy Liang and
Peter Chang and
Peter Eckersley and
Phu Mon Htut and
Pinyu Hwang and
Piotr Milkowski and
Piyush Patil and
Pouya Pezeshkpour and
Priti Oli and
Qiaozhu Mei and
Qing Lyu and
Qinlang Chen and
Rabin Banjade and
Rachel Etta Rudolph and
Raefer Gabriel and
Rahel Habacker and
Ramon Risco and
Rapha{\"{e}}l Milli{\`{e}}re and
Rhythm Garg and
Richard Barnes and
Rif A. Saurous and
Riku Arakawa and
Robbe Raymaekers and
Robert Frank and
Rohan Sikand and
Roman Novak and
Roman Sitelew and
Ronan LeBras and
Rosanne Liu and
Rowan Jacobs and
Rui Zhang and
Ruslan Salakhutdinov and
Ryan Chi and
Ryan Lee and
Ryan Stovall and
Ryan Teehan and
Rylan Yang and
Sahib Singh and
Saif M. Mohammad and
Sajant Anand and
Sam Dillavou and
Sam Shleifer and
Sam Wiseman and
Samuel Gruetter and
Samuel R. Bowman and
Samuel S. Schoenholz and
Sanghyun Han and
Sanjeev Kwatra and
Sarah A. Rous and
Sarik Ghazarian and
Sayan Ghosh and
Sean Casey and
Sebastian Bischoff and
Sebastian Gehrmann and
Sebastian Schuster and
Sepideh Sadeghi and
Shadi Hamdan and
Sharon Zhou and
Shashank Srivastava and
Sherry Shi and
Shikhar Singh and
Shima Asaadi and
Shixiang Shane Gu and
Shubh Pachchigar and
Shubham Toshniwal and
Shyam Upadhyay and
Shyamolima (Shammie) Debnath and
Siamak Shakeri and
Simon Thormeyer and
Simone Melzi and
Siva Reddy and
Sneha Priscilla Makini and
Soo{-}Hwan Lee and
Spencer Torene and
Sriharsha Hatwar and
Stanislas Dehaene and
Stefan Divic and
Stefano Ermon and
Stella Biderman and
Stephanie Lin and
Stephen Prasad and
Steven T. Piantadosi and
Stuart M. Shieber and
Summer Misherghi and
Svetlana Kiritchenko and
Swaroop Mishra and
Tal Linzen and
Tal Schuster and
Tao Li and
Tao Yu and
Tariq Ali and
Tatsu Hashimoto and
Te{-}Lin Wu and
Th{\'{e}}o Desbordes and
Theodore Rothschild and
Thomas Phan and
Tianle Wang and
Tiberius Nkinyili and
Timo Schick and
Timofei Kornev and
Titus Tunduny and
Tobias Gerstenberg and
Trenton Chang and
Trishala Neeraj and
Tushar Khot and
Tyler Shultz and
Uri Shaham and
Vedant Misra and
Vera Demberg and
Victoria Nyamai and
Vikas Raunak and
Vinay V. Ramasesh and
Vinay Uday Prabhu and
Vishakh Padmakumar and
Vivek Srikumar and
William Fedus and
William Saunders and
William Zhang and
Wout Vossen and
Xiang Ren and
Xiaoyu Tong and
Xinran Zhao and
Xinyi Wu and
Xudong Shen and
Yadollah Yaghoobzadeh and
Yair Lakretz and
Yangqiu Song and
Yasaman Bahri and
Yejin Choi and
Yichi Yang and
Yiding Hao and
Yifu Chen and
Yonatan Belinkov and
Yu Hou and
Yufang Hou and
Yuntao Bai and
Zachary Seid and
Zhuoye Zhao and
Zijian Wang and
Zijie J. Wang and
Zirui Wang and
Ziyi Wu},
title = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities
of language models},
journal = {CoRR},
volume = {abs/2206.04615},
year = {2022}
}
@article{DBLP:journals/corr/abs-2206-08357,
author = {Gaurav Parmar and
Yijun Li and
Jingwan Lu and
Richard Zhang and
Jun{-}Yan Zhu and
Krishna Kumar Singh},
title = {Spatially-Adaptive Multilayer Selection for {GAN} Inversion and Editing},
journal = {CoRR},
volume = {abs/2206.08357},
year = {2022}
}
@article{DBLP:journals/corr/abs-2206-10532,
author = {Mohammad Dehghani Soltani and
Hossein Kazemi and
Elham Sarbazi and
Ahmad Adnan Qidan and
Barzan A. Yosuf and
Sanaa H. Mohamed and
Ravinder Singh and
Bela Berde and
Dominique Chiaroni and
Bastien B{\'{e}}chadergue and
Fathi Abdeldayem and
Hardik Soni and
Jose Tabu and
Micheline Perrufel and
Nikola Serafimovski and
Taisir E. H. El{-}Gorashi and
Jaafar M. H. Elmirghani and
Richard V. Penty and
Ian H. White and
Harald Haas and
Majid Safari},
title = {Terabit Indoor Laser-Based Wireless Communications: LiFi 2.0 for 6G},
journal = {CoRR},
volume = {abs/2206.10532},
year = {2022}
}
@article{DBLP:journals/corr/abs-2208-13061,
author = {Sasikanth Kotti and
Mayank Vatsa and
Richa Singh},
title = {On GANs perpetuating biases for face verification},
journal = {CoRR},
volume = {abs/2208.13061},
year = {2022}
}
@article{DBLP:journals/corr/abs-2209-09111,
author = {Kartik Narayan and
Harsh Agarwal and
Kartik Thakral and
Surbhi Mittal and
Mayank Vatsa and
Richa Singh},
title = {DeePhy: On Deepfake Phylogeny},
journal = {CoRR},
volume = {abs/2209.09111},
year = {2022}
}
@article{DBLP:journals/corr/abs-2210-00092,
author = {Raviteja Vemulapalli and
Warren Richard Morningstar and
Philip Andrew Mansfield and
Hubert Eichner and
Karan Singhal and
Arash Afkanpour and
Bradley Green},
title = {Federated Training of Dual Encoding Models on Small Non-IID Client
Datasets},
journal = {CoRR},
volume = {abs/2210.00092},
year = {2022}
}
@article{DBLP:journals/corr/abs-2210-03821,
author = {Ethan A. Brooks and
Logan Walls and
Richard L. Lewis and
Satinder Singh},
title = {In-Context Policy Iteration},
journal = {CoRR},
volume = {abs/2210.03821},
year = {2022}
}
@article{DBLP:journals/corr/abs-2211-03588,
author = {Surbhi Mittal and
Kartik Thakral and
Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Are Face Detection Models Biased?},
journal = {CoRR},
volume = {abs/2211.03588},
year = {2022}
}
@article{DBLP:journals/corr/abs-2211-09981,
author = {Yangjun Ruan and
Saurabh Singh and
Warren R. Morningstar and
Alexander A. Alemi and
Sergey Ioffe and
Ian Fischer and
Joshua V. Dillon},
title = {Weighted Ensemble Self-Supervised Learning},
journal = {CoRR},
volume = {abs/2211.09981},
year = {2022}
}
@article{DBLP:journals/corr/abs-2212-02057,
author = {Ziyuan Zhao and
Mingxi Xu and
Peisheng Qian and
Ramanpreet Singh Pahwa and
Richard Chang},
title = {{DA-CIL:} Towards Domain Adaptive Class-Incremental 3D Object Detection},
journal = {CoRR},
volume = {abs/2212.02057},
year = {2022}
}
@article{DBLP:journals/ai/SilverSPS21,
author = {David Silver and
Satinder Singh and
Doina Precup and
Richard S. Sutton},
title = {Reward is enough},
journal = {Artif. Intell.},
volume = {299},
pages = {103535},
year = {2021}
}
@article{DBLP:journals/bioinformatics/JiangJGMRSWYDHP21,
author = {Richard M. Jiang and
Bruno Jacob and
Matthew Geiger and
Sean Matthew and
Bryan Rumsey and
Prashant Singh and
Fredrik Wrede and
Tau{-}Mu Yi and
Brian Drawert and
Andreas Hellander and
Linda R. Petzold},
title = {Epidemiological modeling in StochSS Live!},
journal = {Bioinform.},
volume = {37},
number = {17},
pages = {2787--2788},
year = {2021}
}
@article{DBLP:journals/bmcbi/JiangWSHP21,
author = {Richard M. Jiang and
Fredrik Wrede and
Prashant Singh and
Andreas Hellander and
Linda R. Petzold},
title = {Accelerated regression-based summary statistics for discrete stochastic
systems via approximate simulators},
journal = {{BMC} Bioinform.},
volume = {22},
number = {1},
pages = {339},
year = {2021}
}
@article{DBLP:journals/candc/DhanukaS21,
author = {Richa Dhanuka and
Jyoti Prakash Singh},
title = {Protein function prediction using functional inter-relationship},
journal = {Comput. Biol. Chem.},
volume = {95},
pages = {107593},
year = {2021}
}
@article{DBLP:journals/cbm/SpinaCAAGCCHLMS21,
author = {Gabriele Spina and
Pierluigi Casale and
Paul S. Albert and
Jennifer Alison and
Judith Garcia{-}Aymerich and
Christian F. Clarenbach and
Richard W. Costello and
Nidia A. Hernandes and
Jorg D. Leuppi and
Rafael Mesquita and
Sally J. Singh and
Frank W. J. M. Smeenk and
Ruth Tal{-}Singer and
Emiel F. M. Wouters and
Martijn A. Spruit and
Albertus C. den Brinker},
title = {Nighttime features derived from topic models for classification of
patients with {COPD}},
journal = {Comput. Biol. Medicine},
volume = {132},
pages = {104322},
year = {2021}
}
@article{DBLP:journals/cea/JollyLMFORSBS21,
author = {Ben Jolly and
Jiafa Luo and
Promil Mehra and
Patrick Forrestal and
Macdara O'Neill and
Karl G. Richards and
Bhupinder Pal Singh and
Geoff Bates and
Surinder Saggar},
title = {Evaluation of proximal sensing technologies for mapping bovine urine
patches under grazing pastures},
journal = {Comput. Electron. Agric.},
volume = {188},
pages = {106309},
year = {2021}
}
@article{DBLP:journals/cviu/ChellappaGLMS21,
author = {Rama Chellappa and
Diego Gragnaniello and
Chang{-}Tsun Li and
Francesco Marra and
Richa Singh},
title = {Guest Editorial: Adversarial Deep Learning in Biometrics {\&}
Forensics},
journal = {Comput. Vis. Image Underst.},
volume = {208-209},
pages = {103227},
year = {2021}
}
@article{DBLP:journals/frai/AgarwalSVN21,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {MagNet: Detecting Digital Presentation Attacks on Face Recognition},
journal = {Frontiers Artif. Intell.},
volume = {4},
year = {2021}
}
@article{DBLP:journals/frai/DhamechaGVS21,
author = {Tejas I. Dhamecha and
Soumyadeep Ghosh and
Mayank Vatsa and
Richa Singh},
title = {Kernelized Heterogeneity-Aware Cross-View Face Recognition},
journal = {Frontiers Artif. Intell.},
volume = {4},
pages = {670538},
year = {2021}
}
@article{DBLP:journals/ieeejas/WangHBLBSRHW21,
author = {Shuangyi Wang and
James Housden and
Tianxiang Bai and
Hongbin Liu and
Junghwan Back and
Davinder Singh and
Kawal S. Rhode and
Zeng{-}Guang Hou and
Fei{-}Yue Wang},
title = {Robotic Intra-Operative Ultrasound: Virtual Environments and Parallel
Systems},
journal = {{IEEE} {CAA} J. Autom. Sinica},
volume = {8},
number = {5},
pages = {1095--1106},
year = {2021}
}
@article{DBLP:journals/iet-ifs/SinghRSA21,
author = {Kunwar Singh and
C. Pandu Rangan and
Samir Sheshank and
Richa Agrawal},
title = {Lattice-based unidirectional Proxy Re-Encryption and Proxy Re-Encryption+
schemes},
journal = {{IET} Inf. Secur.},
volume = {15},
number = {1},
pages = {1--12},
year = {2021}
}
@article{DBLP:journals/ijcini/SinghSN21,
author = {Pavan Kumar Singh and
Nitin Singh and
Richa Negi},
title = {Short-Term Wind Power Prediction Using Hybrid Auto Regressive Integrated
Moving Average Model and Dynamic Particle Swarm Optimization},
journal = {Int. J. Cogn. Informatics Nat. Intell.},
volume = {15},
number = {2},
pages = {124--151},
year = {2021}
}
@article{DBLP:journals/ijrr/SinghRSSP21,
author = {Sumeet Singh and
Spencer M. Richards and
Vikas Sindhwani and
Jean{-}Jacques E. Slotine and
Marco Pavone},
title = {Learning stabilizable nonlinear dynamics with contraction-based regularization},
journal = {Int. J. Robotics Res.},
volume = {40},
number = {10-11},
year = {2021}
}
@article{DBLP:journals/imwut/CloeteNS21,
author = {Richard Cloete and
Chris Norval and
Jatinder Singh},
title = {Auditable Augmented/Mixed/Virtual Reality: The Practicalities of Mobile
System Transparency},
journal = {Proc. {ACM} Interact. Mob. Wearable Ubiquitous Technol.},
volume = {5},
number = {4},
pages = {149:1--149:24},
year = {2021}
}
@article{DBLP:journals/integration/SharmaRSP21,
author = {Richa Sharma and
Vijaypal Singh Rathor and
G. K. Sharma and
Manisha Pattanaik},
title = {A new hardware Trojan detection technique using deep convolutional
neural network},
journal = {Integr.},
volume = {79},
pages = {1--11},
year = {2021}
}
@article{DBLP:journals/mta/MishraSDB21,
author = {Santosh Kumar Mishra and
Koushlendra Kumar Singh and
Richa Dixit and
Manish Kumar Bajpai},
title = {Design of Fractional Calculus based differentiator for edge detection
in color images},
journal = {Multim. Tools Appl.},
volume = {80},
number = {19},
pages = {29965--29983},
year = {2021}
}
@article{DBLP:journals/neuroimage/SaxenaMRBSHWS21,
author = {Neeraj Saxena and
Suresh D. Muthukumaraswamy and
Lewys Richmond and
Adele Babic and
Krish D. Singh and
Judith E. Hall and
Richard G. Wise and
Alexander D. Shaw},
title = {A comparison of GABA-ergic (propofol) and non-GABA-ergic (dexmedetomidine)
sedation on visual and motor cortical oscillations, using magnetoencephalography},
journal = {NeuroImage},
volume = {245},
pages = {118659},
year = {2021}
}
@article{DBLP:journals/pr/NagpalSSV21,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa},
title = {Discriminative shared transform learning for sketch to image matching},
journal = {Pattern Recognit.},
volume = {114},
pages = {107815},
year = {2021}
}
@article{DBLP:journals/prl/AgarwalVSR21,
author = {Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Cognitive data augmentation for adversarial defense via pixel masking},
journal = {Pattern Recognit. Lett.},
volume = {146},
pages = {244--251},
year = {2021}
}
@article{DBLP:journals/prl/SuriSVS21,
author = {Saksham Suri and
Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {Improving face recognition performance using TeCS2 dictionary},
journal = {Pattern Recognit. Lett.},
volume = {145},
pages = {88--95},
year = {2021}
}
@article{DBLP:journals/ral/HousdenWBZSMNES21,
author = {James Housden and
Shuangyi Wang and
Xianqiang Bao and
Jia Zheng and
Emily Skelton and
Jacqueline Matthew and
Yohan Noh and
Olla Eltiraifi and
Anisha Singh and
Davinder Singh and
Kawal S. Rhode},
title = {Towards Standardized Acquisition With a Dual-Probe Ultrasound Robot
for Fetal Imaging},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {6},
number = {2},
pages = {1059--1065},
year = {2021}
}
@article{DBLP:journals/tbbis/MajumdarCSV21,
author = {Puspita Majumdar and
Saheb Chhabra and
Richa Singh and
Mayank Vatsa},
title = {Recognizing Injured Faces via {SCIFI} Loss},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {3},
number = {1},
pages = {112--123},
year = {2021}
}
@article{DBLP:journals/tbbis/MalhotraSVSMN21,
author = {Aakarsh Malhotra and
Anush Sankaran and
Mayank Vatsa and
Richa Singh and
Keith B. Morris and
Afzel Noore},
title = {Understanding {ACE-V} Latent Fingerprint Examination Process via Eye-Gaze
Analysis},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {3},
number = {1},
pages = {44--58},
year = {2021}
}
@article{DBLP:journals/tbbis/RathaSSKPV21,
author = {Nalini K. Ratha and
Richa Singh and
Vitomir Struc and
Ioannis A. Kakadiaris and
P. Jonathon Phillips and
Mayank Vatsa},
title = {{TBIOM} Special Issue on "Best Reviewed Papers From {IJCB} 2020 -
Editorial"},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {3},
number = {4},
pages = {441--442},
year = {2021}
}
@article{DBLP:journals/tdsc/AgarwalSVR21,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Image Transformation-Based Defense Against Adversarial Perturbation
on Deep Learning Models},
journal = {{IEEE} Trans. Dependable Secur. Comput.},
volume = {18},
number = {5},
pages = {2106--2121},
year = {2021}
}
@inproceedings{DBLP:conf/aaai/0001V021,
author = {Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {Role of Optimizer on Network Fine-tuning for Adversarial Robustness
(Student Abstract)},
booktitle = {{AAAI}},
pages = {15745--15746},
publisher = {{AAAI} Press},
year = {2021}
}
@inproceedings{DBLP:conf/aaai/ChauhanV021,
author = {Arushi Chauhan and
Mayank Vatsa and
Richa Singh},
title = {{NEAP-F:} Network Epoch Accuracy Prediction Framework (Student Abstract)},
booktitle = {{AAAI}},
pages = {15767--15768},
publisher = {{AAAI} Press},
year = {2021}
}
@inproceedings{DBLP:conf/aaai/Majumdar0V21,
author = {Puspita Majumdar and
Richa Singh and
Mayank Vatsa},
title = {On Learning Deep Models with Imbalanced Data Distribution},
booktitle = {{AAAI}},
pages = {15720--15721},
publisher = {{AAAI} Press},
year = {2021}
}
@inproceedings{DBLP:conf/aaai/Mehra0V021,
author = {Aman Mehra and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {Detection of Digital Manipulation in Facial Images (Student Abstract)},
booktitle = {{AAAI}},
pages = {15845--15846},
publisher = {{AAAI} Press},
year = {2021}
}
@inproceedings{DBLP:conf/aaai/SundriyalGV021,
author = {Divyanshu Sundriyal and
Soumyadeep Ghosh and
Mayank Vatsa and
Richa Singh},
title = {Semi-Supervised Learning via Triplet Network Based Active Learning
(Student Abstract)},
booktitle = {{AAAI}},
pages = {15903--15904},
publisher = {{AAAI} Press},
year = {2021}
}
@inproceedings{DBLP:conf/aies/JavadiNCS21,
author = {Seyyed Ahmad Javadi and
Chris Norval and
Richard Cloete and
Jatinder Singh},
title = {Monitoring {AI} Services for Misuse},
booktitle = {{AIES}},
pages = {597--607},
publisher = {{ACM}},
year = {2021}
}
@inproceedings{DBLP:conf/comad/0001VR21,
author = {Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Trustworthy {AI}},
booktitle = {{COMAD/CODS}},
pages = {449--453},
publisher = {{ACM}},
year = {2021}
}
@inproceedings{DBLP:conf/comad/AryaBCDHHHLLMMP21,
author = {Vijay Arya and
Rachel K. E. Bellamy and
Pin{-}Yu Chen and
Amit Dhurandhar and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Q. Vera Liao and
Ronny Luss and
Aleksandra Mojsilovic and
Sami Mourad and
Pablo Pedemonte and
Ramya Raghavendra and
John T. Richards and
Prasanna Sattigeri and
Karthikeyan Shanmugam and
Moninder Singh and
Kush R. Varshney and
Dennis Wei and
Yunfeng Zhang},
title = {{AI} Explainability 360 Toolkit},
booktitle = {{COMAD/CODS}},
pages = {376--379},
publisher = {{ACM}},
year = {2021}
}
@inproceedings{DBLP:conf/cscw/KarusalaIBGPKAB21,
author = {Naveena Karusala and
Azra Ismail and
Karthik S. Bhat and
Aakash Gautam and
Sachin R. Pendse and
Neha Kumar and
Richard J. Anderson and
Madeline Balaam and
Shaowen Bardzell and
Nicola J. Bidwell and
Melissa Densmore and
Elizabeth Kaziunas and
Anne Marie Piper and
Noopur Raval and
Pushpendra Singh and
Austin Toombs and
Nervo Verdezoto Dias and
Ding Wang},
title = {The Future of Care Work: Towards a Radical Politics of Care in {CSCW}
Research and Practice},
booktitle = {{CSCW} Companion},
pages = {338--342},
publisher = {{ACM}},
year = {2021}
}
@inproceedings{DBLP:conf/fast/PanSZSZSPSWGCPS21,
author = {Satadru Pan and
Theano Stavrinos and
Yunqiao Zhang and
Atul Sikaria and
Pavel Zakharov and
Abhinav Sharma and
Shiva Shankar P. and
Mike Shuey and
Richard Wareing and
Monika Gangapuram and
Guanglei Cao and
Christian Preseau and
Pratap Singh and
Kestutis Patiejunas and
J. R. Tipton and
Ethan Katz{-}Bassett and
Wyatt Lloyd},
title = {Facebook's Tectonic Filesystem: Efficiency from Exascale},
booktitle = {{FAST}},
pages = {217--231},
publisher = {{USENIX} Association},
year = {2021}
}
@inproceedings{DBLP:conf/fgr/AgarwalASVS21,
author = {Aayushi Agarwal and
Akshay Agarwal and
Sayan Sinha and
Mayank Vatsa and
Richa Singh},
title = {MD-CSDNetwork: Multi-Domain Cross Stitched Network for Deepfake Detection},
booktitle = {{FG}},
pages = {1--8},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/fgr/AgarwalRVS21,
author = {Akshay Agarwal and
Nalini K. Ratha and
Mayank Vatsa and
Richa Singh},
title = {When Sketch Face Recognition Meets Mask Obfuscation: Database and
Benchmark},
booktitle = {{FG}},
pages = {1--5},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/fgr/DosiTMVS21,
author = {Muskan Dosi and
Kartik Thakral and
Surbhi Mittal and
Mayank Vatsa and
Richa Singh},
title = {AECNet: Attentive EfficientNet For Crowd Counting},
booktitle = {{FG}},
pages = {1--8},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/fgr/GhoshSVN21,
author = {Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {{RGB-D} Face Recognition using Reconstruction based Shared Representation},
booktitle = {{FG}},
pages = {1--8},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/fgr/MishraMDVS21,
author = {Shiksha Mishra and
Puspita Majumdar and
Muskan Dosi and
Mayank Vatsa and
Richa Singh},
title = {Dual Sensor Indian Masked Face Dataset},
booktitle = {{FG}},
pages = {1--8},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/ficta/KumariSR21,
author = {Pallavi Kumari and
Richa Sharma and
Virendra Singh Rathore},
title = {{COVID-19:} Geospatial Analysis of the Pandemic - {A} Case Study of
Bihar State, India, Using Data Derived from Remote Sensing Satellites
and {COVID-19} National Geoportal},
booktitle = {{FICTA} {(1)}},
series = {Smart Innovation, Systems and Technologies},
volume = {266},
pages = {425--431},
publisher = {Springer},
year = {2021}
}
@inproceedings{DBLP:conf/icalt/PozdniakovMSCRB21,
author = {Stanislav Pozdniakov and
Roberto Mart{'{i}}nez{ }Maldonado and
Shaveen Singh and
Peter Chen and
Dan Richardson and
Tom Bartindale and
Patrick Olivier and
Dragan Gasevic},
title = {Question-driven Learning Analytics: Designing a Teacher Dashboard
for Online Breakout Rooms},
booktitle = {{ICALT}},
pages = {176--178},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/iccvw/MajumdarMSV21,
author = {Puspita Majumdar and
Surbhi Mittal and
Richa Singh and
Mayank Vatsa},
title = {Unravelling the Effect of Image Distortions for Biased Prediction
of Pre-trained Face Recognition Models},
booktitle = {{ICCVW}},
pages = {3779--3788},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/iccvw/MajumdarSV21,
author = {Puspita Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Attention Aware Debiasing for Unbiased Model Prediction},
booktitle = {{ICCVW}},
pages = {4116--4124},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/icip/0001V0R21,
author = {Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Intelligent and Adaptive Mixup Technique for Adversarial Robustness},
booktitle = {{ICIP}},
pages = {824--828},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/icip/MishraM0V21,
author = {Shiksha Mishra and
Puspita Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Indian Masked Faces in the Wild Dataset},
booktitle = {{ICIP}},
pages = {884--888},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/icml/BrooksRLS21,
author = {Ethan A. Brooks and
Janarthanan Rajendran and
Richard L. Lewis and
Satinder Singh},
title = {Reinforcement Learning of Implicit and Explicit Control Flow Instructions},
booktitle = {{ICML}},
series = {Proceedings of Machine Learning Research},
volume = {139},
pages = {1082--1091},
publisher = {{PMLR}},
year = {2021}
}
@inproceedings{DBLP:conf/ijcai/CarvalhoLLSLLS21,
author = {Wilka Carvalho and
Anthony Liang and
Kimin Lee and
Sungryull Sohn and
Honglak Lee and
Richard L. Lewis and
Satinder Singh},
title = {Reinforcement Learning for Sparse-Reward Object-Interaction Tasks
in a First-person Simulated 3D Environment},
booktitle = {{IJCAI}},
pages = {2219--2226},
publisher = {ijcai.org},
year = {2021}
}
@inproceedings{DBLP:conf/ijcnn/ChhabraMVS21,
author = {Saheb Chhabra and
Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Class Equilibrium using Coulomb's Law},
booktitle = {{IJCNN}},
pages = {1--8},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/ijcnn/SinghNVS21,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh},
title = {Enhancing Fine-Grained Classification for Low Resolution Images},
booktitle = {{IJCNN}},
pages = {1--8},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/ijcnn/SinghNYKPPSVNBM21,
author = {Maneet Singh and
Shruti Nagpal and
Daksha Yadav and
Naman Kohli and
Prateekshit Pandey and
Gokulraj Prabhakaran and
Richa Singh and
Mayank Vatsa and
Afzel Noore and
Julie Brefczynski{-}Lewis and
Harsh Mahajan},
title = {Understanding Neural Responses to Face Verification of Cross-Domain
Representations},
booktitle = {{IJCNN}},
pages = {1--8},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/isr2/ZhengWHHSR21,
author = {Jia Zheng and
Shuangyi Wang and
James Housden and
Zeng{-}Guang Hou and
Davinder Singh and
Kawal S. Rhode},
title = {A Safety Joint with Passive Compliant and Manual Override Mechanisms
for Medical Robotics},
booktitle = {{ISR}},
pages = {144--147},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/nips/VasudevanJBSSHS21,
author = {Shobha Vasudevan and
Wenjie Jiang and
David Bieber and
Rishabh Singh and
Hamid Shojaei and
Richard Ho and
Charles Sutton},
title = {Learning Semantic Representations to Verify Hardware Designs},
booktitle = {NeurIPS},
pages = {23491--23504},
year = {2021}
}
@inproceedings{DBLP:conf/nips/ZhengVVLS21,
author = {Zeyu Zheng and
Vivek Veeriah and
Risto Vuorio and
Richard L. Lewis and
Satinder Singh},
title = {Learning State Representations from Random Deep Action-conditional
Predictions},
booktitle = {NeurIPS},
pages = {23679--23691},
year = {2021}
}
@inproceedings{DBLP:conf/nsdi/FergusonGHKMMOP21,
author = {Andrew D. Ferguson and
Steve D. Gribble and
Chi{-}Yao Hong and
Charles Edwin Killian and
Waqar Mohsin and
Henrik M{\"{u}}he and
Joon Ong and
Leon Poutievski and
Arjun Singh and
Lorenzo Vicisano and
Richard Alimi and
Shawn Shuoshuo Chen and
Mike Conley and
Subhasree Mandal and
Karthik Nagaraj and
Kondapa Naidu Bollineni and
Amr Sabaa and
Shidong Zhang and
Min Zhu and
Amin Vahdat},
title = {Orion: Google's Software-Defined Networking Control Plane},
booktitle = {{NSDI}},
pages = {83--98},
publisher = {{USENIX} Association},
year = {2021}
}
@inproceedings{DBLP:conf/socrob/PahwaCJSVDJPW21,
author = {Ramanpreet Singh Pahwa and
Richard Chang and
Jie Wang and
Sankeerthana Satini and
Chandrashekar Viswanathan and
Yiming Du and
Vernica Jain and
Tai Pang Chen and
Kong{-}Wah Wan},
title = {A Survey on Object Detection Performance with Different Data Distributions},
booktitle = {{ICSR}},
series = {Lecture Notes in Computer Science},
volume = {13086},
pages = {553--563},
publisher = {Springer},
year = {2021}
}
@inproceedings{DBLP:conf/wifs/AgarwalRVS21,
author = {Akshay Agarwal and
Nalini K. Ratha and
Mayank Vatsa and
Richa Singh},
title = {Impact of Super-Resolution and Human Identification in Drone Surveillance},
booktitle = {{WIFS}},
pages = {1--6},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/wosp/BieringaRSVDI21,
author = {Richard Bieringa and
Abijith Radhakrishnan and
Tavneet Singh and
Sophie Vos and
Jesse Donkervliet and
Alexandru Iosup},
title = {An Empirical Evaluation of the Performance of Video Conferencing Systems},
booktitle = {{ICPE} (Companion)},
pages = {65--71},
publisher = {{ACM}},
year = {2021}
}
@inproceedings{DBLP:conf/wosp/SinghKK21,
author = {Snigdha Singh and
Yves Richard Kirschner and
Anne Koziolek},
title = {Towards Extraction of Message-Based Communication in Mixed-Technology
Architectures for Performance Model},
booktitle = {{ICPE} (Companion)},
pages = {133--138},
publisher = {{ACM}},
year = {2021}
}
@article{DBLP:journals/corr/abs-2102-04897,
author = {Zeyu Zheng and
Vivek Veeriah and
Risto Vuorio and
Richard L. Lewis and
Satinder Singh},
title = {Learning State Representations from Random Deep Action-conditional
Predictions},
journal = {CoRR},
volume = {abs/2102.04897},
year = {2021}
}
@article{DBLP:journals/corr/abs-2102-04999,
author = {Zeyu Zheng and
Risto Vuorio and
Richard L. Lewis and
Satinder Singh},
title = {Pairwise Weights for Temporal Credit Assignment},
journal = {CoRR},
volume = {abs/2102.04999},
year = {2021}
}
@article{DBLP:journals/corr/abs-2102-06521,
author = {Fredrik Wrede and
Robin Eriksson and
Richard M. Jiang and
Linda R. Petzold and
Stefan Engblom and
Andreas Hellander and
Prashant Singh},
title = {Robust and integrative Bayesian neural networks for likelihood-free
parameter inference},
journal = {CoRR},
volume = {abs/2102.06521},
year = {2021}
}
@article{DBLP:journals/corr/abs-2102-13195,
author = {Ethan A. Brooks and
Janarthanan Rajendran and
Richard L. Lewis and
Satinder Singh},
title = {Reinforcement Learning of Implicit and Explicit Control Flow in Instructions},
journal = {CoRR},
volume = {abs/2102.13195},
year = {2021}
}
@article{DBLP:journals/corr/abs-2103-04838,
author = {Ramanpreet Singh Pahwa and
Soon Wee Ho and
Ren Qin and
Richard Chang and
Oo Zaw Min and
Jie Wang and
Vempati Srinivasa Rao and
Tin Lay Nwe and
Yanjing Yang and
Jens Timo Neumann and
Ramani Pichumani and
Thomas Gregorich},
title = {Machine-learning based methodologies for 3d x-ray measurement, characterization
and optimization for buried structures in advanced ic packages},
journal = {CoRR},
volume = {abs/2103.04838},
year = {2021}
}
@article{DBLP:journals/corr/abs-2104-12287,
author = {Saheb Chhabra and
Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Class Equilibrium using Coulomb's Law},
journal = {CoRR},
volume = {abs/2104.12287},
year = {2021}
}
@article{DBLP:journals/corr/abs-2105-00241,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh},
title = {Enhancing Fine-Grained Classification for Low Resolution Images},
journal = {CoRR},
volume = {abs/2105.00241},
year = {2021}
}
@article{DBLP:journals/corr/abs-2106-09670,
author = {Shiksha Mishra and
Puspita Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Indian Masked Faces in the Wild Dataset},
journal = {CoRR},
volume = {abs/2106.09670},
year = {2021}
}
@article{DBLP:journals/corr/abs-2106-13784,
author = {Yuan Yao and
Pantea Kiaei and
Richa Singh and
Shahin Tajik and
Patrick Schaumont},
title = {Programmable {RO} {(PRO):} {A} Multipurpose Countermeasure against
Side-channel and Fault Injection Attack},
journal = {CoRR},
volume = {abs/2106.13784},
year = {2021}
}
@article{DBLP:journals/corr/abs-2108-06581,
author = {Puspita Majumdar and
Surbhi Mittal and
Richa Singh and
Mayank Vatsa},
title = {Unravelling the Effect of Image Distortions for Biased Prediction
of Pre-trained Face Recognition Models},
journal = {CoRR},
volume = {abs/2108.06581},
year = {2021}
}
@article{DBLP:journals/corr/abs-2109-07311,
author = {Aayushi Agarwal and
Akshay Agarwal and
Sayan Sinha and
Mayank Vatsa and
Richa Singh},
title = {MD-CSDNetwork: Multi-Domain Cross Stitched Network for Deepfake Detection},
journal = {CoRR},
volume = {abs/2109.07311},
year = {2021}
}
@article{DBLP:journals/corr/abs-2109-12151,
author = {Vijay Arya and
Rachel K. E. Bellamy and
Pin{-}Yu Chen and
Amit Dhurandhar and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Q. Vera Liao and
Ronny Luss and
Aleksandra Mojsilovic and
Sami Mourad and
Pablo Pedemonte and
Ramya Raghavendra and
John T. Richards and
Prasanna Sattigeri and
Karthikeyan Shanmugam and
Moninder Singh and
Kush R. Varshney and
Dennis Wei and
Yunfeng Zhang},
title = {{AI} Explainability 360: Impact and Design},
journal = {CoRR},
volume = {abs/2109.12151},
year = {2021}
}
@article{DBLP:journals/corr/abs-2110-02564,
author = {Pavani Tripathi and
Yasmeena Akhter and
Mahapara Khurshid and
Aditya Lakra and
Rohit Keshari and
Mayank Vatsa and
Richa Singh},
title = {{MTCD:} Cataract Detection via Near Infrared Eye Images},
journal = {CoRR},
volume = {abs/2110.02564},
year = {2021}
}
@article{DBLP:journals/corr/abs-2110-08820,
author = {Richa Singh},
title = {On-board Fault Diagnosis of a Laboratory Mini {SR-30} Gas Turbine
Engine},
journal = {CoRR},
volume = {abs/2110.08820},
year = {2021}
}
@article{DBLP:journals/corr/abs-2110-14216,
author = {Honglin Yuan and
Warren R. Morningstar and
Lin Ning and
Karan Singhal},
title = {What Do We Mean by Generalization in Federated Learning?},
journal = {CoRR},
volume = {abs/2110.14216},
year = {2021}
}
@article{DBLP:journals/corr/abs-2112-02721,
author = {Kaustubh D. Dhole and
Varun Gangal and
Sebastian Gehrmann and
Aadesh Gupta and
Zhenhao Li and
Saad Mahamood and
Abinaya Mahendiran and
Simon Mille and
Ashish Srivastava and
Samson Tan and
Tongshuang Wu and
Jascha Sohl{-}Dickstein and
Jinho D. Choi and
Eduard H. Hovy and
Ondrej Dusek and
Sebastian Ruder and
Sajant Anand and
Nagender Aneja and
Rabin Banjade and
Lisa Barthe and
Hanna Behnke and
Ian Berlot{-}Attwell and
Connor Boyle and
Caroline Brun and
Marco Antonio Sobrevilla Cabezudo and
Samuel Cahyawijaya and
Emile Chapuis and
Wanxiang Che and
Mukund Choudhary and
Christian Clauss and
Pierre Colombo and
Filip Cornell and
Gautier Dagan and
Mayukh Das and
Tanay Dixit and
Thomas Dopierre and
Paul{-}Alexis Dray and
Suchitra Dubey and
Tatiana Ekeinhor and
Marco Di Giovanni and
Tanya Goyal and
Rishabh Gupta and
Louanes Hamla and
Sang Han and
Fabrice Harel{-}Canada and
Antoine Honore and
Ishan Jindal and
Przemyslaw K. Joniak and
Denis Kleyko and
Venelin Kovatchev and
Kalpesh Krishna and
Ashutosh Kumar and
Stefan Langer and
Seungjae Ryan Lee and
Corey James Levinson and
Hualou Liang and
Kaizhao Liang and
Zhexiong Liu and
Andrey Lukyanenko and
Vukosi Marivate and
Gerard de Melo and
Simon Meoni and
Maxime Meyer and
Afnan Mir and
Nafise Sadat Moosavi and
Niklas Muennighoff and
Timothy Sum Hon Mun and
Kenton Murray and
Marcin Namysl and
Maria Obedkova and
Priti Oli and
Nivranshu Pasricha and
Jan Pfister and
Richard Plant and
Vinay Prabhu and
Vasile Pais and
Libo Qin and
Shahab Raji and
Pawan Kumar Rajpoot and
Vikas Raunak and
Roy Rinberg and
Nicholas Roberts and
Juan Diego Rodriguez and
Claude Roux and
Paulo Henrique Santos Vasconcellos and
Ananya B. Sai and
Robin M. Schmidt and
Thomas Scialom and
Tshephisho Sefara and
Saqib Shamsi and
Xudong Shen and
Yiwen Shi and
Haoyue Shi and
Anna Shvets and
Nick Siegel and
Damien Sileo and
Jamie Simon and
Chandan Singh and
Roman Sitelew and
Priyank Soni and
Taylor Sorensen and
William Soto and
Aman Srivastava and
K. V. Aditya Srivatsa and
Tony Sun and
Mukund Varma T. and
A. Tabassum and
Fiona Anting Tan and
Ryan Teehan and
Mo Tiwari and
Marie Tolkiehn and
Athena Wang and
Zijian Wang and
Zijie J. Wang and
Gloria Wang and
Fuxuan Wei and
Bryan Wilie and
Genta Indra Winata and
Xinyi Wu and
Witold Wydmanski and
Tianbao Xie and
Usama Yaseen and
Michael A. Yee and
Jing Zhang and
Yue Zhang},
title = {NL-Augmenter: {A} Framework for Task-Sensitive Natural Language Augmentation},
journal = {CoRR},
volume = {abs/2112.02721},
year = {2021}
}
@article{DBLP:journals/corr/abs-2112-06522,
author = {Richa Singh and
Puspita Majumdar and
Surbhi Mittal and
Mayank Vatsa},
title = {Anatomizing Bias in Facial Analysis},
journal = {CoRR},
volume = {abs/2112.06522},
year = {2021}
}
@article{DBLP:journals/corr/abs-2112-08348,
author = {Daniel Khashabi and
Shane Lyu and
Sewon Min and
Lianhui Qin and
Kyle Richardson and
Sameer Singh and
Sean Welleck and
Hannaneh Hajishirzi and
Tushar Khot and
Ashish Sabharwal and
Yejin Choi},
title = {{PROMPT} {WAYWARDNESS:} The Curious Case of Discretized Interpretation
of Continuous Prompts},
journal = {CoRR},
volume = {abs/2112.08348},
year = {2021}
}
@article{DBLP:journals/corr/abs-2112-10074,
author = {Raghav Mehta and
Angelos Filos and
Ujjwal Baid and
Chiharu Sako and
Richard McKinley and
Michael Rebsamen and
Katrin D{\"{a}}twyler and
Raphael Meier and
Piotr Radojewski and
Gowtham Krishnan Murugesan and
Sahil S. Nalawade and
Chandan Ganesh and
Benjamin C. Wagner and
Fang F. Yu and
Baowei Fei and
Ananth J. Madhuranthakam and
Joseph A. Maldjian and
Laura Alexandra Daza and
Catalina G{\'{o}}mez Caballero and
Pablo Arbel{\'{a}}ez and
Chengliang Dai and
Shuo Wang and
Hadrien Raynaud and
Yuanhan Mo and
Elsa D. Angelini and
Yike Guo and
Wenjia Bai and
Subhashis Banerjee and
Linmin Pei and
Murat Ak and
Sarahi Rosas{-}Gonz{\'{a}}lez and
Ilyess Zemmoura and
Clovis Tauber and
Minh H. Vu and
Tufve Nyholm and
Tommy L{\"{o}}fstedt and
Laura Mora Ballestar and
Ver{\'{o}}nica Vilaplana and
Hugh McHugh and
Gonzalo D. Maso Talou and
Alan Wang and
Jay B. Patel and
Ken Chang and
Katharina Hoebel and
Mishka Gidwani and
Nishanth Thumbavanam Arun and
Sharut Gupta and
Mehak Aggarwal and
Praveer Singh and
Elizabeth R. Gerstner and
Jayashree Kalpathy{-}Cramer and
Nicolas Boutry and
Alexis Huard and
Lasitha Vidyaratne and
Md Monibor Rahman and
Khan M. Iftekharuddin and
Joseph Chazalon and
{\'{E}}lodie Puybareau and
Guillaume Tochon and
Jun Ma and
Mariano Cabezas and
Xavier Llad{\'{o}} and
Arnau Oliver and
Liliana Valencia and
Sergi Valverde and
Mehdi Amian and
Mohammadreza Soltaninejad and
Andriy Myronenko and
Ali Hatamizadeh and
Xue Feng and
Quan Dou and
Nicholas J. Tustison and
Craig H. Meyer and
Nisarg A. Shah and
Sanjay N. Talbar and
Marc{-}Andr{\'{e}} Weber and
Abhishek Mahajan and
Andr{\'{a}}s Jakab and
Roland Wiest and
Hassan M. Fathallah{-}Shaykh and
Arash Nazeri and
Mikhail Milchenko and
Daniel S. Marcus and
Aikaterini Kotrotsou and
Rivka Colen and
John B. Freymann and
Justin S. Kirby and
Christos Davatzikos and
Bjoern H. Menze and
Spyridon Bakas and
Yarin Gal and
Tal Arbel},
title = {QU-BraTS: {MICCAI} BraTS 2020 Challenge on Quantifying Uncertainty
in Brain Tumor Segmentation - Analysis of Ranking Metrics and Benchmarking
Results},
journal = {CoRR},
volume = {abs/2112.10074},
year = {2021}
}
@article{DBLP:journals/corr/abs-2112-12554,
author = {Ryan T. Scott and
Erik L. Antonsen and
Lauren M. Sanders and
Jaden J. A. Hastings and
Seung{-}Min Park and
Graham Mackintosh and
Robert J. Reynolds and
Adrienne L. Hoarfrost and
Aenor Sawyer and
Casey S. Greene and
Benjamin S. Glicksberg and
Corey A. Theriot and
Daniel C. Berrios and
Jack Miller and
Joel Babdor and
Richard Barker and
Sergio E. Baranzini and
Afshin Beheshti and
Stuart J. Chalk and
Guillermo M. Delgado{-}Aparicio and
Melissa A. Haendel and
Arif A. Hamid and
Philip Heller and
Daniel Jamieson and
Katelyn J. Jarvis and
John Kalantari and
Kia Khezeli and
Svetlana V. Komarova and
Matthieu Komorowski and
Prachi Kothiyal and
Ashish Mahabal and
Uri Manor and
H{\'{e}}ctor Garc{\'{\i}}a Mart{\'{\i}}n and
Christopher E. Mason and
Mona Matar and
George I. Mias and
Jerry G. Myers Jr. and
Charlotte A. Nelson and
Jonathan Oribello and
Patricia Parsons{-}Wingerter and
R. K. Prabhu and
Amina Ann Qutub and
Jon Rask and
Amanda Saravia{-}Butler and
Suchi Saria and
Nitin Kumar Singh and
Frank Soboczenski and
Michael Snyder and
Karthik Soman and
David Van Valen and
Kasthuri Venkateswaran and
Liz Warren and
Liz Worthey and
Jason H. Yang and
Marinka Zitnik and
Sylvain V. Costes},
title = {Beyond Low Earth Orbit: Biomonitoring, Artificial Intelligence, and
Precision Space Health},
journal = {CoRR},
volume = {abs/2112.12554},
year = {2021}
}
@article{DBLP:journals/corr/abs-2112-12582,
author = {Lauren M. Sanders and
Jason H. Yang and
Ryan T. Scott and
Amina Ann Qutub and
H{\'{e}}ctor Garc{\'{\i}}a Mart{\'{\i}}n and
Daniel C. Berrios and
Jaden J. A. Hastings and
Jon Rask and
Graham Mackintosh and
Adrienne L. Hoarfrost and
Stuart J. Chalk and
John Kalantari and
Kia Khezeli and
Erik L. Antonsen and
Joel Babdor and
Richard Barker and
Sergio E. Baranzini and
Afshin Beheshti and
Guillermo M. Delgado{-}Aparicio and
Benjamin S. Glicksberg and
Casey S. Greene and
Melissa A. Haendel and
Arif A. Hamid and
Philip Heller and
Daniel Jamieson and
Katelyn J. Jarvis and
Svetlana V. Komarova and
Matthieu Komorowski and
Prachi Kothiyal and
Ashish Mahabal and
Uri Manor and
Christopher E. Mason and
Mona Matar and
George I. Mias and
Jack Miller and
Jerry G. Myers Jr. and
Charlotte A. Nelson and
Jonathan Oribello and
Seung{-}Min Park and
Patricia Parsons{-}Wingerter and
R. K. Prabhu and
Robert J. Reynolds and
Amanda Saravia{-}Butler and
Suchi Saria and
Aenor Sawyer and
Nitin Kumar Singh and
Frank Soboczenski and
Michael Snyder and
Karthik Soman and
Corey A. Theriot and
David Van Valen and
Kasthuri Venkateswaran and
Liz Warren and
Liz Worthey and
Marinka Zitnik and
Sylvain V. Costes},
title = {Beyond Low Earth Orbit: Biological Research, Artificial Intelligence,
and Self-Driving Labs},
journal = {CoRR},
volume = {abs/2112.12582},
year = {2021}
}
@article{DBLP:journals/corr/abs-2112-15422,
author = {Peter Vamplew and
Benjamin J. Smith and
Johan K{\"{a}}llstr{\"{o}}m and
Gabriel de Oliveira Ramos and
Roxana Radulescu and
Diederik M. Roijers and
Conor F. Hayes and
Fredrik Heintz and
Patrick Mannion and
Pieter J. K. Libin and
Richard Dazeley and
Cameron Foale},
title = {Scalar reward is not enough: {A} response to Silver, Singh, Precup
and Sutton {(2021)}},
journal = {CoRR},
volume = {abs/2112.15422},
year = {2021}
}
@article{DBLP:journals/iacr/YaoKSTS21,
author = {Yuan Yao and
Pantea Kiaei and
Richa Singh and
Shahin Tajik and
Patrick Schaumont},
title = {Programmable {RO} {(PRO):} {A} Multipurpose Countermeasure against
Side-channel and Fault Injection Attacks},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {878},
year = {2021}
}
@article{DBLP:journals/fdata/MajumdarCSV20,
author = {Puspita Majumdar and
Saheb Chhabra and
Richa Singh and
Mayank Vatsa},
title = {Subgroup Invariant Perturbation for Unbiased Pre-Trained Model Prediction},
journal = {Frontiers Big Data},
volume = {3},
pages = {590296},
year = {2020}
}
@article{DBLP:journals/iet-com/SharmaVS20,
author = {Richa Sharma and
Vasudha Vashisht and
Umang Singh},
title = {{WOATCA:} {A} secure and energy aware scheme based on whale optimisation
in clustered wireless sensor networks},
journal = {{IET} Commun.},
volume = {14},
number = {8},
pages = {1199--1208},
year = {2020}
}
@article{DBLP:journals/iet-wss/SharmaVS20,
author = {Richa Sharma and
Vasudha Vashisht and
Umang Singh},
title = {Modelling and simulation frameworks for wireless sensor networks:
a comparative study},
journal = {{IET} Wirel. Sens. Syst.},
volume = {10},
number = {5},
pages = {181--197},
year = {2020}
}
@article{DBLP:journals/iet-wss/SharmaVS20a,
author = {Richa Sharma and
Vasudha Vashisht and
Umang Singh},
title = {Metaheuristics-based energy efficient clustering in WSNs: challenges
and research contributions},
journal = {{IET} Wirel. Sens. Syst.},
volume = {10},
number = {6},
pages = {253--264},
year = {2020}
}
@article{DBLP:journals/ijabim/MisraSM20,
author = {Richa Misra and
Sonali Singh and
Renuka Mahajan},
title = {An Analysis on Consumer Preference of Ayurvedic Products in Indian
Market},
journal = {Int. J. Asian Bus. Inf. Manag.},
volume = {11},
number = {4},
pages = {1--15},
year = {2020}
}
@article{DBLP:journals/ijcbpl/MisraSS20,
author = {Richa Misra and
Sonali Singh and
Nidhi Singh},
title = {Assessing Behavioral Patterns for Online Gaming Addiction: {A} Study
Among Indian Youth},
journal = {Int. J. Cyber Behav. Psychol. Learn.},
volume = {10},
number = {2},
pages = {43--64},
year = {2020}
}
@article{DBLP:journals/ijdet/KushwahaMAM20,
author = {Pooja Singh Kushwaha and
Renuka Mahajan and
Rekha Attri and
Richa Misra},
title = {Study of Attitude of B-School Faculty for Learning Management System
Implementation an Indian Case Study},
journal = {Int. J. Distance Educ. Technol.},
volume = {18},
number = {2},
pages = {52--72},
year = {2020}
}
@article{DBLP:journals/ijinfoman/DubeyT20,
author = {Richa Singh Dubey and
Vijayshri Tiwari},
title = {Operationalisation of soft skill attributes and determining the existing
gap in novice {ICT} professionals},
journal = {Int. J. Inf. Manag.},
volume = {50},
pages = {375--386},
year = {2020}
}
@article{DBLP:journals/istr/SinghRAS20,
author = {Kunwar Singh and
C. Pandu Rangan and
Richa Agrawal and
Samir Sheshank},
title = {Provably secure lattice based identity based unidirectional {PRE}
and {PRE+} schemes},
journal = {J. Inf. Secur. Appl.},
volume = {54},
pages = {102569},
year = {2020}
}
@article{DBLP:journals/jcisd/MishraBSDJSRG20,
author = {Avinash Mishra and
Rohit Bansal and
Shravan Sreenivasan and
Rozaleen Dash and
Srishti Joshi and
Richa Singh and
Anurag S. Rathore and
Gaurav Goel},
title = {Structure-Based Design of Small Peptide Ligands to Inhibit Early-Stage
Protein Aggregation Nucleation},
journal = {J. Chem. Inf. Model.},
volume = {60},
number = {6},
pages = {3304--3314},
year = {2020}
}
@article{DBLP:journals/jmlr/AryaBCDHHHLLMMP20,
author = {Vijay Arya and
Rachel K. E. Bellamy and
Pin{-}Yu Chen and
Amit Dhurandhar and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Q. Vera Liao and
Ronny Luss and
Aleksandra Mojsilovic and
Sami Mourad and
Pablo Pedemonte and
Ramya Raghavendra and
John T. Richards and
Prasanna Sattigeri and
Karthikeyan Shanmugam and
Moninder Singh and
Kush R. Varshney and
Dennis Wei and
Yunfeng Zhang},
title = {{AI} Explainability 360: An Extensible Toolkit for Understanding Data
and Machine Learning Models},
journal = {J. Mach. Learn. Res.},
volume = {21},
pages = {130:1--130:6},
year = {2020}
}
@article{DBLP:journals/jssc/TajalliPCCGGGHH20,
author = {Armin Tajalli and
Mani Bastani Parizi and
Dario Albino Carnelli and
Chen Cao and
Kiarash Gharibdoust and
Davide Gorret and
Amit Gupta and
Christopher Hall and
Ahmed Hassanin and
Klaas L. Hofstra and
Brian Holden and
Ali Hormati and
John Keay and
Yohann Mogentale and
Victor Perrin and
John Phillips and
Sumathi Raparthy and
Amin Shokrollahi and
David Stauffer and
Richard Simpson and
Andrew Stewart and
Giuseppe Surace and
Omid Talebi Amiri and
Emanuele Truffa and
Anton Tschank and
Roger Ulrich and
Christoph Walter and
Anant Singh},
title = {A 1.02-pJ/b 20.83-Gb/s/Wire {USR} Transceiver Using {CNRZ-5} in 16-nm
FinFET},
journal = {{IEEE} J. Solid State Circuits},
volume = {55},
number = {4},
pages = {1108--1123},
year = {2020}
}
@article{DBLP:journals/mj/SrivastavaGKS20,
author = {Richa Srivastava and
Om Krishna Gupta and
Anup Kumar and
Devesh Singh},
title = {Low-voltage bulk-driven self-cascode transistor based voltage differencing
inverting buffered amplifier and its application as universal filter},
journal = {Microelectron. J.},
volume = {102},
pages = {104828},
year = {2020}
}
@article{DBLP:journals/ploscb/SmithGSMEAUNSKD20,
author = {Morgan E. Smith and
Emily Griswold and
Brajendra K. Singh and
Emmanuel Miri and
Abel Eigege and
Solomon Adelamo and
John Umaru and
Kenrick Nwodu and
Yohanna Sambo and
Jonathan Kadimbo and
Jacob Danyobi and
Frank O. Richards and
Edwin Michael},
title = {Predicting lymphatic filariasis elimination in data-limited settings:
{A} reconstructive computational framework for combining data generation
and model discovery},
journal = {PLoS Comput. Biol.},
volume = {16},
number = {7},
year = {2020}
}
@article{DBLP:journals/ppna/SrivastavaASTN20,
author = {Gaurav Srivastava and
Richa Agrawal and
Kunwar Singh and
Rajeev Tripathi and
Kshirasagar Naik},
title = {A hierarchical identity-based security for delay tolerant networks
using lattice-based cryptography},
journal = {Peer-to-Peer Netw. Appl.},
volume = {13},
number = {1},
pages = {348--367},
year = {2020}
}
@article{DBLP:journals/tbbis/BeveridgeDPS20,
author = {J. Ross Beveridge and
Mohamed Daoudi and
Catherine Pelachaud and
Richa Singh},
title = {Selected Best Works From Automated Face and Gesture Recognition 2019},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {2},
number = {2},
pages = {83--84},
year = {2020}
}
@article{DBLP:journals/tbbis/GhoshSV20,
author = {Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa},
title = {Subclass Heterogeneity Aware Loss for Cross-Spectral Cross-Resolution
Face Recognition},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {2},
number = {3},
pages = {245--256},
year = {2020}
}
@article{DBLP:journals/tbbis/MalhotraSVS20,
author = {Aakarsh Malhotra and
Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {On Matching Finger-Selfies Using Deep Scattering Networks},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {2},
number = {4},
pages = {350--362},
year = {2020}
}
@article{DBLP:journals/tbbis/SuriVS20,
author = {Anshuman Suri and
Mayank Vatsa and
Richa Singh},
title = {{A2-LINK:} Recognizing Disguised Faces via Active Learning and Adversarial
Noise Based Inter-Domain Knowledge},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {2},
number = {4},
pages = {326--336},
year = {2020}
}
@article{DBLP:journals/telsys/SharmaVS20,
author = {Richa Sharma and
Vasudha Vashisht and
Umang Singh},
title = {eeTMFO/GA: a secure and energy efficient cluster head selection in
wireless sensor networks},
journal = {Telecommun. Syst.},
volume = {74},
number = {3},
pages = {253--268},
year = {2020}
}
@inproceedings{DBLP:conf/aaai/0001ASNV20,
author = {Richa Singh and
Akshay Agarwal and
Maneet Singh and
Shruti Nagpal and
Mayank Vatsa},
title = {On the Robustness of Face Recognition Algorithms Against Attacks and
Bias},
booktitle = {{AAAI}},
pages = {13583--13589},
publisher = {{AAAI} Press},
year = {2020}
}
@inproceedings{DBLP:conf/aaai/JindalS0V020,
author = {Sarthak Jindal and
Raghav Sood and
Richa Singh and
Mayank Vatsa and
Tanmoy Chakraborty},
title = {NewsBag: {A} Benchmark Multimodal Dataset for Fake News Detection},
booktitle = {SafeAI@AAAI},
series = {{CEUR} Workshop Proceedings},
volume = {2560},
pages = {138--145},
publisher = {CEUR-WS.org},
year = {2020}
}
@inproceedings{DBLP:conf/aaai/RajendranLVLS20,
author = {Janarthanan Rajendran and
Richard L. Lewis and
Vivek Veeriah and
Honglak Lee and
Satinder Singh},
title = {How Should an Agent Practice?},
booktitle = {{AAAI}},
pages = {5454--5461},
publisher = {{AAAI} Press},
year = {2020}
}
@inproceedings{DBLP:conf/aies/JavadiCCLS20,
author = {Seyyed Ahmad Javadi and
Richard Cloete and
Jennifer Cobbe and
Michelle Seng Ah Lee and
Jatinder Singh},
title = {Monitoring Misuse for Accountable 'Artificial Intelligence as a Service'},
booktitle = {{AIES}},
pages = {300--306},
publisher = {{ACM}},
year = {2020}
}
@inproceedings{DBLP:conf/bigmm/KeshariGCV020,
author = {Rohit Keshari and
Soumyadeep Ghosh and
Saheb Chhabra and
Mayank Vatsa and
Richa Singh},
title = {Unravelling Small Sample Size Problems in the Deep Learning World},
booktitle = {BigMM},
pages = {134--143},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/cicc/TajalliPCCGGHHH20,
author = {Armin Tajalli and
Mani Bastani Parizi and
Dario Albino Carnelli and
Chen Cao and
Kiarash Gharibdoust and
Amit Gupta and
Ahmed Hassanin and
Klaas L. Hofstra and
Brian Holden and
Ali Hormati and
John Keay and
Amin Shokrollahi and
David Stauffer and
Richard Simpson and
Andrew Stewart and
Giuseppe Surace and
Omid Talebi Amiri and
Anton Tschank and
Roger Ulrich and
Christoph Walter and
Anant Singh},
title = {Short-Reach and Pin-Efficient Interfaces Using Correlated {NRZ}},
booktitle = {{CICC}},
pages = {1--8},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/cvpr/00010V20,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {The Role of 'Sign' and 'Direction' of Gradient on the Performance
of {CNN}},
booktitle = {{CVPR} Workshops},
pages = {2748--2756},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/cvpr/0001V0R20,
author = {Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Noise is Inside Me! Generating Adversarial Perturbations with Noise
Derived from Natural Filters},
booktitle = {{CVPR} Workshops},
pages = {3354--3363},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/cvpr/Goel0V0R20,
author = {Akhil Goel and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {DNDNet: Reconfiguring {CNN} for Adversarial Robustness},
booktitle = {{CVPR} Workshops},
pages = {103--110},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/cvpr/JainM0V20,
author = {Anubhav Jain and
Puspita Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Detecting GANs and Retouching based Digital Alterations via {DAD-HCNN}},
booktitle = {{CVPR} Workshops},
pages = {2870--2879},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/cvpr/Keshari0V20,
author = {Rohit Keshari and
Richa Singh and
Mayank Vatsa},
title = {Generalized Zero-Shot Learning via Over-Complete Distribution},
booktitle = {{CVPR}},
pages = {13297--13305},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/cvpr/MalhotraCV020,
author = {Aakarsh Malhotra and
Saheb Chhabra and
Mayank Vatsa and
Richa Singh},
title = {On Privacy Preserving Anonymization of Finger-selfies},
booktitle = {{CVPR} Workshops},
pages = {120--128},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/cvpr/NagpalS0V20,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa},
title = {Attribute Aware Filter-Drop for Bias-Invariant Classification},
booktitle = {{CVPR} Workshops},
pages = {147--153},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/eccv/AnshumaanAVS20,
author = {Divyam Anshumaan and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {WaveTransform: Crafting Adversarial Examples via Input Decomposition},
booktitle = {{ECCV} Workshops {(1)}},
series = {Lecture Notes in Computer Science},
volume = {12535},
pages = {152--168},
publisher = {Springer},
year = {2020}
}
@inproceedings{DBLP:conf/eccv/KarSVS20,
author = {Amlaan Kar and
Maneet Singh and
Mayank Vatsa and
Richa Singh},
title = {Disguised Face Verification Using Inverse Disguise Quality},
booktitle = {{ECCV} Workshops {(6)}},
series = {Lecture Notes in Computer Science},
volume = {12540},
pages = {524--540},
publisher = {Springer},
year = {2020}
}
@inproceedings{DBLP:conf/eccv/SinhaVS20,
author = {Raunak Sinha and
Mayank Vatsa and
Richa Singh},
title = {FamilyGAN: Generating Kin Face Images Using Generative Adversarial
Networks},
booktitle = {{ECCV} Workshops {(3)}},
series = {Lecture Notes in Computer Science},
volume = {12537},
pages = {297--311},
publisher = {Springer},
year = {2020}
}
@inproceedings{DBLP:conf/fat/AryaBCDHHHLLMMP20,
author = {Vijay Arya and
Rachel K. E. Bellamy and
Pin{-}Yu Chen and
Amit Dhurandhar and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Q. Vera Liao and
Ronny Luss and
Aleksandra Mojsilovic and
Sami Mourad and
Pablo Pedemonte and
Ramya Raghavendra and
John T. Richards and
Prasanna Sattigeri and
Karthikeyan Shanmugam and
Moninder Singh and
Kush R. Varshney and
Dennis Wei and
Yunfeng Zhang},
title = {{AI} explainability 360: hands-on tutorial},
booktitle = {FAT*},
pages = {696},
publisher = {{ACM}},
year = {2020}
}
@inproceedings{DBLP:conf/fie/BatraRW20,
author = {Jaskirat Singh Batra and
Ra'sheedah Richardson and
Robert Webb},
title = {How can instructors strengthen students' motivation to learn complex
3D concepts in an engineering classroom?},
booktitle = {{FIE}},
pages = {1--9},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/hpec/SinghCS20,
author = {Richa Singh and
Thomas Conroy and
Patrick Schaumont},
title = {Variable Precision Multiplication for Software-Based Neural Networks},
booktitle = {{HPEC}},
pages = {1--7},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/icb/NagpalSSV20,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa},
title = {Diversity Blocks for De-biasing Classification Models},
booktitle = {{IJCB}},
pages = {1--9},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/iclr/OsbandDHASSMLSS20,
author = {Ian Osband and
Yotam Doron and
Matteo Hessel and
John Aslanides and
Eren Sezener and
Andre Saraiva and
Katrina McKinney and
Tor Lattimore and
Csaba Szepesv{\'{a}}ri and
Satinder Singh and
Benjamin Van Roy and
Richard S. Sutton and
David Silver and
Hado van Hasselt},
title = {Behaviour Suite for Reinforcement Learning},
booktitle = {{ICLR}},
publisher = {OpenReview.net},
year = {2020}
}
@inproceedings{DBLP:conf/icpr/Chhabra00V20,
author = {Saheb Chhabra and
Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Attack Agnostic Adversarial Defense via Visual Imperceptible Bound},
booktitle = {{ICPR}},
pages = {5302--5309},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/icpr/GuptaS0V020,
author = {Mehak Gupta and
Vishal Singh and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {Generalized Iris Presentation Attack Detection Algorithm under Cross-Database
Settings},
booktitle = {{ICPR}},
pages = {5318--5325},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/icpr/SanghviS0V020,
author = {Nilay Sanghvi and
Sushant Kumar Singh and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {MixNet for Generalized Face Presentation Attack Detection},
booktitle = {{ICPR}},
pages = {5511--5518},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/icpr/YadavKV0N20,
author = {Daksha Yadav and
Naman Kohli and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Age Gap Reducer-GAN for Recognizing Age-Separated Faces},
booktitle = {{ICPR}},
pages = {10090--10097},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/icsoc/SamantCVKN20,
author = {Sunil Singh Samant and
Mohan Baruwal Chhetri and
Quoc Bao Vo and
Ryszard Kowalczyk and
Surya Nepal},
title = {AuraEN: Autonomous Resource Allocation for Cloud-Hosted Data Processing
Pipelines},
booktitle = {{ICSOC} Workshops},
series = {Lecture Notes in Computer Science},
volume = {12632},
pages = {77--80},
publisher = {Springer},
year = {2020}
}
@inproceedings{DBLP:conf/miccai/RothCSNLGGQIBWB20,
author = {Holger R. Roth and
Ken Chang and
Praveer Singh and
Nir Neumark and
Wenqi Li and
Vikash Gupta and
Sharut Gupta and
Liangqiong Qu and
Alvin Ihsani and
Bernardo C. Bizzo and
Yuhong Wen and
Varun Buch and
Meesam Shah and
Felipe Kitamura and
Matheus Mendon{\c{c}}a and
Vitor Lavor and
Ahmed Harouni and
Colin Compas and
Jesse Tetreault and
Prerna Dogra and
Yan Cheng and
Selnur Erdal and
Richard D. White and
Behrooz Hashemian and
Thomas J. Schultz and
Miao Zhang and
Adam McCarthy and
B. Min Yun and
Elshaimaa Sharaf and
Katharina Viktoria Hoebel and
Jay B. Patel and
Bryan Chen and
Sean Ko and
Evan Leibovitz and
Etta D. Pisano and
Laura Coombs and
Daguang Xu and
Keith J. Dreyer and
Ittai Dayan and
Ram C. Naidu and
Mona Flores and
Daniel L. Rubin and
Jayashree Kalpathy{-}Cramer},
title = {Federated Learning for Breast Density Classification: {A} Real-World
Implementation},
booktitle = {DART/DCL@MICCAI},
series = {Lecture Notes in Computer Science},
volume = {12444},
pages = {181--191},
publisher = {Springer},
year = {2020}
}
@inproceedings{DBLP:conf/miccai/WangHHHSR20,
author = {Shuangyi Wang and
Xilong Hou and
James Housden and
Zengguang Hou and
Davinder Singh and
Kawal S. Rhode},
title = {IoT-Based Remote Control Study of a Robotic Trans-Esophageal Ultrasound
Probe via {LAN} and 5G},
booktitle = {ASMUS/PIPPI@MICCAI},
series = {Lecture Notes in Computer Science},
volume = {12437},
pages = {171--179},
publisher = {Springer},
year = {2020}
}
@inproceedings{DBLP:conf/nips/AnthonyETKGHPLP20,
author = {Thomas W. Anthony and
Tom Eccles and
Andrea Tacchetti and
J{\'{a}}nos Kram{\'{a}}r and
Ian Gemp and
Thomas C. Hudson and
Nicolas Porcel and
Marc Lanctot and
Julien P{\'{e}}rolat and
Richard Everett and
Satinder Singh and
Thore Graepel and
Yoram Bachrach},
title = {Learning to Play No-Press Diplomacy with Best Response Policy Iteration},
booktitle = {NeurIPS},
year = {2020}
}
@inproceedings{DBLP:conf/pimrc/0001DSGDC20,
author = {Peter J. Smith and
Pawel A. Dmochowski and
Ikram Singh and
Richard D. Green and
Carl P. Dettmann and
Justin P. Coon},
title = {3D Mobility Models and Analysis for UAVs},
booktitle = {{PIMRC}},
pages = {1--6},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/sigmod/ChenCDD0HKMMNOP20,
author = {Andrew Chen and
Andy Chow and
Aaron Davidson and
Arjun DCunha and
Ali Ghodsi and
Sue Ann Hong and
Andy Konwinski and
Clemens Mewald and
Siddharth Murching and
Tomas Nykodym and
Paul Ogilvie and
Mani Parkhe and
Avesh Singh and
Fen Xie and
Matei Zaharia and
Richard Zang and
Juntai Zheng and
Corey Zumar},
title = {Developments in MLflow: {A} System to Accelerate the Machine Learning
Lifecycle},
booktitle = {DEEM@SIGMOD},
pages = {5:1--5:4},
publisher = {{ACM}},
year = {2020}
}
@inproceedings{DBLP:conf/vrst/CloeteNS20,
author = {Richard Cloete and
Chris Norval and
Jatinder Singh},
title = {A Call for Auditable Virtual, Augmented and Mixed Reality},
booktitle = {{VRST}},
pages = {16:1--16:6},
publisher = {{ACM}},
year = {2020}
}
@inproceedings{DBLP:conf/wacv/KumarV020,
author = {Prabhat Kumar and
Mayank Vatsa and
Richa Singh},
title = {Detecting Face2Face Facial Reenactment in Videos},
booktitle = {{WACV}},
pages = {2578--2586},
publisher = {{IEEE}},
year = {2020}
}
@incollection{DBLP:books/sp/20/Ghosh0VRP20,
author = {Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha and
Vishal M. Patel},
title = {Domain Adaptation for Visual Understanding},
booktitle = {Domain Adaptation for Visual Understanding},
pages = {1--15},
publisher = {Springer},
year = {2020}
}
@incollection{DBLP:books/sp/20/SankaranV020,
author = {Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {Intuition Learning},
booktitle = {Domain Adaptation for Visual Understanding},
pages = {111--127},
publisher = {Springer},
year = {2020}
}
@book{DBLP:books/sp/20/SVPR2020,
editor = {Richa Singh and
Mayank Vatsa and
Vishal M. Patel and
Nalini K. Ratha},
title = {Domain Adaptation for Visual Understanding},
publisher = {Springer},
year = {2020}
}
@article{DBLP:journals/corr/abs-2001-07444,
author = {Prabhat Kumar and
Mayank Vatsa and
Richa Singh},
title = {Detecting Face2Face Facial Reenactment in Videos},
journal = {CoRR},
volume = {abs/2001.07444},
year = {2020}
}
@article{DBLP:journals/corr/abs-2001-08383,
author = {Thomas Paul Matthews and
Sadanand Singh and
Brent Mombourquette and
Jason Su and
Meet P. Shah and
Stefano Pedemonte and
Aaron Long and
David Maffit and
Jenny Gurney and
Rodrigo Morales Hoil and
Nikita Ghare and
Douglas Smith and
Stephen M. Moore and
Susan C. Marks and
Richard L. Wahl},
title = {A multi-site study of a breast density deep learning model for full-field
digital mammography and digital breast tomosynthesis exams},
journal = {CoRR},
volume = {abs/2001.08383},
year = {2020}
}
@article{DBLP:journals/corr/abs-2001-09723,
author = {Seyyed Ahmad Javadi and
Richard Cloete and
Jennifer Cobbe and
Michelle Seng Ah Lee and
Jatinder Singh},
title = {Monitoring Misuse for Accountable 'Artificial Intelligence as a Service'},
journal = {CoRR},
volume = {abs/2001.09723},
year = {2020}
}
@article{DBLP:journals/corr/abs-2002-02942,
author = {Richa Singh and
Akshay Agarwal and
Maneet Singh and
Shruti Nagpal and
Mayank Vatsa},
title = {On the Robustness of Face Recognition Algorithms Against Attacks and
Bias},
journal = {CoRR},
volume = {abs/2002.02942},
year = {2020}
}
@article{DBLP:journals/corr/abs-2004-00666,
author = {Rohit Keshari and
Richa Singh and
Mayank Vatsa},
title = {Generalized Zero-Shot Learning Via Over-Complete Distribution},
journal = {CoRR},
volume = {abs/2004.00666},
year = {2020}
}
@article{DBLP:journals/corr/abs-2005-13749,
author = {Shuangyi Wang and
Xilong Hou and
Richard James Housden and
Zengguang Hou and
Davinder Singh and
Kawal S. Rhode},
title = {IoT-based Remote Control Study of a Robotic Trans-esophageal Ultrasound
Probe via {LAN} and 5G},
journal = {CoRR},
volume = {abs/2005.13749},
year = {2020}
}
@article{DBLP:journals/corr/abs-2006-04635,
author = {Thomas W. Anthony and
Tom Eccles and
Andrea Tacchetti and
J{\'{a}}nos Kram{\'{a}}r and
Ian Gemp and
Thomas C. Hudson and
Nicolas Porcel and
Marc Lanctot and
Julien P{\'{e}}rolat and
Richard Everett and
Satinder Singh and
Thore Graepel and
Yoram Bachrach},
title = {Learning to Play No-Press Diplomacy with Best Response Policy Iteration},
journal = {CoRR},
volume = {abs/2006.04635},
year = {2020}
}
@article{DBLP:journals/corr/abs-2007-00463,
author = {Richa Verma and
Aniruddha Singhal and
Harshad Khadilkar and
Ansuma Basumatary and
Siddharth Nayak and
Harsh Vardhan Singh and
Swagat Kumar and
Rajesh Sinha},
title = {A Generalized Reinforcement Learning Algorithm for Online 3D Bin-Packing},
journal = {CoRR},
volume = {abs/2007.00463},
year = {2020}
}
@article{DBLP:journals/corr/abs-2008-00054,
author = {Akhil Goel and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Securing {CNN} Model and Biometric Template using Blockchain},
journal = {CoRR},
volume = {abs/2008.00054},
year = {2020}
}
@article{DBLP:journals/corr/abs-2008-00141,
author = {Jing Shi and
Zhiheng Li and
Haitian Zheng and
Yihang Xu and
Tianyou Xiao and
Weitao Tan and
Xiaoning Guo and
Sizhe Li and
Bin Yang and
Zhexin Xu and
Ruitao Lin and
Zhongkai Shangguan and
Yue Zhao and
Jingwen Wang and
Rohan Sharma and
Surya Iyer and
Ajinkya Deshmukh and
Raunak Mahalik and
Srishti Singh and
Jayant G. Rohra and
Yipeng Zhang and
Tongyu Yang and
Xuan Wen and
Ethan Fahnestock and
Bryce Ikeda and
Ian Lawson and
Alan Finkelstein and
Kehao Guo and
Richard Magnotti and
Andrew Sexton and
Jeet Ketan Thaker and
Yiyang Su and
Chenliang Xu},
title = {Actor-Action Video Classification {CSC} 249/449 Spring 2020 Challenge
Report},
journal = {CoRR},
volume = {abs/2008.00141},
year = {2020}
}
@article{DBLP:journals/corr/abs-2008-01993,
author = {Puspita Majumdar and
Saheb Chhabra and
Richa Singh and
Mayank Vatsa},
title = {Subclass Contrastive Loss for Injured Face Recognition},
journal = {CoRR},
volume = {abs/2008.01993},
year = {2020}
}
@article{DBLP:journals/corr/abs-2008-03205,
author = {Aakarsh Malhotra and
Surbhi Mittal and
Puspita Majumdar and
Saheb Chhabra and
Kartik Thakral and
Mayank Vatsa and
Richa Singh and
Santanu Chaudhury and
Ashwin Pudrod and
Anjali Agrawal},
title = {Multi-Task Driven Explainable Diagnosis of {COVID-19} using Chest
X-ray Images},
journal = {CoRR},
volume = {abs/2008.03205},
year = {2020}
}
@article{DBLP:journals/corr/abs-2008-03522,
author = {Rohit Keshari and
Soumyadeep Ghosh and
Saheb Chhabra and
Mayank Vatsa and
Richa Singh},
title = {Unravelling Small Sample Size Problems in the Deep Learning World},
journal = {CoRR},
volume = {abs/2008.03522},
year = {2020}
}
@article{DBLP:journals/corr/abs-2009-01871,
author = {Holger R. Roth and
Ken Chang and
Praveer Singh and
Nir Neumark and
Wenqi Li and
Vikash Gupta and
Sharut Gupta and
Liangqiong Qu and
Alvin Ihsani and
Bernardo C. Bizzo and
Yuhong Wen and
Varun Buch and
Meesam Shah and
Felipe Kitamura and
Matheus Mendon{\c{c}}a and
Vitor Lavor and
Ahmed Harouni and
Colin Compas and
Jesse Tetreault and
Prerna Dogra and
Yan Cheng and
Selnur Erdal and
Richard D. White and
Behrooz Hashemian and
Thomas J. Schultz and
Miao Zhang and
Adam McCarthy and
B. Min Yun and
Elshaimaa Sharaf and
Katharina Viktoria Hoebel and
Jay B. Patel and
Bryan Chen and
Sean Ko and
Evan Leibovitz and
Etta D. Pisano and
Laura Coombs and
Daguang Xu and
Keith J. Dreyer and
Ittai Dayan and
Ram C. Naidu and
Mona Flores and
Daniel L. Rubin and
Jayashree Kalpathy{-}Cramer},
title = {Federated Learning for Breast Density Classification: {A} Real-World
Implementation},
journal = {CoRR},
volume = {abs/2009.01871},
year = {2020}
}
@article{DBLP:journals/corr/abs-2009-10190,
author = {Ming Y. Lu and
Dehan Kong and
Jana Lipkov{\'{a}} and
Richard J. Chen and
Rajendra Singh and
Drew F. K. Williamson and
Tiffany Y. Chen and
Faisal Mahmood},
title = {Federated Learning for Computational Pathology on Gigapixel Whole
Slide Images},
journal = {CoRR},
volume = {abs/2009.10190},
year = {2020}
}
@article{DBLP:journals/corr/abs-2010-13244,
author = {Mehak Gupta and
Vishal Singh and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {Generalized Iris Presentation Attack Detection Algorithm under Cross-Database
Settings},
journal = {CoRR},
volume = {abs/2010.13244},
year = {2020}
}
@article{DBLP:journals/corr/abs-2010-13246,
author = {Nilay Sanghvi and
Sushant Kumar Singh and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {MixNet for Generalized Face Presentation Attack Detection},
journal = {CoRR},
volume = {abs/2010.13246},
year = {2020}
}
@article{DBLP:journals/corr/abs-2010-13247,
author = {Saheb Chhabra and
Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Attack Agnostic Adversarial Defense via Visual Imperceptible Bound},
journal = {CoRR},
volume = {abs/2010.13247},
year = {2020}
}
@article{DBLP:journals/corr/abs-2010-13778,
author = {Clarice D. Aiello and
D. D. Awschalom and
Hannes Bernien and
Tina Brower{-}Thomas and
Kenneth R. Brown and
Todd A. Brun and
Justin R. Caram and
Eric Chitambar and
Rosa Di Felice and
Michael F. J. Fox and
Stephan Haas and
Alexander W. Holleitner and
Eric R. Hudson and
Jeffrey H. Hunt and
Robert Joynt and
Scott Koziol and
H. J. Lewandowski and
Douglas T. McClure and
Jens Palsberg and
Gina Passante and
Kristen L. Pudenz and
Christopher J. K. Richardson and
Jessica L. Rosenberg and
R. S. Ross and
Mark Saffman and
M. Singh and
David W. Steuerman and
Chad Stark and
Jos Thijssen and
A. Nick Vamivakas and
James D. Whitfield and
Benjamin M. Zwickl},
title = {Achieving a quantum smart workforce},
journal = {CoRR},
volume = {abs/2010.13778},
year = {2020}
}
@article{DBLP:journals/corr/abs-2010-15195,
author = {Wilka Carvalho and
Anthony Liang and
Kimin Lee and
Sungryull Sohn and
Honglak Lee and
Richard L. Lewis and
Satinder Singh},
title = {Reinforcement Learning for Sparse-Reward Object-Interaction Tasks
in First-person Simulated 3D Environments},
journal = {CoRR},
volume = {abs/2010.15195},
year = {2020}
}
@article{DBLP:journals/corr/abs-2010-15773,
author = {Divyam Anshumaan and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {WaveTransform: Crafting Adversarial Examples via Input Decomposition},
journal = {CoRR},
volume = {abs/2010.15773},
year = {2020}
}
@article{DBLP:journals/corr/abs-2011-02272,
author = {Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Trustworthy {AI}},
journal = {CoRR},
volume = {abs/2011.02272},
year = {2020}
}
@article{DBLP:journals/corr/abs-2011-05897,
author = {Daksha Yadav and
Naman Kohli and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Age Gap Reducer-GAN for Recognizing Age-Separated Faces},
journal = {CoRR},
volume = {abs/2011.05897},
year = {2020}
}
@article{DBLP:journals/corr/abs-2012-01772,
author = {Darshan Gandhi and
Rohan Sukumaran and
Priyanshi Katiyar and
Alex Radunsky and
Sunaina Anand and
Shailesh Advani and
Jil Kothari and
Kasia Jakimowicz and
Sheshank Shankar and
Sethuraman T. V. and
Krutika Misra and
Aishwarya Saxena and
Sanskruti Landage and
Richa Sonker and
Parth Patwa and
Aryan Mahindra and
Mikhail Dmitrienko and
Kanishka Vaish and
Ashley Mehra and
Srinidhi Murali and
Rohan Iyer and
Joseph Bae and
Vivek Sharma and
Abhishek Singh and
Rachel Barbar and
Ramesh Raskar},
title = {Digital Landscape of {COVID-19} Testing: Challenges and Opportunities},
journal = {CoRR},
volume = {abs/2012.01772},
year = {2020}
}
@article{DBLP:journals/ibmrd/BellamyDHHHKLMM19,
author = {Rachel K. E. Bellamy and
Kuntal Dey and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Kalapriya Kannan and
Pranay Lohia and
Jacquelyn Martino and
Sameep Mehta and
Aleksandra Mojsilovic and
Seema Nagar and
Karthikeyan Natesan Ramamurthy and
John T. Richards and
Diptikalyan Saha and
Prasanna Sattigeri and
Moninder Singh and
Kush R. Varshney and
Yunfeng Zhang},
title = {{AI} Fairness 360: An extensible toolkit for detecting and mitigating
algorithmic bias},
journal = {{IBM} J. Res. Dev.},
volume = {63},
number = {4/5},
pages = {4:1--4:15},
year = {2019}
}
@article{DBLP:journals/iet-com/SharmaVS19,
author = {Richa Sharma and
Vasudha Vashisht and
Umang Singh},
title = {{EEFCM-DE:} energy-efficient clustering based on fuzzy {C} means and
differential evolution algorithm in WSNs},
journal = {{IET} Commun.},
volume = {13},
number = {8},
pages = {996--1007},
year = {2019}
}
@article{DBLP:journals/ijbra/SinghBBMK19,
author = {Pushpendra Singh and
Felix Bast and
Satej Bhushan and
Richa Mehra and
Pooja Kamboj},
title = {Molecular docking and in vitro study of Syzygium cumini-derived natural
compounds on receptor tyrosine kinases pathway components},
journal = {Int. J. Bioinform. Res. Appl.},
volume = {15},
number = {2},
pages = {144--158},
year = {2019}
}
@article{DBLP:journals/ijcv/GoswamiARSV19,
author = {Gaurav Goswami and
Akshay Agarwal and
Nalini K. Ratha and
Richa Singh and
Mayank Vatsa},
title = {Detecting and Mitigating Adversarial Perturbations for Robust Face
Recognition},
journal = {Int. J. Comput. Vis.},
volume = {127},
number = {6-7},
pages = {719--742},
year = {2019}
}
@article{DBLP:journals/ijdats/SharmaSK19,
author = {Richa Sharma and
Shailendra Narayan Singh and
Sujata Khatri},
title = {Data mining classification techniques - comparison for better accuracy
in prediction of cardiovascular disease},
journal = {Int. J. Data Anal. Tech. Strateg.},
volume = {11},
number = {4},
pages = {356--373},
year = {2019}
}
@article{DBLP:journals/inffus/AgarwalKWVPSV19,
author = {Akshay Agarwal and
Rohit Keshari and
Manya Wadhwa and
Mansi Vijh and
Chandani Parmar and
Richa Singh and
Mayank Vatsa},
title = {Iris sensor identification in multi-camera environment},
journal = {Inf. Fusion},
volume = {45},
pages = {333--345},
year = {2019}
}
@article{DBLP:journals/inffus/SinghSR19,
author = {Maneet Singh and
Richa Singh and
Arun Ross},
title = {A comprehensive overview of biometric fusion},
journal = {Inf. Fusion},
volume = {52},
pages = {187--205},
year = {2019}
}
@article{DBLP:journals/jcc/SunLYXNEDLSSZ19,
author = {Xin Sun and
Xin Li and
Jiong Yang and
Jinyang Xi and
Ryky Nelson and
Christina Ertural and
Richard Dronskowski and
Weishu Liu and
Gerald J. Snyder and
David J. Singh and
Wenqing Zhang},
title = {Achieving band convergence by tuning the bonding ionicity in n-type
Mg3Sb2},
journal = {J. Comput. Chem.},
volume = {40},
number = {18},
pages = {1693--1700},
year = {2019}
}
@article{DBLP:journals/jcisd/LiuSZLTDZZKLCMG19,
author = {Zhijie Liu and
Suresh B. Singh and
Yajun Zheng and
Peter Lindblom and
Colin Tice and
Chengguo Dong and
Linghang Zhuang and
Yi Zhao and
Barbara A. Kruk and
Deepak Lala and
David A. Claremon and
Gerard M. McGeehan and
Richard D. Gregg and
Robert Cain},
title = {Discovery of Potent Inhibitors of 11{\(\beta\)}-Hydroxysteroid Dehydrogenase
Type 1 Using a Novel Growth-Based Protocol of in Silico Screening
and Optimization in {CONTOUR}},
journal = {J. Chem. Inf. Model.},
volume = {59},
number = {8},
pages = {3422--3436},
year = {2019}
}
@article{DBLP:journals/jdi/SinghDGFL19,
author = {Varun Singh and
Varun Danda and
Richard J. T. Gorniak and
Adam E. Flanders and
Paras Lakhani},
title = {Assessment of Critical Feeding Tube Malpositions on Radiographs Using
Deep Learning},
journal = {J. Digit. Imaging},
volume = {32},
number = {4},
pages = {651--655},
year = {2019}
}
@article{DBLP:journals/mcs/HasanSRB19,
author = {Bushra Hasan and
Manmohan Singh and
David Richards and
Aaron Simon Blicblau},
title = {Mathematical modelling of Zika virus as a mosquito-borne and sexually
transmitted disease with diffusion effects},
journal = {Math. Comput. Simul.},
volume = {166},
pages = {56--75},
year = {2019}
}
@article{DBLP:journals/neuroimage/BoringJWWWRG19,
author = {Matthew J. Boring and
Zachary F. Jessen and
Thomas A. Wozny and
Michael J. Ward and
Ashley C. Whiteman and
Robert Mark Richardson and
Avniel Singh Ghuman},
title = {Quantitatively validating the efficacy of artifact suppression techniques
to study the cortical consequences of deep brain stimulation with
magnetoencephalography},
journal = {NeuroImage},
volume = {199},
pages = {366--374},
year = {2019}
}
@article{DBLP:journals/npjdm/BradburySCGKHEC19,
author = {Katherine J. Bradbury and
Mary Steele and
Teresa Corbett and
Adam W. A. Geraghty and
Adele Krusche and
Elena Heber and
Steph Easton and
Tara Cheetham{-}Blake and
Joanna Slodkowska{-}Barabasz and
Andre Matthias M{\"{u}}ller and
Kirsten Smith and
Laura J. Wilde and
Liz Payne and
Karmpaul Singh and
Roger Bacon and
Tamsin Burford and
Kevin Summers and
Lesley Turner and
Alison Richardson and
Eila Watson and
Claire L. Foster and
Paul Little and
Lucy Yardley},
title = {Developing a digital intervention for cancer survivors: an evidence-,
theory- and person-based approach},
journal = {npj Digit. Medicine},
volume = {2},
year = {2019}
}
@article{DBLP:journals/pr/DhamechaNSV19,
author = {Tejas Indulal Dhamecha and
Afzel Noore and
Richa Singh and
Mayank Vatsa},
title = {Between-subclass piece-wise linear solutions in large scale kernel
{SVM} learning},
journal = {Pattern Recognit.},
volume = {95},
pages = {173--190},
year = {2019}
}
@article{DBLP:journals/prl/SethiSSV19,
author = {Akshay Sethi and
Maneet Singh and
Richa Singh and
Mayank Vatsa},
title = {Residual Codean Autoencoder for Facial Attribute Analysis},
journal = {Pattern Recognit. Lett.},
volume = {119},
pages = {157--165},
year = {2019}
}
@article{DBLP:journals/prl/SinghNVS19,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh},
title = {Are you eligible? Predicting adulthood from face images via Class
Specific Mean Autoencoder},
journal = {Pattern Recognit. Lett.},
volume = {119},
pages = {121--130},
year = {2019}
}
@article{DBLP:journals/software/BellamyDHHHKLMM19,
author = {Rachel K. E. Bellamy and
Kuntal Dey and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Kalapriya Kannan and
Pranay Lohia and
Sameep Mehta and
Aleksandra Mojsilovic and
Seema Nagar and
Karthikeyan Natesan Ramamurthy and
John T. Richards and
Diptikalyan Saha and
Prasanna Sattigeri and
Moninder Singh and
Kush R. Varshney and
Yunfeng Zhang},
title = {Think Your Artificial Intelligence Software Is Fair? Think Again},
journal = {{IEEE} Softw.},
volume = {36},
number = {4},
pages = {76--80},
year = {2019}
}
@article{DBLP:journals/tbbis/SinghSVRC19,
author = {Maneet Singh and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha and
Rama Chellappa},
title = {Recognizing Disguised Faces in the Wild},
journal = {{IEEE} Trans. Biom. Behav. Identity Sci.},
volume = {1},
number = {2},
pages = {97--108},
year = {2019}
}
@article{DBLP:journals/tip/KohliYVSN19,
author = {Naman Kohli and
Daksha Yadav and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Supervised Mixed Norm Autoencoder for Kinship Verification in Unconstrained
Videos},
journal = {{IEEE} Trans. Image Process.},
volume = {28},
number = {3},
pages = {1329--1341},
year = {2019}
}
@inproceedings{DBLP:conf/aaai/ChhabraMV019,
author = {Saheb Chhabra and
Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Data Fine-Tuning},
booktitle = {{AAAI}},
pages = {8223--8230},
publisher = {{AAAI} Press},
year = {2019}
}
@inproceedings{DBLP:conf/aaai/Keshari0V19,
author = {Rohit Keshari and
Richa Singh and
Mayank Vatsa},
title = {Guided Dropout},
booktitle = {{AAAI}},
pages = {4065--4072},
publisher = {{AAAI} Press},
year = {2019}
}
@inproceedings{DBLP:conf/aaai/ZhangLSD19,
author = {Qi Zhang and
Richard L. Lewis and
Satinder Singh and
Edmund H. Durfee},
title = {Learning to Communicate and Solve Visual Blocks-World Tasks},
booktitle = {{AAAI}},
pages = {5781--5788},
publisher = {{AAAI} Press},
year = {2019}
}
@inproceedings{DBLP:conf/acl-deeplo/SinghMSX19,
author = {Jasdeep Singh and
Bryan McCann and
Richard Socher and
Caiming Xiong},
title = {{BERT} is Not an Interlingua and the Bias of Tokenization},
booktitle = {DeepLo@EMNLP-IJCNLP},
pages = {47--55},
publisher = {Association for Computational Linguistics},
year = {2019}
}
@inproceedings{DBLP:conf/air/VirkCSPKDP19,
author = {Gurvinder Singh Virk and
Stephen Cameron and
Ratna Sambhav and
Moumita Paul and
Roshan Kumar and
Arvind Dixit and
Richa Pandey},
title = {Towards realising wearable exoskeletons for elderly people},
booktitle = {{AIR}},
pages = {20:1--20:6},
publisher = {{ACM}},
year = {2019}
}
@inproceedings{DBLP:conf/amcc/SinghalM19,
author = {Vipul Singhal and
Richard M. Murray},
title = {Transforming Data Across Environments Despite Structural Non-Identifiability},
booktitle = {{ACC}},
pages = {5639--5646},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/bigmm/0002S0V19,
author = {Akshay Agarwal and
Akarsha Sehwag and
Richa Singh and
Mayank Vatsa},
title = {Deceiving Face Presentation Attack Detection via Image Transforms},
booktitle = {BigMM},
pages = {373--382},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/btas/AgarwalVS19,
author = {Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {{CHIF:} Convoluted Histogram Image Features for Detecting Silicone
Mask based Face Presentation Attack},
booktitle = {{BTAS}},
pages = {1--5},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/btas/GoelAVSR19,
author = {Akhil Goel and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Securing {CNN} Model and Biometric Template using Blockchain},
booktitle = {{BTAS}},
pages = {1--7},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/btas/GoelVS19,
author = {Lamha Goel and
Mayank Vatsa and
Richa Singh},
title = {{LC-DECAL:} Label Consistent Deep Collaborative Learning for Face
Recognition},
booktitle = {{BTAS}},
pages = {1--8},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/btas/MajumdarCSV19,
author = {Puspita Majumdar and
Saheb Chhabra and
Richa Singh and
Mayank Vatsa},
title = {Subclass Contrastive Loss for Injured Face Recognition},
booktitle = {{BTAS}},
pages = {1--7},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/btas/SuriVS19,
author = {Anshuman Suri and
Mayank Vatsa and
Richa Singh},
title = {{A-LINK:} Recognizing Disguised Faces via Active Learning based Inter-Domain
Knowledge},
booktitle = {{BTAS}},
pages = {1--8},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/coinco/SamantCVNK19,
author = {Sunil Singh Samant and
Mohan Baruwal Chhetri and
Quoc Bao Vo and
Surya Nepal and
Ryszard Kowalczyk},
title = {Benchmarking for End-to-End QoS Sustainability in Cloud-Hosted Data
Processing Pipelines},
booktitle = {{CIC}},
pages = {39--48},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/complexnetworks/TripathiMSMJ19,
author = {Richa Tripathi and
Dyutiman Mukhopadhyay and
Chakresh Kumar Singh and
Krishna Prasad Miyapuram and
Shivakumar Jolad},
title = {Characterization of Functional Brain Networks and Emotional Centers
Using the Complex Networks Techniques},
booktitle = {{COMPLEX} {NETWORKS} {(2)}},
series = {Studies in Computational Intelligence},
volume = {882},
pages = {854--867},
publisher = {Springer},
year = {2019}
}
@inproceedings{DBLP:conf/cvpr/Ghosh0V19,
author = {Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa},
title = {On Learning Density Aware Embeddings},
booktitle = {{CVPR}},
pages = {4884--4892},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/cvpr/Goel0V0R19,
author = {Akhil Goel and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {DeepRing: Protecting Deep Neural Network With Blockchain},
booktitle = {{CVPR} Workshops},
pages = {2821--2828},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/cvpr/GuTZ19,
author = {Shuhang Gu and
Radu Timofte and
Richard Zhang and
Maitreya Suin and
Kuldeep Purohit and
A. N. Rajagopalan and
S. Athi Narayanan and
Jameer Babu Pinjari and
Zhiwei Xiong and
Zhan Shi and
Chang Chen and
Dong Liu and
Manoj Sharma and
Megh Makwana and
Anuj Badhwar and
Ajay Pratap Singh and
Avinash Upadhyay and
Akkshita Trivedi and
Anil K. Saini and
Santanu Chaudhury and
Prasen Kumar Sharma and
Priyankar Jain and
Arijit Sur and
G{\"{o}}khan {\"{O}}zbulak},
title = {{NTIRE} 2019 Challenge on Image Colorization: Report},
booktitle = {{CVPR} Workshops},
pages = {2233--2240},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/cvpr/GuptaAA00V19,
author = {Viresh Gupta and
Mohit Agarwal and
Manik Arora and
Tanmoy Chakraborty and
Richa Singh and
Mayank Vatsa},
title = {Bag-Of-Lies: {A} Multimodal Dataset for Deception Detection},
booktitle = {{CVPR} Workshops},
pages = {83--90},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/cvpr/Majumdar00V19,
author = {Puspita Majumdar and
Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Evading Face Recognition via Partial Tampering of Faces},
booktitle = {{CVPR} Workshops},
pages = {11--20},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/cvpr/NagpalSV0N19,
author = {Shruti Nagpal and
Maneet Singh and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Expression Classification in Children Using Mean Supervised Deep Boltzmann
Machine},
booktitle = {{CVPR} Workshops},
pages = {236--245},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/cvpr/YadavKV0N19,
author = {Daksha Yadav and
Naman Kohli and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Detecting Textured Contact Lens in Uncontrolled Environment Using
DensePAD},
booktitle = {{CVPR} Workshops},
pages = {2336--2344},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/fgr/GuptaGG0NVS19,
author = {Sanchit Gupta and
Nikita Gupta and
Soumyadeep Ghosh and
Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh},
title = {FaceSurv: {A} Benchmark Video Dataset for Face Detection and Recognition
Across Spectra and Resolutions},
booktitle = {{FG}},
pages = {1--7},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/fgr/KalraSN0VS19,
author = {Isha Kalra and
Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa and
P. B. Sujit},
title = {DroneSURF: Benchmark Dataset for Drone-based Face Recognition},
booktitle = {{FG}},
pages = {1--7},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/icb/0001SV019,
author = {Akshay Agarwal and
Akarsha Sehwag and
Mayank Vatsa and
Richa Singh},
title = {Deceiving the Protector: Fooling Face Presentation Attack Detection
Algorithms},
booktitle = {{ICB}},
pages = {1--6},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/icb/MehtaU0V019,
author = {Suril Mehta and
Anannya Uberoi and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {Crafting {A} Panoptic Face Presentation Attack Detector},
booktitle = {{ICB}},
pages = {1--6},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/icb/SGV019,
author = {Ramya Y. S. and
Soumyadeep Ghosh and
Mayank Vatsa and
Richa Singh},
title = {Face Sketch Colorization via Supervised GANs},
booktitle = {{ICB}},
pages = {1--6},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/iccv/SinghN0V19,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {Dual Directed Capsule Network for Very Low Resolution Image Recognition},
booktitle = {{ICCV}},
pages = {340--349},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/iccvw/SinghC0VC19,
author = {Maneet Singh and
Mohit Chawla and
Richa Singh and
Mayank Vatsa and
Rama Chellappa},
title = {Disguised Faces in the Wild 2019},
booktitle = {{ICCV} Workshops},
pages = {542--550},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/icip/AgarwalS0N0V19,
author = {Mohit Agarwal and
Sanchit Sinha and
Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {Triplet Transform Learning for Automated Primate Face Recognition},
booktitle = {{ICIP}},
pages = {3462--3466},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/icip/TripathiKGVS19,
author = {Pavani Tripathi and
Rohit Keshari and
Soumyadeep Ghosh and
Mayank Vatsa and
Richa Singh},
title = {{AUTO-G:} Gesture Recognition in the Crowd for Autonomous Vehicl},
booktitle = {{ICIP}},
pages = {3482--3486},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/iclr/ShinKGBTSS19,
author = {Richard Shin and
Neel Kant and
Kavi Gupta and
Chris Bender and
Brandon Trabucco and
Rishabh Singh and
Dawn Song},
title = {Synthetic Datasets for Neural Program Synthesis},
booktitle = {{ICLR} (Poster)},
publisher = {OpenReview.net},
year = {2019}
}
@inproceedings{DBLP:conf/ijcnn/SinghalMV019,
author = {Vanika Singhal and
Angshul Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Siamese Deep Dictionary Learning},
booktitle = {{IJCNN}},
pages = {1--6},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/medinfo/HunterELWGS19,
author = {Inga M. Hunter and
Phoebe Elers and
Caroline Lockhart and
Dick Whiddett and
Hans W. Guesgen and
Amardeep Singh},
title = {Technology to Assist Aging in Place: The Perspective of Health Organizations},
booktitle = {MedInfo},
series = {Studies in Health Technology and Informatics},
volume = {264},
pages = {1688--1689},
publisher = {{IOS} Press},
year = {2019}
}
@inproceedings{DBLP:conf/nips/VeeriahHXRLOHSS19,
author = {Vivek Veeriah and
Matteo Hessel and
Zhongwen Xu and
Janarthanan Rajendran and
Richard L. Lewis and
Junhyuk Oh and
Hado van Hasselt and
David Silver and
Satinder Singh},
title = {Discovery of Useful Questions as Auxiliary Tasks},
booktitle = {NeurIPS},
pages = {9306--9317},
year = {2019}
}
@inproceedings{DBLP:conf/taros/WangHNSSSMTBLGT19,
author = {Shuangyi Wang and
James Housden and
Yohan Noh and
Davinder Singh and
Anisha Singh and
Emily Skelton and
Jacqueline Matthew and
Cornelius Tan and
Junghwan Back and
Lukas Lindenroth and
Alberto G{\'{o}}mez and
Nicolas Toussaint and
Veronika A. M. Zimmer and
Caroline Knight and
Tara P. Fletcher and
David Lloyd and
John M. Simpson and
Dharmintra Pasupathy and
Hongbin Liu and
Kaspar Althoefer and
Joseph V. Hajnal and
Reza Razavi and
Kawal S. Rhode},
title = {Robotic-Assisted Ultrasound for Fetal Imaging: Evolution from Single-Arm
to Dual-Arm System},
booktitle = {{TAROS} {(2)}},
series = {Lecture Notes in Computer Science},
volume = {11650},
pages = {27--38},
publisher = {Springer},
year = {2019}
}
@inproceedings{DBLP:conf/vlsic/TajalliBCCFGGGH19,
author = {Armin Tajalli and
Mani Bastani Parizi and
Dario Albino Carnelli and
Chen Cao and
John Fox and
Kiarash Gharibdoust and
Davide Gorret and
Amit Gupta and
Christopher Hall and
Ahmed Hassanin and
Klaas L. Hofstra and
Brian Holden and
Ali Hormati and
John Keay and
Yohann Mogentale and
G. Paul and
Victor Perrin and
John Phillips and
Sumathi Raparthy and
Amin Shokrollahi and
David Stauffer and
Richard Simpson and
Andrew Stewart and
Giuseppe Surace and
Omid Talebi Amiri and
Emanuele Truffa and
Anton Tschank and
Roger Ulrich and
Christoph Walter and
Anant Singh},
title = {A 1.02pJ/b 417Gb/s/mm {USR} Link in 16nm FinFET},
booktitle = {{VLSI} Circuits},
pages = {92},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/wacv/JoshiAV0RK19,
author = {Indu Joshi and
Adithya Anand and
Mayank Vatsa and
Richa Singh and
Sumantra Dutta Roy and
Prem Kalra},
title = {Latent Fingerprint Enhancement Using Generative Adversarial Networks},
booktitle = {{WACV}},
pages = {895--903},
publisher = {{IEEE}},
year = {2019}
}
@incollection{DBLP:books/sp/19/MalhotraCV019,
author = {Aakarsh Malhotra and
Shaan Chopra and
Mayank Vatsa and
Richa Singh},
title = {User Authentication via Finger-Selfies},
booktitle = {Selfie Biometrics},
series = {Advances in Computer Vision and Pattern Recognition},
pages = {21--47},
publisher = {Springer},
year = {2019}
}
@incollection{DBLP:series/acvpr/YambayCBV0NKYS19,
author = {David Yambay and
Adam Czajka and
Kevin W. Bowyer and
Mayank Vatsa and
Richa Singh and
Afzel Noore and
Naman Kohli and
Daksha Yadav and
Stephanie Schuckers},
title = {Review of Iris Presentation Attack Detection Competitions},
booktitle = {Handbook of Biometric Anti-Spoofing, 2nd Ed},
series = {Advances in Computer Vision and Pattern Recognition},
pages = {169--183},
publisher = {Springer},
year = {2019}
}
@proceedings{DBLP:conf/dsaa/2019,
editor = {Lisa Singh and
Richard D. De Veaux and
George Karypis and
Francesco Bonchi and
Jennifer Hill},
title = {2019 {IEEE} International Conference on Data Science and Advanced
Analytics, {DSAA} 2019, Washington, DC, USA, October 5-8, 2019},
publisher = {{IEEE}},
year = {2019}
}
@proceedings{DBLP:conf/sin/2019,
editor = {Oleg B. Makarevich and
Dmitry Popov and
Ludmila K. Babenko and
Pete Burnap and
Atilla El{\c{c}}i and
Ron Poet and
Jaideep Vaidya and
Mehmet A. Orgun and
Manoj Singh Gaur and
Rajveer Singh Shekhawat},
title = {Proceedings of the 12th International Conference on Security of Information
and Networks, {SIN} 2019, Sochi, Russian Federation, September 12-15,
2019},
publisher = {{ACM}},
year = {2019}
}
@article{DBLP:journals/corr/abs-1901-09237,
author = {Anubhav Jain and
Richa Singh and
Mayank Vatsa},
title = {On Detecting GANs and Retouching based Synthetic Alterations},
journal = {CoRR},
volume = {abs/1901.09237},
year = {2019}
}
@article{DBLP:journals/corr/abs-1902-02919,
author = {Maneet Singh and
Richa Singh and
Arun Ross},
title = {A Comprehensive Overview of Biometric Fusion},
journal = {CoRR},
volume = {abs/1902.02919},
year = {2019}
}
@article{DBLP:journals/corr/abs-1902-05458,
author = {Shuangyi Wang and
James Housden and
Yohan Noh and
Davinder Singh and
Anisha Singh and
Emily Skelton and
Jacqueline Matthew and
Cornelius Tan and
Junghwan Back and
Lukas Lindenroth and
Alberto G{\'{o}}mez and
Nicolas Toussaint and
Veronika A. M. Zimmer and
Caroline Knight and
Tara P. Fletcher and
David Lloyd and
John M. Simpson and
Dharmintra Pasupathy and
Hongbin Liu and
Kaspar Althoefer and
Joseph V. Hajnal and
Reza Razavi and
Kawal S. Rhode},
title = {Robotic-assisted Ultrasound for Fetal Imaging: Evolution from Single-arm
to Dual-arm System},
journal = {CoRR},
volume = {abs/1902.05458},
year = {2019}
}
@article{DBLP:journals/corr/abs-1904-01219,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Deep Learning for Face Recognition: Pride or Prejudiced?},
journal = {CoRR},
volume = {abs/1904.01219},
year = {2019}
}
@article{DBLP:journals/corr/abs-1904-03911,
author = {Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa},
title = {On Learning Density Aware Embeddings},
journal = {CoRR},
volume = {abs/1904.03911},
year = {2019}
}
@article{DBLP:journals/corr/abs-1905-11471,
author = {Jasdeep Singh and
Bryan McCann and
Nitish Shirish Keskar and
Caiming Xiong and
Richard Socher},
title = {{XLDA:} Cross-Lingual Data Augmentation for Natural Language Inference
and Question Answering},
journal = {CoRR},
volume = {abs/1905.11471},
year = {2019}
}
@article{DBLP:journals/corr/abs-1907-13122,
author = {Sumeet Singh and
Spencer M. Richards and
Vikas Sindhwani and
Jean{-}Jacques E. Slotine and
Marco Pavone},
title = {Learning Stabilizable Nonlinear Dynamics with Contraction-Based Regularization},
journal = {CoRR},
volume = {abs/1907.13122},
year = {2019}
}
@article{DBLP:journals/corr/abs-1908-03568,
author = {Ian Osband and
Yotam Doron and
Matteo Hessel and
John Aslanides and
Eren Sezener and
Andre Saraiva and
Katrina McKinney and
Tor Lattimore and
Csaba Szepesv{\'{a}}ri and
Satinder Singh and
Benjamin Van Roy and
Richard S. Sutton and
David Silver and
Hado van Hasselt},
title = {Behaviour Suite for Reinforcement Learning},
journal = {CoRR},
volume = {abs/1908.03568},
year = {2019}
}
@article{DBLP:journals/corr/abs-1908-10027,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {Dual Directed Capsule Network for Very Low Resolution Image Recognition},
journal = {CoRR},
volume = {abs/1908.10027},
year = {2019}
}
@article{DBLP:journals/corr/abs-1909-03012,
author = {Vijay Arya and
Rachel K. E. Bellamy and
Pin{-}Yu Chen and
Amit Dhurandhar and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Q. Vera Liao and
Ronny Luss and
Aleksandra Mojsilovic and
Sami Mourad and
Pablo Pedemonte and
Ramya Raghavendra and
John T. Richards and
Prasanna Sattigeri and
Karthikeyan Shanmugam and
Moninder Singh and
Kush R. Varshney and
Dennis Wei and
Yunfeng Zhang},
title = {One Explanation Does Not Fit All: {A} Toolkit and Taxonomy of {AI}
Explainability Techniques},
journal = {CoRR},
volume = {abs/1909.03012},
year = {2019}
}
@article{DBLP:journals/corr/abs-1909-04607,
author = {Vivek Veeriah and
Matteo Hessel and
Zhongwen Xu and
Richard L. Lewis and
Janarthanan Rajendran and
Junhyuk Oh and
Hado van Hasselt and
David Silver and
Satinder Singh},
title = {Discovery of Useful Questions as Auxiliary Tasks},
journal = {CoRR},
volume = {abs/1909.04607},
year = {2019}
}
@article{DBLP:journals/corr/abs-1911-13250,
author = {Raunak Sinha and
Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {AuthorGAN: Improving {GAN} Reproducibility using a Modular {GAN} Framework},
journal = {CoRR},
volume = {abs/1911.13250},
year = {2019}
}
@article{DBLP:journals/corr/abs-1912-07045,
author = {Janarthanan Rajendran and
Richard L. Lewis and
Vivek Veeriah and
Honglak Lee and
Satinder Singh},
title = {How Should an Agent Practice?},
journal = {CoRR},
volume = {abs/1912.07045},
year = {2019}
}
@article{DBLP:journals/corr/abs-1912-12345,
author = {Richard Shin and
Neel Kant and
Kavi Gupta and
Christopher Bender and
Brandon Trabucco and
Rishabh Singh and
Dawn Song},
title = {Synthetic Datasets for Neural Program Synthesis},
journal = {CoRR},
volume = {abs/1912.12345},
year = {2019}
}
@article{DBLP:journals/amc/SinghN18,
author = {Maneesh Kumar Singh and
Srinivasan Natesan},
title = {Richardson extrapolation technique for singularly perturbed system
of parabolic partial differential equations with exponential boundary
layers},
journal = {Appl. Math. Comput.},
volume = {333},
pages = {254--275},
year = {2018}
}
@article{DBLP:journals/amc/SinghN18a,
author = {Maneesh Kumar Singh and
Srinivasan Natesan},
title = {Corrigendum to "Richardson extrapolation technique for singularly
perturbed system of parabolic partial differential equations with
exponential boundary layers" [Applied Mathematics and Computation
333 {(2018)} 254-275]},
journal = {Appl. Math. Comput.},
volume = {338},
pages = {660},
year = {2018}
}
@article{DBLP:journals/bmcbi/SinghKMGBVF18,
author = {Gurnoor Singh and
Arnold Kuzniar and
Erik M. van Mulligen and
Anand Gavai and
Christian W. Bachem and
Richard G. F. Visser and
Richard Finkers},
title = {QTLTableMiner++: semantic mining of {QTL} tables in scientific articles},
journal = {{BMC} Bioinform.},
volume = {19},
number = {1},
pages = {183:1--183:11},
year = {2018}
}
@article{DBLP:journals/brain/SharmaTCKKSDK18,
author = {Kanishka Sharma and
Richa Trivedi and
Sushil Chandra and
Prabhjot Kaur and
Pawan Kumar and
Kavita Singh and
Ashok K. Dubey and
Subash Khushu},
title = {Enhanced White Matter Integrity in Corpus Callosum of Long-Term Brahmakumaris
Rajayoga Meditators},
journal = {Brain Connect.},
volume = {8},
number = {1},
pages = {49--55},
year = {2018}
}
@article{DBLP:journals/inffus/ChhokraCGVS18,
author = {Pawas Chhokra and
Anurag Chowdhury and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh},
title = {Unconstrained Kinect video face database},
journal = {Inf. Fusion},
volume = {44},
pages = {113--125},
year = {2018}
}
@article{DBLP:journals/iotj/BediVSBW18,
author = {Guneet Bedi and
Ganesh Kumar Venayagamoorthy and
Rajendra Singh and
Richard R. Brooks and
Kuang{-}Ching Wang},
title = {Review of Internet of Things (IoT) in Electric Power and Energy Systems},
journal = {{IEEE} Internet Things J.},
volume = {5},
number = {2},
pages = {847--870},
year = {2018}
}
@article{DBLP:journals/mktsci/SchaeferRM18,
author = {Richard Schaefer and
Raghunath Singh Rao and
Vijay Mahajan},
title = {Marketing Self-Improvement Programs for Self-Signaling Consumers},
journal = {Mark. Sci.},
volume = {37},
number = {6},
pages = {912--929},
year = {2018}
}
@article{DBLP:journals/prl/DhamechaSVVS18,
author = {Tejas I. Dhamecha and
Mahek Shah and
Priyanka Verma and
Mayank Vatsa and
Richa Singh},
title = {CrowdFaceDB: Database and benchmarking for face verification in crowd},
journal = {Pattern Recognit. Lett.},
volume = {107},
pages = {17--24},
year = {2018}
}
@article{DBLP:journals/tmis/MendlingWABCDDC18,
author = {Jan Mendling and
Ingo Weber and
Wil M. P. van der Aalst and
Jan vom Brocke and
Cristina Cabanillas and
Florian Daniel and
S{\o}ren Debois and
Claudio Di Ciccio and
Marlon Dumas and
Schahram Dustdar and
Avigdor Gal and
Luciano Garc{\'{\i}}a{-}Ba{\~{n}}uelos and
Guido Governatori and
Richard Hull and
Marcello La Rosa and
Henrik Leopold and
Frank Leymann and
Jan Recker and
Manfred Reichert and
Hajo A. Reijers and
Stefanie Rinderle{-}Ma and
Andreas Solti and
Michael Rosemann and
Stefan Schulte and
Munindar P. Singh and
Tijs Slaats and
Mark Staples and
Barbara Weber and
Matthias Weidlich and
Mathias Weske and
Xiwei Xu and
Liming Zhu},
title = {Blockchains for Business Process Management - Challenges and Opportunities},
journal = {{ACM} Trans. Manag. Inf. Syst.},
volume = {9},
number = {1},
pages = {4:1--4:16},
year = {2018}
}
@inproceedings{DBLP:conf/IEEEscc/SamantCVKN18,
author = {Sunil Singh Samant and
Mohan Baruwal Chhetri and
Quoc Bao Vo and
Ryszard Kowalczyk and
Surya Nepal},
title = {Towards End-to-End QoS and Cost-Aware Resource Scaling in Cloud-Based
IoT Data Processing Pipelines},
booktitle = {{SCC}},
pages = {287--290},
publisher = {{IEEE}},
year = {2018}
}
@inproceedings{DBLP:conf/aaai/GoswamiRASV18,
author = {Gaurav Goswami and
Nalini K. Ratha and
Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Unravelling Robustness of Deep Learning Based Face Recognition Against
Adversarial Attacks},
booktitle = {{AAAI}},
pages = {6829--6836},
publisher = {{AAAI} Press},
year = {2018}
}
@inproceedings{DBLP:conf/bigdataconf/MarcianoUHMST18,
author = {Richard Marciano and
William Underwood and
Mohammad Hanaee and
Connor Mullane and
Aakanksha Singh and
Zayden Tethong},
title = {Automating the Detection of Personally Identifiable Information {(PII)}
in Japanese-American {WWII} Incarceration Camp Records},
booktitle = {{IEEE} BigData},
pages = {2725--2732},
publisher = {{IEEE}},
year = {2018}
}
@inproceedings{DBLP:conf/btas/Agarwal0VR18,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Are Image-Agnostic Universal Adversarial Perturbations for Face Recognition
Difficult to Detect?},
booktitle = {{BTAS}},
pages = {1--7},
publisher = {{IEEE}},
year = {2018}
}
@inproceedings{DBLP:conf/btas/GargBG0VR18,
author = {Rishabh Garg and
Yashasvi Baweja and
Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Heterogeneity Aware Deep Embedding for Mobile Periocular Recognition},
booktitle = {{BTAS}},
pages = {1--7},
publisher = {{IEEE}},
year = {2018}
}
@inproceedings{DBLP:conf/btas/GoelSAV018,
author = {Akhil Goel and
Anirudh Singh and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh},
title = {SmartBox: Benchmarking Adversarial Detection and Mitigation Algorithms
for Face Recognition},
booktitle = {{BTAS}},
pages = {1--7},
publisher = {{IEEE}},
year = {2018}
}
@inproceedings{DBLP:conf/btas/Jain0V18,
author = {Anubhav Jain and
Richa Singh and
Mayank Vatsa},
title = {On Detecting GANs and Retouching based Synthetic Alterations},
booktitle = {{BTAS}},
pages = {1--7},
publisher = {{IEEE}},
year = {2018}
}
@inproceedings{DBLP:conf/btas/SinghN0VN18,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Learning {A} Shared Transform Model for Skull to Digital Face Image
Matching},
booktitle = {{BTAS}},
pages = {1--7},
publisher = {{IEEE}},
year = {2018}
}
@inproceedings{DBLP:conf/btas/SuriSV018,
author = {Saksham Suri and
Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {On Matching Faces with Alterations due to Plastic Surgery and Disguise},
booktitle = {{BTAS}},
pages = {1--7},
publisher = {{IEEE}},
year = {2018}
}
@inproceedings{DBLP:conf/cvpr/ChopraMV018,
author = {Shaan Chopra and
Aakarsh Malhotra and
Mayank Vatsa and
Richa Singh},
title = {Unconstrained Fingerphoto Database},
booktitle = {{CVPR} Workshops},
pages = {517--525},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/cvpr/KeshariV0N18,
author = {Rohit Keshari and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Learning Structure and Strength of {CNN} Filters for Small Sample
Size Training},
booktitle = {{CVPR}},
pages = {9349--9358},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/cvpr/KushwahaS0VRC18,
author = {Vineet Kushwaha and
Maneet Singh and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha and
Rama Chellappa},
title = {Disguised Faces in the Wild},
booktitle = {{CVPR} Workshops},
pages = {1--9},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/cvpr/MajumdarC0V18,
author = {Puspita Majumdar and
Saheb Chhabra and
Richa Singh and
Mayank Vatsa},
title = {On Detecting Domestic Abuse via Faces},
booktitle = {{CVPR} Workshops},
pages = {2173--2179},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/cvpr/SinghNV0M18,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh and
Angshul Majumdar},
title = {Identity Aware Synthesis for Cross Resolution Face Recognition},
booktitle = {{CVPR} Workshops},
pages = {479--488},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/cvpr/YadavKAV0N18,
author = {Daksha Yadav and
Naman Kohli and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Fusion of Handcrafted and Deep Learning Features for Large-Scale Multiple
Iris Presentation Attack Detection},
booktitle = {{CVPR} Workshops},
pages = {572--579},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/cvpr/YadavKKV0N18,
author = {Daksha Yadav and
Naman Kohli and
Ekampreet Kalsi and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Unraveling Human Perception of Facial Aging Using Eye Gaze},
booktitle = {{CVPR} Workshops},
pages = {2140--2147},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/dh/MarcianoLULDS18,
author = {Richard Marciano and
Myeong Lee and
William Underwood and
Sandra Laib and
Zeynep Diker and
Aakanksha Singh},
title = {Digital Curation of a World War {II} Japanese-American Incarceration
Camp Collection: Implications for Sociotechnical Archival Systems},
booktitle = {DigitalHERITAGE/VSMM},
pages = {1--4},
publisher = {{IEEE}},
year = {2018}
}
@inproceedings{DBLP:conf/eccv/KristanLMFPZVBL18,
author = {Matej Kristan and
Ales Leonardis and
Jiri Matas and
Michael Felsberg and
Roman P. Pflugfelder and
Luka Cehovin Zajc and
Tom{\'{a}}s Voj{\'{\i}}r and
Goutam Bhat and
Alan Lukezic and
Abdelrahman Eldesokey and
Gustavo Fern{\'{a}}ndez and
{\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and
{\'{A}}lvaro Iglesias{-}Arias and
A. Aydin Alatan and
Abel Gonz{\'{a}}lez{-}Garc{\'{\i}}a and
Alfredo Petrosino and
Alireza Memarmoghadam and
Andrea Vedaldi and
Andrej Muhic and
Anfeng He and
Arnold W. M. Smeulders and
Asanka G. Perera and
Bo Li and
Boyu Chen and
Changick Kim and
Changsheng Xu and
Changzhen Xiong and
Cheng Tian and
Chong Luo and
Chong Sun and
Cong Hao and
Daijin Kim and
Deepak Mishra and
Deming Chen and
Dong Wang and
Dongyoon Wee and
Efstratios Gavves and
Erhan Gundogdu and
Erik Velasco{-}Salido and
Fahad Shahbaz Khan and
Fan Yang and
Fei Zhao and
Feng Li and
Francesco Battistone and
George De Ath and
Gorthi R. K. Sai Subrahmanyam and
Guilherme Sousa Bastos and
Haibin Ling and
Hamed Kiani Galoogahi and
Hankyeol Lee and
Haojie Li and
Haojie Zhao and
Heng Fan and
Honggang Zhang and
Horst Possegger and
Houqiang Li and
Huchuan Lu and
Hui Zhi and
Huiyun Li and
Hyemin Lee and
Hyung Jin Chang and
Isabela Drummond and
Jack Valmadre and
Jaime Spencer Martin and
Javaan Singh Chahl and
Jin Young Choi and
Jing Li and
Jinqiao Wang and
Jinqing Qi and
Jinyoung Sung and
Joakim Johnander and
Jo{\~{a}}o F. Henriques and
Jongwon Choi and
Joost van de Weijer and
Jorge Rodr{\'{\i}}guez Herranz and
Jos{\'{e}} M. Mart{\'{\i}}nez and
Josef Kittler and
Junfei Zhuang and
Junyu Gao and
Klemen Grm and
Lichao Zhang and
Lijun Wang and
Lingxiao Yang and
Litu Rout and
Liu Si and
Luca Bertinetto and
Lutao Chu and
Manqiang Che and
Mario Edoardo Maresca and
Martin Danelljan and
Ming{-}Hsuan Yang and
Mohamed H. Abdelpakey and
Mohamed S. Shehata and
Myunggu Kang and
Namhoon Lee and
Ning Wang and
Ondrej Miksik and
Payman Moallem and
Pablo Vicente{-}Mo{\~{n}}ivar and
Pedro Senna and
Peixia Li and
Philip H. S. Torr and
Priya Mariam Raju and
Ruihe Qian and
Qiang Wang and
Qin Zhou and
Qing Guo and
Rafael Martin Nieto and
Rama Krishna Sai Subrahmanyam Gorthi and
Ran Tao and
Richard Bowden and
Richard M. Everson and
Runling Wang and
Sangdoo Yun and
Seokeon Choi and
Sergio Vivas and
Shuai Bai and
Shuangping Huang and
Sihang Wu and
Simon Hadfield and
Siwen Wang and
Stuart Golodetz and
Ming Tang and
Tianyang Xu and
Tianzhu Zhang and
Tobias Fischer and
Vincenzo Santopietro and
Vitomir Struc and
Wei Wang and
Wangmeng Zuo and
Wei Feng and
Wei Wu and
Wei Zou and
Weiming Hu and
Wengang Zhou and
Wenjun Zeng and
Xiaofan Zhang and
Xiaohe Wu and
Xiao{-}Jun Wu and
Xinmei Tian and
Yan Li and
Yan Lu and
Yee Wei Law and
Yi Wu and
Yiannis Demiris and
Yicai Yang and
Yifan Jiao and
Yuhong Li and
Yunhua Zhang and
Yuxuan Sun and
Zheng Zhang and
Zheng Zhu and
Zhen{-}Hua Feng and
Zhihui Wang and
Zhiqun He},
title = {The Sixth Visual Object Tracking {VOT2018} Challenge Results},
booktitle = {{ECCV} Workshops {(1)}},
series = {Lecture Notes in Computer Science},
volume = {11129},
pages = {3--53},
publisher = {Springer},
year = {2018}
}
@inproceedings{DBLP:conf/eccv/SinhaAV0A18,
author = {Sanchit Sinha and
Mohit Agarwal and
Mayank Vatsa and
Richa Singh and
Saket Anand},
title = {Exploring Bias in Primate Face Detection and Recognition},
booktitle = {{ECCV} Workshops {(1)}},
series = {Lecture Notes in Computer Science},
volume = {11129},
pages = {541--555},
publisher = {Springer},
year = {2018}
}
@inproceedings{DBLP:conf/flairs/GuesgenWHELSM18,
author = {Hans W. Guesgen and
Dick Whiddett and
Inga M. Hunter and
Phoebe Elers and
Caroline Lockhart and
Amardeep Singh and
Stephen Marsland},
title = {Using Spatio-Temporal Anomalies to Detect Abnormal Behaviour in Smart
Homes},
booktitle = {{FLAIRS}},
pages = {20--25},
publisher = {{AAAI} Press},
year = {2018}
}
@inproceedings{DBLP:conf/icdf2c/SinghIV18,
author = {Avinash Singh and
Adeyemi R. Ikuesan and
Hein S. Venter},
title = {Digital Forensic Readiness Framework for Ransomware Investigation},
booktitle = {{ICDF2C}},
series = {Lecture Notes of the Institute for Computer Sciences, Social Informatics
and Telecommunications Engineering},
volume = {259},
pages = {91--105},
publisher = {Springer},
year = {2018}
}
@inproceedings{DBLP:conf/icpr/GuptaB0V18,
author = {Ishita Gupta and
Ikshu Bhalla and
Richa Singh and
Mayank Vatsa},
title = {Scattering Transform for Matching Surgically Altered Face Images},
booktitle = {{ICPR}},
pages = {2215--2220},
publisher = {{IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/icpr/LakraTKV018,
author = {Aditya Lakra and
Pavani Tripathi and
Rohit Keshari and
Mayank Vatsa and
Richa Singh},
title = {SegDenseNet: Iris Segmentation for Pre-and-Post Cataract Surgery},
booktitle = {{ICPR}},
pages = {3150--3155},
publisher = {{IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/icpr/SiddiquiV018,
author = {Sahar Siddiqui and
Mayank Vatsa and
Richa Singh},
title = {Face Recognition for Newborns, Toddlers, and Pre-School Children:
{A} Deep Learning Approach},
booktitle = {{ICPR}},
pages = {3156--3161},
publisher = {{IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/ieeesensors/ChaturvediLSKMC18,
author = {Nidhi Chaturvedi and
Richard Lossy and
Kuldip Singh and
Dheeraj K. Kharbanda and
Shivanshu Mishra and
Ashok Chauhan and
Kaushal Kishore and
Pramod K. Khanna and
Joachim W{\"{u}}rfl},
title = {Design and Development of Gallium Nitride HEMTs Based Liquid Sensor},
booktitle = {{IEEE} {SENSORS}},
pages = {1--3},
publisher = {{IEEE}},
year = {2018}
}
@inproceedings{DBLP:conf/ijcai/ChhabraSVG18,
author = {Saheb Chhabra and
Richa Singh and
Mayank Vatsa and
Gaurav Gupta},
title = {Anonymizing k Facial Attributes via Adversarial Perturbations},
booktitle = {{IJCAI}},
pages = {656--662},
publisher = {ijcai.org},
year = {2018}
}
@inproceedings{DBLP:conf/uemcom/GrewalMTCG18,
author = {Harkishan Singh Grewal and
Aaron Matthews and
Richard Tea and
Ved Contractor and
Kiran George},
title = {Sip-and-Puff Autonomous Wheelchair for Individuals with Severe Disabilities},
booktitle = {{UEMCON}},
pages = {705--710},
publisher = {{IEEE}},
year = {2018}
}
@inproceedings{DBLP:conf/wacv/MalhotraSVP18,
author = {Aakarsh Malhotra and
Richa Singh and
Mayank Vatsa and
Vishal M. Patel},
title = {Person Authentication Using Head Images},
booktitle = {{WACV}},
pages = {409--417},
publisher = {{IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/wacv/YadavKVSN18,
author = {Daksha Yadav and
Naman Kohli and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Iris Presentation Attack via Textured Contact Lens in Unconstrained
Environment},
booktitle = {{WACV}},
pages = {503--511},
publisher = {{IEEE} Computer Society},
year = {2018}
}
@proceedings{DBLP:conf/hotsos/2018,
editor = {Munindar P. Singh and
Laurie A. Williams and
Rick Kuhn and
Tao Xie},
title = {Proceedings of the 5th Annual Symposium and Bootcamp on Hot Topics
in the Science of Security, HoTSoS 2018, Raleigh, North Carolina,
USA, April 10-11, 2018},
publisher = {{ACM}},
year = {2018}
}
@article{DBLP:journals/corr/abs-1801-10100,
author = {Aditya Lakra and
Pavani Tripathi and
Rohit Keshari and
Mayank Vatsa and
Richa Singh},
title = {SegDenseNet: Iris Segmentation for Pre and Post Cataract Surgery},
journal = {CoRR},
volume = {abs/1801.10100},
year = {2018}
}
@article{DBLP:journals/corr/abs-1802-08057,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa and
Angshul Majumdar},
title = {MagnifyMe: Aiding Cross Resolution Face Recognition via Identity Aware
Synthesis},
journal = {CoRR},
volume = {abs/1802.08057},
year = {2018}
}
@article{DBLP:journals/corr/abs-1803-00401,
author = {Gaurav Goswami and
Nalini K. Ratha and
Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Unravelling Robustness of Deep Learning based Face Recognition Against
Adversarial Attacks},
journal = {CoRR},
volume = {abs/1803.00401},
year = {2018}
}
@article{DBLP:journals/corr/abs-1803-07385,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh},
title = {Are you eligible? Predicting adulthood from face images via class
specific mean autoencoder},
journal = {CoRR},
volume = {abs/1803.07385},
year = {2018}
}
@article{DBLP:journals/corr/abs-1803-07386,
author = {Akshay Sethi and
Maneet Singh and
Richa Singh and
Mayank Vatsa},
title = {Residual Codean Autoencoder for Facial Attribute Analysis},
journal = {CoRR},
volume = {abs/1803.07386},
year = {2018}
}
@article{DBLP:journals/corr/abs-1803-11405,
author = {Rohit Keshari and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Learning Structure and Strength of {CNN} Filters for Small Sample
Size Training},
journal = {CoRR},
volume = {abs/1803.11405},
year = {2018}
}
@article{DBLP:journals/corr/abs-1805-07905,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {Class Representative Autoencoder for Low Resolution Multi-Spectral
Gender Classification},
journal = {CoRR},
volume = {abs/1805.07905},
year = {2018}
}
@article{DBLP:journals/corr/abs-1805-09380,
author = {Saheb Chhabra and
Richa Singh and
Mayank Vatsa and
Gaurav Gupta},
title = {Anonymizing k-Facial Attributes via Adversarial Perturbations},
journal = {CoRR},
volume = {abs/1805.09380},
year = {2018}
}
@article{DBLP:journals/corr/abs-1805-10557,
author = {Naman Kohli and
Mayank Vatsa and
Richa Singh and
Afzel Noore and
Angshul Majumdar},
title = {Hierarchical Representation Learning for Kinship Verification},
journal = {CoRR},
volume = {abs/1805.10557},
year = {2018}
}
@article{DBLP:journals/corr/abs-1805-12167,
author = {Naman Kohli and
Daksha Yadav and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Supervised Mixed Norm Autoencoder for Kinship Verification in Unconstrained
Videos},
journal = {CoRR},
volume = {abs/1805.12167},
year = {2018}
}
@article{DBLP:journals/corr/abs-1808-04571,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Learning {A} Shared Transform Model for Skull to Digital Face Image
Matching},
journal = {CoRR},
volume = {abs/1808.04571},
year = {2018}
}
@article{DBLP:journals/corr/abs-1810-01943,
author = {Rachel K. E. Bellamy and
Kuntal Dey and
Michael Hind and
Samuel C. Hoffman and
Stephanie Houde and
Kalapriya Kannan and
Pranay Lohia and
Jacquelyn Martino and
Sameep Mehta and
Aleksandra Mojsilovic and
Seema Nagar and
Karthikeyan Natesan Ramamurthy and
John T. Richards and
Diptikalyan Saha and
Prasanna Sattigeri and
Moninder Singh and
Kush R. Varshney and
Yunfeng Zhang},
title = {{AI} Fairness 360: An Extensible Toolkit for Detecting, Understanding,
and Mitigating Unwanted Algorithmic Bias},
journal = {CoRR},
volume = {abs/1810.01943},
year = {2018}
}
@article{DBLP:journals/corr/abs-1810-06221,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Supervised {COSMOS} Autoencoder: Learning Beyond the Euclidean Loss!},
journal = {CoRR},
volume = {abs/1810.06221},
year = {2018}
}
@article{DBLP:journals/corr/abs-1811-00846,
author = {Rishabh Garg and
Yashasvi Baweja and
Soumyadeep Ghosh and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Heterogeneity Aware Deep Embedding for Mobile Periocular Recognition},
journal = {CoRR},
volume = {abs/1811.00846},
year = {2018}
}
@article{DBLP:journals/corr/abs-1811-07318,
author = {Saksham Suri and
Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {On Matching Faces with Alterations due to Plastic Surgery and Disguise},
journal = {CoRR},
volume = {abs/1811.07318},
year = {2018}
}
@article{DBLP:journals/corr/abs-1811-08837,
author = {Maneet Singh and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha and
Rama Chellappa},
title = {Recognizing Disguised Faces in the Wild},
journal = {CoRR},
volume = {abs/1811.08837},
year = {2018}
}
@article{DBLP:journals/corr/abs-1812-03944,
author = {Saheb Chhabra and
Puspita Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Data Fine-tuning},
journal = {CoRR},
volume = {abs/1812.03944},
year = {2018}
}
@article{DBLP:journals/corr/abs-1812-03965,
author = {Rohit Keshari and
Richa Singh and
Mayank Vatsa},
title = {Guided Dropout},
journal = {CoRR},
volume = {abs/1812.03965},
year = {2018}
}
@article{DBLP:journals/bmcbi/RouchkaCTPRSVCFCMJJHCSDSMFWHFLMLD17,
author = {Eric C. Rouchka and
Julia H. Chariker and
David Tieri and
Juw Won Park and
Shreedharkumar D. Rajurkar and
Vikas Singh and
Nishchal K. Verma and
Yan Cui and
Mark L. Farman and
Bradford Condon and
Neil Moore and
Jerzy W. Jaromczyk and
Jolanta Jaromczyk and
Daniel R. Harris and
Patrick Calie and
Eun Kyong Shin and
Robert L. Davis and
Arash Shaban{-}Nejad and
Joshua M. Mitchell and
Robert M. Flight and
Qing Jun Wang and
Richard M. Higashi and
Teresa W.{-}M. Fan and
Andrew N. Lane and
Hunter N. B. Moseley and
Liangqun Lu and
Bernie J. Daigle and
Xi Chen and
Andrey Smelter and
Li Chen and
Bailey K. Phan and
Nathaniel J. Serpico and
Ethan G. Toney and
Caroline E. Melton and
Jennifer R. Mandel and
Bernie J. Daigle Jr. and
Hao Chen and
Kazi I. Zaman and
Ramin Homayouni and
Patrick J. Trainor and
Samantha M. Carlisle and
Andrew P. DeFilippis and
Shesh N. Rai},
title = {Proceedings of the 16th Annual {UT-KBRIN} Bioinformatics Summit 2016:
bioinformatics: Burns, TN, {USA.} April 21-23, 2017},
journal = {{BMC} Bioinform.},
volume = {18},
number = {{S-9}},
year = {2017}
}
@article{DBLP:journals/inffus/MittalJGVS17,
author = {Paritosh Mittal and
Aishwarya Jain and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh},
title = {Composite sketch recognition using saliency and attribute feedback},
journal = {Inf. Fusion},
volume = {33},
pages = {86--99},
year = {2017}
}
@article{DBLP:journals/inffus/SankaranJVVS17,
author = {Anush Sankaran and
Aayush Jain and
Tarun Vashisth and
Mayank Vatsa and
Richa Singh},
title = {Adaptive latent fingerprint segmentation using feature selection and
random decision forest classification},
journal = {Inf. Fusion},
volume = {34},
pages = {1--15},
year = {2017}
}
@article{DBLP:journals/ivc/SankaranVSM17,
author = {Anush Sankaran and
Mayank Vatsa and
Richa Singh and
Angshul Majumdar},
title = {Group sparse autoencoder},
journal = {Image Vis. Comput.},
volume = {60},
pages = {64--74},
year = {2017}
}
@article{DBLP:journals/jamia/McEvoySHAA17,
author = {Dustin McEvoy and
Dean F. Sittig and
Thu{-}Trang T. Hickman and
Skye Aaron and
Angela Ai and
Mary G. Amato and
David W. Bauer and
Greg Fraser and
Jeremy Harper and
Angela Kennemer and
Michael Krall and
Christoph U. Lehmann and
Sameer Malhotra and
Daniel R. Murphy and
Brandi O'Kelley and
Lipika Samal and
Richard Schreiber and
Hardeep Singh and
Eric J. Thomas and
Carl V. Vartian and
Jennifer Westmorland and
Allison B. McCoy and
Adam Wright},
title = {Variation in high-priority drug-drug interaction alerts across institutions
and electronic health records},
journal = {J. Am. Medical Informatics Assoc.},
volume = {24},
number = {2},
pages = {331--338},
year = {2017}
}
@article{DBLP:journals/jsyml/RastS17,
author = {Richard Rast and
Davender Singh Sahota},
title = {The Borel Complexity of Isomorphism for O-Minimal Theories},
journal = {J. Symb. Log.},
volume = {82},
number = {2},
pages = {453--473},
year = {2017}
}
@article{DBLP:journals/mj/SrivastavaSGS17,
author = {Richa Srivastava and
Urvashi Singh and
Maneesha Gupta and
Devesh Singh},
title = {Low-voltage low-power high performance current mode fullwave rectifier},
journal = {Microelectron. J.},
volume = {61},
pages = {51--56},
year = {2017}
}
@article{DBLP:journals/neuroimage/LiRG17,
author = {Yuanning Li and
Robert Mark Richardson and
Avniel Singh Ghuman},
title = {Multi-Connection Pattern Analysis: Decoding the representational content
of neural communication},
journal = {NeuroImage},
volume = {162},
pages = {32--44},
year = {2017}
}
@article{DBLP:journals/pami/MajumdarSV17,
author = {Angshul Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Face Verification via Class Sparsity Based Supervised Encoding},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {39},
number = {6},
pages = {1273--1280},
year = {2017}
}
@article{DBLP:journals/peerj-cs/MeurerSPCKRKIMS17,
author = {Aaron Meurer and
Christopher P. Smith and
Mateusz Paprocki and
Ondrej Cert{\'{\i}}k and
Sergey B. Kirpichev and
Matthew Rocklin and
Amit Kumar and
Sergiu Ivanov and
Jason Keith Moore and
Sartaj Singh and
Thilina Rathnayake and
Sean Vig and
Brian E. Granger and
Richard P. Muller and
Francesco Bonazzi and
Harsh Gupta and
Shivam Vats and
Fredrik Johansson and
Fabian Pedregosa and
Matthew J. Curry and
Andy R. Terrel and
Step{\'{a}}n Roucka and
Ashutosh Saboo and
Isuru Fernando and
Sumith Kulal and
Robert Cimrman and
Anthony M. Scopatz},
title = {SymPy: symbolic computing in Python},
journal = {PeerJ Comput. Sci.},
volume = {3},
pages = {e103},
year = {2017}
}
@article{DBLP:journals/pr/SankaranGVSM17,
author = {Anush Sankaran and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh and
Angshul Majumdar},
title = {Class sparsity signature based Restricted Boltzmann Machine},
journal = {Pattern Recognit.},
volume = {61},
pages = {674--685},
year = {2017}
}
@article{DBLP:journals/sensors/AminRMTMRDSYCOR17,
author = {Ruhul Amin and
Benjamin L. Richards and
William F. X. E. Misa and
Jeremy C. Taylor and
Dianna R. Miller and
Audrey K. Rollo and
Christopher Demarke and
Hanumant Singh and
Grace C. Young and
Jeremy Childress and
Justin E. Ossolinski and
Russell T. Reardon and
Kyle H. Koyanagi},
title = {The Modular Optical Underwater Survey System},
journal = {Sensors},
volume = {17},
number = {10},
pages = {2309},
year = {2017}
}
@article{DBLP:journals/tifs/GoswamiVS17,
author = {Gaurav Goswami and
Mayank Vatsa and
Richa Singh},
title = {Face Verification via Learned Representation on Feature-Rich Video
Frames},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {12},
number = {7},
pages = {1686--1698},
year = {2017}
}
@article{DBLP:journals/tifs/ManjaniTVSM17,
author = {Ishan Manjani and
Snigdha Tariyal and
Mayank Vatsa and
Richa Singh and
Angshul Majumdar},
title = {Detecting Silicone Mask-Based Presentation Attack via Deep Dictionary
Learning},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {12},
number = {7},
pages = {1713--1723},
year = {2017}
}
@article{DBLP:journals/tii/NegiKUN17,
author = {Sanjay Singh Negi and
Nand Kishor and
Kjetil Uhlen and
Richa Negi},
title = {Event Detection and Its Signal Characterization in {PMU} Data Stream},
journal = {{IEEE} Trans. Ind. Informatics},
volume = {13},
number = {6},
pages = {3108--3118},
year = {2017}
}
@article{DBLP:journals/tip/KohliVSNM17,
author = {Naman Kohli and
Mayank Vatsa and
Richa Singh and
Afzel Noore and
Angshul Majumdar},
title = {Hierarchical Representation Learning for Kinship Verification},
journal = {{IEEE} Trans. Image Process.},
volume = {26},
number = {1},
pages = {289--302},
year = {2017}
}
@inproceedings{DBLP:conf/bigdataconf/UnderwoodMLABFG17,
author = {William Underwood and
Richard Marciano and
Sandra Laib and
Carl Apgar and
Luis Beteta and
Waleed Falak and
Marisa Gilman and
Riss Hardcastle and
Keona Holden and
Yun Huang and
David Baasch and
Brittni Ballard and
Tricia Glaser and
Adam Gray and
Leigh Plummer and
Zeynep Diker and
Mayanka Jha and
Aakanksha Singh and
Namrata Walanj},
title = {Computational curation of a digitized record series of {WWII} Japanese-American
Internment},
booktitle = {{IEEE} BigData},
pages = {2309--2313},
publisher = {{IEEE} Computer Society},
year = {2017}
}
@inproceedings{DBLP:conf/coinco/SamantCVKN17,
author = {Sunil Singh Samant and
Mohan Baruwal Chhetri and
Quoc Bao Vo and
Ryszard Kowalczyk and
Surya Nepal},
title = {Towards Quality-Assured Data Delivery in Cloud-Based IoT Platforms
for Smart Cities},
booktitle = {{CIC}},
pages = {291--298},
publisher = {{IEEE} Computer Society},
year = {2017}
}
@inproceedings{DBLP:conf/cvpr/AgarwalYKSVN17,
author = {Akshay Agarwal and
Daksha Yadav and
Naman Kohli and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Face Presentation Attack with Latex Masks in Multispectral Videos},
booktitle = {{CVPR} Workshops},
pages = {275--283},
publisher = {{IEEE} Computer Society},
year = {2017}
}
@inproceedings{DBLP:conf/cvpr/ChughSNSV17,
author = {Tarang Chugh and
Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {Transfer Learning Based Evolutionary Algorithm for Composite Face
Sketch Recognition},
booktitle = {{CVPR} Workshops},
pages = {619--627},
publisher = {{IEEE} Computer Society},
year = {2017}
}
@inproceedings{DBLP:conf/ehealth2/PartlJSSBSSWNS17,
author = {Richard Partl and
Beata Jonko and
Stefan Schnidar and
Michael Sch{\"{o}}llhammer and
Max Bauer and
Sanchit Singh and
Julia Simeckova and
Kathrin Wiesner and
Andreas Neubauer and
Harald Schnidar},
title = {128 {SHADES} {OF} {RED:} Objective Remote Assessment of Radiation
Dermatitis by Augmented Digital Skin Imaging},
booktitle = {eHealth},
series = {Studies in Health Technology and Informatics},
volume = {236},
pages = {363--374},
publisher = {{IOS} Press},
year = {2017}
}
@inproceedings{DBLP:conf/icb/AgarwalSVN17,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {SWAPPED! Digital face presentation attack detection via weighted local
magnitude pattern},
booktitle = {{IJCB}},
pages = {659--665},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/icb/BasakDAMVS17,
author = {Pratichi Basak and
Saurabh De and
Mallika Agarwal and
Aakarsh Malhotra and
Mayank Vatsa and
Richa Singh},
title = {Multimodal biometric recognition for toddlers and pre-school children},
booktitle = {{IJCB}},
pages = {627--633},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/icb/BharatiVSBT17,
author = {Aparna Bharati and
Mayank Vatsa and
Richa Singh and
Kevin W. Bowyer and
Xin Tong},
title = {Demography-based facial retouching detection using subclass supervised
sparse autoencoder},
booktitle = {{IJCB}},
pages = {474--482},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/icb/KohliYVSN17,
author = {Naman Kohli and
Daksha Yadav and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Synthetic iris presentation attack using iDCGAN},
booktitle = {{IJCB}},
pages = {674--680},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/icb/NagpalSJSVN17,
author = {Shruti Nagpal and
Maneet Singh and
Arushi Jain and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {On matching skulls to digital face images: {A} preliminary approach},
booktitle = {{IJCB}},
pages = {813--819},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/icb/SinghNVSNM17,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh and
Afzel Noore and
Angshul Majumdar},
title = {Gender and ethnicity classification of Iris images using deep class-encoder},
booktitle = {{IJCB}},
pages = {666--673},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/icb/YadavKVSN17,
author = {Daksha Yadav and
Naman Kohli and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Unconstrained visible spectrum iris with textured contact lens variations:
Database and benchmarking},
booktitle = {{IJCB}},
pages = {574--580},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/icb/YambayBKYCBSSVN17,
author = {David Yambay and
Benedict Becker and
Naman Kohli and
Daksha Yadav and
Adam Czajka and
Kevin W. Bowyer and
Stephanie Schuckers and
Richa Singh and
Mayank Vatsa and
Afzel Noore and
Diego Gragnaniello and
Carlo Sansone and
Luisa Verdoliva and
Lingxiao He and
Yiwei Ru and
Haiqing Li and
Nianfeng Liu and
Zhenan Sun and
Tieniu Tan},
title = {LivDet iris 2017 - Iris liveness detection competition 2017},
booktitle = {{IJCB}},
pages = {733--741},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/iccv/NagpalSSVNM17,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa and
Afzel Noore and
Angshul Majumdar},
title = {Face Sketch Matching via Coupled Deep Transform Learning},
booktitle = {{ICCV}},
pages = {5429--5438},
publisher = {{IEEE} Computer Society},
year = {2017}
}
@inproceedings{DBLP:conf/ijcnn/GoswamiSVM17,
author = {Gaurav Goswami and
Richa Singh and
Mayank Vatsa and
Angshul Majumdar},
title = {Kernel group sparse representation based classifier for multimodal
biometrics},
booktitle = {{IJCNN}},
pages = {2894--2901},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/ijcnn/SinghNSV17,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {Class representative autoencoder for low resolution multi-spectral
gender classification},
booktitle = {{IJCNN}},
pages = {1026--1033},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/ijcnn/YadavKNSPVSNPM17,
author = {Daksha Yadav and
Naman Kohli and
Shruti Nagpal and
Maneet Singh and
Prateekshit Pandey and
Mayank Vatsa and
Richa Singh and
Afzel Noore and
Gokulraj Prabhakaran and
Harsh Mahajan},
title = {Region-specific fMRI dictionary for decoding face verification in
humans},
booktitle = {{IJCNN}},
pages = {3814--3821},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/sipaim/SinghSMCCGR017,
author = {Shibani Singh and
Anant Srivastava and
Liang Mi and
Richard J. Caselli and
Kewei Chen and
Dhruman Goradia and
Eric M. Reiman and
Yalin Wang},
title = {Deep-learning-based classification of {FDG-PET} data for Alzheimer's
disease categories},
booktitle = {{SIPAIM}},
series = {{SPIE} Proceedings},
volume = {10572},
pages = {105720J},
publisher = {{SPIE}},
year = {2017}
}
@inproceedings{DBLP:conf/sp/PowellKGVSN17,
author = {Brian M. Powell and
Ekampreet Kalsy and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Attack-Resistant aiCAPTCHA Using a Negative Selection Artificial Immune
System},
booktitle = {{IEEE} Symposium on Security and Privacy Workshops},
pages = {41--46},
publisher = {{IEEE} Computer Society},
year = {2017}
}
@inproceedings{DBLP:conf/vtc/SinghBOFL17,
author = {Ravinder Singh and
Qiang Bai and
Timothy O'Farrell and
Kenneth Lee Ford and
Richard J. Langley},
title = {Concurrent, Tunable, Multi-Band, Single Chain Radio Receivers for
5G RANs},
booktitle = {{VTC} Spring},
pages = {1--5},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/vtc/SinghBOFL17a,
author = {Ravinder Singh and
Qiang Bai and
Timothy O'Farrell and
Kenneth Lee Ford and
Richard J. Langley},
title = {Concurrent, Multi-Band, Single-Chain Radio Receiver for High Data-Rate
HetNets},
booktitle = {{VTC} Fall},
pages = {1--5},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/wiopt/OFarrellSBFLBAG17,
author = {Timothy O'Farrell and
Ravinder Singh and
Qiang Bai and
Kenneth Lee Ford and
Richard J. Langley and
Mark A. Beach and
Eyad Arabi and
Chris Gamlath and
Kevin A. Morris},
title = {Tunable, concurrent multiband, single chain radio architecture for
low energy 5G-RANs},
booktitle = {WiOpt},
pages = {1--6},
publisher = {{IEEE}},
year = {2017}
}
@article{DBLP:journals/corr/MendlingWABCDDC17,
author = {Jan Mendling and
Ingo Weber and
Wil M. P. van der Aalst and
Jan vom Brocke and
Cristina Cabanillas and
Florian Daniel and
S{\o}ren Debois and
Claudio Di Ciccio and
Marlon Dumas and
Schahram Dustdar and
Avigdor Gal and
Luciano Garc{\'{\i}}a{-}Ba{\~{n}}uelos and
Guido Governatori and
Richard Hull and
Marcello La Rosa and
Henrik Leopold and
Frank Leymann and
Jan Recker and
Manfred Reichert and
Hajo A. Reijers and
Stefanie Rinderle{-}Ma and
Andreas Rogge{-}Solti and
Michael Rosemann and
Stefan Schulte and
Munindar P. Singh and
Tijs Slaats and
Mark Staples and
Barbara Weber and
Matthias Weidlich and
Mathias Weske and
Xiwei Xu and
Liming Zhu},
title = {Blockchains for Business Process Management - Challenges and Opportunities},
journal = {CoRR},
volume = {abs/1704.03610},
year = {2017}
}
@article{DBLP:journals/corr/abs-1709-07598,
author = {Aparna Bharati and
Mayank Vatsa and
Richa Singh and
Kevin W. Bowyer and
Xin Tong},
title = {Demography-based Facial Retouching Detection using Subclass Supervised
Sparse Autoencoder},
journal = {CoRR},
volume = {abs/1709.07598},
year = {2017}
}
@article{DBLP:journals/corr/abs-1710-02856,
author = {Maneet Singh and
Shruti Nagpal and
Mayank Vatsa and
Richa Singh and
Afzel Noore and
Angshul Majumdar},
title = {Gender and Ethnicity Classification of Iris Images using Deep Class-Encoder},
journal = {CoRR},
volume = {abs/1710.02856},
year = {2017}
}
@article{DBLP:journals/corr/abs-1710-02866,
author = {Shruti Nagpal and
Maneet Singh and
Arushi Jain and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {On Matching Skulls to Digital Face Images: {A} Preliminary Approach},
journal = {CoRR},
volume = {abs/1710.02866},
year = {2017}
}
@article{DBLP:journals/corr/abs-1710-02914,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa and
Afzel Noore and
Angshul Majumdar},
title = {Face Sketch Matching via Coupled Deep Transform Learning},
journal = {CoRR},
volume = {abs/1710.02914},
year = {2017}
}
@article{DBLP:journals/corr/abs-1710-10565,
author = {Naman Kohli and
Daksha Yadav and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Synthetic Iris Presentation Attack using iDCGAN},
journal = {CoRR},
volume = {abs/1710.10565},
year = {2017}
}
@article{DBLP:journals/access/TariyalMSV16,
author = {Snigdha Tariyal and
Angshul Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Deep Dictionary Learning},
journal = {{IEEE} Access},
volume = {4},
pages = {10096--10109},
year = {2016}
}
@article{DBLP:journals/ibmrd/SingheeLKWCKKTM16,
author = {Amith Singhee and
Zhiguo Li and
Ali Koc and
Haijing Wang and
James P. Cipriani and
Younghun Kim and
Ashok Pon Kumar and
Lloyd A. Treinish and
Richard Mueller and
Gerard Labut and
Richard A. Foltman and
Gary M. Gauthier},
title = {{OPRO:} Precise emergency preparedness for electric utilities},
journal = {{IBM} J. Res. Dev.},
volume = {60},
number = {1},
year = {2016}
}
@article{DBLP:journals/inffus/GoswamiMMVS16,
author = {Gaurav Goswami and
Paritosh Mittal and
Angshul Majumdar and
Mayank Vatsa and
Richa Singh},
title = {Group sparse representation based classification for multi-feature
multimodal biometrics},
journal = {Inf. Fusion},
volume = {32},
pages = {3--12},
year = {2016}
}
@article{DBLP:journals/inffus/SinghRB16,
author = {Richa Singh and
Arun Ross and
Kevin W. Bowyer},
title = {Special issue on information fusion in biometrics},
journal = {Inf. Fusion},
volume = {32},
pages = {1--2},
year = {2016}
}
@article{DBLP:journals/ivc/NagpalVS16,
author = {Shruti Nagpal and
Mayank Vatsa and
Richa Singh},
title = {Sketch Recognition: What Lies Ahead?},
journal = {Image Vis. Comput.},
volume = {55},
pages = {9--13},
year = {2016}
}
@article{DBLP:journals/mta/PandeySKM16,
author = {Richa Pandey and
Amit Kumar Singh and
Basant Kumar and
Anand Mohan},
title = {Iris based secure {NROI} multiple eye image watermarking for teleophthalmology},
journal = {Multim. Tools Appl.},
volume = {75},
number = {22},
pages = {14381--14397},
year = {2016}
}
@article{DBLP:journals/pr/DhamechaSV16,
author = {Tejas Indulal Dhamecha and
Richa Singh and
Mayank Vatsa},
title = {On incremental semi-supervised discriminant analysis},
journal = {Pattern Recognit.},
volume = {52},
pages = {135--147},
year = {2016}
}
@article{DBLP:journals/pr/MehrotraSVM16,
author = {Hunny Mehrotra and
Richa Singh and
Mayank Vatsa and
Banshidhar Majhi},
title = {Incremental granular relevance vector machine: {A} case study in multimodal
biometrics},
journal = {Pattern Recognit.},
volume = {56},
pages = {63--76},
year = {2016}
}
@article{DBLP:journals/ram/WangSJARH16,
author = {Shuangyi Wang and
Davinder Singh and
Devapriyan Johnson and
Kaspar Althoefer and
Kawal S. Rhode and
Richard James Housden},
title = {Robotic Ultrasound: View Planning, Tracking, and Automatic Acquisition
of Transesophageal Echocardiography},
journal = {{IEEE} Robotics Autom. Mag.},
volume = {23},
number = {4},
pages = {118--127},
year = {2016}
}
@article{DBLP:journals/tifs/BharadwajBVS16,
author = {Samarth Bharadwaj and
Himanshu S. Bhatt and
Mayank Vatsa and
Richa Singh},
title = {Domain Specific Learning for Newborn Face Recognition},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {11},
number = {7},
pages = {1630--1641},
year = {2016}
}
@article{DBLP:journals/tifs/BharatiSVB16,
author = {Aparna Bharati and
Richa Singh and
Mayank Vatsa and
Kevin W. Bowyer},
title = {Detecting Facial Retouching Using Supervised Deep Learning},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {11},
number = {9},
pages = {1903--1913},
year = {2016}
}
@article{DBLP:journals/tmc/SinghLBLS16,
author = {Vaibhav Singh and
Matthew Lentz and
Bobby Bhattacharjee and
Richard J. La and
Mark A. Shayman},
title = {Dynamic Frequency Resource Allocation in Heterogeneous Cellular Networks},
journal = {{IEEE} Trans. Mob. Comput.},
volume = {15},
number = {11},
pages = {2735--2748},
year = {2016}
}
@inproceedings{DBLP:conf/amia/ManningSDDB16,
author = {John D. Manning and
Manmeet Singh and
Pavithra I. Dissanayake and
Elizabeth Day and
Richard Banchs},
title = {Incorporation of Case Setup Complexities into the Analysis of Operating
Room Turnover Times},
booktitle = {{AMIA}},
publisher = {{AMIA}},
year = {2016}
}
@inproceedings{DBLP:conf/btas/AgarwalSV16,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Face anti-spoofing using Haralick features},
booktitle = {{BTAS}},
pages = {1--6},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/btas/ChowdhuryGSV16,
author = {Anurag Chowdhury and
Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa},
title = {{RGB-D} face recognition via learning-based reconstruction},
booktitle = {{BTAS}},
pages = {1--7},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/btas/KohliYVSN16,
author = {Naman Kohli and
Daksha Yadav and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Detecting medley of iris spoofing attacks using {DESIST}},
booktitle = {{BTAS}},
pages = {1--6},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/btas/PowellKTGVSN16,
author = {Brian M. Powell and
Abhishek Kumar and
Jatin Thapar and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {A multibiometrics-based {CAPTCHA} for improved online security},
booktitle = {{BTAS}},
pages = {1--8},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/btas/SinghNGGGSV16,
author = {Maneet Singh and
Shruti Nagpal and
Nikita Gupta and
Sanchit Gupta and
Soumyadeep Ghosh and
Richa Singh and
Mayank Vatsa},
title = {Cross-spectral cross-resolution video database for face recognition},
booktitle = {{BTAS}},
pages = {1--7},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/btas/TanejaTMSVS16,
author = {Archit Taneja and
Aakriti Tayal and
Aakarsh Malhotra and
Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {Fingerphoto spoofing in mobile devices: {A} preliminary study},
booktitle = {{BTAS}},
pages = {1--7},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/icb/PandeySV16,
author = {Prateekshit Pandey and
Richa Singh and
Mayank Vatsa},
title = {Face recognition using scattering wavelet under Illicit Drug Abuse
variations},
booktitle = {{ICB}},
pages = {1--6},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/icip/GhoshKSV16,
author = {Soumyadeep Ghosh and
Rohit Keshari and
Richa Singh and
Mayank Vatsa},
title = {Face identification from low resolution near-infrared images},
booktitle = {{ICIP}},
pages = {938--942},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/icip/KeshariGASV16,
author = {Rohit Keshari and
Soumyadeep Ghosh and
Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Mobile periocular matching with pre-post cataract surgery},
booktitle = {{ICIP}},
pages = {3116--3120},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/icip/VermaMVS16,
author = {Shalini Verma and
Paritosh Mittal and
Mayank Vatsa and
Richa Singh},
title = {At-a-distance person recognition via combining ocular features},
booktitle = {{ICIP}},
pages = {3131--3135},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/icip/YadavSVSM16,
author = {Shivangi Yadav and
Maneet Singh and
Mayank Vatsa and
Richa Singh and
Angshul Majumdar},
title = {Low rank group sparse representation based classifier for pose variation},
booktitle = {{ICIP}},
pages = {2986--2990},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/icpr/AgarwalSV16,
author = {Akshay Agarwal and
Richa Singh and
Mayank Vatsa},
title = {Fingerprint sensor classification via M{\'{e}}lange of handcrafted
features},
booktitle = {{ICPR}},
pages = {3001--3006},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/icpr/GoswamiRSV16,
author = {Gaurav Goswami and
Nalini K. Ratha and
Richa Singh and
Mayank Vatsa},
title = {Improving classifier fusion via Pool Adjacent Violators normalization},
booktitle = {{ICPR}},
pages = {1011--1016},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/icpr/SiddiquiBDAVSR16,
author = {Talha Ahmad Siddiqui and
Samarth Bharadwaj and
Tejas I. Dhamecha and
Akshay Agarwal and
Mayank Vatsa and
Richa Singh and
Nalini K. Ratha},
title = {Face anti-spoofing with multifeature videolet aggregation},
booktitle = {{ICPR}},
pages = {1035--1040},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/ieeesensors/SuHKSDKHALRT16,
author = {Peter Su and
Zhaohong Han and
Derek Kita and
Vivek Singh and
Qingyang Du and
Lionel C. Kimerling and
Juejun Hu and
Anu Agarwal and
Pao Tai Lin and
Kathleen A. Richardson and
Dawn T. H. Tan},
title = {Irradiation of on-chip chalcogenide glass waveguide mid-infrared gas
sensor},
booktitle = {{IEEE} {SENSORS}},
pages = {1--3},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/ihci/SinghTB016,
author = {Ankita Singh and
Richa Tibrewal and
Chandrima Bhattacharya and
Malay Bhattacharyya},
title = {Hands Up! To Assess Your Sustained Fitness},
booktitle = {{IHCI}},
series = {Lecture Notes in Computer Science},
volume = {10127},
pages = {187--194},
publisher = {Springer},
year = {2016}
}
@inproceedings{DBLP:conf/ijcai/GuoSLL16,
author = {Xiaoxiao Guo and
Satinder Singh and
Richard L. Lewis and
Honglak Lee},
title = {Deep Learning for Reward Design to Improve Monte Carlo Tree Search
in {ATARI} Games},
booktitle = {{IJCAI}},
pages = {1519--1525},
publisher = {{IJCAI/AAAI} Press},
year = {2016}
}
@inproceedings{DBLP:conf/ijcai/JiangKSL16,
author = {Nan Jiang and
Alex Kulesza and
Satinder Singh and
Richard L. Lewis},
title = {The Dependence of Effective Planning Horizon on Model Accuracy},
booktitle = {{IJCAI}},
pages = {4180--4189},
publisher = {{IJCAI/AAAI} Press},
year = {2016}
}
@inproceedings{DBLP:conf/isscc/ShokrollahiCFHH16,
author = {Amin Shokrollahi and
Dario Albino Carnelli and
John Fox and
Klaas L. Hofstra and
Brian Holden and
Ali Hormati and
Peter Hunt and
Margaret Johnston and
John Keay and
Sergio Pesenti and
Richard Simpson and
David Stauffer and
Andrew Stewart and
Giuseppe Surace and
Armin Tajalli and
Omid Talebi Amiri and
Anton Tschank and
Roger Ulrich and
Christoph Walter and
Fabio Licciardello and
Yohann Mogentale and
Anant Singh},
title = {10.1 {A} pin-efficient 20.83Gb/s/wire 0.94pJ/bit forwarded clock CNRZ-5-coded
SerDes up to 12mm for {MCM} packages in 28nm {CMOS}},
booktitle = {{ISSCC}},
pages = {182--183},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/mhci/TibrewalSB16,
author = {Richa Tibrewal and
Ankita Singh and
Malay Bhattacharyya},
title = {mSTROKE: a crowd-powered mobility towards stroke recognition},
booktitle = {MobileHCI Adjunct},
pages = {645--650},
publisher = {{ACM}},
year = {2016}
}
@inproceedings{DBLP:conf/miccai/WangSLRARH16,
author = {Shuangyi Wang and
Davinder Singh and
David Lau and
Kiran Reddy and
Kaspar Althoefer and
Kawal S. Rhode and
Richard James Housden},
title = {Probe Tracking and Its Application in Automatic Acquisition Using
a Trans-Esophageal Ultrasound Robot},
booktitle = {CARE@MICCAI},
series = {Lecture Notes in Computer Science},
volume = {10170},
pages = {14--23},
publisher = {Springer},
year = {2016}
}
@inproceedings{DBLP:conf/sc/ClarkJSCGB16,
author = {Michael A. Clark and
B{\'{a}}lint Jo{\'{o}} and
Alexei Strelchenko and
Michael Cheng and
Arjun Singh Gambhir and
Richard C. Brower},
title = {Accelerating lattice {QCD} multigrid on GPUs using fine-grained parallelization},
booktitle = {{SC}},
pages = {795--806},
publisher = {{IEEE} Computer Society},
year = {2016}
}
@inproceedings{DBLP:conf/vtc/SinghBOFL16,
author = {Ravinder Singh and
Qiang Bai and
Timothy O'Farrell and
Kenneth Lee Ford and
Richard J. Langley},
title = {Demonstration of {RF} Digitising Concurrent Dual-Band Receiver for
Carrier Aggregation over {TV} White Spaces},
booktitle = {{VTC} Fall},
pages = {1--5},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/wacv/DhamechaSSV16,
author = {Tejas Indulal Dhamecha and
Praneet Sharma and
Richa Singh and
Mayank Vatsa},
title = {Discriminative FaceTopics for face recognition via latent Dirichlet
allocation},
booktitle = {{WACV}},
pages = {1--8},
publisher = {{IEEE} Computer Society},
year = {2016}
}
@inproceedings{DBLP:conf/wacv/YadavKPSVN16,
author = {Daksha Yadav and
Naman Kohli and
Prateekshit Pandey and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Effect of illicit drug abuse on face recognition},
booktitle = {{WACV}},
pages = {1--7},
publisher = {{IEEE} Computer Society},
year = {2016}
}
@inproceedings{DBLP:conf/wiopt/SinghLS16,
author = {Vaibhav Singh and
Richard J. La and
Mark A. Shayman},
title = {Coordinated scheduling in {MIMO} heterogeneous wireless networks using
submodular optimization},
booktitle = {WiOpt},
pages = {107--114},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/xsede/ChiuLSDJPGLP16,
author = {Chui{-}Hui Chiu and
Nathan Lewis and
Dipak Kumar Singh and
Arghya Kusum Das and
Mohammad M. Jalazai and
Richard Platania and
Sayan Goswami and
Kisung Lee and
Seung{-}Jong Park},
title = {{BIC-LSU:} Big Data Research Integration with Cyberinfrastructure
for {LSU}},
booktitle = {{XSEDE}},
pages = {28:1--28:8},
publisher = {{ACM}},
year = {2016}
}
@incollection{DBLP:books/sp/16/AgrawalPDSV16,
author = {Janhavi Agrawal and
Aishwarya Pant and
Tejas I. Dhamecha and
Richa Singh and
Mayank Vatsa},
title = {Understanding Thermal Face Detection: Challenges and Evaluation},
booktitle = {Face Recognition Across the Imaging Spectrum},
pages = {139--163},
publisher = {Springer},
year = {2016}
}
@incollection{DBLP:books/sp/16/GoswamiVS16,
author = {Gaurav Goswami and
Mayank Vatsa and
Richa Singh},
title = {Face Recognition with {RGB-D} Images Using Kinect},
booktitle = {Face Recognition Across the Imaging Spectrum},
pages = {281--303},
publisher = {Springer},
year = {2016}
}
@article{DBLP:journals/corr/GuoSLL16,
author = {Xiaoxiao Guo and
Satinder Singh and
Richard L. Lewis and
Honglak Lee},
title = {Deep Learning for Reward Design to Improve Monte Carlo Tree Search
in {ATARI} Games},
journal = {CoRR},
volume = {abs/1604.07095},
year = {2016}
}
@article{DBLP:journals/corr/TariyalMSV16,
author = {Snigdha Tariyal and
Angshul Majumdar and
Richa Singh and
Mayank Vatsa},
title = {Greedy Deep Dictionary Learning},
journal = {CoRR},
volume = {abs/1602.00203},
year = {2016}
}
@article{DBLP:journals/corr/TomarR16,
author = {Vikrant Singh Tomar and
Richard C. Rose},
title = {Graph based manifold regularized deep neural networks for automatic
speech recognition},
journal = {CoRR},
volume = {abs/1606.05925},
year = {2016}
}
@article{DBLP:journals/peerjpre/MeurerSPCRK0MSR16,
author = {Aaron Meurer and
Christopher P. Smith and
Mateusz Paprocki and
Ondrej Cert{\'{\i}}k and
Matthew Rocklin and
Amit Kumar and
Sergiu Ivanov and
Jason Keith Moore and
Sartaj Singh and
Thilina Rathnayake and
Sean Vig and
Brian E. Granger and
Richard P. Muller and
Francesco Bonazzi and
Harsh Gupta and
Shivam Vats and
Fredrik Johansson and
Fabian Pedregosa and
Matthew J. Curry and
Ashutosh Saboo and
Isuru Fernando and
Sumith Kulal and
Robert Cimrman and
Anthony M. Scopatz},
title = {SymPy: Symbolic computing in Python},
journal = {PeerJ Prepr.},
volume = {4},
pages = {e2083},
year = {2016}
}
@article{DBLP:journals/access/NagpalSSV15,
author = {Shruti Nagpal and
Maneet Singh and
Richa Singh and
Mayank Vatsa},
title = {Regularized Deep Learning for Face Recognition With Weight Variations},
journal = {{IEEE} Access},
volume = {3},
pages = {3010--3018},
year = {2015}
}
@article{DBLP:journals/access/NigamASV15,
author = {Ishan Nigam and
Shreyasi Agrawal and
Richa Singh and
Mayank Vatsa},
title = {Revisiting HEp-2 Cell Image Classification},
journal = {{IEEE} Access},
volume = {3},
pages = {3102--3113},
year = {2015}
}
@article{DBLP:journals/access/SankaranVS15,
author = {Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {Multisensor Optical and Latent Fingerprint Database},
journal = {{IEEE} Access},
volume = {3},
pages = {653--665},
year = {2015}
}
@article{DBLP:journals/access/VatsaSB15,
author = {Mayank Vatsa and
Richa Singh and
Kevin W. Bowyer},
title = {{IEEE} Access Special Section Editorial: Applying Four D'S of Machine
Learning to Advance Biometrics},
journal = {{IEEE} Access},
volume = {3},
pages = {3083--3084},
year = {2015}
}
@article{DBLP:journals/computer/BresnikerSW15,
author = {Kirk Bresniker and
Sharad Singhal and
R. Stanley Williams},
title = {Adapting to Thrive in a New Economy of Memory Abundance},
journal = {Computer},
volume = {48},
number = {12},
pages = {44--53},
year = {2015}
}
@article{DBLP:journals/ijstm/SharmaSP15,
author = {Veenu Sharma and
Richa Singh and
G. N. Patel},
title = {Measuring the effect of brand equity on the consumers' purchase intention},
journal = {Int. J. Serv. Technol. Manag.},
volume = {21},
number = {1/2/3},
pages = {98--110},
year = {2015}
}
@article{DBLP:journals/ijuwbcs/GuptaY15,
author = {Richa Gupta and
Rajveer S. Yaduvanshi},
title = {Embedded cylindrical magneto-hydrodynamic antenna},
journal = {Int. J. Ultra Wideband Commun. Syst.},
volume = {3},
number = {2},
pages = {68--74},
year = {2015}
}
@article{DBLP:journals/ijuwbcs/GuptaY15a,
author = {Richa Gupta and
Rajveer S. Yaduvanshi},
title = {High gain and wide band rectangular {DRA}},
journal = {Int. J. Ultra Wideband Commun. Syst.},
volume = {3},
number = {2},
pages = {107--114},
year = {2015}
}
@article{DBLP:journals/inffus/NigamVS15,
author = {Ishan Nigam and
Mayank Vatsa and
Richa Singh},
title = {Ocular biometrics: {A} survey of modalities and fusion approaches},
journal = {Inf. Fusion},
volume = {26},
pages = {1--35},
year = {2015}
}
@article{DBLP:journals/mj/GuptaSS15,
author = {Maneesha Gupta and
Richa Srivastava and
Urvashi Singh},
title = {Low-voltage low-power {FGMOS} based {VDIBA} and its application as
universal filter},
journal = {Microelectron. J.},
volume = {46},
number = {2},
pages = {125--134},
year = {2015}
}
@article{DBLP:journals/mj/SinghGS15,
author = {Urvashi Singh and
Maneesha Gupta and
Richa Srivastava},
title = {A new wideband regulated cascode amplifier with improved performance
and its application},
journal = {Microelectron. J.},
volume = {46},
number = {8},
pages = {758--776},
year = {2015}
}
@article{DBLP:journals/pr/BharadwajBSVN15,
author = {Samarth Bharadwaj and
Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {QFuse: Online learning framework for adaptive biometric system},
journal = {Pattern Recognit.},
volume = {48},
number = {11},
pages = {3428--3439},
year = {2015}
}
@article{DBLP:journals/titb/SpinaCAAGCHGLMS15,
author = {Gabriele Spina and
Pierluigi Casale and
Paul S. Albert and
Jennifer Alison and
Judith Garcia{-}Aymerich and
Richard W. Costello and
Nidia A. Hernandes and
Arnoldus J. R. van Gestel and
Jorg D. Leuppi and
Rafael Mesquita and
Sally J. Singh and
Frank W. J. M. Smeenk and
Ruth Tal{-}Singer and
Emiel F. M. Wouters and
Martijn Spruit and
Albertus C. den Brinker},
title = {Identifying Physical Activity Profiles in {COPD} Patients Using Topic
Models},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {19},
number = {5},
pages = {1567--1576},
year = {2015}
}
@inproceedings{DBLP:conf/amcis/AgrawalAJRS15,
author = {Deepti Agrawal and
John Amis and
Brian Janz and
Sandra M. Richardson and
Kulraj Singh},
title = {'What are they saying?' Examining healthcare field discourses in West
Tennessee},
booktitle = {{AMCIS}},
publisher = {Association for Information Systems},
year = {2015}
}
@inproceedings{DBLP:conf/atal/JiangKSL15,
author = {Nan Jiang and
Alex Kulesza and
Satinder Singh and
Richard L. Lewis},
title = {The Dependence of Effective Planning Horizon on Model Accuracy},
booktitle = {{AAMAS}},
pages = {1181--1189},
publisher = {{ACM}},
year = {2015}
}
@inproceedings{DBLP:conf/btas/ChaharYNSV15,
author = {Aman Chahar and
Shivangi Yadav and
Ishan Nigam and
Richa Singh and
Mayank Vatsa},
title = {A Leap Password based verification system},
booktitle = {{BTAS}},
pages = {1--6},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/btas/GhoshDKSV15,
author = {Soumyadeep Ghosh and
Tejas I. Dhamecha and
Rohit Keshari and
Richa Singh and
Mayank Vatsa},
title = {Feature and keypoint selection for visible to near-infrared face matching},
booktitle = {{BTAS}},
pages = {1--7},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/btas/NagpalSVS15,
author = {Shruti Nagpal and
Maneet Singh and
Mayank Vatsa and
Richa Singh},
title = {Regularizing deep learning architecture for face recognition with
weight variations},
booktitle = {{BTAS}},
pages = {1--6},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/btas/SankaranAKGSVS15,
author = {Anush Sankaran and
Akshay Agarwal and
Rohit Keshari and
Soumyadeep Ghosh and
Anjali Sharma and
Mayank Vatsa and
Richa Singh},
title = {Latent fingerprint from multiple surfaces: Database and quality analysis},
booktitle = {{BTAS}},
pages = {1--6},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/btas/SankaranMMVS15,
author = {Anush Sankaran and
Aakarsh Malhotra and
Apoorva Mittal and
Mayank Vatsa and
Richa Singh},
title = {On smartphone camera based fingerphoto authentication},
booktitle = {{BTAS}},
pages = {1--7},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/icb/BhardwajGSV15,
author = {Romil Bhardwaj and
Gaurav Goswami and
Richa Singh and
Mayank Vatsa},
title = {Harnessing social context for improved face recognition},
booktitle = {{ICB}},
pages = {121--126},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/icb/DhamechaVSSV15,
author = {Tejas I. Dhamecha and
Priyanka Verma and
Mahek Shah and
Richa Singh and
Mayank Vatsa},
title = {Annotated crowd video face database},
booktitle = {{ICB}},
pages = {106--112},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/icb/MittalVS15,
author = {Paritosh Mittal and
Mayank Vatsa and
Richa Singh},
title = {Composite sketch recognition via deep network - a transfer learning
approach},
booktitle = {{ICB}},
pages = {251--256},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/icit2/SinghPGM15,
author = {Santosh Kumar Singh and
Naresh K. Pilli and
Florent Guedon and
Richard A. McMahon},
title = {{PMSM} drive using silicon carbide inverter: Design, development and
testing at elevated temperature},
booktitle = {{ICIT}},
pages = {2612--2618},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/isba/JainMGVS15,
author = {Aishwarya Jain and
Paritosh Mittal and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh},
title = {Person identification at a distance via ocular biometrics},
booktitle = {{ISBA}},
pages = {1--6},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/nips/OhGLLS15,
author = {Junhyuk Oh and
Xiaoxiao Guo and
Honglak Lee and
Richard L. Lewis and
Satinder Singh},
title = {Action-Conditional Video Prediction using Deep Networks in Atari Games},
booktitle = {{NIPS}},
pages = {2863--2871},
year = {2015}
}
@inproceedings{DBLP:conf/nsdi/MadhavapeddyLSG15,
author = {Anil Madhavapeddy and
Thomas Leonard and
Magnus Skjegstad and
Thomas Gazagnaire and
David Sheets and
David J. Scott and
Richard Mortier and
Amir Chaudhry and
Balraj Singh and
Jon Ludlam and
Jon Crowcroft and
Ian M. Leslie},
title = {Jitsu: Just-In-Time Summoning of Unikernels},
booktitle = {{NSDI}},
pages = {559--573},
publisher = {{USENIX} Association},
year = {2015}
}
@inproceedings{DBLP:conf/trecvid/Yu0XLXCLMGMDCMW15,
author = {Shoou{-}I Yu and
Lu Jiang and
Zhongwen Xu and
Zhenzhong Lan and
Shicheng Xu and
Xiaojun Chang and
Xuanchong Li and
Zexi Mao and
Chuang Gan and
Yajie Miao and
Xingzhong Du and
Yang Cai and
Lara J. Martin and
Nikolas Wolfe and
Anurag Kumar and
Huan Li and
Ming Lin and
Zhigang Ma and
Yi Yang and
Deyu Meng and
Shiguang Shan and
Pinar Duygulu Sahin and
Susanne Burger and
Florian Metze and
Rita Singh and
Bhiksha Raj and
Teruko Mitamura and
Richard M. Stern and
Alexander G. Hauptmann},
title = {{CMU} Informedia@TRECVID 2015: {MED/SIN/LNK/SED}},
booktitle = {{TRECVID}},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2015}
}
@incollection{DBLP:reference/bio/BhattBSV15,
author = {Himanshu Sharad Bhatt and
Samarth Bharadwaj and
Richa Singh and
Mayank Vatsa},
title = {Plastic Surgery and Face Recognition},
booktitle = {Encyclopedia of Biometrics},
pages = {1257--1261},
publisher = {Springer {US}},
year = {2015}
}
@incollection{DBLP:reference/bio/NooreSV15,
author = {Afzel Noore and
Richa Singh and
Mayank Vatsa},
title = {Fusion, Sensor Level},
booktitle = {Encyclopedia of Biometrics},
pages = {772--778},
publisher = {Springer {US}},
year = {2015}
}
@article{DBLP:journals/corr/OhGLLS15,
author = {Junhyuk Oh and
Xiaoxiao Guo and
Honglak Lee and
Richard L. Lewis and
Satinder Singh},
title = {Action-Conditional Video Prediction using Deep Networks in Atari Games},
journal = {CoRR},
volume = {abs/1507.08750},
year = {2015}
}
@article{DBLP:journals/corr/ThakurHTLS15,
author = {Chetan Singh Thakur and
Tara Julia Hamilton and
Jonathan Tapson and
Richard F. Lyon and
Andr{\'{e}} van Schaik},
title = {{FPGA} Implementation of the {CAR} Model of the Cochlea},
journal = {CoRR},
volume = {abs/1503.00504},
year = {2015}
}
@article{DBLP:journals/access/PowellGVSN14,
author = {Brian M. Powell and
Gaurav Goswami and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {fgCAPTCHA: Genetically Optimized Face Image {CAPTCHA} 5},
journal = {{IEEE} Access},
volume = {2},
pages = {473--484},
year = {2014}
}
@article{DBLP:journals/access/SankaranVS14,
author = {Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {Latent fingerprint matching: {A} survey},
journal = {{IEEE} Access},
volume = {2},
pages = {982--1004},
year = {2014}
}
@article{DBLP:journals/access/SinghNSV14,
author = {Maneet Singh and
Shruti Nagpal and
Richa Singh and
Mayank Vatsa},
title = {On Recognizing Face Images With Weight and Age Variations},
journal = {{IEEE} Access},
volume = {2},
pages = {822--830},
year = {2014}
}
@article{DBLP:journals/ais/BhattPS14,
author = {Ashutosh Kumar Bhatt and
Durgesh Pant and
Richa Singh},
title = {An analysis of the performance of Artificial Neural Network technique
for apple classification},
journal = {{AI} Soc.},
volume = {29},
number = {1},
pages = {103--111},
year = {2014}
}
@article{DBLP:journals/biodb/ManasaLRNVGZBSSDCSMIMSO14,
author = {Justen Manasa and
Richard Lessells and
Theresa Rossouw and
Kevindra Naidu and
Cloete Van Vuuren and
Dominique Goedhals and
Gert van Zyl and
P. Armand Bester and
Andrew Skingsley and
Katharine Stott and
Siva Danaviah and
Terusha Chetty and
Lavanya Singh and
Pravi Moodley and
Collins Iwuji and
Nuala McGrath and
Christopher J. Seebregts and
Tulio de Oliveira},
title = {Southern African Treatment Resistance Network (SATuRN) RegaDB {HIV}
drug resistance and clinical management database: supporting patient
management, surveillance and research in southern Africa},
journal = {Database J. Biol. Databases Curation},
volume = {2014},
year = {2014}
}
@article{DBLP:journals/bmcbi/CastellaniMWLAOS14,
author = {Christina A. Castellani and
Melkaye G. Melka and
Andrea E. Wishart and
M. Elizabeth Locke and
Zain Awamleh and
Richard L. O'Reilly and
Shiva M. Singh},
title = {Biological relevance of {CNV} calling methods using familial relatedness
including monozygotic twins},
journal = {{BMC} Bioinform.},
volume = {15},
pages = {114},
year = {2014}
}
@article{DBLP:journals/ejivp/BharadwajVS14,
author = {Samarth Bharadwaj and
Mayank Vatsa and
Richa Singh},
title = {Biometric quality: a review of fingerprint, iris, and face},
journal = {{EURASIP} J. Image Video Process.},
volume = {2014},
pages = {34},
year = {2014}
}
@article{DBLP:journals/eswa/SharmaRK14,
author = {Richa Sharma and
K. P. S. Rana and
Vineet Kumar},
title = {Performance analysis of fractional order fuzzy {PID} controllers applied
to a robotic manipulator},
journal = {Expert Syst. Appl.},
volume = {41},
number = {9},
pages = {4274--4289},
year = {2014}
}
@article{DBLP:journals/fgcs/GoswamiPVSN14,
author = {Gaurav Goswami and
Brian M. Powell and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {FaceDCAPTCHA: Face detection based color image {CAPTCHA}},
journal = {Future Gener. Comput. Syst.},
volume = {31},
pages = {59--68},
year = {2014}
}
@article{DBLP:journals/mia/HongDMKSKPSDZN14,
author = {Yi Hong and
Brad Davis and
J. S. Marron and
Roland Kwitt and
Nikhil Singh and
Julia S. Kimbell and
Elizabeth Pitkin and
Richard Superfine and
Stephanie Davis and
Carlton J. Zdanski and
Marc Niethammer},
title = {Statistical atlas construction via weighted functional boxplots},
journal = {Medical Image Anal.},
volume = {18},
number = {4},
pages = {684--698},
year = {2014}
}
@article{DBLP:journals/mia/SinghFPKMWJ14,
author = {Nikhil Singh and
P. Thomas Fletcher and
J. Samuel Preston and
Richard D. King and
J. S. Marron and
Michael W. Weiner and
Sarang C. Joshi},
title = {Quantifying anatomical shape variations in neurological disorders},
journal = {Medical Image Anal.},
volume = {18},
number = {3},
pages = {616--633},
year = {2014}
}
@article{DBLP:journals/sigpro/AgrawalVS14,
author = {Praful Agrawal and
Mayank Vatsa and
Richa Singh},
title = {Saliency based mass detection from screening mammograms},
journal = {Signal Process.},
volume = {99},
pages = {29--47},
year = {2014}
}
@article{DBLP:journals/staeors/RahmouneFSKRB14,
author = {Rachid Rahmoune and
Paolo Ferrazzoli and
Yogesh Kumar Singh and
Yann H. Kerr and
Philippe Richaume and
Ahmad Al Bitar},
title = {{SMOS} Retrieval Results Over Forests: Comparisons With Independent
Measurements},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {7},
number = {9},
pages = {3858--3866},
year = {2014}
}
@article{DBLP:journals/tamd/LiuSLQ14,
author = {Bingyao Liu and
Satinder Singh and
Richard L. Lewis and
Shiyin Qin},
title = {Optimal Rewards for Cooperative Agents},
journal = {{IEEE} Trans. Auton. Ment. Dev.},
volume = {6},
number = {4},
pages = {286--297},
year = {2014}
}
@article{DBLP:journals/taslp/TomarR14,
author = {Vikrant Singh Tomar and
Richard C. Rose},
title = {A Family of Discriminative Manifold Learning Algorithms and Their
Application to Speech Recognition},
journal = {{IEEE} {ACM} Trans. Audio Speech Lang. Process.},
volume = {22},
number = {1},
pages = {161--171},
year = {2014}
}
@article{DBLP:journals/tifs/BhattSV14,
author = {Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa},
title = {On Recognizing Faces in Videos Using Clustering-Based Re-Ranking and
Fusion},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {9},
number = {7},
pages = {1056--1068},
year = {2014}
}
@article{DBLP:journals/tifs/GoswamiVS14,
author = {Gaurav Goswami and
Mayank Vatsa and
Richa Singh},
title = {{RGB-D} Face Recognition With Texture and Attribute Features},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {9},
number = {10},
pages = {1629--1640},
year = {2014}
}
@article{DBLP:journals/tifs/YadavKDSVB14,
author = {Daksha Yadav and
Naman Kohli and
James S. Doyle Jr. and
Richa Singh and
Mayank Vatsa and
Kevin W. Bowyer},
title = {Unraveling the Effect of Textured Contact Lenses on Iris Recognition},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {9},
number = {5},
pages = {851--862},
year = {2014}
}
@article{DBLP:journals/tip/BhattSVR14,
author = {Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Improving Cross-Resolution Face Matching Using Ensemble-Based Co-Transfer
Learning},
journal = {{IEEE} Trans. Image Process.},
volume = {23},
number = {12},
pages = {5654--5669},
year = {2014}
}
@article{DBLP:journals/topics/HowesLS14,
author = {Andrew Howes and
Richard L. Lewis and
Satinder Singh},
title = {Utility Maximization and Bounds on Human Information Processing},
journal = {Top. Cogn. Sci.},
volume = {6},
number = {2},
pages = {198--203},
year = {2014}
}
@article{DBLP:journals/topics/LewisHS14,
author = {Richard L. Lewis and
Andrew Howes and
Satinder Singh},
title = {Computational Rationality: Linking Mechanism and Behavior Through
Bounded Utility Maximization},
journal = {Top. Cogn. Sci.},
volume = {6},
number = {2},
pages = {279--311},
year = {2014}
}
@inproceedings{DBLP:conf/acl-cmcl/ShvartsmanLS14,
author = {Michael Shvartsman and
Richard L. Lewis and
Satinder Singh},
title = {Computationally Rational Saccadic Control: An Explanation of Spillover
Effects Based on Sampling from Noisy Perception and Memory},
booktitle = {CMCL@ACL},
pages = {1--9},
publisher = {Association for Computational Linguistics},
year = {2014}
}
@inproceedings{DBLP:conf/atal/JiangSL14,
author = {Nan Jiang and
Satinder Singh and
Richard L. Lewis},
title = {Improving {UCT} planning via approximate homomorphisms},
booktitle = {{AAMAS}},
pages = {1289--1296},
publisher = {{IFAAMAS/ACM}},
year = {2014}
}
@inproceedings{DBLP:conf/cvpr/KimBACCJDS14,
author = {Hyunwoo J. Kim and
Barbara B. Bendlin and
Nagesh Adluru and
Maxwell D. Collins and
Moo K. Chung and
Sterling C. Johnson and
Richard J. Davidson and
Vikas Singh},
title = {Multivariate General Linear Models {(MGLM)} on Riemannian Manifolds
with Applications to Statistical Analysis of Diffusion Weighted Images},
booktitle = {{CVPR}},
pages = {2705--2712},
publisher = {{IEEE} Computer Society},
year = {2014}
}
@inproceedings{DBLP:conf/icb/BharadwajVS14,
author = {Samarth Bharadwaj and
Mayank Vatsa and
Richa Singh},
title = {Aiding face recognition with social context association rule based
re-ranking},
booktitle = {{IJCB}},
pages = {1--8},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/icb/GoswamiBSV14,
author = {Gaurav Goswami and
Romil Bhardwaj and
Richa Singh and
Mayank Vatsa},
title = {MDLFace: Memorability augmented deep learning for video face recognition},
booktitle = {{IJCB}},
pages = {1--7},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/icb/MittalJGSV14,
author = {Paritosh Mittal and
Aishwarya Jain and
Gaurav Goswami and
Richa Singh and
Mayank Vatsa},
title = {Recognizing composite sketches with digital face images via {SSD}
dictionary},
booktitle = {{IJCB}},
pages = {1--6},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/icb/SankaranPVS14,
author = {Anush Sankaran and
Prateekshit Pandey and
Mayank Vatsa and
Richa Singh},
title = {On latent fingerprint minutiae extraction using stacked denoising
sparse AutoEncoders},
booktitle = {{IJCB}},
pages = {1--7},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/icip/NigamVS14,
author = {Ishan Nigam and
Mayank Vatsa and
Richa Singh},
title = {Leap signature recognition using {HOOF} and {HOT} features},
booktitle = {{ICIP}},
pages = {5012--5016},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/icip/SharmaVVS14,
author = {Anjali Sharma and
Shalini Verma and
Mayank Vatsa and
Richa Singh},
title = {On cross spectral periocular recognition},
booktitle = {{ICIP}},
pages = {5007--5011},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/icpr/DhamechaSSV14,
author = {Tejas Indulal Dhamecha and
Praneet Sharma and
Richa Singh and
Mayank Vatsa},
title = {On Effectiveness of Histogram of Oriented Gradient Features for Visible
to Near Infrared Face Matching},
booktitle = {{ICPR}},
pages = {1788--1793},
publisher = {{IEEE} Computer Society},
year = {2014}
}
@inproceedings{DBLP:conf/icpr/GuptaBVS14,
author = {Priyanshu Gupta and
Shipra Behera and
Mayank Vatsa and
Richa Singh},
title = {On Iris Spoofing Using Print Attack},
booktitle = {{ICPR}},
pages = {1681--1686},
publisher = {{IEEE} Computer Society},
year = {2014}
}
@inproceedings{DBLP:conf/interspeech/TomarR14,
author = {Vikrant Singh Tomar and
Richard C. Rose},
title = {Manifold regularized deep neural networks},
booktitle = {{INTERSPEECH}},
pages = {348--352},
publisher = {{ISCA}},
year = {2014}
}
@inproceedings{DBLP:conf/isca/CzechowskiLGRSVD14,
author = {Kenneth Czechowski and
Victor W. Lee and
Ed Grochowski and
Ronny Ronen and
Ronak Singhal and
Richard W. Vuduc and
Pradeep Dubey},
title = {Improving the energy efficiency of Big Cores},
booktitle = {{ISCA}},
pages = {493--504},
publisher = {{IEEE} Computer Society},
year = {2014}
}
@inproceedings{DBLP:conf/iscas/ThakurHTSL14,
author = {Chetan Singh Thakur and
Tara Julia Hamilton and
Jonathan Tapson and
Andr{\'{e}} van Schaik and
Richard F. Lyon},
title = {{FPGA} implementation of the {CAR} Model of the cochlea},
booktitle = {{ISCAS}},
pages = {1853--1856},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/isscc/SinghCFHLSSSUWF14,
author = {Anant Singh and
Dario Albino Carnelli and
Altay Falay and
Klaas L. Hofstra and
Fabio Licciardello and
Kia Salimi and
Hugo Santos and
Amin Shokrollahi and
Roger Ulrich and
Christoph Walter and
John Fox and
Peter Hunt and
John Keay and
Richard Simpson and
Andrew Stewart and
Giuseppe Surace and
Harm S. Cronie},
title = {26.3 {A} pin- and power-efficient low-latency 8-to-12Gb/s/wire 8b8w-coded
SerDes link for high-loss channels in 40nm technology},
booktitle = {{ISSCC}},
pages = {442--443},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/nips/GuoSLLW14,
author = {Xiaoxiao Guo and
Satinder Singh and
Honglak Lee and
Richard L. Lewis and
Xiaoshi Wang},
title = {Deep Learning for Real-Time Atari Game Play Using Offline Monte-Carlo
Tree Search Planning},
booktitle = {{NIPS}},
pages = {3338--3346},
year = {2014}
}
@inproceedings{DBLP:conf/trecvid/Yu0XLXCLMGMDCMW14,
author = {Shoou{-}I Yu and
Lu Jiang and
Zhongwen Xu and
Zhenzhong Lan and
Shicheng Xu and
Xiaojun Chang and
Xuanchong Li and
Zexi Mao and
Chuang Gan and
Yajie Miao and
Xingzhong Du and
Yang Cai and
Lara J. Martin and
Nikolas Wolfe and
Anurag Kumar and
Huan Li and
Ming Lin and
Zhigang Ma and
Yi Yang and
Deyu Meng and
Shiguang Shan and
Pinar Duygulu Sahin and
Susanne Burger and
Florian Metze and
Rita Singh and
Bhiksha Raj and
Teruko Mitamura and
Richard M. Stern and
Alexander G. Hauptmann and
Anil Armagan and
Yicheng Zhao},
title = {Informedia @ {TRECVID} 2014},
booktitle = {{TRECVID}},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2014}
}
@inproceedings{DBLP:conf/vlsid/DuttaSTACW14,
author = {Anupam Dutta and
Saurabh Sirohi and
Ethirajan Tamilmani and
Harshit Agarwal and
Yogesh Singh Chauhan and
Richard Q. Williams},
title = {{BSIM6} - Benchmarking the Next-Generation {MOSFET} Model for {RF}
Applications},
booktitle = {{VLSID}},
pages = {421--426},
publisher = {{IEEE} Computer Society},
year = {2014}
}
@article{DBLP:journals/corr/GuptaGS14,
author = {Richa Gupta and
Sunny Gupta and
Anuradha Singhal},
title = {Importance and Techniques of Information Hiding : {A} Review},
journal = {CoRR},
volume = {abs/1404.3063},
year = {2014}
}
@article{DBLP:journals/corr/GuptaGS14a,
author = {Richa Gupta and
Sunny Gupta and
Anuradha Singhal},
title = {Big Data: Overview},
journal = {CoRR},
volume = {abs/1404.4136},
year = {2014}
}
@article{DBLP:journals/mktsci/ChintaguntaHHRSS13,
author = {Pradeep Chintagunta and
Dominique M. Hanssens and
John R. Hauser and
Jagmohan Singh Raju and
Kannan Srinivasan and
Richard Staelin},
title = {Editorial - \emph{Marketing Science}: {A} Strategic Review},
journal = {Mark. Sci.},
volume = {32},
number = {1},
pages = {4--7},
year = {2013}
}
@article{DBLP:journals/mktsci/RaoS13,
author = {Raghunath Singh Rao and
Richard Schaefer},
title = {Conspicuous Consumption and Dynamic Pricing},
journal = {Mark. Sci.},
volume = {32},
number = {5},
pages = {786--804},
year = {2013}
}
@article{DBLP:journals/ploscb/MortonSS13,
author = {Richard A. Morton and
Jonathan R. Stone and
Rama S. Singh},
title = {Mate Choice and the Origin of Menopause},
journal = {PLoS Comput. Biol.},
volume = {9},
number = {6},
year = {2013}
}
@article{DBLP:journals/tifs/BhattBSV13,
author = {Himanshu S. Bhatt and
Samarth Bharadwaj and
Richa Singh and
Mayank Vatsa},
title = {Recognizing Surgically Altered Face Images Using Multiobjective Evolutionary
Algorithm},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {8},
number = {1},
pages = {89--100},
year = {2013}
}
@article{DBLP:journals/topics/LewisSS13,
author = {Richard L. Lewis and
Michael Shvartsman and
Satinder Singh},
title = {The Adaptive Nature of Eye Movements in Linguistic Tasks: How Payoff
and Architecture Shape Speed-Accuracy Trade-Offs},
journal = {Top. Cogn. Sci.},
volume = {5},
number = {3},
pages = {581--610},
year = {2013}
}
@inproceedings{DBLP:conf/asplos/MadhavapeddyMRSSGSHC13,
author = {Anil Madhavapeddy and
Richard Mortier and
Charalampos Rotsos and
David J. Scott and
Balraj Singh and
Thomas Gazagnaire and
Steven Smith and
Steven Hand and
Jon Crowcroft},
title = {Unikernels: library operating systems for the cloud},
booktitle = {{ASPLOS}},
pages = {461--472},
publisher = {{ACM}},
year = {2013}
}
@inproceedings{DBLP:conf/btas/ChughBSV13,
author = {Tarang Chugh and
Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa},
title = {Matching age separated composite sketches and digital face images},
booktitle = {{BTAS}},
pages = {1--6},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/btas/GoswamiBVS13,
author = {Gaurav Goswami and
Samarth Bharadwaj and
Mayank Vatsa and
Richa Singh},
title = {On {RGB-D} face recognition using Kinect},
booktitle = {{BTAS}},
pages = {1--6},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/btas/SankaranVS13,
author = {Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {Automated clarity and quality assessment for latent fingerprints},
booktitle = {{BTAS}},
pages = {1--6},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/cdc/TuzaSKM13,
author = {Zolt{\'{a}}n A. Tuza and
Vipul Singhal and
Jongmin Kim and
Richard M. Murray},
title = {An in silico modeling toolbox for rapid prototyping of circuits in
a biomolecular "breadboard" system},
booktitle = {{CDC}},
pages = {1404--1410},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/cicc/SchenkerS13,
author = {Richard Schenker and
Vivek Singh},
title = {Foundations for scaling beyond 14nm},
booktitle = {{CICC}},
pages = {1--4},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/cvpr/BharadwajDVS13,
author = {Samarth Bharadwaj and
Tejas I. Dhamecha and
Mayank Vatsa and
Richa Singh},
title = {Computationally Efficient Face Spoofing Detection with Motion Magnification},
booktitle = {{CVPR} Workshops},
pages = {105--110},
publisher = {{IEEE} Computer Society},
year = {2013}
}
@inproceedings{DBLP:conf/cvpr/BhattSV13,
author = {Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa},
title = {Can Combining Demographics and Biometrics Improve De-duplication Performance?},
booktitle = {{CVPR} Workshops},
pages = {188--193},
publisher = {{IEEE} Computer Society},
year = {2013}
}
@inproceedings{DBLP:conf/cvpr/YadavVST13,
author = {Daksha Yadav and
Mayank Vatsa and
Richa Singh and
Massimo Tistarelli},
title = {Bacteria Foraging Fusion for Face Recognition across Age Progression},
booktitle = {{CVPR} Workshops},
pages = {173--179},
publisher = {{IEEE} Computer Society},
year = {2013}
}
@inproceedings{DBLP:conf/ercimdl/MenesesBSFS13,
author = {Luis Meneses and
Himanshu Barthwal and
Sanjeev Singh and
Richard Furuta and
Frank Shipman},
title = {Restoring Semantically Incomplete Document Collections Using Lexical
Signatures},
booktitle = {{TPDL}},
series = {Lecture Notes in Computer Science},
volume = {8092},
pages = {321--332},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/hci/FearyBCHLSS13,
author = {Michael Feary and
Dorrit Billman and
Xiuli Chen and
Andrew Howes and
Richard L. Lewis and
Lance Sherry and
Satinder Singh},
title = {Linking Context to Evaluation in the Design of Safety Critical Interfaces},
booktitle = {{HCI} {(1)}},
series = {Lecture Notes in Computer Science},
volume = {8004},
pages = {193--202},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/ic3/SrivastavaSK13,
author = {Richa Srivastava and
Rajiv Singh and
Ashish Khare},
title = {Fusion of multifocus noisy images using contourlet transform},
booktitle = {{IC3}},
pages = {497--502},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/icassp/TomarR13,
author = {Vikrant Singh Tomar and
Richard C. Rose},
title = {Efficient manifold learning for speech recognition using locality
sensitive hashing},
booktitle = {{ICASSP}},
pages = {6995--6999},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/icassp/TomarR13a,
author = {Vikrant Singh Tomar and
Richard C. Rose},
title = {Noise aware manifold learning for robust speech recognition},
booktitle = {{ICASSP}},
pages = {7087--7091},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/icb/DhamechaNSV13,
author = {Tejas I. Dhamecha and
Aastha Nigam and
Richa Singh and
Mayank Vatsa},
title = {Disguise detection and face recognition in visible and thermal spectrums},
booktitle = {{ICB}},
pages = {1--8},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/icb/KohliYVS13,
author = {Naman Kohli and
Daksha Yadav and
Mayank Vatsa and
Richa Singh},
title = {Revisiting iris recognition with color cosmetic contact lenses},
booktitle = {{ICB}},
pages = {1--7},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/icip/BharadwajVS13,
author = {Samarth Bharadwaj and
Mayank Vatsa and
Richa Singh},
title = {Can holistic representations be used for face biometric quality assessment?},
booktitle = {{ICIP}},
pages = {2792--2796},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/icip/BhattSV13,
author = {Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa},
title = {On rank aggregation for face recognition from videos},
booktitle = {{ICIP}},
pages = {2993--2997},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/icip/MittalJSV13,
author = {Paritosh Mittal and
Aishwarya Jain and
Richa Singh and
Mayank Vatsa},
title = {Boosting local descriptors for matching composite and digital face
images},
booktitle = {{ICIP}},
pages = {2797--2801},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/igarss/RahmouneSFKRBM13,
author = {Rachid Rahmoune and
Yogesh Kumar Singh and
Paolo Ferrazzoli and
Yann Kerr and
Philippe Richaume and
Ahmad Al Bitar and
Christophe Moisy},
title = {{SMOS} {L2} retrieval results over the American continent and comparisons
with independent data sources},
booktitle = {{IGARSS}},
pages = {3419--3422},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/interspeech/TomarR13,
author = {Vikrant Singh Tomar and
Richard C. Rose},
title = {Locality sensitive hashing for fast computation of correlational manifold
learning based feature space transformations},
booktitle = {{INTERSPEECH}},
pages = {1776--1780},
publisher = {{ISCA}},
year = {2013}
}
@inproceedings{DBLP:conf/miccai/AgrawalVS13,
author = {Praful Agrawal and
Mayank Vatsa and
Richa Singh},
title = {HEp-2 Cell Image Classification: {A} Comparative Analysis},
booktitle = {{MLMI}},
series = {Lecture Notes in Computer Science},
volume = {8184},
pages = {195--202},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/nips/GuoSL13,
author = {Xiaoxiao Guo and
Satinder Singh and
Richard L. Lewis},
title = {Reward Mapping for Transfer in Long-Lived Agents},
booktitle = {{NIPS}},
pages = {2130--2138},
year = {2013}
}
@inproceedings{DBLP:conf/socpros/0001RKSMN13,
author = {Vineet Kumar and
K. P. S. Rana and
Amit Kumar and
Richa Sharma and
Puneet Mishra and
Sreejith S. Nair},
title = {Development of a Genetic Algorithm Toolkit in LabVIEW},
booktitle = {SocProS {(1)}},
series = {Advances in Intelligent Systems and Computing},
volume = {258},
pages = {281--296},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/socpros/SharmaR013,
author = {Richa Sharma and
K. P. S. Rana and
Vineet Kumar},
title = {Comparative Study of Controller Optimization Techniques for a Robotic
Manipulator},
booktitle = {SocProS {(1)}},
series = {Advances in Intelligent Systems and Computing},
volume = {258},
pages = {379--393},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/trecvid/Lan0YGR0XSLWS0M13,
author = {Zhenzhong Lan and
Lu Jiang and
Shoou{-}I Yu and
Chenqiang Gao and
Shourabh Rawat and
Yang Cai and
Shicheng Xu and
Haoquan Shen and
Xuanchong Li and
Yipei Wang and
Waito Sze and
Yan Yan and
Zhigang Ma and
Nicolas Ballas and
Deyu Meng and
Wei Tong and
Yi Yang and
Susanne Burger and
Florian Metze and
Rita Singh and
Bhiksha Raj and
Richard M. Stern and
Teruko Mitamura and
Eric Nyberg and
Alexander G. Hauptmann},
title = {Informedia@TRECVID 2013},
booktitle = {{TRECVID}},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2013}
}
@article{DBLP:journals/ibmrd/BaierCCLMRSSV12,
author = {Moritz Baier and
Jorge E. Carballo and
Alice J. Chang and
Yingdong Lu and
Aleksandra Mojsilovic and
M. Jonathan Richard and
Moninder Singh and
Mark S. Squillante and
Kush R. Varshney},
title = {Sales-force performance analytics and optimization},
journal = {{IBM} J. Res. Dev.},
volume = {56},
number = {6},
pages = {8},
year = {2012}
}
@article{DBLP:journals/jcisd/IshchenkoLLWJGCS12,
author = {Alexey Ishchenko and
Zhijie Liu and
Peter Lindblom and
Guosheng Wu and
Kam{-}Chuen Jim and
Richard D. Gregg and
David A. Claremon and
Suresh B. Singh},
title = {Structure-Based Design Technology Contour and Its Application to the
Design of Renin Inhibitors},
journal = {J. Chem. Inf. Model.},
volume = {52},
number = {8},
pages = {2089--2097},
year = {2012}
}
@article{DBLP:journals/nar/FlicekAB12,
author = {Paul Flicek and
M. Ridwan Amode and
Daniel Barrell and
Kathryn Beal and
Simon Brent and
Denise Carvalho{-}Silva and
Peter Clapham and
Guy Coates and
Susan Fairley and
Stephen Fitzgerald and
Laurent Gil and
Leo Gordon and
Maurice Hendrix and
Thibaut Hourlier and
Nathan Johnson and
Andreas K{\"{a}}h{\"{a}}ri and
Damian Keefe and
Stephen Keenan and
Rhoda Kinsella and
Monika Komorowska and
Gautier Koscielny and
Eugene Kulesha and
Pontus Larsson and
Ian Longden and
William M. McLaren and
Matthieu Muffato and
Bert Overduin and
Miguel Pignatelli and
Bethan Pritchard and
Harpreet Singh Riat and
Graham R. S. Ritchie and
Magali Ruffier and
Michael Schuster and
Daniel Sobral and
Y. Amy Tang and
Kieron R. Taylor and
Stephen J. Trevanion and
Jana Vandrovcova and
Simon White and
Mark Wilson and
Steven P. Wilder and
Bronwen L. Aken and
Ewan Birney and
Fiona Cunningham and
Ian Dunham and
Richard Durbin and
Xos{\'{e}} M. Fern{\'{a}}ndez{-}Su{\'{a}}rez and
Jennifer L. Harrow and
Javier Herrero and
Tim J. P. Hubbard and
Anne Parker and
Glenn Proctor and
Giulietta Spudich and
Jan Vogel and
Andy Yates and
Amonida Zadissa and
Stephen M. J. Searle},
title = {Ensembl 2012},
journal = {Nucleic Acids Res.},
volume = {40},
number = {Database-Issue},
pages = {84--90},
year = {2012}
}
@article{DBLP:journals/neuroimage/SinghalCBMLP12,
author = {Shaloo Singhal and
Jian Chen and
Richard Beare and
Henry Ma and
John Ly and
Thanh G. Phan},
title = {Application of principal component analysis to study topography of
hypoxic-ischemic brain injury},
journal = {NeuroImage},
volume = {62},
number = {1},
pages = {300--306},
year = {2012}
}
@article{DBLP:journals/tifs/BhattBSV12,
author = {Himanshu S. Bhatt and
Samarth Bharadwaj and
Richa Singh and
Mayank Vatsa},
title = {Memetically Optimized {MCWLD} for Matching Sketches With Digital Face
Images},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {7},
number = {5},
pages = {1522--1535},
year = {2012}
}
@inproceedings{DBLP:conf/aamas/BratmanSSL12,
author = {Jeshua Bratman and
Satinder Singh and
Jonathan Sorg and
Richard L. Lewis},
title = {Strong mitigation: nesting search for good policies within search
for good reward},
booktitle = {{AAMAS}},
pages = {407--414},
publisher = {{IFAAMAS}},
year = {2012}
}
@inproceedings{DBLP:conf/amlta/SharmaBS12,
author = {Richa N. K. Sharma and
Roheet Bhatnagar and
A. K. Singh},
title = {Surface Mining Signal Discrimination Using Landsat {TM} Sensor: An
Empirical Approach},
booktitle = {{AMLTA}},
series = {Communications in Computer and Information Science},
volume = {322},
pages = {222--233},
publisher = {Springer},
year = {2012}
}
@inproceedings{DBLP:conf/btas/AroraVSJ12,
author = {Sunpreet S. Arora and
Mayank Vatsa and
Richa Singh and
Anil K. Jain},
title = {On iris camera interoperability},
booktitle = {{BTAS}},
pages = {346--352},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/btas/GoswamiSVPN12,
author = {Gaurav Goswami and
Richa Singh and
Mayank Vatsa and
Brian M. Powell and
Afzel Noore},
title = {Face recognition {CAPTCHA}},
booktitle = {{BTAS}},
pages = {412--417},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/btas/KohliSV12,
author = {Naman Kohli and
Richa Singh and
Mayank Vatsa},
title = {Self-similarity representation of Weber faces for kinship classification},
booktitle = {{BTAS}},
pages = {245--250},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/btas/SankaranVS12,
author = {Anush Sankaran and
Mayank Vatsa and
Richa Singh},
title = {Hierarchical fusion for matching simultaneous latent fingerprint},
booktitle = {{BTAS}},
pages = {377--382},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/cvpr/MehrotraVSM12,
author = {Hunny Mehrotra and
Mayank Vatsa and
Richa Singh and
Banshidhar Majhi},
title = {Biometric match score fusion using {RVM:} {A} case study in multi-unit
iris recognition},
booktitle = {{CVPR} Workshops},
pages = {65--70},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/fie/SinghP12,
author = {Richa Singh and
Mayank Pundir},
title = {Work in progress: On entrance test criteria for {CS} and {IT} {UG}
programs},
booktitle = {{FIE}},
pages = {1--2},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/fie/SrivastavaS12,
author = {Saket Srivastava and
Richa Singh},
title = {Work in progress: {A} quantitative study of effectiveness in group
learning},
booktitle = {{FIE}},
pages = {1--2},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/host/YuSSMD12,
author = {Meng{-}Day (Mandel) Yu and
Richard Sowell and
Alok Singh and
David M'Ra{\"{\i}}hi and
Srinivas Devadas},
title = {Performance metrics and empirical results of a {PUF} cryptographic
key generation {ASIC}},
booktitle = {{HOST}},
pages = {108--115},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/icb/AroraVSJ12,
author = {Sunpreet S. Arora and
Mayank Vatsa and
Richa Singh and
Anil K. Jain},
title = {Iris recognition under alcohol influence: {A} preliminary study},
booktitle = {{ICB}},
pages = {336--341},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/icc/RotsosMMSM12,
author = {Charalampos Rotsos and
Richard Mortier and
Anil Madhavapeddy and
Balraj Singh and
Andrew W. Moore},
title = {Cost, performance {\&} flexibility in OpenFlow: Pick three},
booktitle = {{ICC}},
pages = {6601--6605},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/icdl-epirob/LiuSLQ12,
author = {Bingyao Liu and
Satinder Singh and
Richard L. Lewis and
Shiyin Qin},
title = {Optimal rewards in multiagent teams},
booktitle = {{ICDL-EPIROB}},
pages = {1--8},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/icer/RadermacherWR12,
author = {Alex Radermacher and
Gursimran S. Walia and
Richard Rummelt},
title = {Improving student learning outcomes with pair programming},
booktitle = {{ICER}},
pages = {87--92},
publisher = {{ACM}},
year = {2012}
}
@inproceedings{DBLP:conf/icip/BhattSVR12,
author = {Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa and
Nalini K. Ratha},
title = {Matching cross-resolution face images using co-transfer learning},
booktitle = {{ICIP}},
pages = {1453--1456},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/icip/LambaDVS12,
author = {Hemank Lamba and
Tejas Indulal Dhamecha and
Mayank Vatsa and
Richa Singh},
title = {Incremental subclass discriminant analysis: {A} case study in face
recognition},
booktitle = {{ICIP}},
pages = {593--596},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/icisp/KhareSS12,
author = {Ashish Khare and
Richa Srivastava and
Rajiv Singh},
title = {Edge Preserving Image Fusion Based on Contourlet Transform},
booktitle = {{ICISP}},
series = {Lecture Notes in Computer Science},
volume = {7340},
pages = {93--102},
publisher = {Springer},
year = {2012}
}
@inproceedings{DBLP:conf/icitcs/KumarCSS12,
author = {Tarun Kumar and
Ajay Chaudhary and
Ganesh Singh and
Richa Sharma},
title = {A Framework of the Wireless Sensor Based Railway Signal System},
booktitle = {{ICITCS}},
series = {Lecture Notes in Electrical Engineering},
volume = {215},
pages = {417--423},
publisher = {Springer},
year = {2012}
}
@inproceedings{DBLP:conf/interspeech/TomarR12,
author = {Vikrant Singh Tomar and
Richard C. Rose},
title = {A Correlational Discriminant Approach to Feature Extraction for Robust
Speech Recognition},
booktitle = {{INTERSPEECH}},
pages = {555--558},
publisher = {{ISCA}},
year = {2012}
}
@inproceedings{DBLP:conf/isspa/TomarR12,
author = {Vikrant Singh Tomar and
Richard C. Rose},
title = {Application of a locality preserving discriminant analysis approach
to {ASR}},
booktitle = {{ISSPA}},
pages = {103--107},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/msn/PalanisamyLLST12,
author = {Balaji Palanisamy and
Ling Liu and
Kisung Lee and
Aameek Singh and
Yuzhe Richard Tang},
title = {Location Privacy with Road Network Mix-Zones},
booktitle = {{MSN}},
pages = {124--131},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/sigcse/RadermacherWR12,
author = {Alex Radermacher and
Gursimran S. Walia and
Richard Rummelt},
title = {Assigning student programming pairs based on their mental model consistency:
an initial investigation},
booktitle = {{SIGCSE}},
pages = {325--330},
publisher = {{ACM}},
year = {2012}
}
@inproceedings{DBLP:conf/srii/GoodwinGMSMM12,
author = {Richard Goodwin and
SweeFen Goh and
Pietro Mazzoleni and
Vibha Sinha and
Debdoot Mukherjee and
Senthil Mani},
title = {Effective Content Reuse for Business Consulting Practices},
booktitle = {{SRII} Global Conference},
pages = {682--690},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/srii/GoodwinMGRSMM12,
author = {Richard Goodwin and
Pietro Mazzoleni and
SweeFen Goh and
Aubrey Rember and
Vibha Sinha and
Debdoot Mukherjee and
Senthil Mani},
title = {Improving Service Quality through Use of Standard Workbenches},
booktitle = {{SRII} Global Conference},
pages = {361--368},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/trecvid/YuXDSVLCRSMBJT012,
author = {Shoou{-}I Yu and
Zhongwen Xu and
Duo Ding and
Waito Sze and
Francisco Vicente and
Zhenzhong Lan and
Yang Cai and
Shourabh Rawat and
Peter F. Schulam and
Nisarga Markandaiah and
Sohail Bahmani and
Antonio Ju{\'{a}}rez and
Wei Tong and
Yi Yang and
Susanne Burger and
Florian Metze and
Rita Singh and
Bhiksha Raj and
Richard M. Stern and
Teruko Mitamura and
Eric Nyberg and
Lu Jiang and
Qiang Chen and
Lisa M. Brown and
Ankur Datta and
Quanfu Fan and
Rog{\'{e}}rio Schmidt Feris and
Shuicheng Yan and
Alexander G. Hauptmann and
Sharath Pankanti},
title = {Informedia @TRECVID 2012},
booktitle = {{TRECVID}},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2012}
}
@article{DBLP:journals/corr/abs-1203-3518,
author = {Jonathan Sorg and
Satinder Singh and
Richard L. Lewis},
title = {Variance-Based Rewards for Approximate Bayesian Reinforcement Learning},
journal = {CoRR},
volume = {abs/1203.3518},
year = {2012}
}
@article{DBLP:journals/asc/VatsaSNM11,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore and
Keith B. Morris},
title = {Simultaneous latent fingerprint recognition},
journal = {Appl. Soft Comput.},
volume = {11},
number = {7},
pages = {4260--4266},
year = {2011}
}
@article{DBLP:journals/jasss/FrankDRSCB11,
author = {Richard Frank and
Vahid Dabbaghian and
Andrew A. Reid and
Suraj K. Singh and
Jonathan Cinnamon and
Patricia L. Brantingham},
title = {Power of Criminal Attractors: Modeling the Pull of Activity Nodes},
journal = {J. Artif. Soc. Soc. Simul.},
volume = {14},
number = {1},
year = {2011}
}
@article{DBLP:journals/nar/FlicekAB11,
author = {Paul Flicek and
M. Ridwan Amode and
Daniel Barrell and
Kathryn Beal and
Simon Brent and
Yuan Chen and
Peter Clapham and
Guy Coates and
Susan Fairley and
Stephen Fitzgerald and
Leo Gordon and
Maurice Hendrix and
Thibaut Hourlier and
Nathan Johnson and
Andreas K{\"{a}}h{\"{a}}ri and
Damian Keefe and
Stephen Keenan and
Rhoda Kinsella and
Felix Kokocinski and
Eugene Kulesha and
Pontus Larsson and
Ian Longden and
William M. McLaren and
Bert Overduin and
Bethan Pritchard and
Harpreet Singh Riat and
Daniel Rios and
Graham R. S. Ritchie and
Magali Ruffier and
Michael Schuster and
Daniel Sobral and
Giulietta Spudich and
Y. Amy Tang and
Stephen J. Trevanion and
Jana Vandrovcova and
Albert J. Vilella and
Simon White and
Steven P. Wilder and
Amonida Zadissa and
Jorge Zamora and
Bronwen L. Aken and
Ewan Birney and
Fiona Cunningham and
Ian Dunham and
Richard Durbin and
Xos{\'{e}} M. Fern{\'{a}}ndez{-}Su{\'{a}}rez and
Javier Herrero and
Tim J. P. Hubbard and
Anne Parker and
Glenn Proctor and
Jan Vogel and
Stephen M. J. Searle},
title = {Ensembl 2011},
journal = {Nucleic Acids Res.},
volume = {39},
number = {Database-Issue},
pages = {800--806},
year = {2011}
}
@article{DBLP:journals/tosn/SinghKMSC11,
author = {Jaspreet Singh and
Rajesh Kumar and
Upamanyu Madhow and
Subhash Suri and
Richard E. Cagley},
title = {Multiple-Target Tracking With Binary Proximity Sensors},
journal = {{ACM} Trans. Sens. Networks},
volume = {8},
number = {1},
pages = {5:1--5:26},
year = {2011}
}
@inproceedings{DBLP:conf/aaai/SorgSL11,
author = {Jonathan Sorg and
Satinder Singh and
Richard L. Lewis},
title = {Optimal Rewards versus Leaf-Evaluation Heuristics in Planning Agents},
booktitle = {{AAAI}},
pages = {465--470},
publisher = {{AAAI} Press},
year = {2011}
}
@inproceedings{DBLP:conf/cvpr/BharadwajBVSN11,
author = {Samarth Bharadwaj and
Himanshu S. Bhatt and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Quality assessment based denoising to improve face recognition performance},
booktitle = {{CVPR} Workshops},
pages = {140--145},
publisher = {{IEEE} Computer Society},
year = {2011}
}
@inproceedings{DBLP:conf/fgr/BhattBSVN11,
author = {Himanshu S. Bhatt and
Samarth Bharadwaj and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Evolutionary granular approach for recognizing faces altered due to
plastic surgery},
booktitle = {{FG}},
pages = {720--725},
publisher = {{IEEE} Computer Society},
year = {2011}
}
@inproceedings{DBLP:conf/icassp/KumarRSS11,
author = {Kshitiz Kumar and
Bhiksha Raj and
Rita Singh and
Richard M. Stern},
title = {An iterative least-squares technique for dereverberation},
booktitle = {{ICASSP}},
pages = {5488--5491},
publisher = {{IEEE}},
year = {2011}
}
@inproceedings{DBLP:conf/icassp/KumarSRS11,
author = {Kshitiz Kumar and
Rita Singh and
Bhiksha Raj and
Richard M. Stern},
title = {Gammatone sub-band magnitude-domain dereverberation for {ASR}},
booktitle = {{ICASSP}},
pages = {4604--4607},
publisher = {{IEEE}},
year = {2011}
}
@inproceedings{DBLP:conf/icb/BhattBSVNR11,
author = {Himanshu S. Bhatt and
Samarth Bharadwaj and
Richa Singh and
Mayank Vatsa and
Afzel Noore and
Arun Ross},
title = {On co-training online biometric classifiers},
booktitle = {{IJCB}},
pages = {1--7},
publisher = {{IEEE} Computer Society},
year = {2011}
}
@inproceedings{DBLP:conf/icb/BhattBVSRN11,
author = {Himanshu S. Bhatt and
Samarth Bharadwaj and
Mayank Vatsa and
Richa Singh and
Arun Ross and
Afzel Noore},
title = {A framework for quality-based biometric classifier selection},
booktitle = {{IJCB}},
pages = {1--7},
publisher = {{IEEE} Computer Society},
year = {2011}
}
@inproceedings{DBLP:conf/icb/DhamechaSSV11,
author = {Tejas I. Dhamecha and
Anush Sankaran and
Richa Singh and
Mayank Vatsa},
title = {Is gender classification across ethnicity feasible using discriminant
functions?},
booktitle = {{IJCB}},
pages = {1--7},
publisher = {{IEEE} Computer Society},
year = {2011}
}
@inproceedings{DBLP:conf/icb/LambaSVSN11,
author = {Hemank Lamba and
Ankit Sarkar and
Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Face recognition for look-alikes: {A} preliminary study},
booktitle = {{IJCB}},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2011}
}
@inproceedings{DBLP:conf/icb/SankaranDVS11,
author = {Anush Sankaran and
Tejas I. Dhamecha and
Mayank Vatsa and
Richa Singh},
title = {On matching latent to latent fingerprints},
booktitle = {{IJCB}},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2011}
}
@inproceedings{DBLP:conf/icse/FeinRSMGGBCLSMMSD11,
author = {Elad Fein and
Natalia Razinkov and
Shlomit Shachor and
Pietro Mazzoleni and
SweeFen Goh and
Richard Goodwin and
Manisha Bhandar and
Shyh{-}Kwei Chen and
Juhnyoung Lee and
Vibha Singhal Sinha and
Senthil Mani and
Debdoot Mukherjee and
Biplav Srivastava and
Pankaj Dhoolia},
title = {Using {MATCON} to generate {CASE} tools that guide deployment of pre-packaged
applications},
booktitle = {{ICSE}},
pages = {1016--1018},
publisher = {{ACM}},
year = {2011}
}
@inproceedings{DBLP:conf/sigmetrics/SinghBLBLS11,
author = {Satinder Pal Singh and
Randolph Baden and
Choon Lee and
Bobby Bhattacharjee and
Richard J. La and
Mark A. Shayman},
title = {{IP} geolocation in metropolitan areas},
booktitle = {{SIGMETRICS}},
pages = {155--156},
publisher = {{ACM}},
year = {2011}
}
@article{DBLP:journals/bioinformatics/ShahABSMIKMZBAS10,
author = {Anuj R. Shah and
Khushbu Agarwal and
Erin S. Baker and
Mudita Singhal and
Anoop M. Mayampurath and
Yehia M. Ibrahim and
Lars J. Kangas and
Matthew E. Monroe and
Rui Zhao and
Mikhail E. Belov and
Gordon A. Anderson and
Richard D. Smith},
title = {Machine learning based prediction for peptide drift times in ion mobility
spectrometry},
journal = {Bioinform.},
volume = {26},
number = {13},
pages = {1601--1607},
year = {2010}
}
@article{DBLP:journals/ijmis/PowellDSVN10,
author = {Brian M. Powell and
Adam C. Day and
Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Image-based face detection {CAPTCHA} for improved security},
journal = {Int. J. Multim. Intell. Secur.},
volume = {1},
number = {3},
pages = {269--284},
year = {2010}
}
@article{DBLP:journals/ivc/SinghVRN10,
author = {Richa Singh and
Mayank Vatsa and
Arun Ross and
Afzel Noore},
title = {Biometric classifier update using online learning: {A} case study
in near infrared face verification},
journal = {Image Vis. Comput.},
volume = {28},
number = {7},
pages = {1098--1105},
year = {2010}
}
@article{DBLP:journals/jfr/BinghamFSCDEMMRS10,
author = {Brian Bingham and
Brendan Foley and
Hanumant Singh and
Richard Camilli and
Katerina Delaporta and
Ryan M. Eustice and
Angelos Mallios and
David A. Mindell and
Christopher N. Roman and
Dimitris Sakellariou},
title = {Robotic tools for deep water archaeology: Surveying an ancient shipwreck
with an autonomous underwater vehicle},
journal = {J. Field Robotics},
volume = {27},
number = {6},
pages = {702--717},
year = {2010}
}
@article{DBLP:journals/tamd/SinghLBS10,
author = {Satinder Singh and
Richard L. Lewis and
Andrew G. Barto and
Jonathan Sorg},
title = {Intrinsically Motivated Reinforcement Learning: An Evolutionary Perspective},
journal = {{IEEE} Trans. Auton. Ment. Dev.},
volume = {2},
number = {2},
pages = {70--82},
year = {2010}
}
@article{DBLP:journals/tifs/SinghVBBNN10,
author = {Richa Singh and
Mayank Vatsa and
Himanshu S. Bhatt and
Samarth Bharadwaj and
Afzel Noore and
Shahin S. Nooreyezdan},
title = {Plastic surgery: a new dimension to face recognition},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {5},
number = {3},
pages = {441--448},
year = {2010}
}
@article{DBLP:journals/tifs/VatsaSNR10,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore and
Arun Ross},
title = {On the dynamic selection of biometric fusion algorithms},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {5},
number = {3},
pages = {470--479},
year = {2010}
}
@article{DBLP:journals/tvlsi/SinghRASB10,
author = {Harmander Singh and
Rahul M. Rao and
Kanak Agarwal and
Dennis Sylvester and
Richard B. Brown},
title = {Dynamically Pulsed {MTCMOS} With Bus Encoding for Reduction of Total
Power and Crosstalk Noise},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {18},
number = {1},
pages = {166--170},
year = {2010}
}
@inproceedings{DBLP:conf/acl-louhi/BhatiaGDMMD10,
author = {Ramanjot Singh Bhatia and
Amber Graystone and
Ross A. Davies and
Susan McClinton and
Jason Morin and
Richard F. Davies},
title = {Extracting Information for Generating {A} Diabetes Report Card from
Free Text in Physicians Notes},
booktitle = {Louhi@NAACL-HLT},
pages = {8--14},
publisher = {Association for Computational Linguistics},
year = {2010}
}
@inproceedings{DBLP:conf/btas/BharadwajBSVS10,
author = {Samarth Bharadwaj and
Himanshu S. Bhatt and
Richa Singh and
Mayank Vatsa and
Sanjay Kumar Singh},
title = {Face recognition for newborns: {A} preliminary study},
booktitle = {{BTAS}},
pages = {1--6},
publisher = {{IEEE}},
year = {2010}
}
@inproceedings{DBLP:conf/btas/BharadwajBVS10,
author = {Samarth Bharadwaj and
Himanshu S. Bhatt and
Mayank Vatsa and
Richa Singh},
title = {Periocular biometrics: When iris recognition fails},
booktitle = {{BTAS}},
pages = {1--6},
publisher = {{IEEE}},
year = {2010}
}
@inproceedings{DBLP:conf/btas/BhattBSV10,
author = {Himanshu S. Bhatt and
Samarth Bharadwaj and
Richa Singh and
Mayank Vatsa},
title = {On matching sketches with digital face images},
booktitle = {{BTAS}},
pages = {1--7},
publisher = {{IEEE}},
year = {2010}
}
@inproceedings{DBLP:conf/btas/VatsaSBBN10,
author = {Mayank Vatsa and
Richa Singh and
Samarth Bharadwaj and
Himanshu S. Bhatt and
Afzel Noore},
title = {Matching digital and scanned face images with age variation},
booktitle = {{BTAS}},
pages = {1--6},
publisher = {{IEEE}},
year = {2010}
}
@inproceedings{DBLP:conf/iceb2/BhattBSV10,
author = {Himanshu S. Bhatt and
Samarth Bharadwaj and
Richa Singh and
Mayank Vatsa},
title = {Face Recognition and Plastic Surgery: Social, Ethical and Engineering
Challenges},
booktitle = {{ICEB}},
series = {Lecture Notes in Computer Science},
volume = {6005},
pages = {70--75},
publisher = {Springer},
year = {2010}
}
@inproceedings{DBLP:conf/iceb2/PuriNTVS10,
author = {Charvi Puri and
Kanika Narang and
A. Tiwari and
Mayank Vatsa and
Richa Singh},
title = {On Analysis of Rural and Urban Indian Fingerprint Images},
booktitle = {{ICEB}},
series = {Lecture Notes in Computer Science},
volume = {6005},
pages = {55--61},
publisher = {Springer},
year = {2010}
}
@inproceedings{DBLP:conf/icml/SorgSL10,
author = {Jonathan Sorg and
Satinder Singh and
Richard L. Lewis},
title = {Internal Rewards Mitigate Agent Boundedness},
booktitle = {{ICML}},
pages = {1007--1014},
publisher = {Omnipress},
year = {2010}
}
@inproceedings{DBLP:conf/icpr/VatsaSRN10,
author = {Mayank Vatsa and
Richa Singh and
Arun Ross and
Afzel Noore},
title = {Quality-Based Fusion for Multichannel Iris Recognition},
booktitle = {{ICPR}},
pages = {1314--1317},
publisher = {{IEEE} Computer Society},
year = {2010}
}
@inproceedings{DBLP:conf/miccai/SinghFPHKMWJ10,
author = {Nikhil Singh and
P. Thomas Fletcher and
J. Samuel Preston and
Linh K. Ha and
Richard D. King and
James Stephen Marron and
Michael Wiener and
Sarang C. Joshi},
title = {Multivariate Statistical Analysis of Deformation Momenta Relating
Anatomical Shape to Neuropsychological Measures},
booktitle = {{MICCAI} {(3)}},
series = {Lecture Notes in Computer Science},
volume = {6363},
pages = {529--537},
publisher = {Springer},
year = {2010}
}
@inproceedings{DBLP:conf/nips/SorgSL10,
author = {Jonathan Sorg and
Satinder Singh and
Richard L. Lewis},
title = {Reward Design via Online Gradient Ascent},
booktitle = {{NIPS}},
pages = {2190--2198},
publisher = {Curran Associates, Inc.},
year = {2010}
}
@inproceedings{DBLP:conf/ppopp/ChoiSV10,
author = {JeeWhan Choi and
Amik Singh and
Richard W. Vuduc},
title = {Model-driven autotuning of sparse matrix-vector multiply on GPUs},
booktitle = {PPoPP},
pages = {115--126},
publisher = {{ACM}},
year = {2010}
}
@inproceedings{DBLP:conf/uai/SorgSL10,
author = {Jonathan Sorg and
Satinder Singh and
Richard L. Lewis},
title = {Variance-Based Rewards for Approximate Bayesian Reinforcement Learning},
booktitle = {{UAI}},
pages = {564--571},
publisher = {{AUAI} Press},
year = {2010}
}
@article{DBLP:journals/ijar/VatsaSNH09,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore and
Max M. Houck},
title = {Quality-augmented fusion of level-2 and level-3 fingerprint information
using DSm theory},
journal = {Int. J. Approx. Reason.},
volume = {50},
number = {1},
pages = {51--61},
year = {2009}
}
@article{DBLP:journals/ijiit/DAubeterreIES09,
author = {Fergle D'Aubeterre and
Lakshmi S. Iyer and
Richard Ehrhardt and
Rahul Singh},
title = {Discovery Process in a {B2B} eMarketplace: {A} Semantic Matchmaking
Approach},
journal = {Int. J. Intell. Inf. Technol.},
volume = {5},
number = {4},
pages = {16--40},
year = {2009}
}
@article{DBLP:journals/ivc/SinghVN09,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Face recognition with disguise and single gallery images},
journal = {Image Vis. Comput.},
volume = {27},
number = {3},
pages = {245--257},
year = {2009}
}
@article{DBLP:journals/ivc/VatsaSN09,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Feature based {RDWT} watermarking for multimodal biometric system},
journal = {Image Vis. Comput.},
volume = {27},
number = {3},
pages = {293--304},
year = {2009}
}
@article{DBLP:journals/jcisd/SinghGGPHM09,
author = {Narender Singh and
Rajarshi Guha and
Marc A. Giulianotti and
Clemencia Pinilla and
Richard A. Houghten and
Jos{\'{e}} L. Medina{-}Franco},
title = {Chemoinformatic Analysis of Combinatorial Libraries, Drugs, Natural
Products, and Molecular Libraries Small Molecule Repository},
journal = {J. Chem. Inf. Model.},
volume = {49},
number = {4},
pages = {1010--1024},
year = {2009}
}
@article{DBLP:journals/jfr/KunzMSPSSSRNJECB09,
author = {Clayton Kunz and
Chris Murphy and
Hanumant Singh and
Claire Pontbriand and
Robert A. Sohn and
Sandipa Singh and
Taichi Sato and
Christopher N. Roman and
Ko{-}ichi Nakamura and
Michael V. Jakuba and
Ryan M. Eustice and
Richard Camilli and
John Bailey},
title = {Toward extraplanetary under-ice exploration: Robotic steps in the
Arctic},
journal = {J. Field Robotics},
volume = {26},
number = {4},
pages = {411--429},
year = {2009}
}
@article{DBLP:journals/sigpro/VatsaSNS09,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore and
Sanjay Kumar Singh},
title = {Combining pores and ridges with minutiae for improved fingerprint
verification},
journal = {Signal Process.},
volume = {89},
number = {12},
pages = {2676--2685},
year = {2009}
}
@article{DBLP:journals/telsys/SinghVSU09,
author = {Richa Singh and
Mayank Vatsa and
Sanjay Kumar Singh and
Saurabh Upadhyay},
title = {Integrating {SVM} classification with {SVD} watermarking for intelligent
video authentication},
journal = {Telecommun. Syst.},
volume = {40},
number = {1-2},
pages = {5--15},
year = {2009}
}
@article{DBLP:journals/tsmc/VatsaSN09,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Unification of Evidence-Theoretic Fusion Algorithms: {A} Case Study
in Level-2 and Level-3 Fingerprint Features},
journal = {{IEEE} Trans. Syst. Man Cybern. Part {A}},
volume = {39},
number = {1},
pages = {47--56},
year = {2009}
}
@inproceedings{DBLP:conf/bncod/HalloranIAFCGGJG09,
author = {John Halloran and
Rahat Iqbal and
Dzmitry Aliakseyeu and
Martinez Fernando and
Richard Cooper and
Adam Grzywaczewski and
Ratvinder Grewal and
Anne E. James and
Chris Greenhalgh},
title = {Design Challenges and Solutions: Review of the 4th International Workshop
on Ubiquitous Computing (iUBICOM 2009)},
booktitle = {{BNCOD}},
series = {Lecture Notes in Computer Science},
volume = {5588},
pages = {234--245},
publisher = {Springer},
year = {2009}
}
@inproceedings{DBLP:conf/cvpr/SinghVN09,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Effect of plastic surgery on face recognition: {A} preliminary study},
booktitle = {{CVPR} Workshops},
pages = {72--77},
publisher = {{IEEE} Computer Society},
year = {2009}
}
@inproceedings{DBLP:conf/icapr/SinghVN09,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Multimodal Medical Image Fusion Using Redundant Discrete Wavelet Transform},
booktitle = {{ICAPR}},
pages = {232--235},
publisher = {{IEEE} Computer Society},
year = {2009}
}
@inproceedings{DBLP:conf/icapr/VatsaSNS09,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore and
Sanjay Kumar Singh},
title = {Belief Function Theory Based Biometric Match Score Fusion: Case Studies
in Multi-instance and Multi-unit Iris Verification},
booktitle = {{ICAPR}},
pages = {433--436},
publisher = {{IEEE} Computer Society},
year = {2009}
}
@inproceedings{DBLP:conf/ipcv/SinghVN09,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Fingerprint Indexing using Minutiae and Pore Features},
booktitle = {{IPCV}},
pages = {870--875},
publisher = {{CSREA} Press},
year = {2009}
}
@inproceedings{DBLP:conf/ipcv/VatsaSN09,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Denoising and Segmentation of 3D Brain Images},
booktitle = {{IPCV}},
pages = {561--567},
publisher = {{CSREA} Press},
year = {2009}
}
@inproceedings{DBLP:conf/miccai/ChungSKDD09,
author = {Moo K. Chung and
Vikas Singh and
Peter T. Kim and
Kim M. Dalton and
Richard J. Davidson},
title = {Topological Characterization of Signal in Brain Images Using Min-Max
Diagrams},
booktitle = {{MICCAI} {(1)}},
series = {Lecture Notes in Computer Science},
volume = {5762},
pages = {158--166},
publisher = {Springer},
year = {2009}
}
@inproceedings{DBLP:conf/oopsla/MazzoleniGGBCLSMMSDFR09,
author = {Pietro Mazzoleni and
SweeFen Goh and
Richard Goodwin and
Manisha Bhandar and
Shyh{-}Kwei Chen and
Juhnyoung Lee and
Vibha Singhal Sinha and
Senthil Mani and
Debdoot Mukherjee and
Biplav Srivastava and
Pankaj Dhoolia and
Elad Fein and
Natalia Razinkov},
title = {Consultant assistant: a tool for collaborative requirements gathering
and business process documentation},
booktitle = {{OOPSLA} Companion},
pages = {807--808},
publisher = {{ACM}},
year = {2009}
}
@inproceedings{DBLP:conf/premi/VatsaSN09,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Context Switching Algorithm for Selective Multibiometric Fusion},
booktitle = {PReMI},
series = {Lecture Notes in Computer Science},
volume = {5909},
pages = {452--457},
publisher = {Springer},
year = {2009}
}
@incollection{DBLP:reference/bio/NooreSV09,
author = {Afzel Noore and
Richa Singh and
Mayank Vatsa},
title = {Fusion, Sensor-Level},
booktitle = {Encyclopedia of Biometrics},
pages = {616--621},
publisher = {Springer {US}},
year = {2009}
}
@article{DBLP:journals/ejasp/SinghTK08,
author = {Manoj Kumar Singh and
Uma Shanker Tiwary and
Young{-}Hoon Kim},
title = {An Adaptively Accelerated Lucy-Richardson Method for Image Deblurring},
journal = {{EURASIP} J. Adv. Signal Process.},
volume = {2008},
year = {2008}
}
@article{DBLP:journals/inffus/SinghVN08,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Hierarchical fusion of multi-spectral face images for improved recognition
performance},
journal = {Inf. Fusion},
volume = {9},
number = {2},
pages = {200--210},
year = {2008}
}
@article{DBLP:journals/pr/SinghVN08,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Integrated multilevel image fusion and match score fusion of visible
and infrared face images for robust face recognition},
journal = {Pattern Recognit.},
volume = {41},
number = {3},
pages = {880--893},
year = {2008}
}
@article{DBLP:journals/taco/IpekMSCSS08,
author = {Engin Ipek and
Sally A. McKee and
Karan Singh and
Rich Caruana and
Bronis R. de Supinski and
Martin Schulz},
title = {Efficient architectural design space exploration via predictive modeling},
journal = {{ACM} Trans. Archit. Code Optim.},
volume = {4},
number = {4},
pages = {1:1--1:34},
year = {2008}
}
@article{DBLP:journals/tbcas/SinghRCMDAGWHL08,
author = {Vinit Singh and
Arup Roy and
Richard Castro and
Kelly McClure and
Rongching Dai and
Rajat Agrawal and
Robert J. Greenberg and
James D. Weiland and
Mark S. Humayun and
Gianluca Lazzi},
title = {On the Thermal Elevation of a 60-Electrode Epiretinal Prosthesis for
the Blind},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {2},
number = {4},
pages = {289--300},
year = {2008}
}
@article{DBLP:journals/tsmc/VatsaSN08,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Improving Iris Recognition Performance Using Segmentation, Quality
Enhancement, Match Score Fusion, and Indexing},
journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
volume = {38},
number = {4},
pages = {1021--1035},
year = {2008}
}
@inproceedings{DBLP:conf/cvpr/VatsaSRN08,
author = {Mayank Vatsa and
Richa Singh and
Arun Ross and
Afzel Noore},
title = {Likelihood ratio in a {SVM} framework: Fusing linear and non-linear
face classifiers},
booktitle = {{CVPR} Workshops},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2008}
}
@inproceedings{DBLP:conf/icpr/SinghVN08,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Multiclass mv-granular soft support vector machine: {A} case study
in dynamic classifier selection for multispectral face recognition},
booktitle = {{ICPR}},
pages = {1--4},
publisher = {{IEEE} Computer Society},
year = {2008}
}
@inproceedings{DBLP:conf/iros/KunzMCSBEJNRSSW08,
author = {Clayton Kunz and
Chris Murphy and
Richard Camilli and
Hanumant Singh and
John Bailey and
Ryan M. Eustice and
Michael V. Jakuba and
Ko{-}ichi Nakamura and
Christopher N. Roman and
Taichi Sato and
Robert A. Sohn and
Claire Willis},
title = {Deep sea underwater robotic exploration in the ice-covered Arctic
ocean with AUVs},
booktitle = {{IROS}},
pages = {3654--3660},
publisher = {{IEEE}},
year = {2008}
}
@incollection{DBLP:series/sci/VatsaSN08,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {{SVM} Based Adaptive Biometric Image Enhancement Using Quality Assessment},
booktitle = {Speech, Audio, Image and Biomedical Signal Processing using Neural
Networks},
series = {Studies in Computational Intelligence},
volume = {83},
pages = {351--371},
publisher = {Springer},
year = {2008}
}
@article{DBLP:journals/concurrency/SinghIMSSC07,
author = {Karan Singh and
Engin Ipek and
Sally A. McKee and
Bronis R. de Supinski and
Martin Schulz and
Rich Caruana},
title = {Predicting parallel application performance via machine learning approaches},
journal = {Concurr. Comput. Pract. Exp.},
volume = {19},
number = {17},
pages = {2219--2235},
year = {2007}
}
@article{DBLP:journals/ieeesp/FerraioloKS07,
author = {David F. Ferraiolo and
D. Richard Kuhn and
Ravi S. Sandhu},
title = {{RBAC} Standard Rationale: Comments on "A Critique of the {ANSI} Standard
on Role-Based Access Control"},
journal = {{IEEE} Secur. Priv.},
volume = {5},
number = {6},
pages = {51--53},
year = {2007}
}
@article{DBLP:journals/ijns/VatsaSN07,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Integrating Image Quality in 2nu-SVM Biometric Match Score Fusion},
journal = {Int. J. Neural Syst.},
volume = {17},
number = {5},
pages = {343--351},
year = {2007}
}
@article{DBLP:journals/inffus/NooreSV07,
author = {Afzel Noore and
Richa Singh and
Mayank Vatsa},
title = {Robust memory-efficient data level information fusion of multi-modal
biometric images},
journal = {Inf. Fusion},
volume = {8},
number = {4},
pages = {337--346},
year = {2007}
}
@article{DBLP:journals/neuroimage/HensonMSBHF07,
author = {Richard N. Henson and
J{\'{e}}r{\'{e}}mie Mattout and
Krish D. Singh and
Gareth R. Barnes and
Arjan Hillebrand and
Karl J. Friston},
title = {Population-level inferences for distributed {MEG} source localization
under multiple constraints: Application to face-evoked fields},
journal = {NeuroImage},
volume = {38},
number = {3},
pages = {422--438},
year = {2007}
}
@article{DBLP:journals/sigpro/SinghVN07,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore},
title = {Improving verification accuracy by synthesis of locally enhanced biometric
images and deformable model},
journal = {Signal Process.},
volume = {87},
number = {11},
pages = {2746--2764},
year = {2007}
}
@article{DBLP:journals/tsmc/SinghVRN07,
author = {Richa Singh and
Mayank Vatsa and
Arun Ross and
Afzel Noore},
title = {A Mosaicing Scheme for Pose-Invariant Face Recognition},
journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
volume = {37},
number = {5},
pages = {1212--1225},
year = {2007}
}
@inproceedings{DBLP:conf/aiprf/LabyedKSS07,
author = {Yassin Labyed and
Naima Kaabouch and
Richard R. Schultz and
Brij B. Singh},
title = {Gel Electrophoresis Image Segmentation and Band Detection Based on
the Derivative of the Standard Deviation},
booktitle = {Artificial Intelligence and Pattern Recognition},
pages = {31--35},
publisher = {{ISRST}},
year = {2007}
}
@inproceedings{DBLP:conf/amcis/DAubeterreSIE07,
author = {Fergle D'Aubeterre and
Rahul Singh and
Lakshmi S. Iyer and
Richard Ehrhardt},
title = {Secure Integration of eBusiness Processes in the Extended-Enterprise},
booktitle = {{AMCIS}},
pages = {331},
publisher = {Association for Information Systems},
year = {2007}
}
@inproceedings{DBLP:conf/ieeevast/JanoosSIMP07,
author = {Firdaus Janoos and
Shantanu Singh and
M. Okan Irfanoglu and
Raghu Machiraju and
Richard E. Parent},
title = {Activity Analysis Using Spatio-Temporal Trajectory Volumes in Surveillance
Applications},
booktitle = {{IEEE} {VAST}},
pages = {3--10},
publisher = {{IEEE} Computer Society},
year = {2007}
}
@inproceedings{DBLP:conf/igarss/RaupKAHD07,
author = {Bruce H. Raup and
Siri Jodha S. Khalsa and
Richard Armstrong and
Christopher Helm and
Mark B. Dyurgerov},
title = {{GLIMS:} Progress in mapping the world's glaciers},
booktitle = {{IGARSS}},
pages = {3991--3993},
publisher = {{IEEE}},
year = {2007}
}
@inproceedings{DBLP:conf/ipsn/SinghMKSC07,
author = {Jaspreet Singh and
Upamanyu Madhow and
Rajesh Kumar and
Subhash Suri and
Richard E. Cagley},
title = {Tracking multiple targets using binary proximity sensors},
booktitle = {{IPSN}},
pages = {529--538},
publisher = {{ACM}},
year = {2007}
}
@inproceedings{DBLP:conf/premi/SinghVNS07,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore and
Sanjay K. Singh},
title = {Age Transformation for Improving Face Recognition Performance},
booktitle = {PReMI},
series = {Lecture Notes in Computer Science},
volume = {4815},
pages = {576--583},
publisher = {Springer},
year = {2007}
}
@article{DBLP:journals/aim/AchtnerAA06,
author = {Wolfgang Achtner and
Esma A{\"{\i}}meur and
Sarabjot Singh Anand and
Douglas E. Appelt and
Naveen Ashish and
Tiffany Barnes and
Joseph E. Beck and
M. Bernardine Dias and
Prashant Doshi and
Chris Drummond and
William Elazmeh and
Ariel Felner and
Dayne Freitag and
Hector Geffner and
Christopher W. Geib and
Richard Goodwin and
Robert C. Holte and
Frank Hutter and
Fair Isaac and
Nathalie Japkowicz and
Gal A. Kaminka and
Sven Koenig and
Michail G. Lagoudakis and
David B. Leake and
Lundy Lewis and
Hugo Liu and
Ted Metzler and
Rada Mihalcea and
Bamshad Mobasher and
Pascal Poupart and
David V. Pynadath and
Thomas Roth{-}Berghofer and
Wheeler Ruml and
Stefan Schulz and
Sven Schwarz and
Stephanie Seneff and
Amit P. Sheth and
Ron Sun and
Michael Thielscher and
Afzal Upal and
Jason D. Williams and
Steve J. Young and
Dmitry Zelenko},
title = {Reports on the Twenty-First National Conference on Artificial Intelligence
{(AAAI-06)} Workshop Program},
journal = {{AI} Mag.},
volume = {27},
number = {4},
pages = {92--102},
year = {2006}
}
@article{DBLP:journals/comcom/WuWD06,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
title = {{E-MACSC:} {A} novel dynamic cache tuning technique to reduce information
retrieval roundtrip time over the Internet},
journal = {Comput. Commun.},
volume = {29},
number = {8},
pages = {1094--1109},
year = {2006}
}
@article{DBLP:journals/ieiceee/SinghVNS06,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore and
Sanjay K. Singh},
title = {{DS} theory based fingerprint classifier fusion with update rule to
minimize training time},
journal = {{IEICE} Electron. Express},
volume = {3},
number = {20},
pages = {429--435},
year = {2006}
}
@article{DBLP:journals/ieiceee/VatsaSNHM06,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore and
Max M. Houck and
Keith B. Morris},
title = {Robust biometric image watermarking for fingerprint and face template
protection},
journal = {{IEICE} Electron. Express},
volume = {3},
number = {2},
pages = {23--28},
year = {2006}
}
@article{DBLP:journals/sp/PahwaJWBGFSHSBYCCBSWB06,
author = {Jaspreet Singh Pahwa and
Andrew C. Jones and
Richard J. White and
Mikhaila Burgess and
W. A. Gray and
Nick J. Fiddian and
R. O. Smith and
Alex R. Hardisty and
Tim Sutton and
Peter Brewer and
Chris Yesson and
Neil Caithness and
Alastair Culham and
Frank A. Bisby and
Malcolm Scoble and
Paul Williams and
Shonil Bhagwat},
title = {Supporting the construction of workflows for biodiversity problem-solving
accessing secure, distributed resources},
journal = {Sci. Program.},
volume = {14},
number = {3-4},
pages = {195--208},
year = {2006}
}
@article{DBLP:journals/tjs/WuWD06,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
title = {CACHE\({}_{\mbox{RP}}\): {A} novel dynamic cache size tuning model
working with relative object popularity for fast web information retrieval},
journal = {J. Supercomput.},
volume = {36},
number = {3},
pages = {283--296},
year = {2006}
}
@inproceedings{DBLP:conf/ccgrid/CromptonMGJWP06,
author = {Shirley Y. Crompton and
B. M. Matthews and
W. A. Gray and
Andrew C. Jones and
Richard J. White and
Jaspreet Singh Pahwa},
title = {{OGSA-DAI} and Bioinformatics Grids: Challenges, Experience and Strategies},
booktitle = {{CCGRID}},
pages = {193--200},
publisher = {{IEEE} Computer Society},
year = {2006}
}
@inproceedings{DBLP:conf/ccgrid/PahwaBSYBXJWGFBCCSWB06,
author = {Jaspreet Singh Pahwa and
Peter Brewer and
Tim Sutton and
Chris Yesson and
Mikhaila Burgess and
Xuebiao Xu and
Andrew C. Jones and
Richard J. White and
W. A. Gray and
Nick J. Fiddian and
Frank A. Bisby and
Alastair Culham and
Neil Caithness and
Malcolm Scoble and
Paul Williams and
Shonil Bhagwat},
title = {Biodiversity World: {A} Problem-Solving Environment for Analysing
Biodiversity Patterns},
booktitle = {{CCGRID}},
pages = {201--208},
publisher = {{IEEE} Computer Society},
year = {2006}
}
@inproceedings{DBLP:conf/dexa/PahwaBGM06,
author = {Jaspreet Singh Pahwa and
Pete Burnap and
W. A. Gray and
John C. Miles},
title = {{MDSSF} - {A} Federated Architecture for Product Procurement},
booktitle = {{DEXA}},
series = {Lecture Notes in Computer Science},
volume = {4080},
pages = {812--821},
publisher = {Springer},
year = {2006}
}
@inproceedings{DBLP:conf/ercimdl/SinghFUADM06,
author = {Manas Singh and
Richard Furuta and
Eduardo Urbina and
Neal Audenaert and
Jie Deng and
Carlos Monroy},
title = {Expanding a Humanities Digital Library: Musical References in Cervantes'
Works},
booktitle = {{ECDL}},
series = {Lecture Notes in Computer Science},
volume = {4172},
pages = {158--169},
publisher = {Springer},
year = {2006}
}
@inproceedings{DBLP:conf/icip/SinghTBRM06,
author = {Meghna Singh and
Richard Thompson and
Anup Basu and
Jana Rieger and
Mrinal Mandal},
title = {Image Based Temporal Registration of {MRI} Data for Medical Visualization},
booktitle = {{ICIP}},
pages = {1169--1172},
publisher = {{IEEE}},
year = {2006}
}
@inproceedings{DBLP:conf/icis/SinghRY06,
author = {Rahul Singh and
Richard T. Redmond and
Victoria Y. Yoon},
title = {Design Artifact to Support Knowledge-Driven Predictive and Explanatory
Decision Analytics},
booktitle = {{ICIS}},
pages = {9},
publisher = {Association for Information Systems},
year = {2006}
}
@inproceedings{DBLP:conf/icvgip/SinghVNS06,
author = {Richa Singh and
Mayank Vatsa and
Afzel Noore and
Sanjay K. Singh},
title = {Dempster-Shafer Theory Based Classifier Fusion for Improved Fingerprint
Verification Performance},
booktitle = {{ICVGIP}},
series = {Lecture Notes in Computer Science},
volume = {4338},
pages = {941--949},
publisher = {Springer},
year = {2006}
}
@inproceedings{DBLP:conf/islped/DeogunSSBN06,
author = {Harmander Deogun and
Robert M. Senger and
Dennis Sylvester and
Richard B. Brown and
Kevin J. Nowka},
title = {A dual-V\({}_{\mbox{DD}}\) boosted pulsed bus technique for low power
and low leakage operation},
booktitle = {{ISLPED}},
pages = {73--78},
publisher = {{ACM}},
year = {2006}
}
@inproceedings{DBLP:conf/mobiquitous/CoenenGJBBGHDLL06,
author = {T. J. M. Coenen and
P. T. H. Goering and
Assed Jehangir and
J. L. van den Berg and
Richard J. Boucherie and
Sonia M. Heemstra de Groot and
Geert J. Heijenk and
Santpal Singh Dhillon and
Weidong Lu and
Anthony C. C. Lo and
Piet Van Mieghem and
Ignas G. Niemegeers},
title = {Architectural and QoS Aspects of Personal Networks},
booktitle = {MobiQuitous},
pages = {1--3},
publisher = {{IEEE} Computer Society},
year = {2006}
}
@incollection{DBLP:books/daglib/p/WuWD06,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
title = {{E-MACSC:} {A} novel dynamic cache tuning technique to maintain the
hit ratio prescribed by the user in internet applications},
booktitle = {e-Business and Telecommunication Networks},
pages = {74--81},
publisher = {Springer},
year = {2006}
}
@article{DBLP:journals/cacm/ThomasRYS05,
author = {Manoj A. Thomas and
Richard T. Redmond and
Victoria Y. Yoon and
Rahul Singh},
title = {A semantic approach to monitor business process},
journal = {Commun. {ACM}},
volume = {48},
number = {12},
pages = {55--59},
year = {2005}
}
@article{DBLP:journals/ieiceee/VatsaSN05,
author = {Mayank Vatsa and
Richa Singh and
Afzel Noore},
title = {Improving biometric recognition accuracy and robustness using {DWT}
and {SVM} watermarking},
journal = {{IEICE} Electron. Express},
volume = {2},
number = {12},
pages = {362--367},
year = {2005}
}
@article{DBLP:journals/tamm/SinghS05,
author = {Manoj Prakash Singh and
Richard Stong},
title = {A Prime Summandification of n: 11045},
journal = {Am. Math. Mon.},
volume = {112},
number = {8},
pages = {750--751},
year = {2005}
}
@inproceedings{DBLP:conf/amcc/ShieldsBLSLASKA05,
author = {Joel Shields and
Richard Bailey and
Brent Lytle and
Jeff Schroeder and
Boris Lurie and
Ahmet Beh{\c{c}}et A{\c{c}}ikmese and
Guru Singh and
Jason Keim and
Asif Ahmed},
title = {System design, modelling, and tracking filter for bearings only analog
camera},
booktitle = {{ACC}},
pages = {1981--1986},
publisher = {{IEEE}},
year = {2005}
}
@inproceedings{DBLP:conf/autoid/SinghVRN05,
author = {Richa Singh and
Mayank Vatsa and
Arun Ross and
Afzel Noore},
title = {Performance Enhancement of 2D Face Recognition via Mosaicing},
booktitle = {AutoID},
pages = {63--68},
publisher = {{IEEE} Computer Society},
year = {2005}
}
@inproceedings{DBLP:conf/icete/LinWWD05,
author = {Wilfred W. K. Lin and
Allan K. Y. Wong and
Richard S. L. Wu and
Tharam S. Dillon},
title = {A Novel real-time self-similar traffic detector/filter to improve
the reliability of a {TCP} based end-to-end client/server interaction
path for shorter roundtrip time},
booktitle = {{ICETE}},
pages = {94--101},
publisher = {{INSTICC} Press},
year = {2005}
}
@inproceedings{DBLP:conf/icete/LinWWD05a,
author = {Wilfred W. K. Lin and
Allan K. Y. Wong and
Richard S. L. Wu and
Tharam S. Dillon},
title = {A Novel Real-Time Self-similar Traffic Detector/Filter to Improve
the Reliability of a {TCP} Based End-to-End Client/Server Interaction
Path for Shorter Roundtrip Time},
booktitle = {{ICETE} (Selected Papers)},
series = {Communications in Computer and Information Science},
volume = {3},
pages = {49--61},
year = {2005}
}
@inproceedings{DBLP:conf/icita/WuWD05,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
title = {Using Real-Time Traffic Pattern Detection for Dynamic Cache Size Tuning
in Information Retrieval},
booktitle = {{ICITA} {(2)}},
pages = {35--40},
publisher = {{IEEE} Computer Society},
year = {2005}
}
@inproceedings{DBLP:conf/icmb/WuDW05,
author = {Richard S. L. Wu and
Tharam S. Dillon and
Allan K. Y. Wong},
title = {{RTPD/MACSC:} {A} Novel Approach for Effective Pervasive Information
Retrieval},
booktitle = {{ICMB}},
pages = {514--520},
publisher = {{IEEE} Computer Society},
year = {2005}
}
@inproceedings{DBLP:conf/isqed/DeogunRSBN05,
author = {Harmander Deogun and
Rahul M. Rao and
Dennis Sylvester and
Richard B. Brown and
Kevin J. Nowka},
title = {Dynamically Pulsed {MTCMOS} with Bus Encoding for Total Power and
Crosstalk Minimization},
booktitle = {{ISQED}},
pages = {88--93},
publisher = {{IEEE} Computer Society},
year = {2005}
}
@inproceedings{DBLP:conf/nips/PrecupSPKS05,
author = {Doina Precup and
Richard S. Sutton and
Cosmin Paduraru and
Anna Koop and
Satinder Singh},
title = {Off-policy Learning with Options and Recognizers},
booktitle = {{NIPS}},
pages = {1097--1104},
year = {2005}
}
@inproceedings{DBLP:conf/robio/KwanLLDRRSS05,
author = {Chiman Kwan and
Xiaokun Li and
Debang Lao and
Yunbin Deng and
Zhubing Ren and
Bhiksha Raj and
Rita Singh and
Richard M. Stern},
title = {Voice driven applications in non-stationary and chaotic environment},
booktitle = {{ROBIO}},
pages = {127--132},
publisher = {{IEEE}},
year = {2005}
}
@incollection{DBLP:books/idea/encyclopediaDB2005/VatsaSGK05,
author = {Mayank Vatsa and
Richa Singh and
Phalguni Gupta and
A. K. Kaushik},
title = {Biometric Databases},
booktitle = {Encyclopedia of Database Technologies and Applications},
pages = {42--46},
publisher = {Idea Group},
year = {2005}
}
@article{DBLP:journals/csse/WuWD04,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
title = {{RDCT:} {A} novel reconfigurable dynamic cache size tuner to shorten
information retrieval time over the Internet},
journal = {Comput. Syst. Sci. Eng.},
volume = {19},
number = {6},
year = {2004}
}
@inproceedings{DBLP:conf/hpdc/FosterGG04,
author = {Ian T. Foster and
Jerry Gieraltowski and
Scott Gose and
Natalia Maltsev and
Edward N. May and
Alex A. Rodriguez and
Dinanath Sulakhe and
A. Vaniachine and
Jim Shank and
Saul Youssef and
David Adams and
Richard Baker and
Wensheng Deng and
Jason Smith and
Dantong Yu and
Iosif Legrand and
Suresh Singh and
Conrad Steenberg and
Yang Xia and
M. Anzar Afaq and
Eileen Berman and
James Annis and
L. A. T. Bauerdick and
Michael Ernst and
Ian Fisk and
Lisa Giacchetti and
Gregory E. Graham and
Anne Heavey and
Joseph Kaiser and
Nickolai Kuropatkin and
Ruth Pordes and
Vijay Sekhri and
John Weigand and
Yujun Wu and
Keith Baker and
Lawrence Sorrillo and
John Huth and
Matthew Allen and
Leigh Grundhoefer and
John Hicks and
Fred Luehring and
Steve Peck and
Robert Quick and
Stephen C. Simms and
George Fekete and
Jan vandenBerg and
Kihyeon Cho and
Kihwan Kwon and
Dongchul Son and
Hyoungwoo Park and
Shane Canon and
Keith R. Jackson and
David E. Konerding and
Jason Lee and
Doug Olson and
Iwona Sakrejda and
Brian Tierney and
Mark Green and
Russ Miller and
James Letts and
Terrence Martin and
David Bury and
Catalin Dumitrescu and
Daniel Engh and
Robert W. Gardner and
Marco Mambelli and
Yuri Smirnov and
Jens{-}S. V{\"{o}}ckler and
Michael Wilde and
Yong Zhao and
Xin Zhao and
Paul Avery and
Richard Cavanaugh and
Bockjoo Kim and
Craig Prescott and
Jorge Luis Rodriguez and
Andrew Zahn and
Shawn McKee and
Christopher T. Jordan and
James E. Prewett and
Timothy L. Thomas and
Horst Severini and
Ben Clifford and
Ewa Deelman and
Larry Flon and
Carl Kesselman and
Gaurang Mehta and
Nosa Olomu and
Karan Vahi and
Kaushik De and
Patrick McGuigan and
Mark Sosebee and
Dan Bradley and
Peter Couvares and
Alan DeSmet and
Carey Kireyev and
Erik Paulson and
Alain Roy and
Scott Koranda and
Brian Moe and
Bobby Brown and
Paul Sheldon},
title = {The Grid2003 Production Grid: Principles and Practice},
booktitle = {{HPDC}},
pages = {236--245},
publisher = {{IEEE} Computer Society},
year = {2004}
}
@inproceedings{DBLP:conf/icassp/RajSS04,
author = {Bhiksha Raj and
Rita Singh and
Richard M. Stern},
title = {On tracking noise with linear dynamical system models},
booktitle = {{ICASSP} {(1)}},
pages = {965--968},
publisher = {{IEEE}},
year = {2004}
}
@inproceedings{DBLP:conf/icba/MeenaVSG04,
author = {Bhola Ram Meena and
Mayank Vatsa and
Richa Singh and
Phalguni Gupta},
title = {Iris Based Human Verification Algorithms},
booktitle = {{ICBA}},
series = {Lecture Notes in Computer Science},
volume = {3072},
pages = {458--466},
publisher = {Springer},
year = {2004}
}
@inproceedings{DBLP:conf/icete/WuWD04,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
title = {{E-MACSC:} {A} Novel Dynamic Cache Tuning Technique to Maintain the
Hit Ratio Prescribed by the User in Internet Applications},
booktitle = {{ICETE} {(1)}},
pages = {152--159},
publisher = {{INSTICC} Press},
year = {2004}
}
@inproceedings{DBLP:conf/iconip/VatsaSMN04,
author = {Mayank Vatsa and
Richa Singh and
Pabitra Mitra and
Afzel Noore},
title = {Signature Verification Using Static and Dynamic Features},
booktitle = {{ICONIP}},
series = {Lecture Notes in Computer Science},
volume = {3316},
pages = {350--355},
publisher = {Springer},
year = {2004}
}
@inproceedings{DBLP:conf/icvgip/VatsaSG04,
author = {Mayank Vatsa and
Richa Singh and
Phalguni Gupta},
title = {Multi Biometric System for Verification with Minimum Training Data},
booktitle = {{ICVGIP}},
pages = {569--574},
publisher = {Allied Publishers Private Limited},
year = {2004}
}
@inproceedings{DBLP:conf/ifip5-5/JoitaRBPGM04,
author = {Liviu Joita and
Omer F. Rana and
Pete Burnap and
Jaspreet Singh Pahwa and
W. A. Gray and
John C. Miles},
title = {A Grid-Enabled Security Framework for Collaborative Virtual Organisations},
booktitle = {Virtual Enterprises and Collaborative Networks},
series = {{IFIP}},
volume = {149},
pages = {415--422},
publisher = {Kluwer/springer},
year = {2004}
}
@inproceedings{DBLP:conf/ispa/WuWD04,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
title = {CACHE\({}_{\mbox{RP}}\): {A} Novel Dynamic Cache Size Tuning Model
Working with Relative Object Popularity for Fast Web Information Retrieval},
booktitle = {{ISPA}},
series = {Lecture Notes in Computer Science},
volume = {3358},
pages = {410--420},
publisher = {Springer},
year = {2004}
}
@inproceedings{DBLP:conf/smc/VatsaSG04,
author = {Mayank Vatsa and
Richa Singh and
Phalguni Gupta},
title = {Face recognition using multiple recognizers},
booktitle = {{SMC} {(3)}},
pages = {2186--2190},
publisher = {{IEEE}},
year = {2004}
}
@inproceedings{DBLP:conf/smc/VatsaSMN04,
author = {Mayank Vatsa and
Richa Singh and
Pabitra Mitra and
Afzel Noore},
title = {Digital watermarking based secure multimodal biometric system},
booktitle = {{SMC} {(3)}},
pages = {2983--2987},
publisher = {{IEEE}},
year = {2004}
}
@article{DBLP:journals/jcisd/SinghHF03,
author = {Suresh B. Singh and
Richard D. Hull and
Eugene M. Fluder},
title = {Text Influenced Molecular Indexing {(TIMI):} {A} Literature Database
Mining Approach that Handles Text and Chemistry},
journal = {J. Chem. Inf. Comput. Sci.},
volume = {43},
number = {3},
pages = {743--752},
year = {2003}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003}
}
@article{DBLP:journals/tec/FieldsendES03,
author = {Jonathan E. Fieldsend and
Richard M. Everson and
Sameer Singh},
title = {Using unconstrained elite archives for multiobjective optimization},
journal = {{IEEE} Trans. Evol. Comput.},
volume = {7},
number = {3},
pages = {305--323},
year = {2003}
}
@article{DBLP:journals/corr/cs-DC-0305066,
author = {Gregory E. Graham and
M. Anzar Afaq and
Shafqat Aziz and
L. A. T. Bauerdick and
Michael Ernst and
Joseph Kaiser and
Natalia Ratnikova and
Hans Wenzel and
Yujun Wu and
Eric Aslakson and
Julian J. Bunn and
Saima Iqbal and
Iosif Legrand and
Harvey B. Newman and
Suresh Singh and
Conrad Steenberg and
James Branson and
Ian Fisk and
James Letts and
Adam Arbree and
Paul Avery and
Dimitri Bourilkov and
Richard Cavanaugh and
Jorge Rodriguez and
Suchindra Kategari and
Peter Couvares and
Alan DeSmet and
Miron Livny and
Alain Roy and
Todd Tannenbaum},
title = {The {CMS} Integration Grid Testbed},
journal = {CoRR},
volume = {cs.DC/0305066},
year = {2003}
}
@article{DBLP:journals/dss/SinghWW02,
author = {Sanjay K. Singh and
Hugh J. Watson and
Richard T. Watson},
title = {{EIS} support for the strategic management process},
journal = {Decis. Support Syst.},
volume = {33},
number = {1},
pages = {71--85},
year = {2002}
}
@article{DBLP:journals/jcisd/WalkerHS02,
author = {Matthew J. Walker and
Richard D. Hull and
Suresh B. Singh},
title = {{CKB} - The Compound Knowledge Base: {A} Text Based Chemical Search
System},
journal = {J. Chem. Inf. Comput. Sci.},
volume = {42},
number = {5},
pages = {1293--1295},
year = {2002}
}
@article{DBLP:journals/jds/SinghYR02,
author = {Rahul Singh and
Victoria Y. Yoon and
Richard T. Redmond},
title = {Integrating Data Mining and On-line Analytical Processing for Intelligent
Decision Systems},
journal = {J. Decis. Syst.},
volume = {11},
number = {2},
pages = {185--204},
year = {2002}
}
@article{DBLP:journals/taslp/SinghRS02,
author = {Rita Singh and
Bhiksha Raj and
Richard M. Stern},
title = {Automatic generation of subword units for speech recognition systems},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {10},
number = {2},
pages = {89--99},
year = {2002}
}
@inproceedings{DBLP:conf/ISCAicis/SinghVSC02,
author = {Sanjay K. Singh and
Mayank Vatsa and
Richa Singh and
D. S. Chauhan},
title = {A Comparison of Face Recognition Algorithms (Feature Based, Eigen
Based, Neural Network Based Approaches)},
booktitle = {{IS}},
pages = {227},
publisher = {{ISCA}},
year = {2002}
}
@inproceedings{DBLP:conf/cluster/AlmasiAB02,
author = {George S. Alm{\'{a}}si and
Daniel K. Beece and
Ralph Bellofatto and
Gyan Bhanot and
Randy Bickford and
Matthias A. Blumrich and
Arthur A. Bright and
Jos{\'{e}} R. Brunheroto and
Calin Cascaval and
Jos{\'{e}} G. Casta{\~{n}}os and
Luis Ceze and
Paul Coteus and
Siddhartha Chatterjee and
Dong Chen and
George L.{-}T. Chiu and
Thomas M. Cipolla and
Paul Crumley and
Alina Deutsch and
Marc Boris Dombrowa and
Wilm E. Donath and
Maria Eleftheriou and
Blake G. Fitch and
Joseph Gagliano and
Alan Gara and
Robert S. Germain and
Mark Giampapa and
Manish Gupta and
Fred G. Gustavson and
Shawn Hall and
Ruud A. Haring and
David F. Heidel and
Philip Heidelberger and
Lorraine Herger and
Dirk Hoenicke and
T. Jamal{-}Eddine and
Gerard V. Kopcsay and
Alphonso P. Lanzetta and
Derek Lieber and
M. Lu and
Mark P. Mendell and
Lawrence S. Mok and
Jos{\'{e}} E. Moreira and
Ben J. Nathanson and
Matthew Newton and
Martin Ohmacht and
Rick A. Rand and
Richard D. Regan and
Ramendra K. Sahoo and
Alda Sanomiya and
Eugen Schenfeld and
Sarabjeet Singh and
Peilin Song and
Burkhard D. Steinmacher{-}Burow and
Karin Strauss and
Richard A. Swetz and
Todd Takken and
R. Brett Tremaine and
Mickey Tsao and
Pavlos Vranas and
T. J. Christopher Ward and
Michael E. Wazlowski and
J. Brown and
Thomas A. Liebsch and
A. Schram and
G. Ulsh},
title = {Blue Gene/L, a System-On-A-Chip},
booktitle = {{CLUSTER}},
pages = {349},
publisher = {{IEEE} Computer Society},
year = {2002}
}
@inproceedings{DBLP:conf/dac/LiuSRC02,
author = {Hongzhou Liu and
Amith Singhee and
Rob A. Rutenbar and
L. Richard Carley},
title = {Remembrance of circuits past: macromodeling by data mining in large
analog design spaces},
booktitle = {{DAC}},
pages = {437--442},
publisher = {{ACM}},
year = {2002}
}
@inproceedings{DBLP:conf/interspeech/LiSS02,
author = {Xiang Li and
Rita Singh and
Richard M. Stern},
title = {Combining search spaces of heterogeneous recognizers for improved
speech recogniton},
booktitle = {{INTERSPEECH}},
pages = {405--408},
publisher = {{ISCA}},
year = {2002}
}
@inproceedings{DBLP:conf/jcis/SinghVSL02,
author = {Sanjay K. Singh and
Mayank Vatsa and
Richa Singh and
R. B. Lokesh},
title = {Image Database for Automatic Face Recognition},
booktitle = {{JCIS}},
pages = {704--707},
publisher = {{JCIS} / Association for Intelligent Machinery, Inc.},
year = {2002}
}
@inproceedings{DBLP:conf/lcn/AllardGSR02,
author = {J{\'{e}}r{\'{e}}mie Allard and
Paul Gonin and
Minoo Singh and
Golden G. Richard III},
title = {A User Level Framework for Ad Hoc Routing},
booktitle = {{LCN}},
pages = {13--19},
publisher = {{IEEE} Computer Society},
year = {2002}
}
@inproceedings{DBLP:conf/pdpta/WuWD02,
author = {Richard S. L. Wu and
Allan K. Y. Wong and
Tharam S. Dillon},
title = {Comparing Four Novel Scalable Split/Aggregate Algorithms (Mobile Agent
Based) for Distributes Mining of Multimedia Association Rules over
the Internet},
booktitle = {{PDPTA}},
pages = {760--766},
publisher = {{CSREA} Press},
year = {2002}
}
@inproceedings{DBLP:conf/sc/AdigaAA02,
author = {Narasimha R. Adiga and
George Alm{\'{a}}si and
George S. Alm{\'{a}}si and
Yariv Aridor and
Rajkishore Barik and
Daniel K. Beece and
Ralph Bellofatto and
Gyan Bhanot and
Randy Bickford and
Matthias A. Blumrich and
Arthur A. Bright and
Jos{\'{e}} R. Brunheroto and
Calin Cascaval and
Jos{\'{e}} G. Casta{\~{n}}os and
Waiman Chan and
Luis Ceze and
Paul Coteus and
Siddhartha Chatterjee and
Dong Chen and
George L.{-}T. Chiu and
Thomas M. Cipolla and
Paul Crumley and
K. M. Desai and
Alina Deutsch and
Tamar Domany and
Marc Boris Dombrowa and
Wilm E. Donath and
Maria Eleftheriou and
C. Christopher Erway and
J. Esch and
Blake G. Fitch and
Joseph Gagliano and
Alan Gara and
Rahul Garg and
Robert S. Germain and
Mark Giampapa and
Balaji Gopalsamy and
John A. Gunnels and
Manish Gupta and
Fred G. Gustavson and
Shawn Hall and
Ruud A. Haring and
David F. Heidel and
Philip Heidelberger and
Lorraine Herger and
Dirk Hoenicke and
R. D. Jackson and
T. Jamal{-}Eddine and
Gerard V. Kopcsay and
Elie Krevat and
Manish P. Kurhekar and
Alphonso P. Lanzetta and
Derek Lieber and
L. K. Liu and
M. Lu and
Mark P. Mendell and
A. Misra and
Yosef Moatti and
Lawrence S. Mok and
Jos{\'{e}} E. Moreira and
Ben J. Nathanson and
Matthew Newton and
Martin Ohmacht and
Adam J. Oliner and
Vinayaka Pandit and
R. B. Pudota and
Rick A. Rand and
Richard D. Regan and
Bradley Rubin and
Albert E. Ruehli and
Silvius Vasile Rus and
Ramendra K. Sahoo and
Alda Sanomiya and
Eugen Schenfeld and
M. Sharma and
Edi Shmueli and
Sarabjeet Singh and
Peilin Song and
Vijay Srinivasan and
Burkhard D. Steinmacher{-}Burow and
Karin Strauss and
Christopher W. Surovic and
Richard A. Swetz and
Todd Takken and
R. Brett Tremaine and
Mickey Tsao and
Arun R. Umamaheshwaran and
P. Verma and
Pavlos Vranas and
T. J. Christopher Ward and
Michael E. Wazlowski and
W. Barrett and
C. Engel and
B. Drehmel and
B. Hilgart and
D. Hill and
F. Kasemkhani and
David J. Krolak and
Chun{-}Tao Li and
Thomas A. Liebsch and
James A. Marcella and
A. Muff and
A. Okomo and
M. Rouse and
A. Schram and
M. Tubbs and
G. Ulsh and
Charles D. Wait and
J. Wittrup and
Myung Bae and
Kenneth A. Dockser and
Lynn Kissel and
Mark K. Seager and
Jeffrey S. Vetter and
K. Yates},
title = {An overview of the BlueGene/L Supercomputer},
booktitle = {{SC}},
pages = {7:1--7:22},
publisher = {{IEEE} Computer Society},
year = {2002}
}
@inproceedings{DBLP:conf/smc/SinghVSC02,
author = {Sanjay K. Singh and
Mayank Vatsa and
Richa Singh and
D. S. Chauhan},
title = {A comparison of face recognition algorithms neural network based {\&}
line based approaches},
booktitle = {{SMC}},
pages = {6},
publisher = {{IEEE}},
year = {2002}
}
@article{DBLP:journals/arobots/SinghVLP01,
author = {Rahul Singh and
Richard M. Voyles and
David Littau and
Nikolaos Papanikolopoulos},
title = {Shape Morphing-Based Control of Robotic Visual Servoing},
journal = {Auton. Robots},
volume = {10},
number = {3},
pages = {317--338},
year = {2001}
}
@article{DBLP:journals/cera/RiedelPB01,
author = {Johann c. k. h. Riedel and
Kulwant Singh Pawar and
Richard J. Barson},
title = {Academic and Industrial User Needs for a Concurrent Engineering Computer
Simulation Game},
journal = {Concurr. Eng. Res. Appl.},
volume = {9},
number = {3},
pages = {223--237},
year = {2001}
}
@article{DBLP:journals/ibmsj/AllenAA01,
author = {Frances E. Allen and
George S. Alm{\'{a}}si and
Wanda Andreoni and
Daniel K. Beece and
Bruce J. Berne and
Arthur A. Bright and
Jos{\'{e}} R. Brunheroto and
Calin Cascaval and
Jos{\'{e}} G. Casta{\~{n}}os and
Paul Coteus and
Paul Crumley and
Alessandro Curioni and
Monty Denneau and
Wilm E. Donath and
Maria Eleftheriou and
Blake G. Fitch and
Bruce M. Fleischer and
Christos J. Georgiou and
Robert S. Germain and
Mark Giampapa and
Donna L. Gresh and
Manish Gupta and
Ruud A. Haring and
C. T. Howard Ho and
Peter H. Hochschild and
Susan Flynn Hummel and
Tiziana Jonas and
Derek Lieber and
Glenn J. Martyna and
Kiran K. Maturu and
Jos{\'{e}} E. Moreira and
Dennis M. Newns and
Matthew Newton and
Robert Philhower and
Thomas Picunko and
Jed W. Pitera and
Michael Pitman and
Rick A. Rand and
Ajay K. Royyuru and
Valentina Salapura and
Alda Sanomiya and
Rahul S. Shah and
Yuk Yin Sham and
Sarabjeet Singh and
Marc Snir and
Frank Suits and
Richard A. Swetz and
William C. Swope and
Nagesh K. Vishnumurthy and
T. J. Christopher Ward and
Henry S. Warren Jr. and
Ruhong Zhou},
title = {Blue Gene: {A} vision for protein science using a petaflop supercomputer},
journal = {{IBM} Syst. J.},
volume = {40},
number = {2},
pages = {310--327},
year = {2001}
}
@article{DBLP:journals/iepol/Joseph01,
author = {Richard Joseph},
title = {{J.P.} Singh, Leapfrogging Development?: The Political Economy of
Telecommunications Restructuring, State University of New York Press,
Albany, New York, USA, 1999, {ISBN} 0-7914-4294-2, xxiv+300 pp},
journal = {Inf. Econ. Policy},
volume = {13},
number = {1},
pages = {113--116},
year = {2001}
}
@article{DBLP:journals/tissec/FerraioloSGKC01,
author = {David F. Ferraiolo and
Ravi S. Sandhu and
Serban I. Gavrila and
D. Richard Kuhn and
Ramaswamy Chandramouli},
title = {Proposed {NIST} standard for role-based access control},
journal = {{ACM} Trans. Inf. Syst. Secur.},
volume = {4},
number = {3},
pages = {224--274},
year = {2001}
}
@article{DBLP:journals/vc/SinghP01,
author = {Karan Singh and
Richard E. Parent},
title = {Joining polyhedral objects using implicitly defined surfaces},
journal = {Vis. Comput.},
volume = {17},
number = {7},
pages = {415--428},
year = {2001}
}
@inproceedings{DBLP:conf/icassp/SinghSRS01,
author = {Rita Singh and
Michael L. Seltzer and
Bhiksha Raj and
Richard M. Stern},
title = {Speech in Noisy Environments: robust automatic segmentation, feature
extraction, and hypothesis combination},
booktitle = {{ICASSP}},
pages = {273--276},
publisher = {{IEEE}},
year = {2001}
}
@inproceedings{DBLP:conf/im/BronsteinDDFKMSC01,
author = {Alexandre Bronstein and
Joydip Das and
Marsha Duro and
Rich Friedrich and
Gary Kleyner and
Martin Mueller and
Sharad Singhal and
Ira Cohen},
title = {Self-Aware Services: Using Bayesian Networks for Detecting Anomalies
in Internet-Based Services},
booktitle = {Integrated Network Management},
pages = {623--638},
publisher = {{IEEE}},
year = {2001}
}
@inproceedings{DBLP:conf/nips/LittmanSS01,
author = {Michael L. Littman and
Richard S. Sutton and
Satinder Singh},
title = {Predictive Representations of State},
booktitle = {{NIPS}},
pages = {1555--1561},
publisher = {{MIT} Press},
year = {2001}
}
@inproceedings{DBLP:conf/sacmat/SandhuBJKL01,
author = {Ravi S. Sandhu and
Elisa Bertino and
Trent Jaeger and
D. Richard Kuhn and
Carl E. Landwehr},
title = {Panel: The next generation of acess control models (panel session):
do we need them and what should they be?},
booktitle = {{SACMAT}},
pages = {53},
publisher = {{ACM}},
year = {2001}
}
@article{DBLP:journals/kbs/HaqueBBP00,
author = {Badr U. Haque and
Roxana Belecheanu and
Richard J. Barson and
Kulwant Singh Pawar},
title = {Towards the application of case based reasoning to decision-making
in concurrent product development (concurrent engineering)},
journal = {Knowl. Based Syst.},
volume = {13},
number = {2-3},
pages = {101--112},
year = {2000}
}
@inproceedings{DBLP:conf/cicc/McPartlandLHSMK00,
author = {Richard J. McPartland and
D. J. Loeper and
Frank P. Higgins and
Raj Singh and
G. MacDonald and
Goh Komoriya and
S. Aymeloglu and
M. V. DePaolis and
C. W. Leung},
title = {{SRAM} embedded memory with low cost, flash EEPROM-switch-controlled
redundancy},
booktitle = {{CICC}},
pages = {287--289},
publisher = {{IEEE}},
year = {2000}
}
@inproceedings{DBLP:conf/icassp/SinghRS00,
author = {Rita Singh and
Bhiksha Raj and
Richard M. Stern},
title = {Automatic generation of phone sets and lexical transcriptions},
booktitle = {{ICASSP}},
pages = {1691--1694},
publisher = {{IEEE}},
year = {2000}
}
@inproceedings{DBLP:conf/icml/PrecupSS00,
author = {Doina Precup and
Richard S. Sutton and
Satinder Singh},
title = {Eligibility Traces for Off-Policy Policy Evaluation},
booktitle = {{ICML}},
pages = {759--766},
publisher = {Morgan Kaufmann},
year = {2000}
}
@inproceedings{DBLP:conf/interspeech/NedelSS00,
author = {Jon P. Nedel and
Rita Singh and
Richard M. Stern},
title = {Phone transition acoustic modeling: application to speaker independent
and spontaneous speech systems},
booktitle = {{INTERSPEECH}},
pages = {572--575},
publisher = {{ISCA}},
year = {2000}
}
@inproceedings{DBLP:conf/interspeech/NedelSS00a,
author = {Jon P. Nedel and
Rita Singh and
Richard M. Stern},
title = {Automatic subword unit refinement for spontaneous speech recognition
via phone splitting},
booktitle = {{INTERSPEECH}},
pages = {588--591},
publisher = {{ISCA}},
year = {2000}
}
@inproceedings{DBLP:conf/interspeech/SinghRS00,
author = {Rita Singh and
Bhiksha Raj and
Richard M. Stern},
title = {Structured redefinition of sound units by merging and splitting for
improved speech recognition},
booktitle = {{INTERSPEECH}},
pages = {151--154},
publisher = {{ISCA}},
year = {2000}
}
@inproceedings{DBLP:conf/rbac/SandhuFK00,
author = {Ravi S. Sandhu and
David F. Ferraiolo and
D. Richard Kuhn},
title = {The {NIST} model for role-based access control: towards a unified
standard},
booktitle = {{ACM} Workshop on Role-Based Access Control},
pages = {47--63},
publisher = {{ACM}},
year = {2000}
}
@inproceedings{DBLP:conf/robocup/StoneSS00,
author = {Peter Stone and
Richard S. Sutton and
Satinder Singh},
title = {Reinforcement Learning for 3 vs. 2 Keepaway},
booktitle = {RoboCup},
series = {Lecture Notes in Computer Science},
volume = {2019},
pages = {249--258},
publisher = {Springer},
year = {2000}
}
@article{DBLP:journals/ai/SuttonPS99,
author = {Richard S. Sutton and
Doina Precup and
Satinder Singh},
title = {Between MDPs and Semi-MDPs: {A} Framework for Temporal Abstraction
in Reinforcement Learning},
journal = {Artif. Intell.},
volume = {112},
number = {1-2},
pages = {181--211},
year = {1999}
}
@inproceedings{DBLP:conf/icassp/SinghRS99,
author = {Rita Singh and
Bhiksha Raj and
Richard M. Stern},
title = {Automatic clustering and generation of contextual questions for tied
states in hidden Markov models},
booktitle = {{ICASSP}},
pages = {117--120},
publisher = {{IEEE} Computer Society},
year = {1999}
}
@inproceedings{DBLP:conf/interspeech/SinghRS99,
author = {Rita Singh and
Bhiksha Raj and
Richard M. Stern},
title = {Domain adduced state tying for cross-domain acoustic modelling},
booktitle = {{EUROSPEECH}},
pages = {1707--1710},
publisher = {{ISCA}},
year = {1999}
}
@inproceedings{DBLP:conf/nips/SuttonMSM99,
author = {Richard S. Sutton and
David A. McAllester and
Satinder Singh and
Yishay Mansour},
title = {Policy Gradient Methods for Reinforcement Learning with Function Approximation},
booktitle = {{NIPS}},
pages = {1057--1063},
publisher = {The {MIT} Press},
year = {1999}
}
@inproceedings{DBLP:conf/ecml/PrecupSS98,
author = {Doina Precup and
Richard S. Sutton and
Satinder Singh},
title = {Theoretical Results on Reinforcement Learning with Temporally Abstract
Options},
booktitle = {{ECML}},
series = {Lecture Notes in Computer Science},
volume = {1398},
pages = {382--393},
publisher = {Springer},
year = {1998}
}
@inproceedings{DBLP:conf/icml/SuttonPS98,
author = {Richard S. Sutton and
Doina Precup and
Satinder Singh},
title = {Intra-Option Learning about Temporally Abstract Actions},
booktitle = {{ICML}},
pages = {556--564},
publisher = {Morgan Kaufmann},
year = {1998}
}
@inproceedings{DBLP:conf/interspeech/RajSS98,
author = {Bhiksha Raj and
Rita Singh and
Richard M. Stern},
title = {Inference of missing spectrographic features for robust speech recognition},
booktitle = {{ICSLP}},
publisher = {{ISCA}},
year = {1998}
}
@inproceedings{DBLP:conf/iros/SinghVLP98,
author = {Rahul Singh and
Richard M. Voyles and
David Littau and
Nikolaos P. Papanikolopoulos},
title = {Pose alignment of an eye-in-hand system using image morphing},
booktitle = {{IROS}},
pages = {698--704},
publisher = {{IEEE}},
year = {1998}
}
@inproceedings{DBLP:conf/nips/SuttonSPR98,
author = {Richard S. Sutton and
Satinder Singh and
Doina Precup and
Balaraman Ravindran},
title = {Improved Switching among Temporally Abstract Actions},
booktitle = {{NIPS}},
pages = {1066--1072},
publisher = {The {MIT} Press},
year = {1998}
}
@article{DBLP:journals/comcom/JirachiefpattanaCDL97,
author = {Ajin Jirachiefpattana and
Phil County and
Tharam S. Dillon and
Richard Lai},
title = {Performance evaluation of {PC} routers using a single-server multi-queue
system with a reflection technique},
journal = {Comput. Commun.},
volume = {20},
number = {1},
pages = {1--10},
year = {1997}
}
@article{DBLP:journals/ieeecc/RichardS97,
author = {Golden G. Richard III and
Mukesh Singhal},
title = {Using vector time to handle multiple failures in distributed systems},
journal = {{IEEE} Concurrency},
volume = {5},
number = {2},
pages = {50--59},
year = {1997}
}
@inproceedings{DBLP:conf/hpdc/SinghalNRNF97,
author = {Sandeep K. Singhal and
Binh Q. Nguyen and
Richard Redpath and
Jimmy Nguyen and
Michael Fraenkel},
title = {InVerse: Designing an Interactive Universe Architecture for Scalability
and Extensibility},
booktitle = {{HPDC}},
pages = {61--70},
publisher = {{IEEE} Computer Society},
year = {1997}
}
@inproceedings{DBLP:conf/oopsla/SinghalNFRN97,
author = {Sandeep K. Singhal and
Binh Q. Nguyen and
Michael Fraenkel and
Richard Redpath and
Jimmy Nguyen},
title = {Building high-performance applications and services in Java: an experiential
study},
booktitle = {{OOPSLA} Addendum},
pages = {16--20},
publisher = {{ACM}},
year = {1997}
}
@inproceedings{DBLP:conf/prs/RichardS97,
author = {Jim Richard and
Jaswinder Pal Singh},
title = {Parallel hierarchical computation of specular radiosity},
booktitle = {{PRS}},
pages = {59--69},
publisher = {{ACM}},
year = {1997}
}
@article{DBLP:journals/jcs/AmmannLS96,
author = {Paul Ammann and
Richard J. Lipton and
Ravi S. Sandhu},
title = {The Expressive Power of Multi-parent Creation in Monotonic Access
Control Models},
journal = {J. Comput. Secur.},
volume = {4},
number = {2/3},
pages = {149--166},
year = {1996}
}
@article{DBLP:journals/jssc/HughesMRBRBS96,
author = {John B. Hughes and
Kenneth W. Moulding and
Judith Richardson and
John Bennett and
William Redman{-}White and
Mark Bracey and
Randeep Singh Soin},
title = {Automated design of switched-current filters},
journal = {{IEEE} J. Solid State Circuits},
volume = {31},
number = {7},
pages = {898--907},
year = {1996}
}
@article{DBLP:journals/ml/SinghS96,
author = {Satinder P. Singh and
Richard S. Sutton},
title = {Reinforcement Learning with Replacing Eligibility Traces},
journal = {Mach. Learn.},
volume = {22},
number = {1-3},
pages = {123--158},
year = {1996}
}
@article{DBLP:journals/dss/WatsonWSH95,
author = {Hugh J. Watson and
Richard T. Watson and
Sanjay K. Singh and
David Holmes},
title = {Development practices for executive information systems: findings
of a field study},
journal = {Decis. Support Syst.},
volume = {14},
number = {2},
pages = {171--184},
year = {1995}
}
@inproceedings{DBLP:conf/dac/SinghalPRB95,
author = {Vigyan Singhal and
Carl Pixley and
Richard L. Rudell and
Robert K. Brayton},
title = {The Validity of Retiming Sequential Circuits},
booktitle = {{DAC}},
pages = {316--321},
publisher = {{ACM} Press},
year = {1995}
}
@inproceedings{DBLP:conf/vr/SinghOP95,
author = {Karansher Singh and
Jun Ohya and
Richard E. Parent},
title = {Human figure synthesis and animation for virtual space teleconferencing},
booktitle = {{VRAIS}},
pages = {118--126},
publisher = {{IEEE} Computer Society},
year = {1995}
}
@article{DBLP:journals/ml/SinghY94,
author = {Satinder P. Singh and
Richard C. Yee},
title = {An Upper Bound on the Loss from Approximate Optimal-Value Functions},
journal = {Mach. Learn.},
volume = {16},
number = {3},
pages = {227--233},
year = {1994}
}
@article{DBLP:journals/sigmod/PissinouSEMOPSTD94,
author = {Niki Pissinou and
Richard T. Snodgrass and
Ramez Elmasri and
Inderpal Singh Mumick and
M. Tamer {\"{O}}zsu and
Barbara Pernici and
Arie Segev and
Babis Theodoulidis and
Umeshwar Dayal},
title = {Towards an Infrastructure for Temporal Databases: Report of an Invitational
{ARPA/NSF} Workshop},
journal = {{SIGMOD} Rec.},
volume = {23},
number = {1},
pages = {35--51},
year = {1994}
}
@article{DBLP:journals/spe/AdelsteinRSPS94,
author = {Frank Adelstein and
Golden G. Richard III and
Loren Schwiebert and
Rick Parent and
Mukesh Singhal},
title = {A Distributed Graphics Library System},
journal = {Softw. Pract. Exp.},
volume = {24},
number = {4},
pages = {363--376},
year = {1994}
}
@inproceedings{DBLP:conf/asplos/HeinrichKOHBSSGNHGRH94,
author = {Mark A. Heinrich and
Jeffrey Kuskin and
David Ofelt and
John Heinlein and
Joel Baxter and
Jaswinder Pal Singh and
Richard Simoni and
Kourosh Gharachorloo and
David Nakahira and
Mark Horowitz and
Anoop Gupta and
Mendel Rosenblum and
John L. Hennessy},
title = {The Performance Impact of Flexibility in the Stanford {FLASH} Multiprocessor},
booktitle = {{ASPLOS}},
pages = {274--285},
publisher = {{ACM} Press},
year = {1994}
}
@inproceedings{DBLP:conf/vbc/HentschelEFFBLL94,
author = {Dietmar Hentschel and
Jay Ezrielev and
Richard Fisler and
Carolyn Flanders and
Ali R. Bani{-}Hashemi and
Cheng{-}Chung Liang and
Shih{-}Ping Liou and
Sumitro Samaddar and
Ajit Singh and
Derek R. Ney},
title = {Techniques for editing and visualizing CT-angiographic data},
booktitle = {{VBC}},
series = {{SPIE} Proceedings},
volume = {2359},
publisher = {{SPIE}},
year = {1994}
}
@inproceedings{DBLP:conf/icci/LiLD93,
author = {Xiaobo Li and
Richard Lai and
Tharam S. Dillon},
title = {A New Decomposition Method to Relieve the State Space Explosion Problem},
booktitle = {{ICCI}},
pages = {150--154},
publisher = {{IEEE} Computer Society},
year = {1993}
}
@inproceedings{DBLP:conf/srds/RichardS93,
author = {Golden G. Richard III and
Mukesh Singhal},
title = {Using Logging and Asynchronous Checkpointing to Implement Recoverable
Distributed Shared Memory},
booktitle = {{SRDS}},
pages = {58--67},
publisher = {{IEEE} Computer Society},
year = {1993}
}
@inproceedings{DBLP:conf/csfw/AmmannLS92,
author = {Paul Ammann and
Richard J. Lipton and
Ravi S. Sandhu},
title = {The Expressive Power of Multi-Parent Creation in a Monotonic Access
Control Model},
booktitle = {{CSFW}},
pages = {148--156},
publisher = {{IEEE} Computer Society},
year = {1992}
}
@inproceedings{DBLP:conf/icci/LiLD92,
author = {Xiaobo Li and
Richard Lai and
Tharam S. Dillon},
title = {Theory of Deductive Systems for Protocol Verification},
booktitle = {{ICCI}},
pages = {422--425},
publisher = {{IEEE} Computer Society},
year = {1992}
}
@inproceedings{DBLP:conf/pnpm/ZurawskiD91,
author = {Richard Zurawski and
Tharam S. Dillon},
title = {Systematic Construction of Functional Abstractions of Petri Net Models
of Typical Components of Flexible Manufacturing Systems},
booktitle = {{PNPM}},
pages = {248--257},
publisher = {{IEEE} Computer Society},
year = {1991}
}
@inproceedings{DBLP:conf/cav/LaiPD90,
author = {Richard Lai and
Ken R. Parker and
Tharam S. Dillon},
title = {On Using Protean To Verify {ISO} {FTAM} Protocol},
booktitle = {{CAV}},
series = {Lecture Notes in Computer Science},
volume = {531},
pages = {126--135},
publisher = {Springer},
year = {1990}
}
@inproceedings{DBLP:conf/pstv/LaiDP89,
author = {Richard Lai and
Tharam S. Dillon and
Ken R. Parker},
title = {Verification Results for {ISO} {FTAM} Basic Protocol},
booktitle = {{PSTV}},
pages = {223--234},
publisher = {North-Holland},
year = {1989}
}
@article{DBLP:journals/tbe/JeffsLS87,
author = {Brian Jeffs and
Richard M. Leahy and
Manbir Singh},
title = {An Evaluation of Methods for Neuromagnetic Image Reconstruction},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {34},
number = {9},
pages = {713--723},
year = {1987}
}
@article{DBLP:journals/tc/SegallSSJS83,
author = {Zary Segall and
Ajay Singh and
Richard T. Snodgrass and
Anita K. Jones and
Daniel P. Siewiorek},
title = {An Integrated Instrumentation Environment for Multiprocessors},
journal = {{IEEE} Trans. Computers},
volume = {32},
number = {1},
pages = {4--14},
year = {1983}
}
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-11-08 18:13 CET from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
