![](https://dblp.uni-trier.de/img/logo.ua.320x120.png)
![](https://dblp.uni-trier.de/img/dropdown.dark.16x16.png)
![](https://dblp.uni-trier.de/img/peace.dark.16x16.png)
Остановите войну!
for scientists:
![search dblp search dblp](https://dblp.uni-trier.de/img/search.dark.16x16.png)
![search dblp](https://dblp.uni-trier.de/img/search.dark.16x16.png)
default search action
Search dblp for Publications
export results for "Mario Sanchez"
@article{DBLP:journals/access/VilchezMembrillaPPSS24, author = {Jos{\'{e}} Antonio Vilchez{-}Membrilla and Mario Fern{\'{a}}ndez Pantoja and Ana Pilar Valerga Puerta and Victor Hugo Oliveira e Souza and Clemente Cobos S{\'{a}}nchez}, title = {Design of Transcranial Magnetic Stimulation Coils With Optimized Stimulation Depth}, journal = {{IEEE} Access}, volume = {12}, pages = {1330--1340}, year = {2024}, url = {https://doi.org/10.1109/ACCESS.2023.3346173}, doi = {10.1109/ACCESS.2023.3346173}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/access/VilchezMembrillaPPSS24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/computers/AndresSanchezOSG24, author = {Jorge de Andr{\'{e}}s{-}S{\'{a}}nchez and Mario Arias Oliva and Mar Souto{-}Romero and Jaume Gen{\'{e}}{-}Albesa}, title = {Assessing the Acceptance of Cyborg Technology with a Hedonic Technology Acceptance Model}, journal = {Comput.}, volume = {13}, number = {3}, pages = {82}, year = {2024}, url = {https://doi.org/10.3390/computers13030082}, doi = {10.3390/COMPUTERS13030082}, timestamp = {Sat, 04 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/computers/AndresSanchezOSG24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/dcg/KolesnikS24, author = {Brett Kolesnik and Mario Sanchez}, title = {The Geometry of Random Tournaments}, journal = {Discret. Comput. Geom.}, volume = {71}, number = {4}, pages = {1343--1351}, year = {2024}, url = {https://doi.org/10.1007/s00454-023-00571-4}, doi = {10.1007/S00454-023-00571-4}, timestamp = {Sat, 08 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/dcg/KolesnikS24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nn/VillaizanValleladoSCS24, author = {Mario Villaiz{\'{a}}n{-}Vallelado and Matteo Salvatori and Bel{\'{e}}n Carro and Antonio Javier S{\'{a}}nchez{-}Esguevillas}, title = {Graph Neural Network contextual embedding for Deep Learning on tabular data}, journal = {Neural Networks}, volume = {173}, pages = {106180}, year = {2024}, url = {https://doi.org/10.1016/j.neunet.2024.106180}, doi = {10.1016/J.NEUNET.2024.106180}, timestamp = {Sat, 08 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nn/VillaizanValleladoSCS24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/software/LorenzoLopezMJPHP24, author = {Alvaro Lorenzo{-}Lopez and Ashley Morris and Owain Jones and Alexander B. Phillips and Mario Hern{\'{a}}ndez{-}Tejera and Adrian Penate{-}Sanchez}, title = {Developing a Reconfigurable Architecture for the Remote Operation of Marine Autonomous Systems}, journal = {{IEEE} Softw.}, volume = {41}, number = {4}, pages = {160--170}, year = {2024}, url = {https://doi.org/10.1109/MS.2023.3317065}, doi = {10.1109/MS.2023.3317065}, timestamp = {Tue, 18 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/software/LorenzoLopezMJPHP24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/EntrenaSGPGLS23, author = {Luis Entrena and Antonio J. Sanchez{-}Clemente and Luis {\'{A}}ngel Garc{\'{\i}}a{-}Astudillo and Marta Portela{-}Garc{\'{\i}}a and Mario Garc{\'{\i}}a{-}Valderas and Almudena Lindoso and Roberto Sarmiento}, title = {Formal Verification of Fault-Tolerant Hardware Designs}, journal = {{IEEE} Access}, volume = {11}, pages = {116127--116140}, year = {2023}, url = {https://doi.org/10.1109/ACCESS.2023.3325616}, doi = {10.1109/ACCESS.2023.3325616}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/access/EntrenaSGPGLS23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/OrtizTorresMSMR23, author = {Gerardo Ortiz{-}Torres and Jesse Yoe Rumbo Morales and Ren{\'{e}} Osorio S{\'{a}}nchez and Mario Mart{\'{\i}}nez{-}Garc{\'{\i}}a and Marco Antonio Rodr{\'{\i}}guez{-}Blanco}, title = {Fault Tolerant Control via Input-Output Linearization Method for LED-Driver Using a Boost Converter}, journal = {{IEEE} Access}, volume = {11}, pages = {10390--10397}, year = {2023}, url = {https://doi.org/10.1109/ACCESS.2023.3235348}, doi = {10.1109/ACCESS.2023.3235348}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/OrtizTorresMSMR23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bspc/MadrugaCP23, author = {Mario Madruga and Yolanda Campos{-}Roca and Carlos J. P{\'{e}}rez}, title = {Addressing smartphone mismatch in Parkinson's disease detection aid systems based on speech}, journal = {Biomed. Signal Process. Control.}, volume = {80}, number = {Part}, pages = {104281}, year = {2023}, url = {https://doi.org/10.1016/j.bspc.2022.104281}, doi = {10.1016/J.BSPC.2022.104281}, timestamp = {Thu, 01 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bspc/MadrugaCP23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/complexity/RoldanCaballeroPHSPRVMGM23, author = {Alfredo Rold{\'{a}}n{-}Caballero and Jose Humberto P{\'{e}}rez{-}Cruz and Eduardo Hern{\'{a}}ndez{-}M{\'{a}}rquez and Jos{\'{e}} Rafael Garc{\'{\i}}a S{\'{a}}nchez and Mario Ponce{-}Silva and Jos{\'{e}} de Jes{\'{u}}s Rubio and Miguel Gabriel Villarreal{-}Cervantes and Jes{\'{u}}s Mart{\'{\i}}nez{-}Mart{\'{\i}}nez and Enrique Garc{\'{\i}}a{-}Trinidad and Alejandro Mendoza{-}Chegue}, title = {Synchronization of a New Chaotic System Using Adaptive Control: Design and Experimental Implementation}, journal = {Complex.}, volume = {2023}, pages = {2881192:1--2881192:22}, year = {2023}, url = {https://doi.org/10.1155/2023/2881192}, doi = {10.1155/2023/2881192}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/complexity/RoldanCaballeroPHSPRVMGM23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/comsur/BeltranPSBBPPC23, author = {Enrique Tom{\'{a}}s Mart{\'{\i}}nez Beltr{\'{a}}n and Mario Quiles P{\'{e}}rez and Pedro Miguel S{\'{a}}nchez S{\'{a}}nchez and Sergio L{\'{o}}pez Bernal and G{\'{e}}r{\^{o}}me Bovet and Manuel Gil P{\'{e}}rez and Gregorio Mart{\'{\i}}nez P{\'{e}}rez and Alberto Huertas Celdr{\'{a}}n}, title = {Decentralized Federated Learning: Fundamentals, State of the Art, Frameworks, Trends, and Challenges}, journal = {{IEEE} Commun. Surv. Tutorials}, volume = {25}, number = {4}, pages = {2983--3013}, year = {2023}, url = {https://doi.org/10.1109/COMST.2023.3315746}, doi = {10.1109/COMST.2023.3315746}, timestamp = {Sun, 17 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/comsur/BeltranPSBBPPC23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cys/VillarFEMP23, author = {Erika Yolanda Aguilar del Villar and Mario Alberto S{\'{a}}nchez Flores and Jes{\'{u}}s Jaime Moreno Escobar and Oswaldo Morales Matamoros and Ricardo Tejeida Padilla}, title = {Power Spectral Analysis of Bioacoustic Signals Emitted by a Bottlenose Dolphin when Performing Assisted Therapy}, journal = {Computaci{\'{o}}n y Sistemas (CyS)}, volume = {27}, number = {1}, year = {2023}, url = {https://cys.cic.ipn.mx/ojs/index.php/CyS/article/view/4564}, timestamp = {Tue, 23 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cys/VillarFEMP23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eait/RojasSanchezPF23, author = {Mario A. Rojas{-}S{\'{a}}nchez and Pedro R. Palos{-}Sanchez and Jos{\'{e}} A. Folgado{-}Fern{\'{a}}ndez}, title = {Systematic literature review and bibliometric analysis on virtual reality and education}, journal = {Educ. Inf. Technol.}, volume = {28}, number = {1}, pages = {155--192}, year = {2023}, url = {https://doi.org/10.1007/s10639-022-11167-5}, doi = {10.1007/S10639-022-11167-5}, timestamp = {Tue, 28 Feb 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eait/RojasSanchezPF23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/esi/CabreraQCSGSL23, author = {Diego Cabrera and Mar{\'{\i}}a J. Quinteros and Mariela Cerrada and Ren{\'{e}}{-}Vinicio S{\'{a}}nchez and Mario Guallpa and Fernando Sancho and Chuan Li}, title = {Rainfall Forecasting using a Bayesian framework and Long Short-Term Memory Multi-model Estimation based on an hourly meteorological monitoring network. Case of study: Andean Ecuadorian Tropical City}, journal = {Earth Sci. Informatics}, volume = {16}, number = {2}, pages = {1373--1388}, year = {2023}, url = {https://doi.org/10.1007/s12145-023-00958-0}, doi = {10.1007/S12145-023-00958-0}, timestamp = {Tue, 30 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/esi/CabreraQCSGSL23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fgcs/SanchezZasVVLMB23, author = {Carmen S{\'{a}}nchez{-}Zas and V{\'{\i}}ctor A. Villagr{\'{a}} and Mario Vega{-}Barbas and Xavier Larriva{-}Novo and Jos{\'{e}} Ignacio Moreno and Julio Berrocal}, title = {Ontology-based approach to real-time risk management and cyber-situational awareness}, journal = {Future Gener. Comput. Syst.}, volume = {141}, pages = {462--472}, year = {2023}, url = {https://doi.org/10.1016/j.future.2022.12.006}, doi = {10.1016/J.FUTURE.2022.12.006}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/fgcs/SanchezZasVVLMB23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcise/PenaCMCS23, author = {Mario Pe{\~{n}}a and Mariela Cerrada and Rub{\'{e}}n Medina and Diego Cabrera and Ren{\'{e}}{-}Vinicio S{\'{a}}nchez}, title = {Poincar{\'{e}} Plot Features and Statistical Features From Current and Vibration Signals for Fault Severity Classification of Helical Gear Tooth Breaks}, journal = {J. Comput. Inf. Sci. Eng.}, volume = {23}, number = {2}, year = {2023}, url = {https://doi.org/10.1115/1.4054574}, doi = {10.1115/1.4054574}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jcise/PenaCMCS23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jirs/SanchezSanchezHGRFFF23, author = {A. G. Sanchez{-}Sanchez and Eduardo Gamaliel Hern{\'{a}}ndez{-}Mart{\'{\i}}nez and Jaime Gonz{\'{a}}lez{-}Sierra and Mario Ramirez{-}Neria and Jos{\'{e}}{-}Job Flores{-}Godoy and Enrique D. Ferreira and Guillermo Fern{\'{a}}ndez{-}Anaya}, title = {Leader-Follower Power-based Formation Control Applied to Differential-drive Mobile Robots}, journal = {J. Intell. Robotic Syst.}, volume = {107}, number = {1}, pages = {6}, year = {2023}, url = {https://doi.org/10.1007/s10846-022-01796-w}, doi = {10.1007/S10846-022-01796-W}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jirs/SanchezSanchezHGRFFF23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/kybernetes/BuitragoFlorezSRHH23, author = {Francisco Buitrago{-}Florez and Mario Sanchez and Vanessa Perez Romanello and Carola Hernandez and Marcela Hern{\'{a}}ndez Hoyos}, title = {A systematic approach for curriculum redesign of introductory courses in engineering: a programming course case study}, journal = {Kybernetes}, volume = {52}, number = {10}, pages = {3904--3917}, year = {2023}, url = {https://doi.org/10.1108/K-10-2021-0957}, doi = {10.1108/K-10-2021-0957}, timestamp = {Sat, 27 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/kybernetes/BuitragoFlorezSRHH23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/mta/OlivaONREMN23, author = {Diego Oliva and No{\'{e}} Ortega{-}S{\'{a}}nchez and Mario A. Navarro and Alfonso Ramos{-}Michel and Mohammed El{-}Abd and Seyed Jalaleddin Mousavirad and Mohammad H. Nadimi{-}Shahraki}, title = {Segmentation of thermographies from electronic systems by using the global-best brain storm optimization algorithm}, journal = {Multim. Tools Appl.}, volume = {82}, number = {29}, pages = {44911--44941}, year = {2023}, url = {https://doi.org/10.1007/s11042-023-15059-9}, doi = {10.1007/S11042-023-15059-9}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/mta/OlivaONREMN23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/neuroimage/GirardRTAANPBABGOBPBSDSCBPFS23, author = {Gabriel Girard and Jonathan Rafael{-}Patino and Rapha{\"{e}}l Truffet and Dogu Baran Aydogan and Nagesh Adluru and Veena A. Nair and Vivek Prabhakaran and Barbara B. Bendlin and Andrew L. Alexander and Sara Bosticardo and Ilaria Gabusi and Mario Ocampo{-}Pineda and Matteo Battocchio and Zuzana Piskorova and Pietro Bontempi and Simona Schiavi and Alessandro Daducci and Aleksandra Stafiej and Dominika Ciupek and Fabian Bogusz and Tomasz Pieciak and Matteo Frigo and Sara Sedlar and Samuel Deslauriers{-}Gauthier and Ivana Kojcic and Mauro Zucchelli and Hiba Laghrissi and Yang Ji and Rachid Deriche and Kurt G. Schilling and Bennett A. Landman and Alberto Cacciola and Gianpaolo Antonio Basile and Salvatore Bertino and Nancy Newlin and Praitayini Kanakaraj and Francois Rheault and Patryk Filipiak and Timothy M. Shepherd and Ying{-}Chia Lin and Dimitris G. Placantonakis and Fernando E. Boada and Steven H. Baete and Erick Hernandez{-}Gutierrez and Alonso Ramirez{-}Manzanares and Ricardo Coronado{-}Leija and Pablo Stack{-}S{\'{a}}nchez and Luis Concha and Maxime Descoteaux and Sina Mansour L and Caio Seguin and Andrew Zalesky and Kenji Marshall and Erick Jorge Canales{-}Rodr{\'{\i}}guez and Ye Wu and Sahar Ahmad and Pew{-}Thian Yap and Antoine Th{\'{e}}berge and Florence Gagnon and Fr{\'{e}}d{\'{e}}ric Massi and Elda Fischi Gomez and Remy Gardier and Juan Luis Villarreal{-}Haro and Marco Pizzolato and Emmanuel Caruyer and Jean{-}Philippe Thiran}, title = {Tractography passes the test: Results from the diffusion-simulated connectivity (disco) challenge}, journal = {NeuroImage}, volume = {277}, pages = {120231}, year = {2023}, url = {https://doi.org/10.1016/j.neuroimage.2023.120231}, doi = {10.1016/J.NEUROIMAGE.2023.120231}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/neuroimage/GirardRTAANPBABGOBPBSDSCBPFS23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/HerreraCoyCHBCDSF23, author = {Mar{\'{\i}}a Camila Herrera{-}Coy and Laura Paola Calder{\'{o}}n and Iv{\'{a}}n Leonardo Herrera{-}P{\'{e}}rez and Paul Esteban Bravo{-}L{\'{o}}pez and Christian Conoscenti and Jorge Delgado and Mario S{\'{a}}nchez{-}G{\'{o}}mez and Tom{\'{a}}s Fern{\'{a}}ndez}, title = {Landslide Susceptibility Analysis on the Vicinity of Bogot{\'{a}}-Villavicencio Road (Eastern Cordillera of the Colombian Andes)}, journal = {Remote. Sens.}, volume = {15}, number = {15}, pages = {3870}, year = {2023}, url = {https://doi.org/10.3390/rs15153870}, doi = {10.3390/RS15153870}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/HerreraCoyCHBCDSF23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/Fernandez-Gorgojo23, author = {Mario Fern{\'{a}}ndez{-}Gorgojo and Diana Salas{-}G{\'{o}}mez and Pascual S{\'{a}}nchez{-}Juan and Esther Laguna{-}Bercero and Mar{\'{\i}}a Isabel P{\'{e}}rez{-}N{\'{u}}{\~{n}}ez}, title = {Analysis of Dynamic Plantar Pressure and Influence of Clinical-Functional Measures on Their Performance in Subjects with Bimalleolar Ankle Fracture at 6 and 12 Months Post-Surgery}, journal = {Sensors}, volume = {23}, number = {8}, pages = {3975}, year = {2023}, url = {https://doi.org/10.3390/s23083975}, doi = {10.3390/S23083975}, timestamp = {Fri, 07 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sensors/Fernandez-Gorgojo23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/GraciaOCISDA23, author = {Desir{\'{e}}e I. Gracia and Mario Ort{\'{\i}}z and Tatiana Candela and Eduardo I{\'{a}}{\~{n}}ez and Rosa M. S{\'{a}}nchez and Carmina D{\'{\i}}az and Jos{\'{e}} Mar{\'{\i}}a Azor{\'{\i}}n}, title = {Design and Evaluation of a Potential Non-Invasive Neurostimulation Strategy for Treating Persistent Anosmia in Post-COVID-19 Patients}, journal = {Sensors}, volume = {23}, number = {13}, pages = {5880}, year = {2023}, url = {https://doi.org/10.3390/s23135880}, doi = {10.3390/S23135880}, timestamp = {Thu, 31 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sensors/GraciaOCISDA23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/MartinezAPMBABL23, author = {Raquel Martinez and Alberto Arroyo and Alberto Pigazo and Mario Manana and Eduardo Bayona and Francisco J. Azcondo and Sergio Bustamante and Alberto Laso}, title = {Acoustic Noise-Based Detection of Ferroresonance Events in Isolated Neutral Power Systems with Inductive Voltage Transformers}, journal = {Sensors}, volume = {23}, number = {1}, pages = {195}, year = {2023}, url = {https://doi.org/10.3390/s23010195}, doi = {10.3390/S23010195}, timestamp = {Thu, 26 Jan 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sensors/MartinezAPMBABL23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/Sanchez-Fernandez23, author = {Luis Pastor S{\'{a}}nchez{-}Fern{\'{a}}ndez and Luis Alejandro S{\'{a}}nchez{-}P{\'{e}}rez and Jos{\'{e}} Juan Carbajal Hern{\'{a}}ndez and Mario Alberto Hern{\'{a}}ndez{-}Guerrero and Lucrecia P{\'{e}}rez{-}Echazabal}, title = {Buildings' Biaxial Tilt Assessment Using Inertial Wireless Sensors and a Parallel Training Model}, journal = {Sensors}, volume = {23}, number = {11}, pages = {5352}, year = {2023}, url = {https://doi.org/10.3390/s23115352}, doi = {10.3390/S23115352}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sensors/Sanchez-Fernandez23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clihc/Sanchez-RinzaSL23, author = {B{\'{a}}rbara Emma S{\'{a}}nchez{-}Rinza and Carlos Ignacio Robledo S{\'{a}}nchez and Mario Rossainz L{\'{o}}pez}, title = {Usability in a Mixed Cryptography and Hardware Security System}, booktitle = {Proceedings of the {XI} Latin American Conference on Human Computer Interaction, {CLIHC} 2023, Puebla, Mexico, 30 October 2023- 1 November 2023}, pages = {10:1--10:5}, publisher = {{ACM}}, year = {2023}, url = {https://doi.org/10.1145/3630970.3631051}, doi = {10.1145/3630970.3631051}, timestamp = {Mon, 15 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/clihc/Sanchez-RinzaSL23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/edoc/VelandiaHBSV23, author = {Paula Velandia and Andrea Herrera and L. Mar{\'{\i}}a Jos{\'{e}} Bonilla and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Tiago Prince Sales and Sybren de Kinderen and Henderik A. Proper and Luise Pufahl and Dimka Karastoyanova and Marten van Sinderen}, title = {Driving Innovation in Industry 4.0 Through Business Model Simulation}, booktitle = {Enterprise Design, Operations, and Computing. {EDOC} 2023 Workshops - IDAMS, iRESEARCH, MIDas4CS, SoEA4EE, {EDOC} Forum, Demonstrations Track and Doctoral Consortium, Groningen, The Netherlands, October 30 - November 3, 2023, Revised Selected Papers}, series = {Lecture Notes in Business Information Processing}, volume = {498}, pages = {23--38}, publisher = {Springer}, year = {2023}, url = {https://doi.org/10.1007/978-3-031-54712-6\_2}, doi = {10.1007/978-3-031-54712-6\_2}, timestamp = {Mon, 15 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/edoc/VelandiaHBSV23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icaisc/SanchezMQ23, author = {Sergio Sanchez and Javier Machacuay and Mario Quinde}, editor = {Leszek Rutkowski and Rafal Scherer and Marcin Korytkowski and Witold Pedrycz and Ryszard Tadeusiewicz and Jacek M. Zurada}, title = {Federated Learning for Human Activity Recognition on the MHealth Dataset}, booktitle = {Artificial Intelligence and Soft Computing - 22nd International Conference, {ICAISC} 2023, Zakopane, Poland, June 18-22, 2023, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {14125}, pages = {215--225}, publisher = {Springer}, year = {2023}, url = {https://doi.org/10.1007/978-3-031-42505-9\_19}, doi = {10.1007/978-3-031-42505-9\_19}, timestamp = {Sun, 24 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icaisc/SanchezMQ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceee/BravoMPRM23, author = {J. Juan Avil{\'{e}}s Bravo and Alfredo Morales{-}S{\'{a}}nchez and Liliana Palacios{-}Huerta and J. Federico Ramirez Rios and Mario Moreno}, title = {Improved Photoluminescence Intensity of Silicon Rich Oxide Film by Surface Etching}, booktitle = {20th International Conference on Electrical Engineering, Computing Science and Automatic Control, {CCE} 2023, Mexico City, Mexico, October 25-27, 2023}, pages = {1--6}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/CCE60043.2023.10332833}, doi = {10.1109/CCE60043.2023.10332833}, timestamp = {Wed, 03 Jan 2024 08:34:23 +0100}, biburl = {https://dblp.org/rec/conf/iceee/BravoMPRM23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/CazcarraBesBLDDSC23, author = {Victor Cazcarra{-}Bes and Mario Busquier and Juan M. Lopez{-}Sanchez and Michael Duersch and Shaunak De and Craig Stringham and Davide Castelleti}, title = {Assessment of Multi-Temporal Capella {SAR} Data for Change Detection and Crop Monitoring}, booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS} 2023, Pasadena, CA, USA, July 16-21, 2023}, pages = {3410--3413}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/IGARSS52108.2023.10281689}, doi = {10.1109/IGARSS52108.2023.10281689}, timestamp = {Tue, 07 Nov 2023 16:21:25 +0100}, biburl = {https://dblp.org/rec/conf/igarss/CazcarraBesBLDDSC23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/VillarroyaCarpioBLE23, author = {Arturo Villarroya{-}Carpio and Mario Busquier and Juan M. Lopez{-}Sanchez and Marcus E. Engdahl}, title = {{C-} and X-Band Repeat-Pass Coherence for Crop-Type Mapping and Monitoring}, booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS} 2023, Pasadena, CA, USA, July 16-21, 2023}, pages = {425--428}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/IGARSS52108.2023.10281890}, doi = {10.1109/IGARSS52108.2023.10281890}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/igarss/VillarroyaCarpioBLE23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/vts/AhmadilivaniBBBDTGJRRST23, author = {Mohammad Hasan Ahmadilivani and Mario Barbareschi and Salvatore Barone and Alberto Bosio and Masoud Daneshtalab and Salvatore Della Torca and Gabriele Gavarini and Maksim Jenihhin and Jaan Raik and Annachiara Ruospo and Ernesto S{\'{a}}nchez and Mahdi Taheri}, title = {Special Session: Approximation and Fault Resiliency of {DNN} Accelerators}, booktitle = {41st {IEEE} {VLSI} Test Symposium, {VTS} 2023, San Diego, CA, USA, April 24-26, 2023}, pages = {1--10}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/VTS56346.2023.10140043}, doi = {10.1109/VTS56346.2023.10140043}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/vts/AhmadilivaniBBBDTGJRRST23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:books/sp/23/SavaglioSFACMRRB23, author = {Claudio Savaglio and Giandomenico Spezzano and Giancarlo Fortino and Mario Alejandro Paguay Alvarado and Fabio Capparelli and Gianmarco Marcello and Luigi Rachiele and Francesco Raco and Samantha Genoveva Sanchez Basantes}, editor = {Franco Cicirelli and Antonio Guerrieri and Andrea Vinci and Giandomenico Spezzano}, title = {Edge Intelligence Against {COVID-19:} {A} Smart University Campus Case Study}, booktitle = {IoT Edge Solutions for Cognitive Buildings - Technology, Communications and Computing}, pages = {221--243}, publisher = {Springer}, year = {2023}, url = {https://doi.org/10.1007/978-3-031-15160-6\_10}, doi = {10.1007/978-3-031-15160-6\_10}, timestamp = {Sun, 25 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/books/sp/23/SavaglioSFACMRRB23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2303-06455, author = {Mario Villaiz{\'{a}}n{-}Vallelado and Matteo Salvatori and Bel{\'{e}}n Carro Mart{\'{\i}}nez and Antonio Javier S{\'{a}}nchez{-}Esguevillas}, title = {Graph Neural Network contextual embedding for Deep Learning on Tabular Data}, journal = {CoRR}, volume = {abs/2303.06455}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2303.06455}, doi = {10.48550/ARXIV.2303.06455}, eprinttype = {arXiv}, eprint = {2303.06455}, timestamp = {Thu, 16 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2303-06455.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2306-04645, author = {Mohammad Hasan Ahmadilivani and Mario Barbareschi and Salvatore Barone and Alberto Bosio and Masoud Daneshtalab and Salvatore Della Torca and Gabriele Gavarini and Maksim Jenihhin and Jaan Raik and Annachiara Ruospo and Ernesto S{\'{a}}nchez and Mahdi Taheri}, title = {Special Session: Approximation and Fault Resiliency of {DNN} Accelerators}, journal = {CoRR}, volume = {abs/2306.04645}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2306.04645}, doi = {10.48550/ARXIV.2306.04645}, eprinttype = {arXiv}, eprint = {2306.04645}, timestamp = {Wed, 14 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2306-04645.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/Calderon-Ramirez22, author = {Mario Calder{\'{o}}n{-}Ram{\'{\i}}rez and Jes{\'{u}}s A. G{\'{o}}mez{-}N{\'{a}}fate and Ramiro Rico{-}Mart{\'{\i}}nez and Ram{\'{o}}n Rodr{\'{\i}}guez{-}Castro and Micael{-}G. Bravo{-}S{\'{a}}nchez and Luis A. Alcaraz{-}Caracheo}, title = {Improvement of Ohmic Pasteurization in Mango Pulp Through {CFD} and {RSM}}, journal = {{IEEE} Access}, volume = {10}, pages = {81380--81389}, year = {2022}, url = {https://doi.org/10.1109/ACCESS.2022.3193391}, doi = {10.1109/ACCESS.2022.3193391}, timestamp = {Thu, 25 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/Calderon-Ramirez22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/Garza-FabreSAB22, author = {Mario Garza{-}Fabre and Aar{\'{o}}n Leonardo S{\'{a}}nchez{-}Mart{\'{\i}}nez and Edwin Aldana{-}Bobadilla and Ricardo Landa Becerra}, title = {Decision Making in Evolutionary Multiobjective Clustering: {A} Machine Learning Challenge}, journal = {{IEEE} Access}, volume = {10}, pages = {117281--117303}, year = {2022}, url = {https://doi.org/10.1109/ACCESS.2022.3219854}, doi = {10.1109/ACCESS.2022.3219854}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/Garza-FabreSAB22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/Maya-RodriguezL22, author = {Mario C. Maya{-}Rodriguez and Mario A. L{\'{o}}pez{-}Pacheco and Yair Lozano{-}Hern{\'{a}}ndez and Victor G. S{\'{a}}nchez{-}Meza and Luis A. Cantera Cantera and Ren{\'{e}} Tolentino{-}Eslava}, title = {Integration of {CNN} in a Dynamic Model-Based Controller for Control of a 2DOF Helicopter With Tail Rotor Perturbations}, journal = {{IEEE} Access}, volume = {10}, pages = {73474--73483}, year = {2022}, url = {https://doi.org/10.1109/ACCESS.2022.3189353}, doi = {10.1109/ACCESS.2022.3189353}, timestamp = {Thu, 25 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/Maya-RodriguezL22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bioinformatics/SanchezAMCO22, author = {Daniel Jim{\'{e}}nez S{\'{a}}nchez and Mikel Ariz and Jos{\'{e}} M{\'{a}}rio Morgado and Iv{\'{a}}n Cort{\'{e}}s{-}Dom{\'{\i}}nguez and Carlos Ortiz{-}de{-}Sol{\'{o}}rzano}, title = {Corrigendum to: {NMF-RI:} blind spectral unmixing of highly mixed multispectral flow and image cytometry data}, journal = {Bioinform.}, volume = {38}, number = {6}, pages = {1779}, year = {2022}, url = {https://doi.org/10.1093/bioinformatics/btab796}, doi = {10.1093/BIOINFORMATICS/BTAB796}, timestamp = {Tue, 22 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/bioinformatics/SanchezAMCO22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cys/GalvezGGA22, author = {Alba Maribel S{\'{a}}nchez G{\'{a}}lvez and Ricardo {\'{A}}lvarez{-}Gonz{\'{a}}lez and Sully S{\'{a}}nchez G{\'{a}}lvez and Mario Anzures{-}Garc{\'{\i}}a}, title = {Model to Predict the Result of a Soccer Match Based on the Number of Goals Scored by a Single Team}, journal = {Computaci{\'{o}}n y Sistemas}, volume = {26}, number = {1}, year = {2022}, url = {https://doi.org/10.13053/cys-26-1-4172}, doi = {10.13053/CYS-26-1-4172}, timestamp = {Fri, 09 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cys/GalvezGGA22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ec/SanchezG22, author = {Claudia N. S{\'{a}}nchez and Mario Graff}, title = {Selection Heuristics on Semantic Genetic Programming for Classification Problems}, journal = {Evol. Comput.}, volume = {30}, number = {2}, pages = {253--289}, year = {2022}, url = {https://doi.org/10.1162/evco\_a\_00297}, doi = {10.1162/EVCO\_A\_00297}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ec/SanchezG22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/esi/Gonzalez-Herrera22, author = {Roger Gonzalez{-}Herrera and Mario Cortazar{-}Cepeda and Ismael S{\'{a}}nchez{-}Pinto and Javier Canto{-}Rios}, title = {A homogeneous approach in modeling a coastal karst aquifer}, journal = {Earth Sci. Informatics}, volume = {15}, number = {3}, pages = {1825--1840}, year = {2022}, url = {https://doi.org/10.1007/s12145-022-00841-4}, doi = {10.1007/S12145-022-00841-4}, timestamp = {Sat, 10 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/esi/Gonzalez-Herrera22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/GomezCSCV22, author = {Manuel J. Gomez and Mario Calder{\'{o}}n and Victor S{\'{a}}nchez and F{\'{e}}lix J. Garc{\'{\i}}a Clemente and Jos{\'{e}} A. Ruip{\'{e}}rez{-}Valiente}, title = {Large scale analysis of open {MOOC} reviews to support learners' course selection}, journal = {Expert Syst. Appl.}, volume = {210}, pages = {118400}, year = {2022}, url = {https://doi.org/10.1016/j.eswa.2022.118400}, doi = {10.1016/J.ESWA.2022.118400}, timestamp = {Mon, 27 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eswa/GomezCSCV22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fgcs/DivanRG22, author = {Mario Jos{\'{e}} Div{\'{a}}n and Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso and Silvio Miguel Gonnet}, title = {Measurement project interoperability for real-time data gathering systems}, journal = {Future Gener. Comput. Syst.}, volume = {129}, pages = {298--314}, year = {2022}, url = {https://doi.org/10.1016/j.future.2021.11.031}, doi = {10.1016/J.FUTURE.2021.11.031}, timestamp = {Wed, 23 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/fgcs/DivanRG22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ieee-rita/JiSPNJ22, author = {Yi Peng Ji and Ra{\'{u}}l Marticorena S{\'{a}}nchez and Carlos Pardo{-}Aguilar and Carlos L{\'{o}}pez Nozal and Mario Juez{-}Gil}, title = {Activity and Dropout Tracking in Moodle Using UBUMonitor Application}, journal = {Rev. Iberoam. de Tecnol. del Aprendiz.}, volume = {17}, number = {3}, pages = {307--317}, year = {2022}, url = {https://doi.org/10.1109/RITA.2022.3191279}, doi = {10.1109/RITA.2022.3191279}, timestamp = {Thu, 22 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ieee-rita/JiSPNJ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/infsof/CrespoNSTP22, author = {Yania Crespo and Carlos L{\'{o}}pez Nozal and Ra{\'{u}}l Marticorena S{\'{a}}nchez and Margarita Gonzalo Tasis and Mario Piattini}, title = {The role of awareness and gamification on technical debt management}, journal = {Inf. Softw. Technol.}, volume = {150}, pages = {106946}, year = {2022}, url = {https://doi.org/10.1016/j.infsof.2022.106946}, doi = {10.1016/J.INFSOF.2022.106946}, timestamp = {Sat, 10 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/infsof/CrespoNSTP22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/js/Mendez-MonroyMT22, author = {Paul E. Mendez{-}Monroy and E. Cruz May and Mario Jim{\'{e}}nez Torres and J. L. G{\'{o}}mez Hern{\'{a}}ndez and M. Canto Romero and Israel Sanchez Dominguez and Oscar May{-}Tzuc and Ali Bassam}, title = {IoT System for the Continuous Electrical and Environmental Monitoring into Mexican Social Housing Evaluated under Tropical Climate Conditions}, journal = {J. Sensors}, volume = {2022}, pages = {1--20}, year = {2022}, url = {https://doi.org/10.1155/2022/5508713}, doi = {10.1155/2022/5508713}, timestamp = {Mon, 23 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/js/Mendez-MonroyMT22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/lgrs/Romero-PuigLB22, author = {Noelia Romero{-}Puig and Juan M. Lopez{-}Sanchez and Mario Busquier}, title = {Evaluation of PolInSAR Observables for Crop-Type Mapping Using Bistatic TanDEM-X Data}, journal = {{IEEE} Geosci. Remote. Sens. Lett.}, volume = {19}, pages = {1--5}, year = {2022}, url = {https://doi.org/10.1109/LGRS.2022.3175689}, doi = {10.1109/LGRS.2022.3175689}, timestamp = {Mon, 13 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/lgrs/Romero-PuigLB22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/npjdm/BiffiSDHSAABCDF22, author = {Carlo Biffi and Pietro Salvagnini and Nhan Ngo Dinh and Cesare Hassan and Prateek Sharma and Giulio Antonelli and Halim Awadie and Sebastian Bernhofer and Sabela Carballal and M{\'{a}}rio Dinis{-}Ribeiro and Agn{\`{e}}s Fern{\'{a}}ndez{-}Clotet and Gloria Fern{\'{a}}ndez{-}Esparrach and Ian Gralnek and Yuta Higasa and Taku Hirabayashi and Tatsuki Hirai and Mineo Iwatate and Miki Kawano and Markus Mader and Andreas Maieron and Sebastian Mattes and Tastuya Nakai and Ingrid Ordas and Raquel Ortig{\~{a}}o and Oswaldo Ortiz Z{\'{u}}{\~{n}}iga and Maria Pellis{\'{e}} and Cl{\'{a}}udia Pinto and Florian Riedl and Ariadna S{\'{a}}nchez and Emanuel Steiner and Yukari Tanaka and Andrea Cherubini}, title = {A novel {AI} device for real-time optical characterization of colorectal polyps}, journal = {npj Digit. Medicine}, volume = {5}, year = {2022}, url = {https://doi.org/10.1038/s41746-022-00633-6}, doi = {10.1038/S41746-022-00633-6}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/npjdm/BiffiSDHSAABCDF22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/npjdm/BiffiSDHSAABCDF22a, author = {Carlo Biffi and Pietro Salvagnini and Nhan Ngo Dinh and Cesare Hassan and Prateek Sharma and Giulio Antonelli and Halim Awadie and Sebastian Bernhofer and Sabela Carballal and M{\'{a}}rio Dinis{-}Ribeiro and Agn{\`{e}}s Fern{\'{a}}ndez{-}Clotet and Gloria Fern{\'{a}}ndez{-}Esparrach and Ian Gralnek and Yuta Higasa and Taku Hirabayashi and Tatsuki Hirai and Mineo Iwatate and Miki Kawano and Markus Mader and Andreas Maieron and Sebastian Mattes and Tastuya Nakai and Ingrid Ordas and Raquel Ortig{\~{a}}o and Oswaldo Ortiz Z{\'{u}}{\~{n}}iga and Maria Pellis{\'{e}} and Cl{\'{a}}udia Pinto and Florian Riedl and Ariadna S{\'{a}}nchez and Emanuel Steiner and Yukari Tanaka and Andrea Cherubini}, title = {Author Correction: {A} novel {AI} device for real-time optical characterization of colorectal polyps}, journal = {npj Digit. Medicine}, volume = {5}, year = {2022}, url = {https://doi.org/10.1038/s41746-022-00669-8}, doi = {10.1038/S41746-022-00669-8}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/npjdm/BiffiSDHSAABCDF22a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/Rio-BarralSGA22, author = {Pablo del R{\'{\i}}o{-}Barral and Mario Soil{\'{a}}n and Silvia Mar{\'{\i}}a Gonz{\'{a}}lez{-}Collazo and Pedro Arias}, title = {Pavement Crack Detection and Clustering via Region-Growing Algorithm from 3D {MLS} Point Clouds}, journal = {Remote. Sens.}, volume = {14}, number = {22}, pages = {5866}, year = {2022}, url = {https://doi.org/10.3390/rs14225866}, doi = {10.3390/RS14225866}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/remotesensing/Rio-BarralSGA22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/Almanza-OjedaRC22, author = {Dora Luz Almanza{-}Ojeda and Daniela Rodriguez{-}Sotelo and Rogelio Castro{-}Sanchez and Rene Martinez{-}Celorio and Mario Alberto Ibarra{-}Manzano}, title = {Stokes Dynamic Polarimeter for Non-Organic and Organic Samples Characterization}, journal = {Sensors}, volume = {22}, number = {6}, pages = {2155}, year = {2022}, url = {https://doi.org/10.3390/s22062155}, doi = {10.3390/S22062155}, timestamp = {Wed, 18 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sensors/Almanza-OjedaRC22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/Contreras-Hernandez22, author = {Jose L. Contreras{-}Hernandez and Dora Luz Almanza{-}Ojeda and Sergio Ledesma and Arturo Garcia{-}Perez and Rogelio Castro{-}Sanchez and Miguel A. Gomez{-}Martinez and Mario Alberto Ibarra{-}Manzano}, title = {Geometric Analysis of Signals for Inference of Multiple Faults in Induction Motors}, journal = {Sensors}, volume = {22}, number = {7}, pages = {2622}, year = {2022}, url = {https://doi.org/10.3390/s22072622}, doi = {10.3390/S22072622}, timestamp = {Wed, 18 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sensors/Contreras-Hernandez22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/Fernandez-Gorgojo22, author = {Mario Fern{\'{a}}ndez{-}Gorgojo and Diana Salas{-}G{\'{o}}mez and Pascual S{\'{a}}nchez{-}Juan and David Barbado and Esther Laguna{-}Bercero and Mar{\'{\i}}a Isabel P{\'{e}}rez{-}N{\'{u}}{\~{n}}ez}, title = {Clinical-Functional Evaluation and Test-Retest Reliability of the {G-WALK} Sensor in Subjects with Bimalleolar Ankle Fractures 6 Months after Surgery}, journal = {Sensors}, volume = {22}, number = {8}, pages = {3050}, year = {2022}, url = {https://doi.org/10.3390/s22083050}, doi = {10.3390/S22083050}, timestamp = {Thu, 02 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sensors/Fernandez-Gorgojo22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/staeors/BusquierLTF22, author = {Mario Busquier and Juan M. Lopez{-}Sanchez and Francesca Ticconi and Nicolas Floury}, title = {Combination of Time Series of L-, C-, and X-Band {SAR} Images for Land Cover and Crop Classification}, journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.}, volume = {15}, pages = {8266--8286}, year = {2022}, url = {https://doi.org/10.1109/JSTARS.2022.3207574}, doi = {10.1109/JSTARS.2022.3207574}, timestamp = {Tue, 18 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/staeors/BusquierLTF22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/SaldanhaSMA22, author = {M{\'{a}}rio Saldanha and Gustavo Sanchez and C{\'{e}}sar A. M. Marcon and Luciano Agostini}, title = {Configurable Fast Block Partitioning for {VVC} Intra Coding Using Light Gradient Boosting Machine}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {32}, number = {6}, pages = {3947--3960}, year = {2022}, url = {https://doi.org/10.1109/TCSVT.2021.3108671}, doi = {10.1109/TCSVT.2021.3108671}, timestamp = {Thu, 23 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcsv/SaldanhaSMA22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/Vilchez-Membrilla22, author = {Jos{\'{e}} Antonio Vilchez{-}Membrilla and Ignacio Mateos and {\'{A}}ngel Quir{\'{o}}s{-}Oloz{\'{a}}bal and Mario Fern{\'{a}}ndez Pantoja and Clemente Cobos S{\'{a}}nchez}, title = {{PCB} Transducer Coil Design for a Low-Noise Magnetic Measurement System in Space Missions}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {71}, pages = {1--9}, year = {2022}, url = {https://doi.org/10.1109/TIM.2022.3217843}, doi = {10.1109/TIM.2022.3217843}, timestamp = {Tue, 08 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/Vilchez-Membrilla22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnsm/RaghuramuCSSKCL22, author = {Arun Raghuramu and Lianjie Cao and Puneet Sharma and Mario S{\'{a}}nchez and Joon{-}Myung Kang and Chen{-}Nee Chuah and David Lee and Vinay Saxena}, title = {Metered Boot: Trusted Framework for Application Usage Rights Management in Virtualized Ecosystems}, journal = {{IEEE} Trans. Netw. Serv. Manag.}, volume = {19}, number = {3}, pages = {2238--2250}, year = {2022}, url = {https://doi.org/10.1109/TNSM.2022.3159191}, doi = {10.1109/TNSM.2022.3159191}, timestamp = {Mon, 05 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnsm/RaghuramuCSSKCL22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/embc/Vilchez-Membrilla22, author = {Jos{\'{e}} Antonio Vilchez{-}Membrilla and Clemente Cobos S{\'{a}}nchez and Carmen Torres Montijano and Ana Pilar Valerga Puerta and Mario Fern{\'{a}}ndez Pantoja}, title = {Design of Optimal Coils for Deep Transcranial Magnetic Stimulation}, booktitle = {44th Annual International Conference of the {IEEE} Engineering in Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland, United Kingdom, July 11-15, 2022}, pages = {3447--3450}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/EMBC48229.2022.9871354}, doi = {10.1109/EMBC48229.2022.9871354}, timestamp = {Tue, 08 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/embc/Vilchez-Membrilla22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscas/SaldanhaSMA22, author = {M{\'{a}}rio Saldanha and Gustavo Sanchez and C{\'{e}}sar A. M. Marcon and Luciano Agostini}, title = {Fast Transform Decision Scheme for {VVC} Intra-Frame Prediction Using Decision Trees}, booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2022, Austin, TX, USA, May 27 - June 1, 2022}, pages = {1948--1952}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/ISCAS48785.2022.9938000}, doi = {10.1109/ISCAS48785.2022.9938000}, timestamp = {Thu, 17 Nov 2022 15:59:17 +0100}, biburl = {https://dblp.org/rec/conf/iscas/SaldanhaSMA22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/micai/Sanchez-Martinez22, author = {Aar{\'{o}}n Leonardo S{\'{a}}nchez{-}Mart{\'{\i}}nez and Mario Garza{-}Fabre and Ricardo Landa Becerra and Edwin Aldana{-}Bobadilla}, editor = {Obdulia Pichardo{-}Lagunas and Juan Mart{\'{\i}}nez{-}Miranda and Bella Mart{\'{\i}}nez{-}Seis}, title = {Machine Learning-Based Decision Making in Evolutionary Multiobjective Clustering}, booktitle = {Advances in Computational Intelligence - 21st Mexican International Conference on Artificial Intelligence, {MICAI} 2022, Monterrey, Mexico, October 24-29, 2022, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {13612}, pages = {123--137}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-19493-1\_10}, doi = {10.1007/978-3-031-19493-1\_10}, timestamp = {Mon, 05 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/micai/Sanchez-Martinez22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/riiforum/SanchezGMG22, author = {Mar{\'{\i}}a de los {\'{A}}ngeles T{\'{a}}rraga S{\'{a}}nchez and Mar{\'{\i}}a del Mar Ballesteros Garc{\'{\i}}a and H{\'{e}}ctor Migall{\'{o}}n and Otoniel L{\'{o}}pez Granado}, editor = {Anna Visvizi and Orlando Troisi and Mara Grimaldi}, title = {Reinforcement Learning Through Gamification and Open Online Resources in Elementary School}, booktitle = {Research and Innovation Forum 2022: Rupture, Resilience and Recovery in the Post-Covid World, {RIIFORUM} 2022, Athens, Greece, April 20-22, 2022}, series = {Springer Proceedings in Complexity}, pages = {455--463}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-19560-0\_37}, doi = {10.1007/978-3-031-19560-0\_37}, timestamp = {Fri, 21 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/riiforum/SanchezGMG22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigcomm/AhujaDPSGSYNRSZ22, author = {Satyajeet Singh Ahuja and Vinayak Dangui and Kirtesh Patil and Manikandan Somasundaram and Varun Gupta and Mario A. S{\'{a}}nchez and Guanqing Yan and Max Noormohammadpour and Alaleh Razmjoo and Grace Smith and Hao Zhong and Abhinav Triguna and Soshant Bali and Yuxiang Xiang and Yilun Chen and Prabhakaran Ganesan and Mikel Jimenez Fernandez and Petr Lapukhov and Guyue Liu and Ying Zhang}, editor = {Fernando Kuipers and Ariel Orda}, title = {Network entitlement: contract-based network sharing with agility and {SLO} guarantees}, booktitle = {{SIGCOMM} '22: {ACM} {SIGCOMM} 2022 Conference, Amsterdam, The Netherlands, August 22 - 26, 2022}, pages = {250--263}, publisher = {{ACM}}, year = {2022}, url = {https://doi.org/10.1145/3544216.3544245}, doi = {10.1145/3544216.3544245}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sigcomm/AhujaDPSGSYNRSZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/sepln/2022iberlef, editor = {Manuel Montes{-}y{-}G{\'{o}}mez and Julio Gonzalo and Francisco Rangel and Marco Casavantes and Miguel {\'{A}}ngel {\'{A}}lvare Carmona and Gemma Bel{-}Enguix and Hugo Jair Escalante and Larissa A. de Freitas and Antonio Miranda{-}Escalada and Francisco J. Rodr{\'{\i}}guez{-}Sanchez and Aiala Ros{\'{a}} and Marco Antonio Sobrevilla Cabezudo and Mariona Taul{\'{e}} and Rafael Valencia{-}Garc{\'{\i}}a}, title = {Proceedings of the Iberian Languages Evaluation Forum (IberLEF 2022) co-located with the Conference of the Spanish Society for Natural Language Processing {(SEPLN} 2022), {A} Coru{\~{n}}a, Spain, September 20, 2022}, series = {{CEUR} Workshop Proceedings}, volume = {3202}, publisher = {CEUR-WS.org}, year = {2022}, url = {https://ceur-ws.org/Vol-3202}, urn = {urn:nbn:de:0074-3202-9}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sepln/2022iberlef.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2201-06967, author = {Manuel J. Gomez and Mario Calder{\'{o}}n and Victor S{\'{a}}nchez and F{\'{e}}lix J. Garc{\'{\i}}a Clemente and Jos{\'{e}} A. Ruip{\'{e}}rez{-}Valiente}, title = {Large Scale Analysis of Open {MOOC} Reviews to Support Learners' Course Selection}, journal = {CoRR}, volume = {abs/2201.06967}, year = {2022}, url = {https://arxiv.org/abs/2201.06967}, eprinttype = {arXiv}, eprint = {2201.06967}, timestamp = {Mon, 27 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2201-06967.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2211-08413, author = {Enrique Tom{\'{a}}s Mart{\'{\i}}nez Beltr{\'{a}}n and Mario Quiles P{\'{e}}rez and Pedro Miguel S{\'{a}}nchez S{\'{a}}nchez and Sergio L{\'{o}}pez Bernal and G{\'{e}}r{\^{o}}me Bovet and Manuel Gil P{\'{e}}rez and Gregorio Mart{\'{\i}}nez P{\'{e}}rez and Alberto Huertas Celdr{\'{a}}n}, title = {Decentralized Federated Learning: Fundamentals, State-of-the-art, Frameworks, Trends, and Challenges}, journal = {CoRR}, volume = {abs/2211.08413}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2211.08413}, doi = {10.48550/ARXIV.2211.08413}, eprinttype = {arXiv}, eprint = {2211.08413}, timestamp = {Wed, 23 Nov 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2211-08413.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/MadrugaCP21, author = {Mario Madruga and Yolanda Campos{-}Roca and C. J. P{\'{e}}rez}, title = {Multicondition Training for Noise-Robust Detection of Benign Vocal Fold Lesions From Recorded Speech}, journal = {{IEEE} Access}, volume = {9}, pages = {1707--1722}, year = {2021}, url = {https://doi.org/10.1109/ACCESS.2020.3046873}, doi = {10.1109/ACCESS.2020.3046873}, timestamp = {Mon, 25 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/MadrugaCP21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/SanchezCOA21, author = {Melissa S{\'{a}}nchez and Jorge M. Cruz{-}Duarte and Jos{\'{e}} Carlos Ortiz{-}Bayliss and Iv{\'{a}}n Amaya}, title = {Sequence-Based Selection Hyper-Heuristic Model via MAP-Elites}, journal = {{IEEE} Access}, volume = {9}, pages = {116500--116527}, year = {2021}, url = {https://doi.org/10.1109/ACCESS.2021.3106815}, doi = {10.1109/ACCESS.2021.3106815}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/SanchezCOA21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/SanchezPANL21, author = {H{\'{e}}ctor Corrales S{\'{a}}nchez and Noelia Hern{\'{a}}ndez Parra and Ignacio Parra Alonso and Eduardo M. Nebot and David Fern{\'{a}}ndez Llorca}, title = {Are We Ready for Accurate and Unbiased Fine-Grained Vehicle Classification in Realistic Environments?}, journal = {{IEEE} Access}, volume = {9}, pages = {116338--116355}, year = {2021}, url = {https://doi.org/10.1109/ACCESS.2021.3104340}, doi = {10.1109/ACCESS.2021.3104340}, timestamp = {Fri, 21 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/access/SanchezPANL21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/artmed/NaranjoPCM21, author = {Lizbeth Naranjo and Carlos J. P{\'{e}}rez and Yolanda Campos{-}Roca and Mario Madruga}, title = {Replication-based regularization approaches to diagnose Reinke's edema by using voice recordings}, journal = {Artif. Intell. Medicine}, volume = {120}, pages = {102162}, year = {2021}, url = {https://doi.org/10.1016/j.artmed.2021.102162}, doi = {10.1016/J.ARTMED.2021.102162}, timestamp = {Thu, 01 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/artmed/NaranjoPCM21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bdr/LealCCGGDSSKGXL21, author = {F{\'{a}}tima Leal and Adriana E. Chis and Simon Caton and Horacio Gonz{\'{a}}lez{-}V{\'{e}}lez and Juan M. Garc{\'{\i}}a{-}G{\'{o}}mez and Marta Dur{\'{a}} and Angel S{\'{a}}nchez{-}Garc{\'{\i}}a and Carlos S{\'{a}}ez and Anthony Karageorgos and Vassilis C. Gerogiannis and Apostolos Xenakis and Efthymios N. Lallas and Theodoros Ntounas and Eleni Vasileiou and Georgios Mountzouris and Barbara Otti and Penelope Pucci and Rossano Papini and David Cerrai and Mariola Mier}, title = {Smart Pharmaceutical Manufacturing: Ensuring End-to-End Traceability and Data Integrity in Medicine Production}, journal = {Big Data Res.}, volume = {24}, pages = {100172}, year = {2021}, url = {https://doi.org/10.1016/j.bdr.2020.100172}, doi = {10.1016/J.BDR.2020.100172}, timestamp = {Tue, 12 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bdr/LealCCGGDSSKGXL21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijgi/LuacesFFOBDL21, author = {Miguel R. Luaces and Jes{\'{u}}s A. Fisteus and Luis S{\'{a}}nchez Fern{\'{a}}ndez and Mario Mu{\~{n}}oz Organero and Jes{\'{u}}s Balado and Luc{\'{\i}}a D{\'{\i}}az{-}Vilari{\~{n}}o and Henrique Lorenzo}, title = {Accessible Routes Integrating Data from Multiple Sources}, journal = {{ISPRS} Int. J. Geo Inf.}, volume = {10}, number = {1}, pages = {7}, year = {2021}, url = {https://doi.org/10.3390/ijgi10010007}, doi = {10.3390/IJGI10010007}, timestamp = {Wed, 07 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijgi/LuacesFFOBDL21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/GonzalezSDR21, author = {Mario Gonz{\'{a}}lez and {\'{A}}ngel S{\'{a}}nchez and David Dominguez and Francisco B. Rodr{\'{\i}}guez}, title = {Ensemble of diluted attractor networks with optimized topology for fingerprint retrieval}, journal = {Neurocomputing}, volume = {442}, pages = {269--280}, year = {2021}, url = {https://doi.org/10.1016/j.neucom.2021.02.033}, doi = {10.1016/J.NEUCOM.2021.02.033}, timestamp = {Sat, 01 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijon/GonzalezSDR21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijris/DivanR21, author = {Mario Jos{\'{e}} Div{\'{a}}n and Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso}, title = {Strategies based on IoT for supporting the decision-making in agriculture: a systematic literature mapping}, journal = {Int. J. Reason. based Intell. Syst.}, volume = {13}, number = {3}, pages = {155--171}, year = {2021}, url = {https://doi.org/10.1504/IJRIS.2021.117080}, doi = {10.1504/IJRIS.2021.117080}, timestamp = {Mon, 25 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijris/DivanR21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/iotj/DivanRPM21, author = {Mario Jos{\'{e}} Div{\'{a}}n and Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso and Juan Esteban Panebianco and Mariano J. M{\'{e}}ndez}, title = {IoT-Based Approaches for Monitoring the Particulate Matter and Its Impact on Health}, journal = {{IEEE} Internet Things J.}, volume = {8}, number = {15}, pages = {11983--12003}, year = {2021}, url = {https://doi.org/10.1109/JIOT.2021.3068898}, doi = {10.1109/JIOT.2021.3068898}, timestamp = {Wed, 15 Dec 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/iotj/DivanRPM21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/RiveraFGPS21, author = {Gilberto Rivera and Rogelio Florencia and Mario Guerrero and Ra{\'{u}}l Porras and Julia Patricia S{\'{a}}nchez{-}Sol{\'{\i}}s}, title = {Online multi-criteria portfolio analysis through compromise programming models built on the underlying principles of fuzzy outranking}, journal = {Inf. Sci.}, volume = {580}, pages = {734--755}, year = {2021}, url = {https://doi.org/10.1016/j.ins.2021.08.087}, doi = {10.1016/J.INS.2021.08.087}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/isci/RiveraFGPS21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/iwc/Bustos-LopezASP21, author = {Maritza Bustos{-}L{\'{o}}pez and Giner Alor{-}Hern{\'{a}}ndez and Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and Mario Andr{\'{e}}s Paredes{-}Valverde and Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate}, title = {EduRecomSys: An Educational Resource Recommender System Based on Collaborative Filtering and Emotion Detection}, journal = {Interact. Comput.}, volume = {32}, number = {4}, pages = {407--432}, year = {2021}, url = {https://doi.org/10.1093/iwc/iwab001}, doi = {10.1093/IWC/IWAB001}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/iwc/Bustos-LopezASP21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jei/SaldanhaSMA21, author = {M{\'{a}}rio Saldanha and Gustavo Sanchez and C{\'{e}}sar A. M. Marcon and Luciano Agostini}, title = {Fast block partitioning scheme for chrominance intra prediction of versatile video coding standard}, journal = {J. Electronic Imaging}, volume = {30}, number = {5}, year = {2021}, url = {https://doi.org/10.1117/1.jei.30.5.053009}, doi = {10.1117/1.JEI.30.5.053009}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jei/SaldanhaSMA21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jis/Sanchez-Cervantes21, author = {Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and Giner Alor{-}Hern{\'{a}}ndez and Mario Andr{\'{e}}s Paredes{-}Valverde and Lisbeth Rodr{\'{\i}}guez{-}Mazahua and Rafael Valencia{-}Garc{\'{\i}}a}, title = {NaLa-Search: {A} multimodal, interaction-based architecture for faceted search on linked open data}, journal = {J. Inf. Sci.}, volume = {47}, number = {6}, year = {2021}, url = {https://doi.org/10.1177/0165551520930918}, doi = {10.1177/0165551520930918}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jis/Sanchez-Cervantes21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jvcir/SaldanhaSMA21, author = {M{\'{a}}rio Saldanha and Gustavo Sanchez and C{\'{e}}sar A. M. Marcon and Luciano Agostini}, title = {Performance analysis of {VVC} intra coding}, journal = {J. Vis. Commun. Image Represent.}, volume = {79}, pages = {103202}, year = {2021}, url = {https://doi.org/10.1016/j.jvcir.2021.103202}, doi = {10.1016/J.JVCIR.2021.103202}, timestamp = {Wed, 03 Nov 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jvcir/SaldanhaSMA21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/kbs/DivanR21, author = {Mario Jos{\'{e}} Div{\'{a}}n and Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso}, title = {Metadata-based measurements transmission verified by a Merkle Tree}, journal = {Knowl. Based Syst.}, volume = {219}, pages = {106871}, year = {2021}, url = {https://doi.org/10.1016/j.knosys.2021.106871}, doi = {10.1016/J.KNOSYS.2021.106871}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/kbs/DivanR21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/paa/RodriguezOM21, author = {Mario Rodr{\'{\i}}guez and Carlos Orrite and Carlos Medrano}, title = {Space-time flexible kernel for recognizing activities from wearable cameras}, journal = {Pattern Anal. Appl.}, volume = {24}, number = {2}, pages = {843--852}, year = {2021}, url = {https://doi.org/10.1007/s10044-020-00942-0}, doi = {10.1007/S10044-020-00942-0}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/paa/RodriguezOM21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ploscb/Rubio-TevesDPSP21, author = {Mario Rubio{-}Teves and Sergio Diez{-}Hermano and C{\'{e}}sar Porrero and Abel Sanchez{-}Jimenez and Luc{\'{\i}}a Prensa and Francisco Clasc{\'{a}} and Mar{\'{\i}}a Garc{\'{\i}}a{-}Amado and Jos{\'{e}} Antonio Villacorta{-}Atienza}, title = {Benchmarking of tools for axon length measurement in individually-labeled projection neurons}, journal = {PLoS Comput. Biol.}, volume = {17}, number = {12}, year = {2021}, url = {https://doi.org/10.1371/journal.pcbi.1009051}, doi = {10.1371/JOURNAL.PCBI.1009051}, timestamp = {Tue, 16 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ploscb/Rubio-TevesDPSP21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/BusquierVLPSA21, author = {Mario Busquier and Rub{\'{e}}n Valcarce{-}Di{\~{n}}eiro and Juan M. Lopez{-}Sanchez and Javier Plaza and Nilda S{\'{a}}nchez and Benjam{\'{\i}}n Arias{-}P{\'{e}}rez}, title = {Fusion of Multi-Temporal {PAZ} and Sentinel-1 Data for Crop Classification}, journal = {Remote. Sens.}, volume = {13}, number = {19}, pages = {3915}, year = {2021}, url = {https://doi.org/10.3390/rs13193915}, doi = {10.3390/RS13193915}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/remotesensing/BusquierVLPSA21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tkde/GatziouraVJS21, author = {Anna Gatzioura and Jo{\~{a}}o Vinagre and Al{\'{\i}}pio M{\'{a}}rio Jorge and Miquel S{\`{a}}nchez{-}Marr{\`{e}}}, title = {A Hybrid Recommender System for Improving Automatic Playlist Continuation}, journal = {{IEEE} Trans. Knowl. Data Eng.}, volume = {33}, number = {5}, pages = {1819--1830}, year = {2021}, url = {https://doi.org/10.1109/TKDE.2019.2952099}, doi = {10.1109/TKDE.2019.2952099}, timestamp = {Thu, 16 Sep 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tkde/GatziouraVJS21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bmsd/NaranjoS21, author = {David Naranjo and Mario E. S{\'{a}}nchez}, editor = {Boris Shishkov}, title = {View and Viewpoint Reconstruction for Assisting the Preparation of Participatory Modeling Sessions}, booktitle = {Business Modeling and Software Design - 11th International Symposium, {BMSD} 2021, Sofia, Bulgaria, July 5-7, 2021, Proceedings}, series = {Lecture Notes in Business Information Processing}, volume = {422}, pages = {306--316}, publisher = {Springer}, year = {2021}, url = {https://doi.org/10.1007/978-3-030-79976-2\_19}, doi = {10.1007/978-3-030-79976-2\_19}, timestamp = {Tue, 31 Aug 2021 10:24:53 +0200}, biburl = {https://dblp.org/rec/conf/bmsd/NaranjoS21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caip/TapiaGEJPCL21, author = {Luis Sanchez Tapia and Antonio Gomez and Mario Esparza and Venkatesh Jatla and Marios Pattichis and Sylvia Celed{\'{o}}n{-}Pattichis and Carlos L{\'{o}}pez Leiva}, editor = {Nicolas Tsapatsoulis and Andreas Panayides and Theo Theocharides and Andreas Lanitis and Constantinos S. Pattichis and Mario Vento}, title = {Bilingual Speech Recognition by Estimating Speaker Geometry from Video Data}, booktitle = {Computer Analysis of Images and Patterns - 19th International Conference, {CAIP} 2021, Virtual Event, September 28-30, 2021, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {13052}, pages = {79--89}, publisher = {Springer}, year = {2021}, url = {https://doi.org/10.1007/978-3-030-89128-2\_8}, doi = {10.1007/978-3-030-89128-2\_8}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/caip/TapiaGEJPCL21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/GonzalezRVHPPST21, author = {Ruben Vasallo Gonz{\'{a}}lez and Antonio Robles{-}G{\'{o}}mez and Rafael Pastor Vargas and Juan Mario Haut and Nicol{\'{a}}s A. Passadore and Mercedes Eugenia Paoletti and Carlos Luis S{\'{a}}nchez{-}Bocanegra and Llanos Tobarra and Karla A. Chac{\'{o}}n{-}Vargas and Roberto Hern{\'{a}}ndez Berlinches and Francesc Saig{\'{\i}} Rubi{\'{o}}}, editor = {Jo{\~{a}}o Rafael Almeida and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Linlin Shen and Bridget Kane and Agma J. M. Traina and Paolo Soda and Jos{\'{e}} Lu{\'{\i}}s Oliveira}, title = {A Recommendation System for Electronic Health Records in the Context of the {HOPE} Project}, booktitle = {34th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2021, Aveiro, Portugal, June 7-9, 2021}, pages = {603--608}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/CBMS52027.2021.00108}, doi = {10.1109/CBMS52027.2021.00108}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/GonzalezRVHPPST21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/fie/IzuLMS21, author = {Cruz Izu and Violetta Lonati and Anna Morpurgo and Mario S{\'{a}}nchez}, title = {An Inventory of Goals from {CS1} Programs Processing a Data Series}, booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2021, Lincoln, NE, USA, October 13-16, 2021}, pages = {1--8}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/FIE49875.2021.9637360}, doi = {10.1109/FIE49875.2021.9637360}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/fie/IzuLMS21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icai2/MachadoSV21, author = {Paola Lara Machado and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Hector Florez and Mar{\'{\i}}a Florencia Pollo Cattaneo}, title = {Enterprise Modeling: {A} Multi-perspective Tool-Supported Approach}, booktitle = {Applied Informatics - Fourth International Conference, {ICAI} 2021, Buenos Aires, Argentina, October 28-30, 2021, Proceedings}, series = {Communications in Computer and Information Science}, volume = {1455}, pages = {465--480}, publisher = {Springer}, year = {2021}, url = {https://doi.org/10.1007/978-3-030-89654-6\_33}, doi = {10.1007/978-3-030-89654-6\_33}, timestamp = {Sun, 15 Jan 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icai2/MachadoSV21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceee/Lopez-TapiaSRAF21, author = {Andrea L{\'{o}}pez{-}Tapia and Luis S{\'{a}}nchez{-}M{\'{a}}rquez and Mario Alfredo Reyes{-}Barranca and Griselda Stephany Abarca{-}Jimenez and Luis Mart{\'{\i}}n Flores{-}Nava}, title = {Micromotors unit based on {CMOS-MEMS} technology integrated on a single chip}, booktitle = {18th International Conference on Electrical Engineering, Computing Science and Automatic Control, {CCE} 2021, Mexico City, Mexico, November 10-12, 2021}, pages = {1--6}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/CCE53527.2021.9633117}, doi = {10.1109/CCE53527.2021.9633117}, timestamp = {Mon, 03 Jan 2022 22:36:53 +0100}, biburl = {https://dblp.org/rec/conf/iceee/Lopez-TapiaSRAF21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iwann/GonzalezSDR21, author = {Mario Gonz{\'{a}}lez and {\'{A}}ngel S{\'{a}}nchez and David Dominguez and Francisco B. Rodr{\'{\i}}guez}, editor = {Ignacio Rojas and Gonzalo Joya and Andreu Catal{\`{a}}}, title = {Fine-Tuning of Patterns Assignment to Subnetworks Increases the Capacity of an Attractor Network Ensemble}, booktitle = {Advances in Computational Intelligence - 16th International Work-Conference on Artificial Neural Networks, {IWANN} 2021, Virtual Event, June 16-18, 2021, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {12862}, pages = {236--247}, publisher = {Springer}, year = {2021}, url = {https://doi.org/10.1007/978-3-030-85099-9\_19}, doi = {10.1007/978-3-030-85099-9\_19}, timestamp = {Sat, 01 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iwann/GonzalezSDR21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/micai/Suarez-RamirezD21, author = {Cuauhtemoc Daniel Suarez{-}Ramirez and Mario Alberto Duran{-}Vega and H{\'{e}}ctor M. S{\'{a}}nchez C. and Miguel Gonz{\'{a}}lez{-}Mendoza and Leonardo Chang and John M. Marshall}, editor = {Ildar Z. Batyrshin and Alexander F. Gelbukh and Grigori Sidorov}, title = {Deep Learning Architectures Applied to Mosquito Count Regressions in {US} Datasets}, booktitle = {Advances in Computational Intelligence - 20th Mexican International Conference on Artificial Intelligence, {MICAI} 2021, Mexico City, Mexico, October 25-30, 2021, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {13067}, pages = {199--212}, publisher = {Springer}, year = {2021}, url = {https://doi.org/10.1007/978-3-030-89817-5\_15}, doi = {10.1007/978-3-030-89817-5\_15}, timestamp = {Mon, 24 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/micai/Suarez-RamirezD21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ondm/UrenaGSGNGG21, author = {Mario Ure{\~{n}}a and Rub{\'{e}}n Guillem and Sabahat Shaheen and Sergi Garc{\'{\i}}a and Elham Nazemosadat and Itandehui Gris{-}S{\'{a}}nchez and Ivana Gasulla}, title = {Specialty fibers exploiting spatial multiplexing for signal processing in radio access networks}, booktitle = {International Conference on Optical Network Design and Modeling, {ONDM} 2021, Gothenburg, Sweden, June 28 - July 1, 2021}, pages = {1--3}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.23919/ONDM51796.2021.9492430}, doi = {10.23919/ONDM51796.2021.9492430}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ondm/UrenaGSGNGG21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/vcip/SaldanhaSMA21, author = {M{\'{a}}rio Saldanha and Gustavo Sanchez and C{\'{e}}sar A. M. Marcon and Luciano Agostini}, title = {Analysis of {VVC} Intra Prediction Block Partitioning Structure}, booktitle = {International Conference on Visual Communications and Image Processing, {VCIP} 2021, Munich, Germany, December 5-8, 2021}, pages = {1--5}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/VCIP53242.2021.9675347}, doi = {10.1109/VCIP53242.2021.9675347}, timestamp = {Tue, 25 Jan 2022 09:48:31 +0100}, biburl = {https://dblp.org/rec/conf/vcip/SaldanhaSMA21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/vcip/SaldanhaSMA21a, author = {M{\'{a}}rio Saldanha and Gustavo Sanchez and C{\'{e}}sar A. M. Marcon and Luciano Agostini}, title = {Learning-Based Complexity Reduction Scheme for {VVC} Intra-Frame Prediction}, booktitle = {International Conference on Visual Communications and Image Processing, {VCIP} 2021, Munich, Germany, December 5-8, 2021}, pages = {1--5}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/VCIP53242.2021.9675394}, doi = {10.1109/VCIP53242.2021.9675394}, timestamp = {Tue, 25 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/vcip/SaldanhaSMA21a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/worldcist/MoralesMTAM21, author = {C. Santiago Morales and Mario Raul Morales{-}Morales and Glenda Toala S{\'{a}}nchez and B. Alicia Andrade and Milton Giovanny Moncayo}, editor = {{\'{A}}lvaro Rocha and Hojjat Adeli and Gintautas Dzemyda and Fernando Moreira and Ana Maria Ramalho Correia}, title = {Business Decision Making Based on Social Media Analysis}, booktitle = {Trends and Applications in Information Systems and Technologies - Volume 2, WorldCIST 2021, Terceira Island, Azores, Portugal, 30 March - 2 April, 2021}, series = {Advances in Intelligent Systems and Computing}, volume = {1366}, pages = {203--213}, publisher = {Springer}, year = {2021}, url = {https://doi.org/10.1007/978-3-030-72651-5\_20}, doi = {10.1007/978-3-030-72651-5\_20}, timestamp = {Wed, 22 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/worldcist/MoralesMTAM21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2106-02009, author = {Eric Sadit Tellez and Sabino Miranda{-}Jim{\'{e}}nez and Mario Graff and Daniela Moctezuma and Oscar S. Siordia and Elio{-}Aten{\'{o}}genes Villase{\~{n}}or}, title = {A Case Study of Spanish Text Transformations for Twitter Sentiment Analysis}, journal = {CoRR}, volume = {abs/2106.02009}, year = {2021}, url = {https://arxiv.org/abs/2106.02009}, eprinttype = {arXiv}, eprint = {2106.02009}, timestamp = {Wed, 17 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2106-02009.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2112-13463, author = {Luis Sanchez Tapia and Antonio Gomez and Mario Esparza and Venkatesh Jatla and Marios Pattichis and Sylvia Celed{\'{o}}n{-}Pattichis and Carlos LopezLeiva}, title = {Bilingual Speech Recognition by Estimating Speaker Geometry from Video Data}, journal = {CoRR}, volume = {abs/2112.13463}, year = {2021}, url = {https://arxiv.org/abs/2112.13463}, eprinttype = {arXiv}, eprint = {2112.13463}, timestamp = {Tue, 04 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2112-13463.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aada/DivanR20, author = {Mario Jos{\'{e}} Div{\'{a}}n and Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso}, title = {Optimizing Data Transmission from IoT Devices Through Weighted Online Data Changing Detectors}, journal = {Adv. Data Sci. Adapt. Anal.}, volume = {12}, number = {2}, pages = {2041001:1--2041001:33}, year = {2020}, url = {https://doi.org/10.1142/S2424922X20410016}, doi = {10.1142/S2424922X20410016}, timestamp = {Fri, 09 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/aada/DivanR20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/Sanchez-AvilaMF20, author = {Mario S{\'{a}}nchez{-}{\'{A}}vila and Marcos Antonio Mouri{\~{n}}o{-}Garc{\'{\i}}a and Jes{\'{u}}s A. Fisteus and Luis S{\'{a}}nchez Fern{\'{a}}ndez}, title = {Detection of Barriers to Mobility in the Smart City Using Twitter}, journal = {{IEEE} Access}, volume = {8}, pages = {168429--168438}, year = {2020}, url = {https://doi.org/10.1109/ACCESS.2020.3022834}, doi = {10.1109/ACCESS.2020.3022834}, timestamp = {Wed, 28 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/access/Sanchez-AvilaMF20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/SanchezCOCTA20, author = {Melissa S{\'{a}}nchez and Jorge M. Cruz{-}Duarte and Jos{\'{e}} Carlos Ortiz{-}Bayliss and Hector G. Ceballos and Hugo Terashima{-}Mar{\'{\i}}n and Iv{\'{a}}n Amaya}, title = {A Systematic Review of Hyper-Heuristics on Combinatorial Optimization Problems}, journal = {{IEEE} Access}, volume = {8}, pages = {128068--128095}, year = {2020}, url = {https://doi.org/10.1109/ACCESS.2020.3009318}, doi = {10.1109/ACCESS.2020.3009318}, timestamp = {Mon, 21 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/access/SanchezCOCTA20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/caee/Jimenez-Ramirez20, author = {Omar Jim{\'{e}}nez{-}Ram{\'{\i}}rez and Jos{\'{e}} A. C{\'{a}}rdenas{-}Valderrama and Alejandro A. Ordo{\~{n}}ez{-}S{\'{a}}nchez and Mario Alan Quiroz{-}Ju{\'{a}}rez and Rub{\'{e}}n V{\'{a}}zquez{-}Medina}, title = {Digital proportional-derivative controller implemented in low-resource microcontrollers}, journal = {Comput. Appl. Eng. Educ.}, volume = {28}, number = {6}, pages = {1671--1682}, year = {2020}, url = {https://doi.org/10.1002/cae.22346}, doi = {10.1002/CAE.22346}, timestamp = {Thu, 17 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/caee/Jimenez-Ramirez20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ci/Paredes-Valverde20, author = {Mario Andr{\'{e}}s Paredes{-}Valverde and Giner Alor{-}Hern{\'{a}}ndez and Jorge Luis Garc{\'{\i}}a{-}Alcaraz and Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and Luis Omar Colombo{-}Mendoza and Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes}, title = {IntelliHome: An internet of things-based system for electrical energy saving in smart home environment}, journal = {Comput. Intell.}, volume = {36}, number = {1}, pages = {203--224}, year = {2020}, url = {https://doi.org/10.1111/coin.12252}, doi = {10.1111/COIN.12252}, timestamp = {Mon, 26 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ci/Paredes-Valverde20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cleiej/DivanR20, author = {Mario Jos{\'{e}} Div{\'{a}}n and Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso}, title = {A Real-Time Entity Monitoring based on States and Scenarios}, journal = {{CLEI} Electron. J.}, volume = {23}, number = {1}, year = {2020}, url = {https://doi.org/10.19153/cleiej.23.1.2}, doi = {10.19153/CLEIEJ.23.1.2}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cleiej/DivanR20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/computer/Gonzalez-Briceno20, author = {Gaspar Gonz{\'{a}}lez{-}Brice{\~{n}}o and Abraham S{\'{a}}nchez and Susana Ortega{-}Cisneros and Mario Salvador Garcia Contreras and German Alonso Pinedo Diaz and Eduardo Ulises Moya{-}S{\'{a}}nchez}, title = {Artificial Intelligence-Based Referral System for Patients With Diabetic Retinopathy}, journal = {Computer}, volume = {53}, number = {10}, pages = {77--87}, year = {2020}, url = {https://doi.org/10.1109/MC.2020.3004392}, doi = {10.1109/MC.2020.3004392}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/computer/Gonzalez-Briceno20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cys/Sanchez-GalvezA20, author = {Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and Mario Anzures{-}Garc{\'{\i}}a and {\'{A}}lvaro Campos Gregorio}, title = {Weighted Bidirectional Graph-based Academic Curricula Model to Support the Tutorial Competence}, journal = {Computaci{\'{o}}n y Sistemas}, volume = {24}, number = {2}, year = {2020}, url = {https://doi.org/10.13053/cys-24-2-3397}, doi = {10.13053/CYS-24-2-3397}, timestamp = {Fri, 10 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cys/Sanchez-GalvezA20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/digearth/SoilanRFA20, author = {Mario Soil{\'{a}}n and Bel{\'{e}}n Riveiro and Jes{\'{u}}s Balado and Pedro Arias}, title = {Comparison of heuristic and deep learning-based methods for ground classification from aerial point clouds}, journal = {Int. J. Digit. Earth}, volume = {13}, number = {10}, pages = {1115--1134}, year = {2020}, url = {https://doi.org/10.1080/17538947.2019.1663948}, doi = {10.1080/17538947.2019.1663948}, timestamp = {Sun, 25 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/digearth/SoilanRFA20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijgi/FernandezPGCCSD20, author = {Tom{\'{a}}s Fern{\'{a}}ndez and Jos{\'{e}} Luis P{\'{e}}rez{-}Garc{\'{\i}}a and Jos{\'{e}} Miguel G{\'{o}}mez{-}L{\'{o}}pez and Javier Cardenal and Julio Calero and Mario S{\'{a}}nchez{-}G{\'{o}}mez and Jorge Delgado and Joaqu{\'{\i}}n Tovar{-}Pescador}, title = {Multitemporal Analysis of Gully Erosion in Olive Groves by Means of Digital Elevation Models Obtained with Aerial Photogrammetric and LiDAR Data}, journal = {{ISPRS} Int. J. Geo Inf.}, volume = {9}, number = {4}, pages = {260}, year = {2020}, url = {https://doi.org/10.3390/ijgi9040260}, doi = {10.3390/IJGI9040260}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijgi/FernandezPGCCSD20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jbi/NaveiraSCGGPCMC20, author = {Miguel Ramos Naveira and Ricardo S{\'{a}}nchez{-}de{-}Madariaga and Jes{\'{u}}s Barros Castro and Lino Carrajo Garc{\'{\i}}a and Guillermo V{\'{a}}zquez Gonz{\'{a}}lez and Santiago P{\'{e}}rez and Mario Pascual Carrasco and Fernando Mart{\'{\i}}n{-}S{\'{a}}nchez and Adolfo Mu{\~{n}}oz Carrero}, title = {An Archetype Query Language interpreter into MongoDB: Managing NoSQL standardized Electronic Health Record extracts systems}, journal = {J. Biomed. Informatics}, volume = {101}, pages = {103339}, year = {2020}, url = {https://doi.org/10.1016/j.jbi.2019.103339}, doi = {10.1016/J.JBI.2019.103339}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jbi/NaveiraSCGGPCMC20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jifs/Anzures-GarciaS20, author = {Mario Anzures{-}Garc{\'{\i}}a and Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez}, title = {{PROMISE:} PRoposing an Ontological Model for developing collaboratIve SystEms}, journal = {J. Intell. Fuzzy Syst.}, volume = {39}, number = {2}, pages = {2545--2557}, year = {2020}, url = {https://doi.org/10.3233/JIFS-179913}, doi = {10.3233/JIFS-179913}, timestamp = {Thu, 10 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jifs/Anzures-GarciaS20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jiii/LaraSV20, author = {Paola Lara and Mario S{\'{a}}nchez and Jorge Villalobos}, title = {Enterprise modeling and operational technologies {(OT)} application in the oil and gas industry}, journal = {J. Ind. Inf. Integr.}, volume = {19}, pages = {100160}, year = {2020}, url = {https://doi.org/10.1016/j.jii.2020.100160}, doi = {10.1016/J.JII.2020.100160}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jiii/LaraSV20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/kais/Salas-ZarateASP20, author = {Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and Giner Alor{-}Hern{\'{a}}ndez and Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and Mario Andr{\'{e}}s Paredes{-}Valverde and Jorge Luis Garc{\'{\i}}a{-}Alcaraz and Rafael Valencia{-}Garc{\'{\i}}a}, title = {Review of English literature on figurative language applied to social networks}, journal = {Knowl. Inf. Syst.}, volume = {62}, number = {6}, pages = {2105--2137}, year = {2020}, url = {https://doi.org/10.1007/s10115-019-01425-3}, doi = {10.1007/S10115-019-01425-3}, timestamp = {Mon, 15 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/kais/Salas-ZarateASP20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/lgrs/BusquierLB20, author = {Mario Busquier and Juan M. Lopez{-}Sanchez and Damian Bargiel}, title = {Added Value of Coherent Copolar Polarimetry at X-Band for Crop-Type Mapping}, journal = {{IEEE} Geosci. Remote. Sens. Lett.}, volume = {17}, number = {5}, pages = {819--823}, year = {2020}, url = {https://doi.org/10.1109/LGRS.2019.2933738}, doi = {10.1109/LGRS.2019.2933738}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/lgrs/BusquierLB20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nca/Alvarez-Arenald20, author = {Angel {\'{A}}lvarez{-}Arenal and H{\'{e}}ctor deLlanos{-}Lanchares and Elena Mart{\'{\i}}n Fern{\'{a}}ndez and Mario Mauvezin{-}Quevedo and Mar{\'{\i}}a Luisa S{\'{a}}nchez Rodr{\'{\i}}guez and Francisco Javier de Cos Juez}, title = {An artificial neural network model for the prediction of bruxism by means of occlusal variables}, journal = {Neural Comput. Appl.}, volume = {32}, number = {5}, pages = {1259--1267}, year = {2020}, url = {https://doi.org/10.1007/s00521-018-3715-7}, doi = {10.1007/S00521-018-3715-7}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nca/Alvarez-Arenald20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/Anzures-GarciaS20, author = {Mario Anzures{-}Garc{\'{\i}}a and Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez}, title = {Enfoque sem{\'{a}}ntico de pol{\'{\i}}ticas para gestionar la conciencia de grupo en Groupware}, journal = {Res. Comput. Sci.}, volume = {149}, number = {8}, pages = {1117--1132}, year = {2020}, url = {https://rcs.cic.ipn.mx/2020\_149\_8/Enfoque\%20semantico\%20de\%20politicas\%20para\%20gestionar\%20la\%20conciencia\%20de\%20grupo\%20en\%20Groupware.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/Anzures-GarciaS20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/BricenoSMODCC20, author = {Gaspar Gonz{\'{a}}lez{-}Brice{\~{n}}o and Abraham S{\'{a}}nchez and Eduardo Ulises Moya{-}S{\'{a}}nchez and Susana Ortega{-}Cisneros and German Alonso Pinedo Diaz and Mario Salvador Garcia Contreras and Beatriz Alvarado Castillo}, title = {Automatic Cropping of Retinal Fundus Photographs using Convolutional Neural Networks}, journal = {Res. Comput. Sci.}, volume = {149}, number = {5}, pages = {161--167}, year = {2020}, url = {https://rcs.cic.ipn.mx/2020\_149\_5/Automatic\%20Cropping\%20of\%20Retinal\%20Fundus\%20Photographs\%20using\%20Convolutional\%20Neural\%20Networks.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/BricenoSMODCC20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/EnriquezGLSPRG20, author = {Karen Andrea Guerrero Enr{\'{\i}}quez and Octavio Jim{\'{e}}nez Gonz{\'{a}}lez and Roberto Pacheco L{\'{o}}pez and Javier Medrano S{\'{a}}nchez and Mario Murguia Perez and Ang{\'{e}}lica Hern{\'{a}}ndez Rayas and Martha Alicia Hern{\'{a}}ndez Gonz{\'{a}}lez}, title = {An{\'{a}}lisis y caracterizaci{\'{o}}n de espectros Raman de tejido neopl{\'{a}}sico e hiperpl{\'{a}}sico de pr{\'{o}}stata}, journal = {Res. Comput. Sci.}, volume = {149}, number = {2}, pages = {87--94}, year = {2020}, url = {https://rcs.cic.ipn.mx/2020\_149\_2/Analisis\%20y\%20caracterizacion\%20de\%20espectros\%20Raman\%20de\%20tejido\%20neoplasico\%20e\%20hiperplasico\%20de\%20prostata.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/EnriquezGLSPRG20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/EstrellaTM20, author = {Guillermo Fern{\'{a}}ndez Estrella and Joel Antonio Trejo{-}S{\'{a}}nchez and Mario Ren{\'{a}}n Moreno{-}Sabido}, title = {Sistema multi-agente para el control de tr{\'{a}}fico urbano para veh{\'{\i}}culos de prioridad}, journal = {Res. Comput. Sci.}, volume = {149}, number = {8}, pages = {713--723}, year = {2020}, url = {https://rcs.cic.ipn.mx/2020\_149\_8/Sistema\%20multi-agente\%20para\%20el\%20control\%20de\%20trafico\%20urbano\%20para\%20vehiculos\%20de\%20prioridad.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/EstrellaTM20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/BusquierLMNGM20, author = {Mario Busquier and Juan M. Lopez{-}Sanchez and Alejandro Mestre{-}Quereda and Elena Navarro and Maria P. Gonz{\'{a}}lez{-}Dugo and Luciano Mateos}, title = {Exploring TanDEM-X Interferometric Products for Crop-Type Mapping}, journal = {Remote. Sens.}, volume = {12}, number = {11}, pages = {1774}, year = {2020}, url = {https://doi.org/10.3390/rs12111774}, doi = {10.3390/RS12111774}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/BusquierLMNGM20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/SoilanJSR20, author = {Mario Soil{\'{a}}n and Andr{\'{e}}s Justo and Ana S{\'{a}}nchez{-}Rodr{\'{\i}}guez and Bel{\'{e}}n Riveiro}, title = {3D Point Cloud to {BIM:} Semi-Automated Framework to Define {IFC} Alignment Entities from MLS-Acquired LiDAR Data of Highway Roads}, journal = {Remote. Sens.}, volume = {12}, number = {14}, pages = {2301}, year = {2020}, url = {https://doi.org/10.3390/rs12142301}, doi = {10.3390/RS12142301}, timestamp = {Fri, 31 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/SoilanJSR20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ress/LozanoZS20, author = {Jorge{-}Mario Lozano and Santiago Zuluaga and Mauricio S{\'{a}}nchez{-}Silva}, title = {Developing flexible management strategies in infrastructure: The sequential expansion problem for infrastructure analysis {(SEPIA)}}, journal = {Reliab. Eng. Syst. Saf.}, volume = {200}, pages = {106951}, year = {2020}, url = {https://doi.org/10.1016/j.ress.2020.106951}, doi = {10.1016/J.RESS.2020.106951}, timestamp = {Mon, 26 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ress/LozanoZS20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/Guerra-SerranoS20, author = {Juan Guerra{-}Serrano and Angel S{\'{a}}nchez{-}Roca and Guillermo Gonz{\'{a}}lez{-}Yero and Mario C. S{\'{a}}nchez{-}Orozco and Mercedes P{\'{e}}rez de la Parte and Emilio Jim{\'{e}}nez Mac{\'{\i}}as and Julio Blanco{-}Fern{\'{a}}ndez}, title = {New Arc Stability Index for Industrial {AC} Three-Phase Electric Arc Furnaces Based on Acoustic Signals}, journal = {Sensors}, volume = {20}, number = {23}, pages = {6840}, year = {2020}, url = {https://doi.org/10.3390/s20236840}, doi = {10.3390/S20236840}, timestamp = {Sat, 25 Dec 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sensors/Guerra-SerranoS20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/SanchezTSGMRPHM20, author = {Jos{\'{e}} Rafael Garc{\'{\i}}a S{\'{a}}nchez and Salvador Tavera{-}Mosqueda and Ram{\'{o}}n Silva{-}Ortigoza and V{\'{\i}}ctor Manuel Hern{\'{a}}ndez Guzm{\'{a}}n and Magdalena Marciano{-}Melchor and Jos{\'{e}} de Jes{\'{u}}s Rubio and Mario Ponce{-}Silva and Miguel Hern{\'{a}}ndez{-}Bola{\~{n}}os and Jes{\'{u}}s Mart{\'{\i}}nez{-}Mart{\'{\i}}nez}, title = {A Novel Dynamic Three-Level Tracking Controller for Mobile Robots Considering Actuators and Power Stage Subsystems: Experimental Assessment}, journal = {Sensors}, volume = {20}, number = {17}, pages = {4959}, year = {2020}, url = {https://doi.org/10.3390/s20174959}, doi = {10.3390/S20174959}, timestamp = {Fri, 25 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sensors/SanchezTSGMRPHM20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcas/SaldanhaSMA20, author = {M{\'{a}}rio Saldanha and Gustavo Sanchez and C{\'{e}}sar A. M. Marcon and Luciano Agostini}, title = {Tile Adaptation for Workload Balancing of 3D-HEVC Encoder in Homogeneous Multicore Systems}, journal = {{IEEE} Trans. Circuits Syst. {I} Fundam. Theory Appl.}, volume = {67-I}, number = {5}, pages = {1704--1714}, year = {2020}, url = {https://doi.org/10.1109/TCSI.2020.2977297}, doi = {10.1109/TCSI.2020.2977297}, timestamp = {Mon, 26 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcas/SaldanhaSMA20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcas/SanchezSFCAM20, author = {Gustavo Sanchez and M{\'{a}}rio Saldanha and Ramon Fernandes and Rodrigo Cataldo and Luciano Agostini and C{\'{e}}sar A. M. Marcon}, title = {3D-HEVC Bipartition Modes Encoder and Decoder Design Targeting High-Resolution Videos}, journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.}, volume = {67-I}, number = {2}, pages = {415--427}, year = {2020}, url = {https://doi.org/10.1109/TCSI.2019.2929977}, doi = {10.1109/TCSI.2019.2929977}, timestamp = {Mon, 26 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcas/SanchezSFCAM20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tce/SanchezSO20, author = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and Daniel D{\'{\i}}az S{\'{a}}nchez and Mario Mu{\~{n}}oz Organero}, title = {Specification and Unattended Deployment of Home Networks at the Edge of the Network}, journal = {{IEEE} Trans. Consumer Electron.}, volume = {66}, number = {4}, pages = {279--288}, year = {2020}, url = {https://doi.org/10.1109/TCE.2020.3018543}, doi = {10.1109/TCE.2020.3018543}, timestamp = {Thu, 27 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tce/SanchezSO20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/SaldanhaSMA20, author = {M{\'{a}}rio Saldanha and Gustavo Sanchez and C{\'{e}}sar A. M. Marcon and Luciano Agostini}, title = {Fast 3D-HEVC Depth Map Encoding Using Machine Learning}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {30}, number = {3}, pages = {850--861}, year = {2020}, url = {https://doi.org/10.1109/TCSVT.2019.2898122}, doi = {10.1109/TCSVT.2019.2898122}, timestamp = {Mon, 26 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcsv/SaldanhaSMA20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tii/SantAnaHSSAN20, author = {Jean Michel de Souza Sant'Ana and Arliones Hoeller and Richard Demo Souza and Samuel Montejo Sanchez and Hirley Alves and Mario de Noronha{-}Neto}, title = {Hybrid Coded Replication in LoRa Networks}, journal = {{IEEE} Trans. Ind. Informatics}, volume = {16}, number = {8}, pages = {5577--5585}, year = {2020}, url = {https://doi.org/10.1109/TII.2020.2966120}, doi = {10.1109/TII.2020.2966120}, timestamp = {Fri, 22 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tii/SantAnaHSSAN20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ahfe/Sanchez-MatuteZ20, author = {Mario Raul Sanchez{-}Matute and Carolina Zayas{-}M{\'{a}}rquez and Mar{\'{\i}}a Marcela Sol{\'{\i}}s{-}Quinteros and Luis Alfredo {\'{A}}vila{-}L{\'{o}}pez}, editor = {Waldemar Karwowski and Ravindra S. Goonetilleke and Shuping Xiong and Richard H. M. Goossens and Atsuo Murata}, title = {Improvement of Efficiency in the Productivity of an Aerospace, Maritime and Military Company in Tijuana, Baja California; Mexico}, booktitle = {Advances in Physical, Social {\&} Occupational Ergonomics - Proceedings of the {AHFE} 2020 Virtual Conferences on Physical Ergonomics and Human Factors, Social {\&} Occupational Ergonomics and Cross-Cultural Decision Making, July 16-20, 2020, {USA}}, series = {Advances in Intelligent Systems and Computing}, volume = {1215}, pages = {421--436}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-3-030-51549-2\_56}, doi = {10.1007/978-3-030-51549-2\_56}, timestamp = {Tue, 07 Nov 2023 08:36:40 +0100}, biburl = {https://dblp.org/rec/conf/ahfe/Sanchez-MatuteZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cec/SanchezOACCT20, author = {Xavier S{\'{a}}nchez and Jos{\'{e}} Carlos Ortiz{-}Bayliss and Iv{\'{a}}n Amaya and Jorge M. Cruz{-}Duarte and Santiago Enrique Conant{-}Pablos and Hugo Terashima{-}Mar{\'{\i}}n}, title = {A Preliminary Study on Feature-independent Hyper-heuristics for the 0/1 Knapsack Problem}, booktitle = {{IEEE} Congress on Evolutionary Computation, {CEC} 2020, Glasgow, United Kingdom, July 19-24, 2020}, pages = {1--8}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/CEC48606.2020.9185671}, doi = {10.1109/CEC48606.2020.9185671}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cec/SanchezOACCT20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cosecivi/RomeroSSMP20, author = {Diego Romero and Mario S{\'{a}}nchez and Jos{\'{e}} M. Sierra and Maximiliano Miranda and Federico Peinado}, editor = {Ra{\'{u}}l Lara{-}Cabrera and Antonio Jos{\'{e}} Fern{\'{a}}ndez Leiva}, title = {Developing an automated planning tool for non-player character behavior}, booktitle = {Proceedings of the {VI} Congreso de la Sociedad Espa{\~{n}}ola para las Ciencias del Videojuego, On-line, October 7-8, 2020}, series = {{CEUR} Workshop Proceedings}, volume = {2719}, pages = {69--77}, publisher = {CEUR-WS.org}, year = {2020}, url = {https://ceur-ws.org/Vol-2719/paper7.pdf}, timestamp = {Fri, 10 Mar 2023 16:22:22 +0100}, biburl = {https://dblp.org/rec/conf/cosecivi/RomeroSSMP20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/MadrugaCP20, author = {Mario Madruga and Yolanda Campos{-}Roca and Carlos J. P{\'{e}}rez}, title = {Robustness Assessment of Automatic Reinke's Edema Diagnosis Systems}, booktitle = {2020 {IEEE} International Conference on Acoustics, Speech and Signal Processing, {ICASSP} 2020, Barcelona, Spain, May 4-8, 2020}, pages = {891--895}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/ICASSP40776.2020.9053676}, doi = {10.1109/ICASSP40776.2020.9053676}, timestamp = {Thu, 01 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icassp/MadrugaCP20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icecsys/MouraSSMPA20, author = {Christopher Moura and M{\'{a}}rio Saldanha and Gustavo Sanchez and C{\'{e}}sar A. M. Marcon and Marcelo Schiavon Porto and Luciano Agostini}, title = {Fast Intra Mode Decision for 3D-HEVC Depth Map Coding using Decision Trees}, booktitle = {27th {IEEE} International Conference on Electronics, Circuits and Systems, {ICECS} 2020, Glasgow, Scotland, UK, November 23-25, 2020}, pages = {1--4}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/ICECS49266.2020.9294919}, doi = {10.1109/ICECS49266.2020.9294919}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icecsys/MouraSSMPA20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceee/Lopez-TapiaRASF20, author = {Andrea L{\'{o}}pez{-}Tapia and Mario Alfredo Reyes{-}Barranca and Griselda Stephany Abarca{-}Jimenez and Luis S{\'{a}}nchez{-}M{\'{a}}rquez and Luis Mart{\'{\i}}n Flores{-}Nava}, title = {Design of position sensor of a linear micromotor based on {CMOS-MEMS} technology}, booktitle = {17th International Conference on Electrical Engineering, Computing Science and Automatic Control, {CCE} 2020, Mexico City, Mexico, November 11-13, 2020}, pages = {1--6}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/CCE50788.2020.9299123}, doi = {10.1109/CCE50788.2020.9299123}, timestamp = {Sun, 07 Feb 2021 14:11:06 +0100}, biburl = {https://dblp.org/rec/conf/iceee/Lopez-TapiaRASF20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceee/MenesesMSM20, author = {Maricela Meneses and Mario Moreno and Alfredo Morales{-}S{\'{a}}nchez and J. C{\'{e}}sar Mendoza}, title = {Effect of the thermal treatments on the emission of a-Si1-xCx: {H} films}, booktitle = {17th International Conference on Electrical Engineering, Computing Science and Automatic Control, {CCE} 2020, Mexico City, Mexico, November 11-13, 2020}, pages = {1--5}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/CCE50788.2020.9299172}, doi = {10.1109/CCE50788.2020.9299172}, timestamp = {Thu, 20 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iceee/MenesesMSM20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceee/Sanchez-Marquez20, author = {Luis S{\'{a}}nchez{-}M{\'{a}}rquez and Mario Alfredo Reyes{-}Barranca and Griselda Stephany Abarca{-}Jimenez and Andrea L{\'{o}}pez{-}Tapia and Luis Mart{\'{\i}}n Flores{-}Nava}, title = {Proposal for a rotary micromotor structure based on {CMOS-MEMS} technology}, booktitle = {17th International Conference on Electrical Engineering, Computing Science and Automatic Control, {CCE} 2020, Mexico City, Mexico, November 11-13, 2020}, pages = {1--6}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/CCE50788.2020.9299176}, doi = {10.1109/CCE50788.2020.9299176}, timestamp = {Sun, 07 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iceee/Sanchez-Marquez20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icict2/Barcelo-Valenzuela20, author = {Mario Barcelo{-}Valenzuela and Carlos Maximiliano Leal{-}Pompa and Gerardo Sanchez{-}Schmitz}, title = {An {IT} Service Management Methodology for an Electoral Public Institution}, booktitle = {3rd International Conference on Information and Computer Technologies, {ICICT} 2020, San Jose, CA, USA, March 9-12, 2020}, pages = {219--223}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/ICICT50521.2020.00041}, doi = {10.1109/ICICT50521.2020.00041}, timestamp = {Tue, 19 May 2020 15:34:02 +0200}, biburl = {https://dblp.org/rec/conf/icict2/Barcelo-Valenzuela20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/SaldanhaSMA20, author = {M{\'{a}}rio Saldanha and Gustavo Sanchez and C{\'{e}}sar A. M. Marcon and Luciano Agostini}, title = {Complexity Analysis Of {VVC} Intra Coding}, booktitle = {{IEEE} International Conference on Image Processing, {ICIP} 2020, Abu Dhabi, United Arab Emirates, October 25-28, 2020}, pages = {3119--3123}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/ICIP40778.2020.9190970}, doi = {10.1109/ICIP40778.2020.9190970}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icip/SaldanhaSMA20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscas/SaldanhaSMA20, author = {M{\'{a}}rio Saldanha and Gustavo Sanchez and C{\'{e}}sar A. M. Marcon and Luciano Agostini}, title = {Fast Partitioning Decision Scheme for Versatile Video Coding Intra-Frame Prediction}, booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2020, Sevilla, Spain, October 10-21, 2020}, pages = {1--5}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/ISCAS45731.2020.9180980}, doi = {10.1109/ISCAS45731.2020.9180980}, timestamp = {Mon, 18 Jan 2021 08:38:59 +0100}, biburl = {https://dblp.org/rec/conf/iscas/SaldanhaSMA20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iticse/SanchezS20, author = {Mario S{\'{a}}nchez and Pedro Salazar}, editor = {Michail N. Giannakos and Guttorm Sindre and Andrew Luxton{-}Reilly and Monica Divitini}, title = {A feedback-oriented platform for deliberate programming practice}, booktitle = {Proceedings of the 2020 {ACM} Conference on Innovation and Technology in Computer Science Education, ITiCSE 2020, Trondheim, Norway, June 15-19, 2020}, pages = {531--532}, publisher = {{ACM}}, year = {2020}, url = {https://doi.org/10.1145/3341525.3393996}, doi = {10.1145/3341525.3393996}, timestamp = {Tue, 08 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iticse/SanchezS20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/micai/Lara-CardenasSA20, author = {Erick Lara{-}C{\'{a}}rdenas and Xavier S{\'{a}}nchez{-}D{\'{\i}}az and Iv{\'{a}}n Amaya and Jorge M. Cruz{-}Duarte and Jos{\'{e}} Carlos Ortiz{-}Bayliss}, editor = {Lourdes Mart{\'{\i}}nez{-}Villase{\~{n}}or and Oscar Herrera{-}Alc{\'{a}}ntara and Hiram E. Ponce and F{\'{e}}lix Castro{-}Espinoza}, title = {A Genetic Programming Framework for Heuristic Generation for the Job-Shop Scheduling Problem}, booktitle = {Advances in Soft Computing - 19th Mexican International Conference on Artificial Intelligence, {MICAI} 2020, Mexico City, Mexico, October 12-17, 2020, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {12468}, pages = {284--295}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-3-030-60884-2\_21}, doi = {10.1007/978-3-030-60884-2\_21}, timestamp = {Mon, 21 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/micai/Lara-CardenasSA20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ssci/Silva-GalvezOLO20, author = {Arturo Silva{-}G{\'{a}}lvez and Jorge Orozco{-}Sanchez and Erick Lara{-}C{\'{a}}rdenas and Jos{\'{e}} Carlos Ortiz{-}Bayliss and Iv{\'{a}}n Amaya and Jorge M. Cruz{-}Duarte and Hugo Terashima{-}Mar{\'{\i}}n}, title = {Discovering Action Regions for Solving the Bin Packing Problem through Hyper-heuristics}, booktitle = {2020 {IEEE} Symposium Series on Computational Intelligence, {SSCI} 2020, Canberra, Australia, December 1-4, 2020}, pages = {822--828}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/SSCI47803.2020.9308538}, doi = {10.1109/SSCI47803.2020.9308538}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ssci/Silva-GalvezOLO20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ssiai/TapiaPCL20, author = {Luis Sanchez Tapia and Marios S. Pattichis and Sylvia Celed{\'{o}}n{-}Pattichis and Carlos L{\'{o}}pez Leiva}, title = {The Importance of the Instantaneous Phase for Face Detection using Simple Convolutional Neural Networks}, booktitle = {{IEEE} Southwest Symposium on Image Analysis and Interpretation, {SSIAI} 2020, Albuquerque, NM, USA, March 29-31, 2020}, pages = {1--4}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/SSIAI49293.2020.9094589}, doi = {10.1109/SSIAI49293.2020.9094589}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ssiai/TapiaPCL20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2001-08168, author = {Jean Michel de Souza Sant'Ana and Arliones Hoeller and Richard Demo Souza and Samuel Montejo S{\'{a}}nchez and Hirley Alves and Mario de Noronha{-}Neto}, title = {Hybrid Coded Replication in LoRa Networks}, journal = {CoRR}, volume = {abs/2001.08168}, year = {2020}, url = {https://arxiv.org/abs/2001.08168}, eprinttype = {arXiv}, eprint = {2001.08168}, timestamp = {Fri, 24 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2001-08168.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/Perez-MedinaGPV19, author = {Jorge Luis P{\'{e}}rez{-}Medina and Mario Gonz{\'{a}}lez and Hennry Mauricio Pilco and Karina Beatriz Jimenes Vargas and Patricia Acosta{-}Vargas and Sandra Sanchez{-}Gordon and Tania Calle{-}Jimenez and Danilo Esparza and Yves Rybarczyk}, title = {Usability Study of a Web-Based Platform for Home Motor Rehabilitation}, journal = {{IEEE} Access}, volume = {7}, pages = {7932--7947}, year = {2019}, url = {https://doi.org/10.1109/ACCESS.2018.2889257}, doi = {10.1109/ACCESS.2018.2889257}, timestamp = {Mon, 26 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/access/Perez-MedinaGPV19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/Sanchez-Martinez19, author = {Juan Jose Sanchez{-}Martinez and Mario Perez{-}Escribano and Enrique Marquez{-}Segura}, title = {Synthesis of Dual-Band Bandpass Filters With Short-Circuited Multiconductor Transmission Lines and Shunt Open Stubs}, journal = {{IEEE} Access}, volume = {7}, pages = {24071--24081}, year = {2019}, url = {https://doi.org/10.1109/ACCESS.2018.2886657}, doi = {10.1109/ACCESS.2018.2886657}, timestamp = {Fri, 12 Apr 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/Sanchez-Martinez19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ascom/SanchezDLBCGQAC19, author = {Bruno S{\'{a}}nchez and Mariano Dom{\'{\i}}nguez and Marcelo Lares and Martin Beroiz and Juan B. Cabral and Sebasti{\'{a}}n Gurovich and Cecilia Qui{\~{n}}ones and Rodolfo A. Artola and Carlos A. Colazo and Mat{\'{\i}}as E. Schneiter and Carla Girardini and Marina Tornatore and Jos Luis Nilo Castell{\'{o}}n and Diego Garc{\'{\i}}a Lambas and Mario C. D{\'{\i}}az}, title = {Machine learning on difference image analysis: {A} comparison of methods for transient detection}, journal = {Astron. Comput.}, volume = {28}, pages = {100284}, year = {2019}, url = {https://doi.org/10.1016/j.ascom.2019.05.002}, doi = {10.1016/J.ASCOM.2019.05.002}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ascom/SanchezDLBCGQAC19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bise/LaraSV19, author = {Paola Lara and Mario E. S{\'{a}}nchez and Jorge Villalobos}, title = {{OT} Modeling: The Enterprise Beyond {IT}}, journal = {Bus. Inf. Syst. Eng.}, volume = {61}, number = {4}, pages = {399--411}, year = {2019}, url = {https://doi.org/10.1007/s12599-018-0543-3}, doi = {10.1007/S12599-018-0543-3}, timestamp = {Fri, 09 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bise/LaraSV19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcisd/Perez-CastilloS19, author = {Yunierkis P{\'{e}}rez{-}Castillo and Stellamaris Sotomayor{-}Burneo and Karina Beatriz Jimenes Vargas and Mario Salvador Gonz{\'{a}}lez{-}Rodr{\'{\i}}guez and Maykel Cruz{-}Monteagudo and Vinicio Armijos{-}Jaramillo and M. Nat{\'{a}}lia Dias Soeiro Cordeiro and Fernanda Borges and Aminael S{\'{a}}nchez{-}Rodr{\'{\i}}guez and Eduardo Tejera}, title = {CompScore: Boosting Structure-Based Virtual Screening Performance by Incorporating Docking Scoring Function Components into Consensus Scoring}, journal = {J. Chem. Inf. Model.}, volume = {59}, number = {9}, pages = {3655--3666}, year = {2019}, url = {https://doi.org/10.1021/acs.jcim.9b00343}, doi = {10.1021/ACS.JCIM.9B00343}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jcisd/Perez-CastilloS19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jd/MuhlbergerSTOBB19, author = {G{\"{u}}nter M{\"{u}}hlberger and Louise Seaward and Melissa Terras and Sofia Ares Oliveira and Vicente Bosch and Maximilian Bryan and Sebastian Colutto and Herv{\'{e}} D{\'{e}}jean and Markus Diem and Stefan Fiel and Basilis Gatos and Albert Greinoecker and Tobias Gr{\"{u}}ning and G{\"{u}}nter Hackl and Vili Haukkovaara and Gerhard Heyer and Lauri Hirvonen and Tobias Hodel and Matti Jokinen and Philip Kahle and Mario Kallio and Fr{\'{e}}d{\'{e}}ric Kaplan and Florian Kleber and Roger Labahn and Eva Maria Lang and S{\"{o}}ren Laube and Gundram Leifert and Georgios Louloudis and Rory McNicholl and Jean{-}Luc Meunier and Johannes Michael and Elena M{\"{u}}hlbauer and Nathanael Philipp and Ioannis Pratikakis and Joan Puigcerver P{\'{e}}rez and Hannelore Putz and George Retsinas and Ver{\'{o}}nica Romero and Robert Sablatnig and Joan{-}Andreu S{\'{a}}nchez and Philip Schofield and Giorgos Sfikas and Christian Sieber and Nikolaos Stamatopoulos and Tobias Strau{\ss} and Tamara Terbul and Alejandro H. Toselli and Berthold Ulreich and Mauricio Villegas and Enrique Vidal and Johanna Walcher and Max Weidemann and Herbert Wurster and Konstantinos Zagoris}, title = {Transforming scholarship in the archives through handwritten text recognition}, journal = {J. Documentation}, volume = {75}, number = {5}, pages = {954--976}, year = {2019}, url = {https://doi.org/10.1108/JD-07-2018-0114}, doi = {10.1108/JD-07-2018-0114}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jd/MuhlbergerSTOBB19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jocs/PrimsCAMLSCD19, author = {Oriol Tint{\'{o}} Prims and Miguel Castrillo and Mario C. Acosta and Oriol Mula{-}Valls and Alicia Sanchez Lorente and Kim Serradell and Ana Cort{\'{e}}s and Francisco J. Doblas{-}Reyes}, title = {Finding, analysing and solving {MPI} communication bottlenecks in Earth System models}, journal = {J. Comput. Sci.}, volume = {36}, year = {2019}, url = {https://doi.org/10.1016/j.jocs.2018.04.015}, doi = {10.1016/J.JOCS.2018.04.015}, timestamp = {Thu, 23 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jocs/PrimsCAMLSCD19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/neuroimage/PremiCDGCAAPGSG19, author = {Enrico Premi and Vince D. Calhoun and Matteo Diano and Stefano Gazzina and Maura Cosseddu and Antonella Alberici and Silvana Archetti and Donata Paternic{\`{o}} and Roberto Gasparotti and John van Swieten and Daniela Galimberti and Raquel S{\'{a}}nchez{-}Valle and Robert Laforce Jr. and Fermin Moreno and Matthis Synofzik and Caroline Graff and Mario Masellis and Maria Carmela Tartaglia and Miren Zulaica}, title = {The inner fluctuations of the brain in presymptomatic Frontotemporal Dementia: The chronnectome fingerprint}, journal = {NeuroImage}, volume = {189}, pages = {645--654}, year = {2019}, url = {https://doi.org/10.1016/j.neuroimage.2019.01.080}, doi = {10.1016/J.NEUROIMAGE.2019.01.080}, timestamp = {Tue, 02 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/neuroimage/PremiCDGCAAPGSG19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pdln/AraujoMDLSCC19, author = {Lourdes Araujo and Juan Mart{\'{\i}}nez{-}Romo and Andr{\'{e}}s Duque and Fernando L{\'{o}}pez{-}Ostenero and Ricardo S{\'{a}}nchez{-}de{-}Madariaga and Adolfo Mu{\~{n}}oz Carrero and Mario Pascual Carrasco}, title = {{EXTRAE:} EXTRacci{\'{o}}n de Asociaciones entre Enfermedades y otros conceptos m{\'{e}}dicos}, journal = {Proces. del Leng. Natural}, volume = {63}, pages = {171--174}, year = {2019}, url = {http://journal.sepln.org/sepln/ojs/ojs/index.php/pln/article/view/6112}, timestamp = {Wed, 17 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pdln/AraujoMDLSCC19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ploscb/BendallMILPOJMR19, author = {Matthew L. Bendall and Miguel de Mulder and Luis Pedro I{\~{n}}iguez and Aar{\'{o}}n Lecanda{-}S{\'{a}}nchez and Marcos P{\'{e}}rez{-}Losada and Mario A. Ostrowski and R. Brad Jones and Lubbertus C. F. Mulder and Gustavo Reyes{-}Ter{\'{a}}n and Keith A. Crandall and Christopher E. Ormsby and Douglas F. Nixon}, title = {Telescope: Characterization of the retrotranscriptome by accurate estimation of transposable element expression}, journal = {PLoS Comput. Biol.}, volume = {15}, number = {9}, year = {2019}, url = {https://doi.org/10.1371/journal.pcbi.1006453}, doi = {10.1371/JOURNAL.PCBI.1006453}, timestamp = {Mon, 26 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ploscb/BendallMILPOJMR19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/SernaLALG19, author = {Mario Serna and Abraham S{\'{a}}nchez L{\'{o}}pez and Mart{\'{\i}}n Estrada Analco and Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and Elberfeld E. P{\'{e}}rez G.}, title = {Navegaci{\'{o}}n de robots m{\'{o}}viles utilizando algoritmos Bugs extendidos}, journal = {Res. Comput. Sci.}, volume = {148}, number = {8}, pages = {159--171}, year = {2019}, url = {https://rcs.cic.ipn.mx/2019\_148\_8/Navegacion\%20de\%20robots\%20moviles\%20utilizando\%20algoritmos\%20Bugs\%20extendidos.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/SernaLALG19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/Mate-GonzalezSB19, author = {Miguel {\'{A}}ngel Mat{\'{e}}{-}Gonz{\'{a}}lez and Luis Javier S{\'{a}}nchez{-}Aparicio and Cristina S{\'{a}}ez Bl{\'{a}}zquez and Pedro Carrasco Garc{\'{\i}}a and David {\'{A}}lvarez{-}Alonso and Mar{\'{\i}}a de Andr{\'{e}}s{-}Herrero and Juan Carlos Garc{\'{\i}}a{-}Davalillo and Diego Gonz{\'{a}}lez{-}Aguilera and Mario Hern{\'{a}}ndez Ruiz and Luis Jord{\'{a}} Bordehore and Carlos L{\'{o}}pez Carnicero and Roc{\'{\i}}o Mora}, title = {On the Combination of Remote Sensing and Geophysical Methods for the Digitalization of the San L{\'{a}}zaro Middle Paleolithic Rock Shelter (Segovia, Central Iberia, Spain)}, journal = {Remote. Sens.}, volume = {11}, number = {17}, pages = {2035}, year = {2019}, url = {https://doi.org/10.3390/rs11172035}, doi = {10.3390/RS11172035}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/Mate-GonzalezSB19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/QSS19, author = {J. Antonio Guzm{\'{a}}n Q. and G. Arturo Sanchez{-}Azofeifa and Mario Marcos do Espirito Santo}, title = {{MODIS} and {PROBA-V} {NDVI} Products Differ when Compared with Observations from Phenological Towers at Four Tropical Dry Forests in the Americas}, journal = {Remote. Sens.}, volume = {11}, number = {19}, pages = {2316}, year = {2019}, url = {https://doi.org/10.3390/rs11192316}, doi = {10.3390/RS11192316}, timestamp = {Tue, 16 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/QSS19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/Sanchez-Rodriguez19, author = {Ana S{\'{a}}nchez{-}Rodr{\'{\i}}guez and Mario Soil{\'{a}}n and Manuel Cabaleiro and Pedro Arias}, title = {Automated Inspection of Railway Tunnels' Power Line Using LiDAR Point Clouds}, journal = {Remote. Sens.}, volume = {11}, number = {21}, pages = {2567}, year = {2019}, url = {https://doi.org/10.3390/rs11212567}, doi = {10.3390/RS11212567}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/remotesensing/Sanchez-Rodriguez19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/TomasPNCPRCCBML19, author = {Roberto Tom{\'{a}}s and Jos{\'{e}} Ignacio Pag{\'{a}}n and Jos{\'{e}} A. Navarro and Miguel Cano and Jos{\'{e}} Luis Pastor and Adri{\'{a}}n J. Riquelme and Mar{\'{\i}}a Cuevas{-}Gonz{\'{a}}lez and Michele Crosetto and Anna Barra and Oriol Monserrat and Juan M. Lopez{-}Sanchez and Alfredo Ram{\'{o}}n and Salvador Ivorra and Matteo Del Soldato and Lorenzo Solari and Silvia Bianchini and Federico Raspini and Fabrizio Novali and Alessandro Ferretti and Mario Costantini and Francesco Trillo and Gerardo Herrera and Nicola Casagli}, title = {Semi-Automatic Identification and Pre-Screening of Geological-Geotechnical Deformational Processes Using Persistent Scatterer Interferometry Datasets}, journal = {Remote. Sens.}, volume = {11}, number = {14}, pages = {1675}, year = {2019}, url = {https://doi.org/10.3390/rs11141675}, doi = {10.3390/RS11141675}, timestamp = {Thu, 16 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/remotesensing/TomasPNCPRCCBML19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sivp/SanchezSAM19, author = {Gustavo Sanchez and M{\'{a}}rio Saldanha and Luciano Agostini and C{\'{e}}sar A. M. Marcon}, title = {Analysis of parallel encoding using tiles in 3D High Efficiency Video Coding}, journal = {Signal Image Video Process.}, volume = {13}, number = {6}, pages = {1079--1086}, year = {2019}, url = {https://doi.org/10.1007/s11760-019-01450-3}, doi = {10.1007/S11760-019-01450-3}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sivp/SanchezSAM19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/soco/PenaBLTPSMGC19, author = {Alejandro Pe{\~{n}}a and Isis Bonet and Christian Lochmuller and Marta S. Tabares and Carlos C. Piedrahita and Carmen C. S{\'{a}}nchez and Lillyana Mar{\'{\i}}a Giraldo Mar{\'{\i}}n and Mario Gongora and Francisco Chiclana}, title = {A fuzzy {ELECTRE} structure methodology to assess big data maturity in healthcare SMEs}, journal = {Soft Comput.}, volume = {23}, number = {20}, pages = {10537--10550}, year = {2019}, url = {https://doi.org/10.1007/s00500-018-3625-8}, doi = {10.1007/S00500-018-3625-8}, timestamp = {Tue, 03 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/soco/PenaBLTPSMGC19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/WuMS19, author = {Chenchen Wu and Mario E. Maga{\~{n}}a and Eduardo Cotilla Sanchez}, title = {Dynamic Frequency and Amplitude Estimation for Three-Phase Unbalanced Power Systems Using the Unscented Kalman Filter}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {68}, number = {9}, pages = {3387--3395}, year = {2019}, url = {https://doi.org/10.1109/TIM.2018.2875605}, doi = {10.1109/TIM.2018.2875605}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/WuMS19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caise/LaraSHVV19, author = {Paola Lara and Mario E. S{\'{a}}nchez and Andrea Herrera and Karol Valdivieso and Jorge Villalobos}, editor = {Cinzia Cappiello and Marcela Ruiz}, title = {Modeling Reverse Logistics Networks: {A} Case Study for {\unicode{8232}}E-Waste Management Policy}, booktitle = {Information Systems Engineering in Responsible Information Systems - CAiSE Forum 2019, Rome, Italy, June 3-7, 2019, Proceedings}, series = {Lecture Notes in Business Information Processing}, volume = {350}, pages = {158--169}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-21297-1\_14}, doi = {10.1007/978-3-030-21297-1\_14}, timestamp = {Fri, 31 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/caise/LaraSHVV19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cisis-spain/SanchezMDE19, author = {Mar{\'{\i}}a Jes{\'{u}}s Santos S{\'{a}}nchez and Mario Miguel and Araceli Queiruga Dios and Ascensi{\'{o}}n Hern{\'{a}}ndez Encinas}, editor = {Francisco Mart{\'{\i}}nez{-}{\'{A}}lvarez and Alicia Troncoso Lora and Jos{\'{e}} Ant{\'{o}}nio S{\'{a}}ez Mu{\~{n}}oz and H{\'{e}}ctor Quinti{\'{a}}n and Emilio Corchado}, title = {Looking for the Antidote for Contaminated Water: Learning Through an Escape Game}, booktitle = {International Joint Conference: 12th International Conference on Computational Intelligence in Security for Information Systems {(CISIS} 2019) and 10th International Conference on EUropean Transnational Education {(ICEUTE} 2019) - Seville, Spain, May 13-15, 2019, Proceedings}, series = {Advances in Intelligent Systems and Computing}, volume = {951}, pages = {217--226}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-20005-3\_22}, doi = {10.1007/978-3-030-20005-3\_22}, timestamp = {Mon, 15 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cisis-spain/SanchezMDE19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/citi/Machorro-CanoPA19, author = {Isaac Machorro{-}Cano and Mario Andr{\'{e}}s Paredes{-}Valverde and Giner Alor{-}Hern{\'{a}}ndez and Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and M{\'{o}}nica Guadalupe Segura Ozuna and Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes}, editor = {Rafael Valencia{-}Garc{\'{\i}}a and Gema Alcaraz{-}M{\'{a}}rmol and Javier del Cioppo{-}Morstadt and N{\'{e}}stor Vera{-}Lucio and Martha Bucaram{-}Leverone}, title = {PESSHIoT: Smart Platform for Monitoring and Controlling Smart Home Devices and Sensors}, booktitle = {Technologies and Innovation - 5th International Conference, {CITI} 2019, Guayaquil, Ecuador, December 2-5, 2019, Proceedings}, series = {Communications in Computer and Information Science}, volume = {1124}, pages = {137--150}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-34989-9\_11}, doi = {10.1007/978-3-030-34989-9\_11}, timestamp = {Thu, 19 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/citi/Machorro-CanoPA19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clei/DivanR19, author = {Mario Jos{\'{e}} Div{\'{a}}n and Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso}, title = {Incorporating Scenarios and States Definitions on Real-Time Entity Monitoring in PAbMM}, booktitle = {{XLV} Latin American Computing Conference, {CLEI} 2019, Panama, September 30 - October 4, 2019}, pages = {1--10}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/CLEI47609.2019.235072}, doi = {10.1109/CLEI47609.2019.235072}, timestamp = {Mon, 15 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/clei/DivanR19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/conielecomp/Ordonez-Sanchez19, author = {Alejandro A. Ordo{\~{n}}ez{-}S{\'{a}}nchez and Omar Jim{\'{e}}nez{-}Ram{\'{\i}}rez and Jos{\'{e}} A. C{\'{a}}rdenas{-}Valderrama and Mario Alan Quiroz{-}Ju{\'{a}}rez and Leonardo Palacios{-}Luengas and Rub{\'{e}}n V{\'{a}}zquez{-}Medina}, title = {Generator of Synthetic Dopaminergic Signals}, booktitle = {International Conference on Electronics, Communications and Computers, {CONIELECOMP} 2019, Cholula, Mexico, February 27 - March 1, 2019}, pages = {31--35}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/CONIELECOMP.2019.8673110}, doi = {10.1109/CONIELECOMP.2019.8673110}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/conielecomp/Ordonez-Sanchez19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hci-collab/LopezGAMCS19, author = {Mario Rossainz L{\'{o}}pez and Carmen Cer{\'{o}}n Garnica and Etelvina Archundia{-}Sierra and Ana Patricia Cervantes M{\'{a}}rquez and David Carrasco{-}Lim{\'{o}}n and B{\'{a}}rbara S{\'{a}}nchez{-}Rinza}, editor = {Pablo H. Ruiz and Vanessa Agredo Delgado}, title = {Parallel Simulation of Digital Logic Circuits Using Message Passing via {CSP} as an Educational Tool}, booktitle = {Human-Computer Interaction - 5th Iberoamerican Workshop, HCI-Collab 2019, Puebla, Mexico, June 19-21, 2019, Revised Selected Papers}, series = {Communications in Computer and Information Science}, volume = {1114}, pages = {284--298}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-37386-3\_21}, doi = {10.1007/978-3-030-37386-3\_21}, timestamp = {Fri, 31 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/hci-collab/LopezGAMCS19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hci-collab/Sanchez-GalvezL19, author = {Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and Juan Manuel Fern{\'{a}}ndez Luna and Mario Anzures{-}Garc{\'{\i}}a}, editor = {Pablo H. Ruiz and Vanessa Agredo Delgado}, title = {A Groupware Usability-Oriented Evaluation Methodology Based on a Fuzzy Linguistic Approach}, booktitle = {Human-Computer Interaction - 5th Iberoamerican Workshop, HCI-Collab 2019, Puebla, Mexico, June 19-21, 2019, Revised Selected Papers}, series = {Communications in Computer and Information Science}, volume = {1114}, pages = {1--16}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-37386-3\_1}, doi = {10.1007/978-3-030-37386-3\_1}, timestamp = {Fri, 31 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/hci-collab/Sanchez-GalvezL19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceee/Lopez-TapiaRASF19, author = {Andrea L{\'{o}}pez{-}Tapia and Mario Alfredo Reyes{-}Barranca and Griselda Stephany Abarca{-}Jimenez and Luis S{\'{a}}nchez{-}M{\'{a}}rquez and Luis Mart{\'{\i}}n Flores{-}Nava and Oliverio Arellano{-}C{\'{a}}rdenas}, title = {Design and analysis of the mechanical structure of a linear micromotor based on {CMOS-MEMS} technology}, booktitle = {16th International Conference on Electrical Engineering, Computing Science and Automatic Control, {CCE} 2019, Mexico City, Mexico, September 11-13, 2019}, pages = {1--6}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/ICEEE.2019.8884566}, doi = {10.1109/ICEEE.2019.8884566}, timestamp = {Fri, 27 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iceee/Lopez-TapiaRASF19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceee/Sanchez-Marquez19, author = {Luis S{\'{a}}nchez{-}M{\'{a}}rquez and Mario Alfredo Reyes{-}Barranca and Griselda Stephany Abarca{-}Jimenez and Andrea L{\'{o}}pez{-}Tapia and Luis Mart{\'{\i}}n Flores{-}Nava and Oliverio Arellano{-}C{\'{a}}rdenas}, title = {Proposal of a speed sensor based on {FGMOS} for a {MEMS} rotatory micromotor}, booktitle = {16th International Conference on Electrical Engineering, Computing Science and Automatic Control, {CCE} 2019, Mexico City, Mexico, September 11-13, 2019}, pages = {1--6}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/ICEEE.2019.8884574}, doi = {10.1109/ICEEE.2019.8884574}, timestamp = {Sun, 25 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iceee/Sanchez-Marquez19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/BernabeGFPHPP19, author = {Sergio Bernab{\'{e}} and Carlos Garc{\'{\i}}a and Rub{\'{e}}n Fern{\'{a}}ndez{-}Beltran and Mercedes Eugenia Paoletti and Juan Mario Haut and Javier Plaza and Antonio Plaza}, title = {Open Multi-Processing Acceleration for Unsupervised Land Cover Categorization Using Probabilistic Latent Semantic Analysis}, booktitle = {2019 {IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS} 2019, Yokohama, Japan, July 28 - August 2, 2019}, pages = {9835--9838}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/IGARSS.2019.8898507}, doi = {10.1109/IGARSS.2019.8898507}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/igarss/BernabeGFPHPP19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscas/SaldanhaSZMA19, author = {M{\'{a}}rio Saldanha and Gustavo Sanchez and Bruno Zatt and C{\'{e}}sar A. M. Marcon and Luciano Agostini}, title = {{TITAN:} Tile Timing-Aware Balancing Algorithm for Speeding Up the 3D-HEVC Intra Coding}, booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2019, Sapporo, Japan, May 26-29, 2019}, pages = {1--5}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/ISCAS.2019.8702475}, doi = {10.1109/ISCAS.2019.8702475}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iscas/SaldanhaSZMA19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iwann/DavilaGPDSR19, author = {Carlos D{\'{a}}vila and Mario Gonz{\'{a}}lez and Jorge Luis P{\'{e}}rez{-}Medina and David Dominguez and {\'{A}}ngel S{\'{a}}nchez and Francisco B. Rodr{\'{\i}}guez}, editor = {Ignacio Rojas and Gonzalo Joya and Andreu Catal{\`{a}}}, title = {Ensemble of Attractor Networks for 2D Gesture Retrieval}, booktitle = {Advances in Computational Intelligence - 15th International Work-Conference on Artificial Neural Networks, {IWANN} 2019, Gran Canaria, Spain, June 12-14, 2019, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {11507}, pages = {488--499}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-20518-8\_41}, doi = {10.1007/978-3-030-20518-8\_41}, timestamp = {Sat, 01 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iwann/DavilaGPDSR19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iwann/GonzalezDDSR19, author = {Mario Gonz{\'{a}}lez and Carlos D{\'{a}}vila and David Dominguez and {\'{A}}ngel S{\'{a}}nchez and Francisco B. Rodr{\'{\i}}guez}, editor = {Ignacio Rojas and Gonzalo Joya and Andreu Catal{\`{a}}}, title = {Fingerprint Retrieval Using a Specialized Ensemble of Attractor Networks}, booktitle = {Advances in Computational Intelligence - 15th International Work-Conference on Artificial Neural Networks, {IWANN} 2019, Gran Canaria, Spain, June 12-14, 2019, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {11507}, pages = {709--719}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-20518-8\_59}, doi = {10.1007/978-3-030-20518-8\_59}, timestamp = {Sat, 01 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iwann/GonzalezDDSR19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iwann/Nimo-JarquezRRY19, author = {Dami{\'{a}}n Nimo{-}J{\'{a}}rquez and Magaly Margarita Narvaez{-}Rios and Mario Rivas{-}S{\'{a}}nchez and Andr{\'{e}}s Y{\'{a}}{\~{n}}ez and Guillermo B{\'{a}}rcena{-}Gonz{\'{a}}lez and Maria De La Paz Guerrero{-}Lebrero and Elisa Guerrero and Pedro L. Galindo}, editor = {Ignacio Rojas and Gonzalo Joya and Andreu Catal{\`{a}}}, title = {{AL4LA:} Active Learning for Text Labeling Based on Paragraph Vectors}, booktitle = {Advances in Computational Intelligence - 15th International Work-Conference on Artificial Neural Networks, {IWANN} 2019, Gran Canaria, Spain, June 12-14, 2019, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {11506}, pages = {679--687}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-20521-8\_56}, doi = {10.1007/978-3-030-20521-8\_56}, timestamp = {Tue, 16 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iwann/Nimo-JarquezRRY19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19, author = {Ziawasch Abedjan and Nozha Boujemaa and Stuart Campbell and Patricia Casla and Supriyo Chatterjea and Sergio Consoli and Crist{\'{o}}bal Costa Soria and Paul Czech and Marija Despenic and Chiara Garattini and Dirk Hamelinck and Adrienne Heinrich and Wessel Kraaij and Jacek Kustra and Aizea Lojo and Marga Martin Sanchez and Miguel Angel Mayer and Matteo Melideo and Ernestina Menasalvas and Frank M{\o}ller Aarestrup and Elvira Narro Artigot and Milan Petkovic and Diego Reforgiato Recupero and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Gisele Roesems Kerremans and Roland Roller and M{\'{a}}rio Rom{\~{a}}o and Stefan R{\"{u}}ping and Felix Sasaki and Wouter Spek and Nenad Stojanovic and Jack Thoms and Andrejs Vasiljevs and Wilfried Verachtert and Roel Wuyts}, editor = {Sergio Consoli and Diego Reforgiato Recupero and Milan Petkovic}, title = {Data Science in Healthcare: Benefits, Challenges and Opportunities}, booktitle = {Data Science for Healthcare - Methodologies and Applications}, pages = {3--38}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-05249-2\_1}, doi = {10.1007/978-3-030-05249-2\_1}, timestamp = {Fri, 22 Mar 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/igisc/2019, editor = {Oscar S. Siordia and Jos{\'{e}} Luis Silv{\'{a}}n{-}C{\'{a}}rdenas and Alejandro Molina{-}Villegas and Gandhi Hern{\'{a}}ndez{-}Chan and Pablo L{\'{o}}pez{-}Ram{\'{\i}}rez and Rodrigo Tapia{-}McClung and Karime Gonz{\'{a}}lez Zuccolotto and Mario Chirinos Colunga}, title = {Proceedings of the 1st International Conference on Geospatial Information Sciences, iGISc 2019, M{\'{e}}rida, Yucat{\'{a}}n, M{\'{e}}xico, October 23-25, 2019}, series = {Kalpa Publications in Computing}, volume = {13}, publisher = {EasyChair}, year = {2019}, url = {https://easychair.org/publications/volume/iGISc\_2019}, timestamp = {Fri, 10 Dec 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/igisc/2019.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1907-07066, author = {Claudia N. S{\'{a}}nchez and Mario Graff}, title = {Selection Heuristics on Semantic Genetic Programming for Classification Problems}, journal = {CoRR}, volume = {abs/1907.07066}, year = {2019}, url = {http://arxiv.org/abs/1907.07066}, eprinttype = {arXiv}, eprint = {1907.07066}, timestamp = {Tue, 23 Jul 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1907-07066.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/candc/ModicaSPOMC18, author = {Maria Vittoria Modica and Jonathan Reinoso S{\'{a}}nchez and Andrea Pasquadibisceglie and Marco Oliverio and Paolo Mariottini and Manuela Cervelli}, title = {Anti-haemostatic compounds from the vampire snail \emph{Cumia reticulata}: Molecular cloning and \emph{in-silico} structure-function analysis}, journal = {Comput. Biol. Chem.}, volume = {75}, pages = {168--177}, year = {2018}, url = {https://doi.org/10.1016/j.compbiolchem.2018.05.014}, doi = {10.1016/J.COMPBIOLCHEM.2018.05.014}, timestamp = {Fri, 13 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/candc/ModicaSPOMC18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/comcom/Sanchez-GarciaG18, author = {Jes{\'{u}}s S{\'{a}}nchez{-}Garc{\'{\i}}a and Jos{\'{e}} M. Garc{\'{\i}}a{-}Campos and Mario Arzamendia and Daniel Guti{\'{e}}rrez{-}Reina and Sergio L. Toral Mar{\'{\i}}n and Derlis Gregor}, title = {A survey on unmanned aerial and aquatic vehicle multi-hop networks: Wireless communications, evaluation tools and applications}, journal = {Comput. Commun.}, volume = {119}, pages = {43--65}, year = {2018}, url = {https://doi.org/10.1016/j.comcom.2018.02.002}, doi = {10.1016/J.COMCOM.2018.02.002}, timestamp = {Tue, 15 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/comcom/Sanchez-GarciaG18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cys/Anzures-GarciaS18, author = {Mario Anzures{-}Garc{\'{\i}}a and Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and Miguel J. Hornos and Patricia Paderewski{-}Rodr{\'{\i}}guez}, title = {A Workflow Ontology to support Knowledge Management in a Group's organizational structure}, journal = {Computaci{\'{o}}n y Sistemas}, volume = {22}, number = {1}, year = {2018}, url = {https://doi.org/10.13053/cys-22-1-2781}, doi = {10.13053/CYS-22-1-2781}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cys/Anzures-GarciaS18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cys/GonzalezSDA18, author = {Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and Jorge Cerezo S{\'{a}}nchez and Mario Bustillo D{\'{\i}}az and Apolonio Ata{-}P{\'{e}}rez}, title = {Recognition and Classification of Sign Language for Spanish}, journal = {Computaci{\'{o}}n y Sistemas}, volume = {22}, number = {1}, year = {2018}, url = {https://doi.org/10.13053/cys-22-1-2780}, doi = {10.13053/CYS-22-1-2780}, timestamp = {Fri, 10 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cys/GonzalezSDA18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cys/Saldana-Gonzalez18, author = {Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and Jorge Cerezo S{\'{a}}nchez and Mario Bustillo D{\'{\i}}az and Apolonio Ata{-}P{\'{e}}rez}, title = {Vision System for the Navigation of a Mobile Robot}, journal = {Computaci{\'{o}}n y Sistemas}, volume = {22}, number = {1}, year = {2018}, url = {https://doi.org/10.13053/cys-22-1-2770}, doi = {10.13053/CYS-22-1-2770}, timestamp = {Fri, 10 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cys/Saldana-Gonzalez18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cys/Sanchez-ReyesRT18, author = {Sergio S{\'{a}}nchez{-}Reyes and Mario E. Rivero{-}Angeles and No{\'{e}} Torres{-}Cruz}, title = {Teletraffic Analysis for VoIP Services in {WLAN} Systems with Handoff Capabilities}, journal = {Computaci{\'{o}}n y Sistemas}, volume = {22}, number = {3}, year = {2018}, url = {https://doi.org/10.13053/cys-22-3-2749}, doi = {10.13053/CYS-22-3-2749}, timestamp = {Thu, 23 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cys/Sanchez-ReyesRT18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fini/Ruiz-GomezGPMTC18, author = {Sa{\'{u}}l J. Ruiz{-}G{\'{o}}mez and Carlos G{\'{o}}mez and Jes{\'{u}}s Poza and Mario Mart{\'{\i}}nez{-}Zarzuela and Miguel {\'{A}}ngel Tola{-}Arribas and M{\'{o}}nica Cano and Roberto Hornero}, title = {Measuring Alterations of Spontaneous {EEG} Neural Coupling in Alzheimer's Disease and Mild Cognitive Impairment by Means of Cross-Entropy Metrics}, journal = {Frontiers Neuroinformatics}, volume = {12}, pages = {76}, year = {2018}, url = {https://doi.org/10.3389/fninf.2018.00076}, doi = {10.3389/FNINF.2018.00076}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/fini/Ruiz-GomezGPMTC18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/iet-spr/MunozMS18, author = {Juan Pablo Mu{\~{n}}oz and Mario E. Maga{\~{n}}a and Eduardo Cotilla Sanchez}, title = {Adaptive master-slave unscented Kalman filter for grid voltage frequency estimation}, journal = {{IET} Signal Process.}, volume = {12}, number = {4}, pages = {496--505}, year = {2018}, url = {https://doi.org/10.1049/iet-spr.2016.0199}, doi = {10.1049/IET-SPR.2016.0199}, timestamp = {Tue, 12 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/iet-spr/MunozMS18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jifs/PenaCAJLMGS18, author = {Mario Pe{\~{n}}a and Mariela Cerrada and Ximena Alvarez and Diana Jad{\'{a}}n and Pablo Lucero and Barrag{\'{a}}n Milton and Rodrigo Guam{\'{a}}n and Ren{\'{e}}{-}Vinicio S{\'{a}}nchez}, title = {Feature engineering based on ANOVA, cluster validity assessment and {KNN} for fault diagnosis in bearings}, journal = {J. Intell. Fuzzy Syst.}, volume = {34}, number = {6}, pages = {3451--3462}, year = {2018}, url = {https://doi.org/10.3233/JIFS-169525}, doi = {10.3233/JIFS-169525}, timestamp = {Thu, 23 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jifs/PenaCAJLMGS18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jucs/Bustos-LopezASS18, author = {Maritza Bustos{-}L{\'{o}}pez and Giner Alor{-}Hern{\'{a}}ndez and Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and Mario Andr{\'{e}}s Paredes{-}Valverde}, title = {EduRP: an Educational Resources Platform based on Opinion Mining and Semantic Web}, journal = {J. Univers. Comput. Sci.}, volume = {24}, number = {11}, pages = {1515--1535}, year = {2018}, url = {http://www.jucs.org/jucs\_24\_11/edurp\_an\_educational\_resources}, timestamp = {Wed, 17 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jucs/Bustos-LopezASS18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/DiazLSVL18, author = {Enrique D{\'{\i}}az and Abraham S{\'{a}}nchez L{\'{o}}pez and Mario Serna and Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca}}, title = {Planificaci{\'{o}}n reactiva de movimientos en tiempo real para robots m{\'{o}}viles}, journal = {Res. Comput. Sci.}, volume = {147}, number = {7}, pages = {115--128}, year = {2018}, url = {https://rcs.cic.ipn.mx/2018\_147\_7/Planificacion\%20reactiva\%20de\%20movimientos\%20en\%20tiempo\%20real\%20para\%20robots\%20moviles.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/DiazLSVL18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/Lopez-RamirezMS18, author = {Pablo L{\'{o}}pez{-}Ram{\'{\i}}rez and Alejandro Molina{-}Villegas and Oscar S{\'{a}}nchez Siordia and Mario Chirinos Colunga and Gandhi Hern{\'{a}}ndez{-}Chan}, title = {Regular Activity Patterns in Spatio-Temporal Events Databases: Multi-Scale Extraction of Geolocated Tweets}, journal = {Res. Comput. Sci.}, volume = {147}, number = {12}, pages = {137--150}, year = {2018}, url = {https://rcs.cic.ipn.mx/2018\_147\_12/Regular\%20Activity\%20Patterns\%20in\%20Spatio-Temporal\%20Events\%20Databases\_\%20Multi-Scale\%20Extraction.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/Lopez-RamirezMS18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tgrs/Nieto-HidalgoGG18, author = {Mario Nieto{-}Hidalgo and Antonio Javier Gallego and Pablo Gil and Antonio Pertusa}, title = {Two-Stage Convolutional Neural Network for Ship and Spill Detection Using {SLAR} Images}, journal = {{IEEE} Trans. Geosci. Remote. Sens.}, volume = {56}, number = {9}, pages = {5217--5230}, year = {2018}, url = {https://doi.org/10.1109/TGRS.2018.2812619}, doi = {10.1109/TGRS.2018.2812619}, timestamp = {Fri, 02 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tgrs/Nieto-HidalgoGG18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tie/MorianoRBMR18, author = {Javier Moriano and Mario Rizo and Emilio Jos{\'{e}} Bueno and Rocio Martin and Francisco J. Rodr{\'{\i}}guez}, title = {A Novel Multifrequency Current Reference Calculation to Mitigate Active Power Fluctuations}, journal = {{IEEE} Trans. Ind. Electron.}, volume = {65}, number = {1}, pages = {810--818}, year = {2018}, url = {https://doi.org/10.1109/TIE.2017.2686319}, doi = {10.1109/TIE.2017.2686319}, timestamp = {Thu, 25 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tie/MorianoRBMR18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tie/OsorioAVPSMB18, author = {Ren{\'{e}} Osorio and J. Marcos Alonso and Nimrod V{\'{a}}zquez and Sergio Pinto and Felipe De Jesus Sorcia{-}Vazquez and Mario Mart{\'{\i}}nez{-}Garc{\'{\i}}a and Luis Manuel Barrera}, title = {Fuzzy Logic Control With an Improved Algorithm for Integrated {LED} Drivers}, journal = {{IEEE} Trans. Ind. Electron.}, volume = {65}, number = {9}, pages = {6994--7003}, year = {2018}, url = {https://doi.org/10.1109/TIE.2018.2795565}, doi = {10.1109/TIE.2018.2795565}, timestamp = {Fri, 22 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tie/OsorioAVPSMB18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/urban/OrganeroRF18, author = {Mario Mu{\~{n}}oz Organero and Ramona Ruiz{-}Blazquez and Luis S{\'{a}}nchez Fern{\'{a}}ndez}, title = {Automatic detection of traffic lights, street crossings and urban roundabouts combining outlier detection and deep learning classification techniques based on {GPS} traces while driving}, journal = {Comput. Environ. Urban Syst.}, volume = {68}, pages = {1--8}, year = {2018}, url = {https://doi.org/10.1016/j.compenvurbsys.2017.09.005}, doi = {10.1016/J.COMPENVURBSYS.2017.09.005}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/urban/OrganeroRF18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amcis/RomeroSV18, author = {Mar{\'{\i}}a Camila Romero and Mario E. S{\'{a}}nchez and Jorge Villalobos}, title = {Executable Business Model Blueprints}, booktitle = {24th Americas Conference on Information Systems, {AMCIS} 2018, New Orleans, LA, USA, August 16-18, 2018}, publisher = {Association for Information Systems}, year = {2018}, url = {https://aisel.aisnet.org/amcis2018/Enterprise/Presentations/5}, timestamp = {Mon, 22 Oct 2018 17:24:45 +0200}, biburl = {https://dblp.org/rec/conf/amcis/RomeroSV18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/appis/Barcena-Gonzalez18, author = {Guillermo B{\'{a}}rcena{-}Gonz{\'{a}}lez and Maria De La Paz Guerrero{-}Lebrero and Elisa Guerrero and D. F. Reyes and B. Nu{\~{n}}ez{-}Moraleda and Mario Rivas{-}S{\'{a}}nchez and Andr{\'{e}}s Y{\'{a}}{\~{n}}ez and David Gonz{\'{a}}lez and Pedro L. Galindo}, editor = {Nicolai Petkov and Nicola Strisciuglio and Carlos Manuel Travieso{-}Gonz{\'{a}}lez}, title = {Application of Super-Resolution Techniques to Transmission Electron Microscopy Images}, booktitle = {Applications of Intelligent Systems - Proceedings of the 1st International {APPIS} Conference 2018, Las Palmas de Gran Canaria, Spain, 8-12 January 2018}, series = {Frontiers in Artificial Intelligence and Applications}, volume = {310}, pages = {42--49}, publisher = {{IOS} Press}, year = {2018}, url = {https://doi.org/10.3233/978-1-61499-929-4-42}, doi = {10.3233/978-1-61499-929-4-42}, timestamp = {Sun, 25 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/appis/Barcena-Gonzalez18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ccia/GatziouraSJ18, author = {Anna Gatzioura and Miquel S{\`{a}}nchez{-}Marr{\`{e}} and Al{\'{\i}}pio M{\'{a}}rio Jorge}, editor = {Zoe Falomir and Karina Gibert and Enric Plaza}, title = {A Study on Contextual Influences on Automatic Playlist Continuation}, booktitle = {Artificial Intelligence Research and Development - Current Challenges, New Trends and Applications, {CCIA} 2018, 21st International Conference of the Catalan Association for Artificial Intelligence, Alt Empord{\`{a}}, Catalonia, Spain, 8-10th October 2018}, series = {Frontiers in Artificial Intelligence and Applications}, volume = {308}, pages = {156--165}, publisher = {{IOS} Press}, year = {2018}, url = {https://doi.org/10.3233/978-1-61499-918-8-156}, doi = {10.3233/978-1-61499-918-8-156}, timestamp = {Wed, 25 Sep 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ccia/GatziouraSJ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/citi/Ochoa-Hernandez18, author = {Jos{\'{e}} Luis Ochoa{-}Hern{\'{a}}ndez and Mario Barcelo{-}Valenzuela and Gerardo Sanchez{-}Schmitz and Raquel Torres Peralta}, editor = {Rafael Valencia{-}Garc{\'{\i}}a and Gema Alcaraz{-}M{\'{a}}rmol and Javier del Cioppo{-}Morstadt and N{\'{e}}stor Vera{-}Lucio and Martha Bucaram{-}Leverone}, title = {Concept Identification from Single-Documents}, booktitle = {Technologies and Innovation - 4th International Conference, {CITI} 2018, Guayaquil, Ecuador, November 6-9, 2018, Proceedings}, series = {Communications in Computer and Information Science}, volume = {883}, pages = {158--173}, publisher = {Springer}, year = {2018}, url = {https://doi.org/10.1007/978-3-030-00940-3\_12}, doi = {10.1007/978-3-030-00940-3\_12}, timestamp = {Tue, 16 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/citi/Ochoa-Hernandez18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clef/AlmagroMIP18, author = {Mario Almagro and Soto Montalvo and Arantza D{\'{\i}}az de Ilarraza and Alicia P{\'{e}}rez}, editor = {Linda Cappellato and Nicola Ferro and Jian{-}Yun Nie and Laure Soulier}, title = {{MAMTRA-MED} at {CLEF} eHealth 2018: {A} Combination of Information Retrieval Techniques and Neural Networks for {ICD-10} Coding of Death Certificates}, booktitle = {Working Notes of {CLEF} 2018 - Conference and Labs of the Evaluation Forum, Avignon, France, September 10-14, 2018}, series = {{CEUR} Workshop Proceedings}, volume = {2125}, publisher = {CEUR-WS.org}, year = {2018}, url = {https://ceur-ws.org/Vol-2125/paper\_110.pdf}, timestamp = {Fri, 10 Mar 2023 16:23:36 +0100}, biburl = {https://dblp.org/rec/conf/clef/AlmagroMIP18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/KristanLMFPZVBL18, author = {Matej Kristan and Ales Leonardis and Jiri Matas and Michael Felsberg and Roman P. Pflugfelder and Luka Cehovin Zajc and Tom{\'{a}}s Voj{\'{\i}}r and Goutam Bhat and Alan Lukezic and Abdelrahman Eldesokey and Gustavo Fern{\'{a}}ndez and {\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and {\'{A}}lvaro Iglesias{-}Arias and A. Aydin Alatan and Abel Gonz{\'{a}}lez{-}Garc{\'{\i}}a and Alfredo Petrosino and Alireza Memarmoghadam and Andrea Vedaldi and Andrej Muhic and Anfeng He and Arnold W. M. Smeulders and Asanka G. Perera and Bo Li and Boyu Chen and Changick Kim and Changsheng Xu and Changzhen Xiong and Cheng Tian and Chong Luo and Chong Sun and Cong Hao and Daijin Kim and Deepak Mishra and Deming Chen and Dong Wang and Dongyoon Wee and Efstratios Gavves and Erhan Gundogdu and Erik Velasco{-}Salido and Fahad Shahbaz Khan and Fan Yang and Fei Zhao and Feng Li and Francesco Battistone and George De Ath and Gorthi R. K. Sai Subrahmanyam and Guilherme Sousa Bastos and Haibin Ling and Hamed Kiani Galoogahi and Hankyeol Lee and Haojie Li and Haojie Zhao and Heng Fan and Honggang Zhang and Horst Possegger and Houqiang Li and Huchuan Lu and Hui Zhi and Huiyun Li and Hyemin Lee and Hyung Jin Chang and Isabela Drummond and Jack Valmadre and Jaime Spencer Martin and Javaan Singh Chahl and Jin Young Choi and Jing Li and Jinqiao Wang and Jinqing Qi and Jinyoung Sung and Joakim Johnander and Jo{\~{a}}o F. Henriques and Jongwon Choi and Joost van de Weijer and Jorge Rodr{\'{\i}}guez Herranz and Jos{\'{e}} M. Mart{\'{\i}}nez and Josef Kittler and Junfei Zhuang and Junyu Gao and Klemen Grm and Lichao Zhang and Lijun Wang and Lingxiao Yang and Litu Rout and Liu Si and Luca Bertinetto and Lutao Chu and Manqiang Che and Mario Edoardo Maresca and Martin Danelljan and Ming{-}Hsuan Yang and Mohamed H. Abdelpakey and Mohamed S. Shehata and Myunggu Kang and Namhoon Lee and Ning Wang and Ondrej Miksik and Payman Moallem and Pablo Vicente{-}Mo{\~{n}}ivar and Pedro Senna and Peixia Li and Philip H. S. Torr and Priya Mariam Raju and Ruihe Qian and Qiang Wang and Qin Zhou and Qing Guo and Rafael Martin Nieto and Rama Krishna Sai Subrahmanyam Gorthi and Ran Tao and Richard Bowden and Richard M. Everson and Runling Wang and Sangdoo Yun and Seokeon Choi and Sergio Vivas and Shuai Bai and Shuangping Huang and Sihang Wu and Simon Hadfield and Siwen Wang and Stuart Golodetz and Ming Tang and Tianyang Xu and Tianzhu Zhang and Tobias Fischer and Vincenzo Santopietro and Vitomir Struc and Wei Wang and Wangmeng Zuo and Wei Feng and Wei Wu and Wei Zou and Weiming Hu and Wengang Zhou and Wenjun Zeng and Xiaofan Zhang and Xiaohe Wu and Xiao{-}Jun Wu and Xinmei Tian and Yan Li and Yan Lu and Yee Wei Law and Yi Wu and Yiannis Demiris and Yicai Yang and Yifan Jiao and Yuhong Li and Yunhua Zhang and Yuxuan Sun and Zheng Zhang and Zheng Zhu and Zhen{-}Hua Feng and Zhihui Wang and Zhiqun He}, editor = {Laura Leal{-}Taix{\'{e}} and Stefan Roth}, title = {The Sixth Visual Object Tracking {VOT2018} Challenge Results}, booktitle = {Computer Vision - {ECCV} 2018 Workshops - Munich, Germany, September 8-14, 2018, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {11129}, pages = {3--53}, publisher = {Springer}, year = {2018}, url = {https://doi.org/10.1007/978-3-030-11009-3\_1}, doi = {10.1007/978-3-030-11009-3\_1}, timestamp = {Mon, 26 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/eccv/KristanLMFPZVBL18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/SaldanhaSMA18, author = {M{\'{a}}rio Saldanha and Gustavo Sanchez and C{\'{e}}sar A. M. Marcon and Luciano Volcan Agostini}, title = {Fast 3D-Hevc Depth Maps Intra-Frame Prediction Using Data Mining}, booktitle = {2018 {IEEE} International Conference on Acoustics, Speech and Signal Processing, {ICASSP} 2018, Calgary, AB, Canada, April 15-20, 2018}, pages = {1738--1742}, publisher = {{IEEE}}, year = {2018}, url = {https://doi.org/10.1109/ICASSP.2018.8462283}, doi = {10.1109/ICASSP.2018.8462283}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icassp/SaldanhaSMA18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ipmu/ValdezGLG18, author = {Mario Garc{\'{\i}}a Valdez and Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and Lucero Lara and Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez}, editor = {Jes{\'{u}}s Medina and Manuel Ojeda{-}Aciego and Jos{\'{e}} Luis Verdegay Galdeano and Irina Perfilieva and Bernadette Bouchon{-}Meunier and Ronald R. Yager}, title = {Increasing Performance via Gamification in a Volunteer-Based Evolutionary Computation System}, booktitle = {Information Processing and Management of Uncertainty in Knowledge-Based Systems. Applications - 17th International Conference, {IPMU} 2018, C{\'{a}}diz, Spain, June 11-15, 2018, Proceedings, Part {III}}, series = {Communications in Computer and Information Science}, volume = {855}, pages = {342--353}, publisher = {Springer}, year = {2018}, url = {https://doi.org/10.1007/978-3-319-91479-4\_29}, doi = {10.1007/978-3-319-91479-4\_29}, timestamp = {Thu, 07 Jan 2021 08:57:40 +0100}, biburl = {https://dblp.org/rec/conf/ipmu/ValdezGLG18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ni/GarciaMFNMS18, author = {Jessica Juarez Garc{\'{\i}}a and Adriana Jord{\'{a}}n Morales and Lizbeth Garc{\'{\i}}a Fern{\'{a}}ndez and Reyna Rosas Negrete and Mario Enrique Rend{\'{o}}n Macias and Sylvia Claudine Ram{\'{\i}}rez S{\'{a}}nchez}, editor = {Ann Kristin Roteg{\aa}rd and Diane J. Skiba and Sayonara F. F. Barbosa and Angelica G. Davalos Alc{\'{a}}zar}, title = {Use of Distraction to Reduce Pain in Venipunture when a Venoclysis Is Placed}, booktitle = {Nursing Informatics 2018 - {ICT} to Improve Quality and Safety at the Point of Care, Proceedings of the 14th International Congress on Nursing Informatics, Guadalajara, Mexico, June 6-8, 2018}, series = {Studies in Health Technology and Informatics}, volume = {250}, pages = {24--25}, publisher = {{IOS} Press}, year = {2018}, url = {https://doi.org/10.3233/978-1-61499-872-3-24}, doi = {10.3233/978-1-61499-872-3-24}, timestamp = {Tue, 09 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ni/GarciaMFNMS18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rice/SanchezGSG18, author = {Claudia N. S{\'{a}}nchez and Sebasti{\'{a}}n Guti{\'{e}}rrez and Julieta Dom{\'{\i}}nguez{-}Soberanes and Mario Graff}, title = {Landscape images distance using kullback leibler divergence}, booktitle = {Proceedings of the 2018 {IEEE} International Conference on Research in Intelligent and Computing in Engineering, {RICE} 2018, San Salvador, El Salvador, August 22-24, 2018}, pages = {1--5}, publisher = {{IEEE}}, year = {2018}, url = {https://doi.org/10.1109/RICE.2018.8627908}, doi = {10.1109/RICE.2018.8627908}, timestamp = {Tue, 23 Apr 2024 09:24:14 +0200}, biburl = {https://dblp.org/rec/conf/rice/SanchezGSG18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sbcci/SanchezSAM18, author = {Gustavo Sanchez and M{\'{a}}rio Saldanha and Luciano Volcan Agostini and C{\'{e}}sar A. M. Marcon}, title = {Hardware-Oriented Wedgelet Evaluation Skip for {DMM-1} in 3D-HEVC}, booktitle = {31st Symposium on Integrated Circuits and Systems Design, {SBCCI} 2018, Bento Gon{\c{c}}alves, RS, Brazil, August 27-31, 2018}, pages = {1--5}, publisher = {{IEEE}}, year = {2018}, url = {https://doi.org/10.1109/SBCCI.2018.8533231}, doi = {10.1109/SBCCI.2018.8533231}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sbcci/SanchezSAM18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sepln/GraffMTMSOS18, author = {Mario Graff and Sabino Miranda{-}Jim{\'{e}}nez and Eric Sadit Tellez and Daniela Moctezuma and Vladimir Salgado and Jos{\'{e}} Ortiz{-}Bejar and Claudia N. S{\'{a}}nchez}, editor = {Paolo Rosso and Julio Gonzalo and Raquel Mart{\'{\i}}nez and Soto Montalvo and Jorge Carrillo de Albornoz}, title = {{INGEOTEC} at {MEX-A3T:} Author Profiling and Aggressiveness Analysis in Twitter Using {\(\mu\)}TC and EvoMSA}, booktitle = {Proceedings of the Third Workshop on Evaluation of Human Language Technologies for Iberian Languages (IberEval 2018) co-located with 34th Conference of the Spanish Society for Natural Language Processing {(SEPLN} 2018), Sevilla, Spain, September 18th, 2018}, series = {{CEUR} Workshop Proceedings}, volume = {2150}, pages = {128--133}, publisher = {CEUR-WS.org}, year = {2018}, url = {https://ceur-ws.org/Vol-2150/MEX-A3T\_paper6.pdf}, timestamp = {Wed, 17 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sepln/GraffMTMSOS18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cbm/NaranjoSMBG17, author = {Claudia Carricarte Naranjo and Lazaro M. Sanchez{-}Rodriguez and Marta Brown Mart{\'{\i}}nez and Mario Est{\'{e}}vez B{\'{a}}ez and Andr{\'{e}}s Machado Garc{\'{\i}}a}, title = {Permutation entropy analysis of heart rate variability for the assessment of cardiovascular autonomic neuropathy in type 1 diabetes mellitus}, journal = {Comput. Biol. Medicine}, volume = {86}, pages = {90--97}, year = {2017}, url = {https://doi.org/10.1016/j.compbiomed.2017.05.003}, doi = {10.1016/J.COMPBIOMED.2017.05.003}, timestamp = {Wed, 02 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cbm/NaranjoSMBG17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/GonzalezDSR17, author = {Mario Gonz{\'{a}}lez and David Dominguez and {\'{A}}ngel S{\'{a}}nchez and Francisco B. Rodr{\'{\i}}guez}, title = {Increase attractor capacity using an ensembled neural network}, journal = {Expert Syst. Appl.}, volume = {71}, pages = {206--215}, year = {2017}, url = {https://doi.org/10.1016/j.eswa.2016.11.035}, doi = {10.1016/J.ESWA.2016.11.035}, timestamp = {Sat, 01 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eswa/GonzalezDSR17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/TellezMGMSV17, author = {Eric Sadit Tellez and Sabino Miranda{-}Jim{\'{e}}nez and Mario Graff and Daniela Moctezuma and Oscar S. Siordia and Elio{-}Aten{\'{o}}genes Villase{\~{n}}or}, title = {A case study of Spanish text transformations for twitter sentiment analysis}, journal = {Expert Syst. Appl.}, volume = {81}, pages = {457--471}, year = {2017}, url = {https://doi.org/10.1016/j.eswa.2017.03.071}, doi = {10.1016/J.ESWA.2017.03.071}, timestamp = {Wed, 17 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eswa/TellezMGMSV17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ett/ContrerasCT17, author = {David Contreras and Mario Castro and David S{\'{a}}nchez de la Torre}, title = {Performance evaluation of bluetooth low energy in indoor positioning systems}, journal = {Trans. Emerg. Telecommun. Technol.}, volume = {28}, number = {1}, year = {2017}, url = {https://doi.org/10.1002/ett.2864}, doi = {10.1002/ETT.2864}, timestamp = {Wed, 04 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ett/ContrerasCT17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijcopi/LorancaAVLSD17, author = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and Mart{\'{\i}}n Estrada Analco and Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and Abraham S{\'{a}}nchez L{\'{o}}pez and Jorge Cerezo S{\'{a}}nchez and Mario Bustillo D{\'{\i}}az}, title = {Quadratic Assignation Problem: {A} solution approach with parallel {GRASP}}, journal = {Int. J. Comb. Optim. Probl. Informatics}, volume = {8}, number = {3}, pages = {33--38}, year = {2017}, url = {https://ijcopi.org/index.php/ojs/article/view/16}, timestamp = {Thu, 24 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijcopi/LorancaAVLSD17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijcta/OsorioAPMVPM17, author = {Ren{\'{e}} Osorio and Jos{\'{e}} Marcos Alonso and Sergio Pinto and Gilberto Mart{\'{\i}}nez and Nimrod V{\'{a}}zquez and Mario Ponce{-}Silva and A. J. Martinez}, title = {Simplified electrical modelling of power LEDs for {DC-DC} converter analysis and simulation}, journal = {Int. J. Circuit Theory Appl.}, volume = {45}, number = {11}, pages = {1760--1772}, year = {2017}, url = {https://doi.org/10.1002/cta.2355}, doi = {10.1002/CTA.2355}, timestamp = {Mon, 15 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijcta/OsorioAPMVPM17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jaihc/PastorMSNC17, author = {Francisco Javier Ferr{\'{a}}ndez Pastor and Higinio Mora Mora and Jos{\'{e}}{-}Luis S{\'{a}}nchez{-}Romero and Mario Nieto{-}Hidalgo and Juan Manuel Garc{\'{\i}}a Chamizo}, title = {Interpreting human activity from electrical consumption data using reconfigurable hardware and hidden Markov models}, journal = {J. Ambient Intell. Humaniz. Comput.}, volume = {8}, number = {4}, pages = {469--483}, year = {2017}, url = {https://doi.org/10.1007/s12652-016-0431-y}, doi = {10.1007/S12652-016-0431-Y}, timestamp = {Fri, 09 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jaihc/PastorMSNC17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jrtip/SaldanhaSZPA17, author = {M{\'{a}}rio Saldanha and Gustavo Sanchez and Bruno Zatt and Marcelo Schiavon Porto and Luciano Volcan Agostini}, title = {Energy-aware scheme for the 3D-HEVC depth maps prediction}, journal = {J. Real Time Image Process.}, volume = {13}, number = {1}, pages = {55--69}, year = {2017}, url = {https://doi.org/10.1007/s11554-016-0597-8}, doi = {10.1007/S11554-016-0597-8}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jrtip/SaldanhaSZPA17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/midm/Sanchez-de-Madariaga17, author = {Ricardo S{\'{a}}nchez{-}de{-}Madariaga and Adolfo Mu{\~{n}}oz and Raimundo Lozano{-}Rub{\'{\i}} and Pablo Serrano{-}Balazote and Antonio L. Castro and Oscar Moreno and Mario Pascual Carrasco}, title = {Examining database persistence of {ISO/EN} 13606 standardized electronic health record extracts: relational vs. NoSQL approaches}, journal = {{BMC} Medical Informatics Decis. Mak.}, volume = {17}, number = {1}, pages = {123:1--123:14}, year = {2017}, url = {https://doi.org/10.1186/s12911-017-0515-4}, doi = {10.1186/S12911-017-0515-4}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/midm/Sanchez-de-Madariaga17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nature/DudasCBTBFPLAAB17, author = {Gytis Dudas and Luiz Max Carvalho and Trevor Bedford and Andrew J. Tatem and Guy Baele and Nuno R. Faria and Daniel J. Park and Jason T. Ladner and Armando Arias and Danny Asogun and Filip Bielejec and Sarah L. Caddy and Matthew Cotten and Jonathan D'Ambrozio and Simon Dellicour and Antonino Di Caro and Joseph W. Diclaro and Sophie Duraffour and Michael J. Elmore and Lawrence S. Fakoli and Ousmane Faye and Merle L. Gilbert and Sahr M. Gevao and Stephen Gire and Adrianne Gladden{-}Young and Andreas Gnirke and Augustine Goba and Donald S. Grant and Bart L. Haagmans and Julian A. Hiscox and Umaru Jah and Jeffrey R. Kugelman and Di Liu and Jia Lu and Christine M. Malboeuf and Suzanne Mate and David A. Matthews and Christian B. Matranga and Luke W. Meredith and James Qu and Joshua Quick and Suzan D. Pas and My V. T. Phan and Georgios Pollakis and Chantal B. Reusken and Mariano Sanchez{-}Lockhart and Stephen F. Schaffner and John S. Schieffelin and Rachel S. G. Sealfon and Etienne Simon{-}Loriere and Saskia L. Smits and Kilian Stoecker and Lucy Thorne and Ekaete Alice Tobin and Mohamed A. Vandi and Simon J. Watson and Kendra West and Shannon Whitmer and Michael R. Wiley and Sarah M. Winnicki and Shirlee Wohl and Roman W{\"{o}}lfel and Nathan L. Yozwiak and Kristian G. Andersen and Sylvia O. Blyden and Fatorma Bolay and Miles W. Carroll and Bernice Dahn and Boubacar Diallo and Pierre Formenty and Christophe Fraser and George F. Gao and Robert F. Garry and Ian Goodfellow and Stephan G{\"{u}}nther and Christian T. Happi and Edward C. Holmes and Brima Kargbo and Sakoba Ke{\"{\i}}ta and Paul Kellam and Marion Koopmans and Jens H. Kuhn and Nicholas J. Loman and N'Faly Magassouba and Dhamari Naidoo and Stuart T. Nichol and Tolbert Nyenswah and Gustavo F. Palacios and Oliver G. Pybus and Pardis C. Sabeti and Amadou Sall and Ute Str{\"{o}}her and Isatta Wurie and Marc A. Suchard and Philippe Lemey and Andrew Rambaut}, title = {Virus genomes reveal factors that spread and sustained the Ebola epidemic}, journal = {Nat.}, volume = {544}, number = {7650}, pages = {309--315}, year = {2017}, url = {https://doi.org/10.1038/nature22040}, doi = {10.1038/NATURE22040}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/nature/DudasCBTBFPLAAB17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pdln/SanchezPVAA17, author = {Francisco Garc{\'{\i}}a{-}S{\'{a}}nchez and Mario Andr{\'{e}}s Paredes{-}Valverde and Rafael Valencia{-}Garc{\'{\i}}a and Gema Alcaraz{-}M{\'{a}}rmol and {\'{A}}ngela Almela}, title = {{KBS4FIA:} Leveraging advanced knowledge-based systems for financial information analysis}, journal = {Proces. del Leng. Natural}, volume = {59}, pages = {145--148}, year = {2017}, url = {http://journal.sepln.org/sepln/ojs/ojs/index.php/pln/article/view/5507}, timestamp = {Wed, 17 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pdln/SanchezPVAA17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/TellezMGMSS17, author = {Eric Sadit Tellez and Sabino Miranda{-}Jim{\'{e}}nez and Mario Graff and Daniela Moctezuma and Ranyart Rodrigo Su{\'{a}}rez and Oscar S{\'{a}}nchez Siordia}, title = {A simple approach to multilingual polarity classification in Twitter}, journal = {Pattern Recognit. Lett.}, volume = {94}, pages = {68--74}, year = {2017}, url = {https://doi.org/10.1016/j.patrec.2017.05.024}, doi = {10.1016/J.PATREC.2017.05.024}, timestamp = {Wed, 17 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/prl/TellezMGMSS17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sosym/Sanchez-Gonzalez17, author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and F{\'{e}}lix Garc{\'{\i}}a and Francisco Ruiz and Mario Piattini}, title = {A case study about the improvement of business process models driven by indicators}, journal = {Softw. Syst. Model.}, volume = {16}, number = {3}, pages = {759--788}, year = {2017}, url = {https://doi.org/10.1007/s10270-015-0482-0}, doi = {10.1007/S10270-015-0482-0}, timestamp = {Fri, 18 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sosym/Sanchez-Gonzalez17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcas/ReyesSPH17, author = {Benjam{\'{\i}}n T. Reyes and Raul M. Sanchez and Ariel L. Pola and Mario R. Hueda}, title = {Design and Experimental Evaluation of a Time-Interleaved {ADC} Calibration Algorithm for Application in High-Speed Communication Systems}, journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.}, volume = {64-I}, number = {5}, pages = {1019--1030}, year = {2017}, url = {https://doi.org/10.1109/TCSI.2016.2636209}, doi = {10.1109/TCSI.2016.2636209}, timestamp = {Mon, 20 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcas/ReyesSPH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/RodriguezOMM17, author = {Mario Rodr{\'{\i}}guez and Carlos Orrite and Carlos Medrano and Dimitrios Makris}, title = {One-Shot Learning of Human Activity With an {MAP} Adapted {GMM} and Simplex-HMM}, journal = {{IEEE} Trans. Cybern.}, volume = {47}, number = {7}, pages = {1769--1780}, year = {2017}, url = {https://doi.org/10.1109/TCYB.2016.2558447}, doi = {10.1109/TCYB.2016.2558447}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcyb/RodriguezOMM17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tvlsi/GarridoSVG17, author = {Mario Garrido and Miguel Angel S{\'{a}}nchez and Mar{\'{\i}}a Luisa L{\'{o}}pez Vallejo and Jes{\'{u}}s Grajal}, title = {A 4096-Point Radix-4 Memory-Based {FFT} Using {DSP} Slices}, journal = {{IEEE} Trans. Very Large Scale Integr. Syst.}, volume = {25}, number = {1}, pages = {375--379}, year = {2017}, url = {https://doi.org/10.1109/TVLSI.2016.2567784}, doi = {10.1109/TVLSI.2016.2567784}, timestamp = {Mon, 26 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tvlsi/GarridoSVG17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bis/SaenzCSV17, author = {Juan Pablo S{\'{a}}enz and Steve C{\'{a}}rdenas and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Witold Abramowicz}, title = {Semi-automated Model-Based Generation of Enterprise Architecture Deliverables}, booktitle = {Business Information Systems - 20th International Conference, {BIS} 2017, Poznan, Poland, June 28-30, 2017, Proceedings}, series = {Lecture Notes in Business Information Processing}, volume = {288}, pages = {59--73}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-59336-4\_5}, doi = {10.1007/978-3-319-59336-4\_5}, timestamp = {Sat, 05 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/bis/SaenzCSV17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clihc/GomezSLR17, author = {Nancy Lizbeth Cruz G{\'{o}}mez and {\'{A}}ngel Quintero S{\'{a}}nchez and Eneas Kevin Garc{\'{\i}}a L{\'{o}}pez and Mario Alberto Moreno Rocha}, title = {{SBK:} Smart Braille Keyboard for Learning Braille Literacy in Blind or Visually Impaired People}, booktitle = {Proceedings of the 8th Latin American Conference on Human-Computer Interaction, {CLIHC} '17, Antigua Guatemala, Guatemala, November 8-10, 2017}, pages = {26:1--26:4}, publisher = {{ACM}}, year = {2017}, url = {https://doi.org/10.1145/3151470.3156645}, doi = {10.1145/3151470.3156645}, timestamp = {Mon, 06 Nov 2023 17:08:49 +0100}, biburl = {https://dblp.org/rec/conf/clihc/GomezSLR17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clihc/HerreraGSC17, author = {Andres E. Acevedo Herrera and Garc{\'{\i}}a Gonz{\'{a}}lez Gabriel and Luis {\'{A}}ngel Ort{\'{\i}}z S{\'{a}}nchez and Mario David May Cuevas}, title = {Light Cane: An Augmented Blind Cane to Help Users to Cross the Street}, booktitle = {Proceedings of the 8th Latin American Conference on Human-Computer Interaction, {CLIHC} '17, Antigua Guatemala, Guatemala, November 8-10, 2017}, pages = {13:1--13:4}, publisher = {{ACM}}, year = {2017}, url = {https://doi.org/10.1145/3151470.3156635}, doi = {10.1145/3151470.3156635}, timestamp = {Thu, 25 Nov 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/clihc/HerreraGSC17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clihc/RochaSLG17, author = {Mario Alberto Moreno Rocha and {\'{A}}ngel Quintero S{\'{a}}nchez and Eneas Kevin Garc{\'{\i}}a L{\'{o}}pez and Nancy Lizbeth Cruz G{\'{o}}mez}, title = {Incorporating Technology into Braille Learning Through a User-Centered Methodology}, booktitle = {Proceedings of the 8th Latin American Conference on Human-Computer Interaction, {CLIHC} '17, Antigua Guatemala, Guatemala, November 8-10, 2017}, pages = {15:1--15:4}, publisher = {{ACM}}, year = {2017}, url = {https://doi.org/10.1145/3151470.3156638}, doi = {10.1145/3151470.3156638}, timestamp = {Thu, 25 Nov 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/clihc/RochaSLG17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/conf-irm/GiraldoHSV17, author = {David Giraldo and Andrea Herrera and Mario E. S{\'{a}}nchez and Jorge Villalobos}, title = {Analysis of {ICT} services by observing "fit for use" attributes}, booktitle = {2017 International Conference on Information Resources Management - Democratization and Participation: People's Roles in Digital World, {CONF-IRM} 2017, Santiago de Chile, Chile, May 17-19, 2017}, pages = {3}, year = {2017}, url = {http://aisel.aisnet.org/confirm2017/3}, timestamp = {Tue, 22 Aug 2017 11:34:43 +0200}, biburl = {https://dblp.org/rec/conf/conf-irm/GiraldoHSV17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/csedu/CasasSV17, author = {Lina Casas and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Paula Escudeiro and Gennaro Costagliola and Susan Zvacek and James Onohuome Uhomoibhi and Bruce M. McLaren}, title = {Using an {IT} Laboratory for Training {IT} Architects}, booktitle = {{CSEDU} 2017 - Proceedings of the 9th International Conference on Computer Supported Education, Volume 1, Porto, Portugal, April 21-23, 2017}, pages = {108--119}, publisher = {SciTePress}, year = {2017}, url = {https://doi.org/10.5220/0006319901080119}, doi = {10.5220/0006319901080119}, timestamp = {Fri, 16 Jun 2017 14:43:56 +0200}, biburl = {https://dblp.org/rec/conf/csedu/CasasSV17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/RodriguezOMM17, author = {Mario Rodr{\'{\i}}guez and Carlos Orrite and Carlos Medrano and Dimitrios Makris}, title = {Fast Simplex-HMM for One-Shot Learning Activity Recognition}, booktitle = {2017 {IEEE} Conference on Computer Vision and Pattern Recognition Workshops, {CVPR} Workshops 2017, Honolulu, HI, USA, July 21-26, 2017}, pages = {1259--1266}, publisher = {{IEEE} Computer Society}, year = {2017}, url = {https://doi.org/10.1109/CVPRW.2017.166}, doi = {10.1109/CVPRW.2017.166}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/RodriguezOMM17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/edoc/NaranjoSV17, author = {David Naranjo and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Sylvain Hall{\'{e}} and Roger Villemaire and Robert Lagerstr{\"{o}}m}, title = {Visualizing the Bias of Enterprise Metamodels towards Nuanced Concepts}, booktitle = {21st {IEEE} International Enterprise Distributed Object Computing Conference, {EDOC} 2017, Quebec City, QC, Canada, October 10-13, 2017}, pages = {30--39}, publisher = {{IEEE} Computer Society}, year = {2017}, url = {https://doi.org/10.1109/EDOC.2017.14}, doi = {10.1109/EDOC.2017.14}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/edoc/NaranjoSV17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emoocs/RivoMCCMGAAA17, author = {Manuel Sanjurjo Rivo and Mario Merino and Filippo Cichocki and Xin Chen and David Morante and Daniel P{\'{e}}rez Grande and Gonzalo S{\'{a}}nchez Arriaga and Manuel Soler Arnedo and Eduardo Ahedo}, editor = {Carlos Delgado Kloos and Carlos Alario{-}Hoyos and Rocael Hern{\'{a}}ndez Rizzardini}, title = {The Conquest of Space: un Curso {MOOC} y {SPOC} en Ingenier{\'{\i}}a Aeroespacial}, booktitle = {Actas de la Jornada de MOOCs en Espa{\~{n}}ol en EMOOCs 2017, EMOOCs-ES 2017, Madrid, Spain, May 26, 2017}, series = {{CEUR} Workshop Proceedings}, volume = {1836}, pages = {91--97}, publisher = {CEUR-WS.org}, year = {2017}, url = {https://ceur-ws.org/Vol-1836/10.pdf}, timestamp = {Fri, 10 Mar 2023 16:22:15 +0100}, biburl = {https://dblp.org/rec/conf/emoocs/RivoMCCMGAAA17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eusipco/SanchezSAM17, author = {Gustavo Sanchez and M{\'{a}}rio Saldanha and Luciano Volcan Agostini and C{\'{e}}sar A. M. Marcon}, title = {Depth modeling modes complexity control system for the 3D-HEVC video encoder}, booktitle = {25th European Signal Processing Conference, {EUSIPCO} 2017, Kos, Greece, August 28 - September 2, 2017}, pages = {1021--1025}, publisher = {{IEEE}}, year = {2017}, url = {https://doi.org/10.23919/EUSIPCO.2017.8081362}, doi = {10.23919/EUSIPCO.2017.8081362}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eusipco/SanchezSAM17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eusipco/SanchezSZPAM17, author = {Gustavo Sanchez and M{\'{a}}rio Saldanha and Bruno Zatt and Marcelo Schiavon Porto and Luciano Volcan Agostini and C{\'{e}}sar A. M. Marcon}, title = {Edge-aware depth motion estimation - {A} complexity reduction scheme for 3D-HEVC}, booktitle = {25th European Signal Processing Conference, {EUSIPCO} 2017, Kos, Greece, August 28 - September 2, 2017}, pages = {1524--1528}, publisher = {{IEEE}}, year = {2017}, url = {https://doi.org/10.23919/EUSIPCO.2017.8081464}, doi = {10.23919/EUSIPCO.2017.8081464}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eusipco/SanchezSZPAM17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/evoW/GuervosBCRGRVHR17, author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and Israel Blancas{-}Alvarez and Pedro A. Castillo and Gustavo Romero and Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and V{\'{\i}}ctor M. Rivas and Mario Garc{\'{\i}}a Valdez and Amaury Hern{\'{a}}ndez{-}{\'{A}}guila and Mario Rom{\'{a}}n}, editor = {Giovanni Squillero and Kevin Sim}, title = {Ranking Programming Languages for Evolutionary Algorithm Operations}, booktitle = {Applications of Evolutionary Computation - 20th European Conference, EvoApplications 2017, Amsterdam, The Netherlands, April 19-21, 2017, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {10199}, pages = {689--704}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-55849-3\_44}, doi = {10.1007/978-3-319-55849-3\_44}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/evoW/GuervosBCRGRVHR17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/evoW/MereloCGV17, author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and Paloma de las Cuevas and Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and Mario Garc{\'{\i}}a Valdez}, editor = {Giovanni Squillero and Kevin Sim}, title = {A Performance Assessment of Evolutionary Algorithms in Volunteer Computing Environments: The Importance of Entropy}, booktitle = {Applications of Evolutionary Computation - 20th European Conference, EvoApplications 2017, Amsterdam, The Netherlands, April 19-21, 2017, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {10199}, pages = {806--821}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-55849-3\_52}, doi = {10.1007/978-3-319-55849-3\_52}, timestamp = {Sat, 19 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/evoW/MereloCGV17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ibpria/RodriguezOM17, author = {Mario Rodr{\'{\i}}guez and Carlos Orrite and Carlos Medrano}, editor = {Lu{\'{\i}}s A. Alexandre and Jos{\'{e}} Salvador S{\'{a}}nchez and Jo{\~{a}}o M. F. Rodrigues}, title = {Space-Time Flexible Kernel for Recognizing Activities from Wearable Cameras}, booktitle = {Pattern Recognition and Image Analysis - 8th Iberian Conference, IbPRIA 2017, Faro, Portugal, June 20-23, 2017, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {10255}, pages = {511--518}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-58838-4\_56}, doi = {10.1007/978-3-319-58838-4\_56}, timestamp = {Tue, 07 May 2024 20:05:10 +0200}, biburl = {https://dblp.org/rec/conf/ibpria/RodriguezOM17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icar/SanchezR17, author = {O. Nelson Andres Sanchez and Mario Fernando De la Rosa Rosero}, title = {Path planning and following using genetic algorithms to solve the multi-travel salesman problem in dynamic scenarios}, booktitle = {18th International Conference on Advanced Robotics, {ICAR} 2017, Hong Kong, China, July 10-12, 2017}, pages = {204--209}, publisher = {{IEEE}}, year = {2017}, url = {https://doi.org/10.1109/ICAR.2017.8023519}, doi = {10.1109/ICAR.2017.8023519}, timestamp = {Wed, 16 Oct 2019 14:14:48 +0200}, biburl = {https://dblp.org/rec/conf/icar/SanchezR17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccS/TintoACCSSD17, author = {Oriol Tint{\'{o}} and Mario C. Acosta and Miguel Castrillo and Ana Cort{\'{e}}s and Alicia Sanchez Lorente and Kim Serradell and Francisco J. Doblas{-}Reyes}, editor = {Petros Koumoutsakos and Michael Lees and Valeria V. Krzhizhanovskaya and Jack J. Dongarra and Peter M. A. Sloot}, title = {Optimizing domain decomposition in an ocean model: the case of {NEMO}}, booktitle = {International Conference on Computational Science, {ICCS} 2017, 12-14 June 2017, Zurich, Switzerland}, series = {Procedia Computer Science}, volume = {108}, pages = {776--785}, publisher = {Elsevier}, year = {2017}, url = {https://doi.org/10.1016/j.procs.2017.05.257}, doi = {10.1016/J.PROCS.2017.05.257}, timestamp = {Thu, 08 Jul 2021 16:04:01 +0200}, biburl = {https://dblp.org/rec/conf/iccS/TintoACCSSD17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceis/RomeroSV17, author = {Mar{\'{\i}}a Camila Romero and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Slimane Hammoudi and Michal Smialek and Olivier Camp and Joaquim Filipe}, title = {Business Model Pattern Execution - {A} System Dynamics Application}, booktitle = {{ICEIS} 2017 - Proceedings of the 19th International Conference on Enterprise Information Systems, Volume 3, Porto, Portugal, April 26-29, 2017}, pages = {440--447}, publisher = {SciTePress}, year = {2017}, url = {https://doi.org/10.5220/0006369704400447}, doi = {10.5220/0006369704400447}, timestamp = {Sat, 05 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iceis/RomeroSV17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ict4ageingwell/OCaoimhMFVCNVWJ17, author = {R{\'{o}}n{\'{a}}n O'Caoimh and D. William Molloy and Carol Fitzgerald and Lex van Velsen and Miriam Cabrita and Mohammad Hossein Nassabi and Frederiek de Vette and Marit Dekker{-}van Weering and Stephanie Jansen{-}Kosterink and Wander Kenter and Sanne Frazer and Am{\'{e}}lia P. Rauter and Maria Ant{\'{o}}nia Amaral Turkman and Mar{\'{\i}}lia Antunes and Feridun Turkman and Marta Sousa Silva and Alice Martins and Helena S. Costa and T{\^{a}}nia Gon{\c{c}}alves Albuquerque and Ant{\'{o}}nio E. N. Ferreira and Mario Scherillo and Vincenzo De Luca and Maddalena Illario and Alejandro Garc{\'{\i}}a{-}Rudolph and Rocio Sanchez{-}Carrion and Javier Solana S{\'{a}}nchez and Enrique J. G{\'{o}}mez Aguilera and Hermie Hermens and Miriam M. R. Vollenbroek{-}Hutten}, editor = {Carsten R{\"{o}}cker and John O'Donoghue and Martina Ziefle and Leszek A. Maciaszek and William Molloy}, title = {Healthcare Recommendations from the Personalised {ICT} Supported Service for Independent Living and Active Ageing {(PERSSILAA)} Study}, booktitle = {Proceedings of the 3rd International Conference on Information and Communication Technologies for Ageing Well and e-Health, ICT4AgeingWell 2017, Porto, Portugal, April 28-29, 2017}, pages = {91--103}, publisher = {{SCITEPRESS}}, year = {2017}, url = {https://doi.org/10.5220/0006331800910103}, doi = {10.5220/0006331800910103}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ict4ageingwell/OCaoimhMFVCNVWJ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ict4ageingwell/OCaoimhMFVCNVWJ17a, author = {R{\'{o}}n{\'{a}}n O'Caoimh and D. William Molloy and Carol Fitzgerald and Lex van Velsen and Miriam Cabrita and Mohammad Hossein Nassabi and Frederiek de Vette and Marit Dekker{-}van Weering and Stephanie Jansen{-}Kosterink and Wander Kenter and Sanne Frazer and Am{\'{e}}lia P. Rauter and Maria Ant{\'{o}}nia Amaral Turkman and Mar{\'{\i}}lia Antunes and Feridun Turkman and Marta Sousa Silva and Alice Martins and Helena S. Costa and T{\^{a}}nia Gon{\c{c}}alves Albuquerque and Ant{\'{o}}nio E. N. Ferreira and Mario Scherillo and Vincenzo De Luca and Pasquale Abete and Annamaria Colao and Alejandro Garc{\'{\i}}a{-}Rudolph and Rocio Sanchez{-}Carrion and Javier Solana S{\'{a}}nchez and Enrique J. G{\'{o}}mez Aguilera and Maddalena Illario and Hermie Hermens and Miriam M. R. Vollenbroek{-}Hutten}, editor = {Carsten R{\"{o}}cker and John O'Donoghue and Martina Ziefle and Leszek A. Maciaszek and William Molloy}, title = {ICT-Supported Interventions Targeting Pre-frailty: Healthcare Recommendations from the Personalised {ICT} Supported Service for Independent Living and Active Ageing {(PERSSILAA)} Study}, booktitle = {Information and Communication Technologies for Ageing Well and e-Health - Third International Conference, {ICT4AWE} 2017, Porto, Portugal, April 28-29, 2017, Revised Selected Papers}, series = {Communications in Computer and Information Science}, volume = {869}, pages = {69--92}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-93644-4\_4}, doi = {10.1007/978-3-319-93644-4\_4}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ict4ageingwell/OCaoimhMFVCNVWJ17a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/infocom/ZhangWBKS17, author = {Ying Zhang and Wenfei Wu and Sujata Banerjee and Joon{-}Myung Kang and Mario A. S{\'{a}}nchez}, title = {SLA-verifier: Stateful and quantitative verification for service chaining}, booktitle = {2017 {IEEE} Conference on Computer Communications, {INFOCOM} 2017, Atlanta, GA, USA, May 1-4, 2017}, pages = {1--9}, publisher = {{IEEE}}, year = {2017}, url = {https://doi.org/10.1109/INFOCOM.2017.8057041}, doi = {10.1109/INFOCOM.2017.8057041}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/infocom/ZhangWBKS17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iwann/GonzalezDSR17, author = {Mario Gonz{\'{a}}lez and David Dominguez and {\'{A}}ngel S{\'{a}}nchez and Francisco B. Rodr{\'{\i}}guez}, editor = {Ignacio Rojas and Gonzalo Joya and Andreu Catal{\`{a}}}, title = {Capacity and Retrieval of a Modular Set of Diluted Attractor Networks with Respect to the Global Number of Neurons}, booktitle = {Advances in Computational Intelligence - 14th International Work-Conference on Artificial Neural Networks, {IWANN} 2017, Cadiz, Spain, June 14-16, 2017, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {10305}, pages = {497--506}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-59153-7\_43}, doi = {10.1007/978-3-319-59153-7\_43}, timestamp = {Sat, 01 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iwann/GonzalezDSR17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iwann/Rivas-SanchezGV17, author = {Mario Rivas{-}S{\'{a}}nchez and Maria De La Paz Guerrero{-}Lebrero and Elisa Guerrero V{\'{a}}zquez and Guillermo B{\'{a}}rcena{-}Gonzalez and Jaime Martel and Pedro L. Galindo}, editor = {Ignacio Rojas and Gonzalo Joya and Andreu Catal{\`{a}}}, title = {Using Deep Learning for Image Similarity in Product Matching}, booktitle = {Advances in Computational Intelligence - 14th International Work-Conference on Artificial Neural Networks, {IWANN} 2017, Cadiz, Spain, June 14-16, 2017, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {10305}, pages = {281--290}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-59153-7\_25}, doi = {10.1007/978-3-319-59153-7\_25}, timestamp = {Sun, 25 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iwann/Rivas-SanchezGV17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lascas/GonzalezSVCRZPS17, author = {S. A. Gonzalez and Enrique Mario Spinelli and Alejandro L. Veiga and D. F. Coral and M. B. Fernandez van Raap and P. Mendoza Zelis and G. A. Pasquevich and F. H. Sanchez}, title = {Portable electromagnetic field applicator for magnetic hyperthermia experiments}, booktitle = {8th {IEEE} Latin American Symposium on Circuits {\&} Systems, {LASCAS} 2017, Bariloche, Argentina, February 20-23, 2017}, pages = {1--4}, publisher = {{IEEE}}, year = {2017}, url = {https://doi.org/10.1109/LASCAS.2017.7948091}, doi = {10.1109/LASCAS.2017.7948091}, timestamp = {Wed, 16 Oct 2019 14:14:54 +0200}, biburl = {https://dblp.org/rec/conf/lascas/GonzalezSVCRZPS17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/somet/Sotelo-GarridoN17, author = {Mario Sotelo{-}Garrido and Mariko Nakano{-}Miyatake and Gabriel Sanchez{-}Perez and Manuel Cedillo{-}Hernandez and H{\'{e}}ctor P{\'{e}}rez{-}Meana}, editor = {Hamido Fujita and Ali Selamat and Sigeru Omatu}, title = {Software Protection Against Illegal Copy Using Software Watermarking}, booktitle = {New Trends in Intelligent Software Methodologies, Tools and Techniques - Proceedings of the 16th International Conference, SoMeT{\_}17, Kitakyushu City, Japan, September 26-28, 2017}, series = {Frontiers in Artificial Intelligence and Applications}, volume = {297}, pages = {503--511}, publisher = {{IOS} Press}, year = {2017}, url = {https://doi.org/10.3233/978-1-61499-800-6-503}, doi = {10.3233/978-1-61499-800-6-503}, timestamp = {Tue, 15 Nov 2022 15:22:38 +0100}, biburl = {https://dblp.org/rec/conf/somet/Sotelo-GarridoN17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ucami/Garcia-SanchezT17, author = {Mario Garc{\'{\i}}a{-}S{\'{a}}nchez and Miguel A. Teruel and Elena Navarro and Pascual Gonz{\'{a}}lez and Antonio Fern{\'{a}}ndez{-}Caballero}, editor = {Sergio F. Ochoa and Pritpal Singh and Jos{\'{e}} Bravo}, title = {A Distributed Tool to Perform Dynamic Therapies for Social Cognitive Deficit Through Avatars}, booktitle = {Ubiquitous Computing and Ambient Intelligence - 11th International Conference, UCAmI 2017, Philadelphia, PA, USA, November 7-10, 2017, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {10586}, pages = {731--741}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-67585-5\_71}, doi = {10.1007/978-3-319-67585-5\_71}, timestamp = {Mon, 07 Nov 2022 21:23:28 +0100}, biburl = {https://dblp.org/rec/conf/ucami/Garcia-SanchezT17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:series/sci/HuacujaLCPR17, author = {H{\'{e}}ctor Joaqu{\'{\i}}n {Fraire Huacuja} and Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and Norberto Castillo{-}Garc{\'{\i}}a and Johnatan E. Pecero and Rodolfo A. Pazos Rangel}, editor = {Patricia Melin and Oscar Castillo and Janusz Kacprzyk}, title = {Solving the Cut Width Optimization Problem with a Genetic Algorithm Approach}, booktitle = {Nature-Inspired Design of Hybrid Intelligent Systems}, series = {Studies in Computational Intelligence}, volume = {667}, pages = {729--738}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-47054-2\_48}, doi = {10.1007/978-3-319-47054-2\_48}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/series/sci/HuacujaLCPR17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/Arias-FisteusFM17, author = {Jes{\'{u}}s Arias{-}Fisteus and Luis S{\'{a}}nchez Fern{\'{a}}ndez and V{\'{\i}}ctor Corcoba Maga{\~{n}}a and Mario Mu{\~{n}}oz Organero and Jorge Yago Fern{\'{a}}ndez Rodr{\'{\i}}guez and Juan Antonio {\'{A}}lvarez{-}Garc{\'{\i}}a}, title = {A Scalable Data Streaming Infrastructure for Smart Cities}, journal = {CoRR}, volume = {abs/1703.02755}, year = {2017}, url = {http://arxiv.org/abs/1703.02755}, eprinttype = {arXiv}, eprint = {1703.02755}, timestamp = {Wed, 28 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/Arias-FisteusFM17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/amcs/LocesMPHBB16, author = {Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and Jedrzej Musial and Johnatan E. Pecero and H{\'{e}}ctor Joaqu{\'{\i}}n {Fraire Huacuja} and Jacek Blazewicz and Pascal Bouvry}, title = {Exact and heuristic approaches to solve the Internet shopping optimization problem with delivery costs}, journal = {Int. J. Appl. Math. Comput. Sci.}, volume = {26}, number = {2}, pages = {391--406}, year = {2016}, url = {https://doi.org/10.1515/amcs-2016-0028}, doi = {10.1515/AMCS-2016-0028}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/amcs/LocesMPHBB16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/crossroads/Sanchez16, author = {Daniel L{\'{o}}pez S{\'{a}}nchez}, title = {"ANN" helps Mario rescue Princess Toadstool}, journal = {{XRDS}}, volume = {23}, number = {1}, pages = {18--19}, year = {2016}, url = {https://doi.org/10.1145/2983465}, doi = {10.1145/2983465}, timestamp = {Fri, 03 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/crossroads/Sanchez16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cviu/Sanchez-Escobedo16, author = {Dalila S{\'{a}}nchez{-}Escobedo and Mario Castel{\'{a}}n and William A. P. Smith}, title = {Statistical 3D face shape estimation from occluding contours}, journal = {Comput. Vis. Image Underst.}, volume = {142}, pages = {111--124}, year = {2016}, url = {https://doi.org/10.1016/j.cviu.2015.08.012}, doi = {10.1016/J.CVIU.2015.08.012}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cviu/Sanchez-Escobedo16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fi/ParraSRFP16, author = {Antonio Santos{-}Olmo and Luis Enrique S{\'{a}}nchez and David Garcia Rosado and Eduardo Fern{\'{a}}ndez{-}Medina and Mario Piattini}, title = {Applying the Action-Research Method to Develop a Methodology to Reduce the Installation and Maintenance Times of Information Security Management Systems}, journal = {Future Internet}, volume = {8}, number = {3}, pages = {36}, year = {2016}, url = {https://doi.org/10.3390/fi8030036}, doi = {10.3390/FI8030036}, timestamp = {Mon, 29 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/fi/ParraSRFP16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijhis/LorancaRVALZGD16, author = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and Jorge A. Ruiz{-}Vanoye and Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and Mart{\'{\i}}n Estrada Analco and Abraham S{\'{a}}nchez L{\'{o}}pez and Alberto Ochoa{-}Zezzatti and Gerardo {Mart{\'{\i}}nez Guzman} and Mario Bustillo D{\'{\i}}az}, title = {An approximation method for the P-median problem: {A} bioinspired tabu search and variable neighborhood search partitioning approach}, journal = {Int. J. Hybrid Intell. Syst.}, volume = {13}, number = {2}, pages = {87--98}, year = {2016}, url = {https://doi.org/10.3233/HIS-160227}, doi = {10.3233/HIS-160227}, timestamp = {Fri, 03 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijhis/LorancaRVALZGD16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/infsof/Barcelo-Valenzuela16, author = {Mario Barcelo{-}Valenzuela and Patricia Shihemy Carrillo{-}Villafa{\~{n}}a and Alonso Perez{-}Soltero and Gerardo Sanchez{-}Schmitz}, title = {A framework to acquire explicit knowledge stored on different versions of software}, journal = {Inf. Softw. Technol.}, volume = {70}, pages = {40--48}, year = {2016}, url = {https://doi.org/10.1016/j.infsof.2015.09.007}, doi = {10.1016/J.INFSOF.2015.09.007}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/infsof/Barcelo-Valenzuela16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ivc/RodriguezOMM16, author = {Mario Rodr{\'{\i}}guez and Carlos Orrite and Carlos Medrano and Dimitrios Makris}, title = {A Time Flexible Kernel framework for video-based activity recognition}, journal = {Image Vis. Comput.}, volume = {48-49}, pages = {26--36}, year = {2016}, url = {https://doi.org/10.1016/j.imavis.2015.12.006}, doi = {10.1016/J.IMAVIS.2015.12.006}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ivc/RodriguezOMM16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jvis/VictoriaRRPO16, author = {{\'{A}}yax Hernando Torres Victoria and Mario S{\'{a}}nchez Rosas and Fernando Arag{\'{o}}n Rivera and Salom{\'{o}}n Peralta and Abraham Medina Ovando}, title = {Visualization of isotherms around a heated horizontal cylinder embedded in a porous medium}, journal = {J. Vis.}, volume = {19}, number = {4}, pages = {631--641}, year = {2016}, url = {https://doi.org/10.1007/s12650-016-0363-9}, doi = {10.1007/S12650-016-0363-9}, timestamp = {Thu, 09 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jvis/VictoriaRRPO16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/midm/Lozano-LozanoMG16, author = {Mario Lozano{-}Lozano and Lydia Mart{\'{\i}}n{-}Mart{\'{\i}}n and Noelia Galiano{-}Castillo and Francisco {\'{A}}lvarez{-}Salvago and Irene Cantarero{-}Villanueva and Carolina Fern{\'{a}}ndez{-}Lao and Carmen S{\'{a}}nchez{-}Salado and Manuel Arroyo Morales}, title = {Integral strategy to supportive care in breast cancer survivors through occupational therapy and a m-health system: design of a randomized clinical trial}, journal = {{BMC} Medical Informatics Decis. Mak.}, volume = {16}, pages = {150:1--150:10}, year = {2016}, url = {https://doi.org/10.1186/s12911-016-0394-0}, doi = {10.1186/S12911-016-0394-0}, timestamp = {Sun, 06 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/midm/Lozano-LozanoMG16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/Anzures-GarciaS16, author = {Mario Anzures{-}Garc{\'{\i}}a and Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and Miguel J. Hornos and Patricia Paderewski{-}Rodr{\'{\i}}guez}, title = {Semantic Formalism for Modelling the Group Interaction}, journal = {Res. Comput. Sci.}, volume = {118}, pages = {137--147}, year = {2016}, url = {https://rcs.cic.ipn.mx/2016\_118/Semantic\%20Formalism\%20for\%20Modelling\%20the\%20Group\%20Interaction.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/Anzures-GarciaS16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/Anzures-GarciaS16a, author = {Mario Anzures{-}Garc{\'{\i}}a and Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and Miguel J. Hornos and Patricia Paderewski{-}Rodr{\'{\i}}guez}, title = {Knowledge-based Workflow Ontology for Group Organizational Structure}, journal = {Res. Comput. Sci.}, volume = {123}, pages = {79--90}, year = {2016}, url = {https://rcs.cic.ipn.mx/2016\_123/Knowledge-based\%20Workflow\%20Ontology\%20for\%20Group\%20Organizational\%20Structure.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/Anzures-GarciaS16a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/DominguezHPHC16, author = {Mario Hernandez Dominguez and Jos{\'{e}}{-}Isidro Hern{\'{a}}ndez{-}Vega and Dolores{-}Gabriela Palomares{-}Gorham and Carlos Hern{\'{a}}ndez{-}Santos and Jonam L. S{\'{a}}nchez Cuevas}, title = {A {BDI} Agent System for the Collaboration of the Unmanned Aerial Vehicle}, journal = {Res. Comput. Sci.}, volume = {121}, pages = {113--124}, year = {2016}, url = {https://rcs.cic.ipn.mx/2016\_121/A\%20BDI\%20Agent\%20System\%20for\%20the\%20Collaboration\%20of\%20the\%20Unmanned\%20Aerial\%20Vehicle.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/DominguezHPHC16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/LopezCPML16, author = {Abraham S{\'{a}}nchez L{\'{o}}pez and Viridiana Cruz{-}Guti{\'{e}}rrez and Mario Alberto Posada{-}Zamora and M. Teresa Torrijos M. and Mar{\'{\i}}a Auxilio Osorio Lama}, title = {Estudio del an{\'{a}}lisis de componentes principales en bases de datos de calidad del aire}, journal = {Res. Comput. Sci.}, volume = {120}, pages = {9--19}, year = {2016}, url = {https://rcs.cic.ipn.mx/2016\_120/Estudio\%20del\%20analisis\%20de\%20componentes\%20principales\%20en\%20bases\%20de\%20datos\%20de\%20calidad\%20del\%20aire.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/LopezCPML16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/LorancaVDASSL16, author = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and Mario Bustillo D{\'{\i}}az and Mart{\'{\i}}n Estrada Analco and Jorge Cerezo S{\'{a}}nchez and Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and Abraham S{\'{a}}nchez L{\'{o}}pez}, title = {Methodology for Location-Allocation Problem}, journal = {Res. Comput. Sci.}, volume = {123}, pages = {91--98}, year = {2016}, url = {https://rcs.cic.ipn.mx/2016\_123/Methodology\%20for\%20Location-Allocation\%20Problem.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/LorancaVDASSL16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/Saldana-Gonzalez16, author = {Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and Jorge Cerezo S{\'{a}}nchez and Mario Bustillo D{\'{\i}}az and Apolonio Ata P{\'{e}}rez and Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and Gerardo {Mart{\'{\i}}nez Guzman} and Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez}, title = {Dise{\~{n}}o de un robot m{\'{o}}vil controlado por un agente reactivo en tiempo real}, journal = {Res. Comput. Sci.}, volume = {125}, pages = {17--26}, year = {2016}, url = {https://rcs.cic.ipn.mx/2016\_125/Diseno\%20de\%20un\%20robot\%20movil\%20controlado\%20por\%20un\%20agente\%20reactivo\%20en\%20tiempo\%20real.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/Saldana-Gonzalez16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/SanchezSDA16, author = {Jorge Cerezo S{\'{a}}nchez and Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and Mario Bustillo D{\'{\i}}az and Apolonio Ata{-}P{\'{e}}rez}, title = {Sistema de planificaci{\'{o}}n de trayectorias utilizando visi{\'{o}}n artificial}, journal = {Res. Comput. Sci.}, volume = {128}, pages = {141--148}, year = {2016}, url = {https://rcs.cic.ipn.mx/2016\_128/Sistema\%20de\%20planificacion\%20de\%20trayectorias\%20utilizando\%20vision\%20artificial.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/SanchezSDA16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/SanchezSDPFLG16, author = {Jorge Cerezo S{\'{a}}nchez and Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and Mario Mauricio Bustillo D{\'{\i}}az and Apolonio Ata P{\'{e}}rez and Jos{\'{e}} Andr{\'{e}}s V{\'{a}}zquez Flores and Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and Gerardo {Mart{\'{\i}}nez Guzman}}, title = {Sistema de reconocimiento y clasificaci{\'{o}}n de se{\~{n}}as para el lenguaje espa{\~{n}}ol}, journal = {Res. Comput. Sci.}, volume = {124}, pages = {73--80}, year = {2016}, url = {https://rcs.cic.ipn.mx/2016\_124/Sistema\%20de\%20reconocimiento\%20y\%20clasificacion\%20de\%20senas\%20para\%20el\%20lenguaje\%20espanol.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/SanchezSDPFLG16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/staeors/RiveiroDCSA16, author = {Bel{\'{e}}n Riveiro and Luc{\'{\i}}a D{\'{\i}}az{-}Vilari{\~{n}}o and Borja Conde{-}Carnero and Mario Soil{\'{a}}n and Pedro Arias}, title = {Automatic Segmentation and Shape-Based Classification of Retro-Reflective Traffic Signs from Mobile LiDAR Data}, journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.}, volume = {9}, number = {1}, pages = {295--303}, year = {2016}, url = {https://doi.org/10.1109/JSTARS.2015.2461680}, doi = {10.1109/JSTARS.2015.2461680}, timestamp = {Tue, 31 Mar 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/staeors/RiveiroDCSA16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tetc/BarrioOS16, author = {Cesar Morillas Barrio and Mario Mu{\~{n}}oz Organero and Joaqu{\'{\i}}n S{\'{a}}nchez{-}Soriano}, title = {Can Gamification Improve the Benefits of Student Response Systems in Learning? An Experimental Study}, journal = {{IEEE} Trans. Emerg. Top. Comput.}, volume = {4}, number = {3}, pages = {429--438}, year = {2016}, url = {https://doi.org/10.1109/TETC.2015.2497459}, doi = {10.1109/TETC.2015.2497459}, timestamp = {Fri, 15 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tetc/BarrioOS16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/alife/Garcia-ValdezGC16, author = {Mario Garc{\'{\i}}a{-}Valdez and Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and Paloma de las Cuevas and Juan Juli{\'{a}}n Merelo}, editor = {Tom Froese and Jes{\'{u}}s Mario Siqueiros{-}Garc{\'{\i}}a and Wendy Aguilar and Eduardo J. Izquierdo and Hiroki Sayama and Carlos Gershenson}, title = {The human in the loop: volunteer-based metacomputers as a socio-technical system}, booktitle = {Fifteenth International Conference on the Simulation and Synthesis of Living Systems, {ALIFE} 2016, Cancun, Mexico, July 4-6, 2016}, pages = {648--655}, publisher = {{MIT} Press}, year = {2016}, url = {https://doi.org/10.7551/978-0-262-33936-0-ch103}, doi = {10.7551/978-0-262-33936-0-CH103}, timestamp = {Thu, 20 Jun 2024 22:18:45 +0200}, biburl = {https://dblp.org/rec/conf/alife/Garcia-ValdezGC16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caise/FlorezSV16, author = {Hector Florez and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Rainer Schmidt and Wided Gu{\'{e}}dria and Ilia Bider and S{\'{e}}rgio Guerreiro}, title = {Analysis of Imprecise Enterprise Models}, booktitle = {Enterprise, Business-Process and Information Systems Modeling - 17th International Conference, {BPMDS} 2016, 21st International Conference, {EMMSAD} 2016, Held at CAiSE 2016, Ljubljana, Slovenia, June 13-14, 2016, Proceedings}, series = {Lecture Notes in Business Information Processing}, volume = {248}, pages = {349--364}, publisher = {Springer}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-39429-9\_22}, doi = {10.1007/978-3-319-39429-9\_22}, timestamp = {Fri, 19 Mar 2021 08:43:31 +0100}, biburl = {https://dblp.org/rec/conf/caise/FlorezSV16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/FelsbergKMLPHBE16, author = {Michael Felsberg and Matej Kristan and Jiri Matas and Ales Leonardis and Roman P. Pflugfelder and Gustav H{\"{a}}ger and Amanda Berg and Abdelrahman Eldesokey and J{\"{o}}rgen Ahlberg and Luka Cehovin and Tom{\'{a}}s Voj{\'{\i}}r and Alan Lukezic and Gustavo Fern{\'{a}}ndez and Alfredo Petrosino and {\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and Andr{\'{e}}s Sol{\'{\i}}s Montero and Anton Varfolomieiev and Aykut Erdem and Bohyung Han and Chang{-}Ming Chang and Dawei Du and Erkut Erdem and Fahad Shahbaz Khan and Fatih Porikli and Fei Zhao and Filiz Bunyak and Francesco Battistone and Gao Zhu and Guna Seetharaman and Hongdong Li and Honggang Qi and Horst Bischof and Horst Possegger and Hyeonseob Nam and Jack Valmadre and Jianke Zhu and Jiayi Feng and Jochen Lang and Jos{\'{e}} M. Mart{\'{\i}}nez and Kannappan Palaniappan and Karel Lebeda and Ke Gao and Krystian Mikolajczyk and Longyin Wen and Luca Bertinetto and Mahdieh Poostchi and Mario Edoardo Maresca and Martin Danelljan and Michael Arens and Ming Tang and Mooyeol Baek and Nana Fan and Noor Al{-}Shakarji and Ondrej Miksik and Osman Akin and Philip H. S. Torr and Qingming Huang and Rafael Martin Nieto and Rengarajan Pelapur and Richard Bowden and Robert Lagani{\`{e}}re and Sebastian Bernd Krah and Shengkun Li and Shizeng Yao and Simon Hadfield and Siwei Lyu and Stefan Becker and Stuart Golodetz and Tao Hu and Thomas Mauthner and Vincenzo Santopietro and Wenbo Li and Wolfgang H{\"{u}}bner and Xin Li and Yang Li and Zhan Xu and Zhenyu He}, editor = {Gang Hua and Herv{\'{e}} J{\'{e}}gou}, title = {The Thermal Infrared Visual Object Tracking {VOT-TIR2016} Challenge Results}, booktitle = {Computer Vision - {ECCV} 2016 Workshops - Amsterdam, The Netherlands, October 8-10 and 15-16, 2016, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {9914}, pages = {824--849}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-48881-3\_55}, doi = {10.1007/978-3-319-48881-3\_55}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/eccv/FelsbergKMLPHBE16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/KristanLMFPCVHL16, author = {Matej Kristan and Ales Leonardis and Jiri Matas and Michael Felsberg and Roman P. Pflugfelder and Luka Cehovin and Tom{\'{a}}s Voj{\'{\i}}r and Gustav H{\"{a}}ger and Alan Lukezic and Gustavo Fern{\'{a}}ndez and Abhinav Gupta and Alfredo Petrosino and Alireza Memarmoghadam and {\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and Andr{\'{e}}s Sol{\'{\i}}s Montero and Andrea Vedaldi and Andreas Robinson and Andy Jinhua Ma and Anton Varfolomieiev and A. Aydin Alatan and Aykut Erdem and Bernard Ghanem and Bin Liu and Bohyung Han and Brais Mart{\'{\i}}nez and Chang{-}Ming Chang and Changsheng Xu and Chong Sun and Daijin Kim and Dapeng Chen and Dawei Du and Deepak Mishra and Dit{-}Yan Yeung and Erhan Gundogdu and Erkut Erdem and Fahad Shahbaz Khan and Fatih Porikli and Fei Zhao and Filiz Bunyak and Francesco Battistone and Gao Zhu and Giorgio Roffo and Gorthi R. K. Sai Subrahmanyam and Guilherme Sousa Bastos and Guna Seetharaman and Henry Medeiros and Hongdong Li and Honggang Qi and Horst Bischof and Horst Possegger and Huchuan Lu and Hyemin Lee and Hyeonseob Nam and Hyung Jin Chang and Isabela Drummond and Jack Valmadre and Jae{-}chan Jeong and Jaeil Cho and Jae{-}Yeong Lee and Jianke Zhu and Jiayi Feng and Jin Gao and Jin Young Choi and Jingjing Xiao and Ji{-}Wan Kim and Jiyeoup Jeong and Jo{\~{a}}o F. Henriques and Jochen Lang and Jongwon Choi and Jos{\'{e}} M. Mart{\'{\i}}nez and Junliang Xing and Junyu Gao and Kannappan Palaniappan and Karel Lebeda and Ke Gao and Krystian Mikolajczyk and Lei Qin and Lijun Wang and Longyin Wen and Luca Bertinetto and Madan Kumar Rapuru and Mahdieh Poostchi and Mario Edoardo Maresca and Martin Danelljan and Matthias Mueller and Mengdan Zhang and Michael Arens and Michel F. Valstar and Ming Tang and Mooyeol Baek and Muhammad Haris Khan and Naiyan Wang and Nana Fan and Noor Al{-}Shakarji and Ondrej Miksik and Osman Akin and Payman Moallem and Pedro Senna and Philip H. S. Torr and Pong C. Yuen and Qingming Huang and Rafael Martin Nieto and Rengarajan Pelapur and Richard Bowden and Robert Lagani{\`{e}}re and Rustam Stolkin and Ryan Walsh and Sebastian Bernd Krah and Shengkun Li and Shengping Zhang and Shizeng Yao and Simon Hadfield and Simone Melzi and Siwei Lyu and Siyi Li and Stefan Becker and Stuart Golodetz and Sumithra Kakanuru and Sunglok Choi and Tao Hu and Thomas Mauthner and Tianzhu Zhang and Tony P. Pridmore and Vincenzo Santopietro and Weiming Hu and Wenbo Li and Wolfgang H{\"{u}}bner and Xiangyuan Lan and Xiaomeng Wang and Xin Li and Yang Li and Yiannis Demiris and Yifan Wang and Yuankai Qi and Zejian Yuan and Zexiong Cai and Zhan Xu and Zhenyu He and Zhizhen Chi}, editor = {Gang Hua and Herv{\'{e}} J{\'{e}}gou}, title = {The Visual Object Tracking {VOT2016} Challenge Results}, booktitle = {Computer Vision - {ECCV} 2016 Workshops - Amsterdam, The Netherlands, October 8-10 and 15-16, 2016, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {9914}, pages = {777--823}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-48881-3\_54}, doi = {10.1007/978-3-319-48881-3\_54}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/eccv/KristanLMFPCVHL16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/er/LaraSV16, author = {Paola Lara and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Isabelle Comyn{-}Wattiau and Katsumi Tanaka and Il{-}Yeol Song and Shuichiro Yamamoto and Motoshi Saeki}, title = {Bridging the {IT} and {OT} Worlds Using an Extensible Modeling Language}, booktitle = {Conceptual Modeling - 35th International Conference, {ER} 2016, Gifu, Japan, November 14-17, 2016, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {9974}, pages = {122--129}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-46397-1\_10}, doi = {10.1007/978-3-319-46397-1\_10}, timestamp = {Thu, 23 Jun 2022 19:56:58 +0200}, biburl = {https://dblp.org/rec/conf/er/LaraSV16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/evoW/MereloCBRGFRV16, author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and Pedro A. Castillo and Israel Blancas and Gustavo Romero and Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and Antonio Fern{\'{a}}ndez{-}Ares and V{\'{\i}}ctor M. Rivas and Mario Garc{\'{\i}}a Valdez}, editor = {Giovanni Squillero and Paolo Burelli}, title = {Benchmarking Languages for Evolutionary Algorithms}, booktitle = {Applications of Evolutionary Computation - 19th European Conference, EvoApplications 2016, Porto, Portugal, March 30 - April 1, 2016, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {9598}, pages = {27--41}, publisher = {Springer}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-31153-1\_3}, doi = {10.1007/978-3-319-31153-1\_3}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/evoW/MereloCBRGFRV16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/gecco/MereloCGCRV16, author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and Pedro A. Castillo and Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and Paloma de las Cuevas and Nuria Rico and Mario Garc{\'{\i}}a Valdez}, editor = {Tobias Friedrich and Frank Neumann and Andrew M. Sutton}, title = {Performance for the Masses: Experiments with {A} Web Based Architecture to Harness Volunteer Resources for Low Cost Distributed Evolutionary Computation}, booktitle = {Proceedings of the 2016 on Genetic and Evolutionary Computation Conference, Denver, CO, USA, July 20 - 24, 2016}, pages = {837--844}, publisher = {{ACM}}, year = {2016}, url = {https://doi.org/10.1145/2908812.2908849}, doi = {10.1145/2908812.2908849}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/gecco/MereloCGCRV16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/gecco/MereloCGCV16, author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and Pedro A. Castillo and Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and Paloma de las Cuevas and Mario Garc{\'{\i}}a Valdez}, editor = {Tobias Friedrich and Frank Neumann and Andrew M. Sutton}, title = {NodIO: {A} Framework and Architecture for Pool-based Evolutionary Computation}, booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2016, Denver, CO, USA, July 20-24, 2016, Companion Material Proceedings}, pages = {1323--1330}, publisher = {{ACM}}, year = {2016}, url = {https://doi.org/10.1145/2908961.2931723}, doi = {10.1145/2908961.2931723}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/gecco/MereloCGCV16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icecsys/SanchezSPZAM16, author = {Gustavo Sanchez and M{\'{a}}rio Saldanha and Marcelo Schiavon Porto and Bruno Zatt and Luciano Volcan Agostini and C{\'{e}}sar A. M. Marcon}, title = {Real-time simplified edge detector architecture for 3D-HEVC depth maps coding}, booktitle = {2016 {IEEE} International Conference on Electronics, Circuits and Systems, {ICECS} 2016, Monte Carlo, Monaco, December 11-14, 2016}, pages = {352--355}, publisher = {{IEEE}}, year = {2016}, url = {https://doi.org/10.1109/ICECS.2016.7841205}, doi = {10.1109/ICECS.2016.7841205}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icecsys/SanchezSPZAM16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceee/Dominguez-Sanchez16, author = {S. Dominguez{-}Sanchez and Salvador Mendoza{-}Acevedo and Mario Alfredo Reyes{-}Barranca and Luis M. Flores{-}Nava and Jose A. Moreno{-}Cadenas}, title = {Assessment of the possibility to couple a photo sensor to a Floating-gate {MOS} transistor}, booktitle = {13th International Conference on Electrical Engineering, Computing Science and Automatic Control, {CCE} 2016, Mexico City, Mexico, September 26-30, 2016}, pages = {1--5}, publisher = {{IEEE}}, year = {2016}, url = {https://doi.org/10.1109/ICEEE.2016.7751201}, doi = {10.1109/ICEEE.2016.7751201}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iceee/Dominguez-Sanchez16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceis/RomeroSV16, author = {Mar{\'{\i}}a Camila Romero and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Slimane Hammoudi and Leszek A. Maciaszek and Michele Missikoff and Olivier Camp and Jos{\'{e}} Cordeiro}, title = {Weaving Business Model Patterns - Understanding Business Models}, booktitle = {{ICEIS} 2016 - Proceedings of the 18th International Conference on Enterprise Information Systems, Volume 2, Rome, Italy, April 25-28, 2016}, pages = {496--505}, publisher = {SciTePress}, year = {2016}, url = {https://doi.org/10.5220/0005838104960505}, doi = {10.5220/0005838104960505}, timestamp = {Thu, 15 Jun 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iceis/RomeroSV16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceis/RomeroSV16a, author = {Mar{\'{\i}}a Camila Romero and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Slimane Hammoudi and Leszek A. Maciaszek and Michele Missikoff and Olivier Camp and Jos{\'{e}} Cordeiro}, title = {Business Model Loom: {A} Pattern-Based Approach Towards the Definition of Business Models}, booktitle = {Enterprise Information Systems - 18th International Conference, {ICEIS} 2016, Rome, Italy, April 25-28, 2016, Revised Selected Papers}, series = {Lecture Notes in Business Information Processing}, volume = {291}, pages = {463--487}, publisher = {Springer}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-62386-3\_21}, doi = {10.1007/978-3-319-62386-3\_21}, timestamp = {Sun, 25 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iceis/RomeroSV16a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/OrriteRM16, author = {Carlos Orrite and Mario Rodr{\'{\i}}guez and Carlos Medrano}, title = {One-shot learning of temporal sequences using a distance dependent Chinese Restaurant Process}, booktitle = {23rd International Conference on Pattern Recognition, {ICPR} 2016, Canc{\'{u}}n, Mexico, December 4-8, 2016}, pages = {2694--2699}, publisher = {{IEEE}}, year = {2016}, url = {https://doi.org/10.1109/ICPR.2016.7900042}, doi = {10.1109/ICPR.2016.7900042}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/OrriteRM16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iecon/MorianoBMRR16, author = {Javier Moriano and Emilio Bueno and Rocio Martin and Francisco Javier Rodr{\'{\i}}guez and Mario Rizo}, title = {Multi-frequency stationary frame grid synchronization using multiple reduced order generalized integrators}, booktitle = {{IECON} 2016 - 42nd Annual Conference of the {IEEE} Industrial Electronics Society, Florence, Italy, October 23-26, 2016}, pages = {2349--2354}, publisher = {{IEEE}}, year = {2016}, url = {https://doi.org/10.1109/IECON.2016.7793332}, doi = {10.1109/IECON.2016.7793332}, timestamp = {Wed, 16 Oct 2019 14:14:49 +0200}, biburl = {https://dblp.org/rec/conf/iecon/MorianoBMRR16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcci/GuervosBCRGSVHR16, author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and Israel Blancas{-}Alvarez and Pedro A. Castillo and Gustavo Romero and Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and V{\'{\i}}ctor Manuel Rivas Santos and Mario Garc{\'{\i}}a Valdez and Amaury Hern{\'{a}}ndez{-}{\'{A}}guila and Mario Rom{\'{a}}n}, editor = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and Fernando Mel{\'{\i}}cio and Jos{\'{e}} Manuel Cadenas and Ant{\'{o}}nio Dourado and Kurosh Madani and Ant{\'{o}}nio E. B. Ruano and Joaquim Filipe}, title = {Ranking the Performance of Compiled and Interpreted Languages in Genetic Algorithms}, booktitle = {Proceedings of the 8th International Joint Conference on Computational Intelligence, {IJCCI} 2016, Volume 1: ECTA, Porto, Portugal, November 9-11, 2016}, pages = {164--170}, publisher = {SciTePress}, year = {2016}, url = {https://doi.org/10.5220/0006048101640170}, doi = {10.5220/0006048101640170}, timestamp = {Sun, 25 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ijcci/GuervosBCRGSVHR16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lascas/SaldanhaZPAS16, author = {M{\'{a}}rio Saldanha and Bruno Zatt and Marcelo Schiavon Porto and Luciano Volcan Agostini and Gustavo Sanchez}, title = {Solutions for {DMM-1} complexity reduction in 3D-HEVC based on gradient calculation}, booktitle = {{IEEE} 7th Latin American Symposium on Circuits {\&} Systems, {LASCAS} 2016, Florianopolis, Brazil, February 28 - March 2, 2016}, pages = {211--214}, publisher = {{IEEE}}, year = {2016}, url = {https://doi.org/10.1109/LASCAS.2016.7451047}, doi = {10.1109/LASCAS.2016.7451047}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/lascas/SaldanhaZPAS16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lascas/SanchezRPH16, author = {Raul M. Sanchez and Benjam{\'{\i}}n T. Reyes and Ariel L. Pola and Mario Rafael Hueda}, title = {An FPGA-based emulation platform for evaluation of time-interleaved {ADC} calibration systems}, booktitle = {{IEEE} 7th Latin American Symposium on Circuits {\&} Systems, {LASCAS} 2016, Florianopolis, Brazil, February 28 - March 2, 2016}, pages = {187--190}, publisher = {{IEEE}}, year = {2016}, url = {https://doi.org/10.1109/LASCAS.2016.7451041}, doi = {10.1109/LASCAS.2016.7451041}, timestamp = {Mon, 20 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/lascas/SanchezRPH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/micai/Cruz-GutierrezP16, author = {Viridiana Cruz{-}Guti{\'{e}}rrez and Mario Alberto Posada{-}Zamora and Abraham S{\'{a}}nchez L{\'{o}}pez}, editor = {Obdulia Pichardo{-}Lagunas and Sabino Miranda{-}Jim{\'{e}}nez}, title = {An Efficient Expert System for Diabetes with a Bayesian Inference Engine}, booktitle = {Advances in Soft Computing - 15th Mexican International Conference on Artificial Intelligence, {MICAI} 2016, Canc{\'{u}}n, Mexico, October 23-28, 2016, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {10062}, pages = {54--64}, publisher = {Springer}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-62428-0\_5}, doi = {10.1007/978-3-319-62428-0\_5}, timestamp = {Tue, 14 May 2019 10:00:49 +0200}, biburl = {https://dblp.org/rec/conf/micai/Cruz-GutierrezP16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/GuervosVCGCR16, author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and Mario Garc{\'{\i}}a Valdez and Pedro {\'{A}}ngel Castillo Valdivieso and Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and Paloma de las Cuevas and Nuria Rico}, title = {NodIO, a JavaScript framework for volunteer-based evolutionary algorithms : first results}, journal = {CoRR}, volume = {abs/1601.01607}, year = {2016}, url = {http://arxiv.org/abs/1601.01607}, eprinttype = {arXiv}, eprint = {1601.01607}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/GuervosVCGCR16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/Poncela-Casasnovas16, author = {Julia Poncela{-}Casasnovas and Mario Guti{\'{e}}rrez{-}Roig and Carlos Gracia{-}L{\'{a}}zaro and Juli{\'{a}}n Vicens and Jes{\'{u}}s G{\'{o}}mez{-}Garde{\~{n}}es and Josep Perello and Yamir Moreno and Jordi Duch and {\'{A}}ngel S{\'{a}}nchez}, title = {Humans display a reduced set of consistent behavioral phenotypes in dyadic games}, journal = {CoRR}, volume = {abs/1608.02015}, year = {2016}, url = {http://arxiv.org/abs/1608.02015}, eprinttype = {arXiv}, eprint = {1608.02015}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/Poncela-Casasnovas16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/TellezMGMSS16, author = {Eric Sadit Tellez and Sabino Miranda{-}Jim{\'{e}}nez and Mario Graff and Daniela Moctezuma and Ranyart Rodrigo Su{\'{a}}rez and Oscar S{\'{a}}nchez Siordia}, title = {A Simple Approach to Multilingual Polarity Classification in Twitter}, journal = {CoRR}, volume = {abs/1612.05270}, year = {2016}, url = {http://arxiv.org/abs/1612.05270}, eprinttype = {arXiv}, eprint = {1612.05270}, timestamp = {Wed, 17 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/TellezMGMSS16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jam/Filobello-NinoV15, author = {Uriel Filobello{-}Ni{\~{n}}o and H{\'{e}}ctor V{\'{a}}zquez{-}Leal and Karem Boubaker and Arturo Sarmiento{-}Reyes and Agustin Perez{-}Sesma and Alejandro D{\'{\i}}az{-}S{\'{a}}nchez and V{\'{\i}}ctor Manuel Jimenez{-}Fernandez and Juan Cervantes{-}Perez and Jesus Sanchez{-}Orea and Jesus Huerta{-}Chua and Luis J. Morales{-}Mendoza and Mario Gonzalez{-}Lee and Carlos Hern{\'{a}}ndez{-}Mej{\'{\i}}a and Francisco Javier Gonzalez{-}Martinez}, title = {Nonlinearities Distribution Homotopy Perturbation Method Applied to Solve Nonlinear Problems: Thomas-Fermi Equation as a Case Study}, journal = {J. Appl. Math.}, volume = {2015}, pages = {405108:1--405108:9}, year = {2015}, url = {https://doi.org/10.1155/2015/405108}, doi = {10.1155/2015/405108}, timestamp = {Sun, 25 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jam/Filobello-NinoV15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jei/SanchezSBZPA15, author = {Gustavo Sanchez and M{\'{a}}rio Saldanha and Gabriel Balota and Bruno Zatt and Marcelo Schiavon Porto and Luciano Volcan Agostini}, title = {DMMFast: a complexity reduction scheme for three-dimensional high-efficiency video coding intraframe depth map coding}, journal = {J. Electronic Imaging}, volume = {24}, number = {2}, pages = {023011}, year = {2015}, url = {https://doi.org/10.1117/1.JEI.24.2.023011}, doi = {10.1117/1.JEI.24.2.023011}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jei/SanchezSBZPA15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jot/NaranjoSV15, author = {David Naranjo and Mario E. S{\'{a}}nchez and Jorge Villalobos}, title = {Evaluating the capabilities of Enterprise Architecture modeling tools for Visual Analysis}, journal = {J. Object Technol.}, volume = {14}, number = {1}, pages = {3:1--32}, year = {2015}, url = {https://doi.org/10.5381/jot.2015.14.1.a3}, doi = {10.5381/JOT.2015.14.1.A3}, timestamp = {Wed, 17 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jot/NaranjoSV15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jpdc/Aartsen15, author = {Mark G. Aartsen and Rasha U. Abbasi and Markus Ackermann and Jenni Adams and Juan Antonio Aguilar S{\'{a}}nchez and Markus Ahlers and David Altmann and Carlos A. Arg{\"{u}}elles Delgado and Jan Auffenberg and Xinhua Bai and Michael F. Baker and Steven W. Barwick and Volker Baum and Ryan Bay and James J. Beatty and Julia K. Becker Tjus and Karl{-}Heinz Becker and Segev BenZvi and Patrick Berghaus and David Berley and Elisa Bernardini and Anna Bernhard and David Z. Besson and G. Binder and Daniel Bindig and Martin Bissok and Erik Blaufuss and Jan Blumenthal and David J. Boersma and Christian Bohm and Debanjan Bose and Sebastian B{\"{o}}ser and Olga Botner and Lionel Brayeur and Hans{-}Peter Bretz and Anthony M. Brown and Ronald Bruijn and James Casey and Martin Casier and Dmitry Chirkin and Asen Christov and Brian John Christy and Ken Clark and Lew Classen and Fabian Clevermann and Stefan Coenders and Shirit Cohen and Doug F. Cowen and Angel H. Cruz Silva and Matthias Danninger and Jacob Daughhetee and James C. Davis and Melanie Day and Catherine De Clercq and Sam De Ridder and Paolo Desiati and Krijn D. de Vries and Meike de With and Tyce DeYoung and Juan Carlos D{\'{\i}}az{-}V{\'{e}}lez and Matthew Dunkman and Ryan Eagan and Benjamin Eberhardt and Bj{\"{o}}rn Eichmann and Jonathan Eisch and Sebastian Euler and Paul A. Evenson and Oladipo O. Fadiran and Ali R. Fazely and Anatoli Fedynitch and Jacob Feintzeig and Tom Feusels and Kirill Filimonov and Chad Finley and Tobias Fischer{-}Wasels and Samuel Flis and Anna Franckowiak and Katharina Frantzen and Tomasz Fuchs and Thomas K. Gaisser and Joseph S. Gallagher and Lisa Marie Gerhardt and Laura E. Gladstone and Thorsten Gl{\"{u}}senkamp and Azriel Goldschmidt and Geraldina Golup and Javier G. Gonz{\'{a}}lez and Jordan A. Goodman and Dariusz G{\'{o}}ra and Dylan T. Grandmont and Darren Grant and Pavel Gretskov and John C. Groh and Andreas Gro{\ss} and Chang Hyon Ha and Abd Al Karim Haj Ismail and Patrick Hallen and Allan Hallgren and Francis Halzen and Kael D. Hanson and Dustin Hebecker and David Heereman and Dirk Heinen and Klaus Helbing and Robert Eugene Hellauer III and Stephanie Virginia Hickford and Gary C. Hill and Kara D. Hoffman and Ruth Hoffmann and Andreas Homeier and Kotoyo Hoshina and Feifei Huang and Warren Huelsnitz and Per Olof Hulth and Klas Hultqvist and Shahid Hussain and Aya Ishihara and Emanuel Jacobi and John E. Jacobsen and Kai Jagielski and George S. Japaridze and Kyle Jero and Ola Jlelati and Basho Kaminsky and Alexander Kappes and Timo Karg and Albrecht Karle and Matthew Kauer and John Lawrence Kelley and Joanna Kiryluk and J. Kl{\"{a}}s and Spencer R. Klein and Jan{-}Hendrik K{\"{o}}hne and Georges Kohnen and Hermann Kolanoski and Lutz K{\"{o}}pke and Claudio Kopper and Sandro Kopper and D. Jason Koskinen and Marek Kowalski and Mark Krasberg and Anna Kriesten and Kai Michael Krings and G{\"{o}}sta Kroll and Jan Kunnen and Naoko Kurahashi and Takao Kuwabara and Mathieu L. M. Labare and Hagar Landsman and Michael James Larson and Mariola Lesiak{-}Bzdak and Martin Leuermann and Julia Leute and Jan L{\"{u}}nemann and Oscar A. Mac{\'{\i}}as{-}Ram{\'{\i}}rez and James Madsen and Giuliano Maggi and Reina Maruyama and Keiichi Mase and Howard S. Matis and Frank McNally and Kevin James Meagher and Martin Merck and Gonzalo Merino Ar{\'{e}}valo and Thomas Meures and Sandra Miarecki and Eike Middell and Natalie Milke and John Lester Miller and Lars Mohrmann and Teresa Montaruli and Robert M. Morse and Rolf Nahnhauer and Uwe Naumann and Hans Niederhausen and Sarah C. Nowicki and David R. Nygren and Anna Obertacke and Sirin Odrowski and Alex Olivas and Ahmad Omairat and Aongus Starbuck {\'{O}} Murchadha and Larissa Paul and Joshua A. Pepper and Carlos P{\'{e}}rez de los Heros and Carl Pfendner and Damian Pieloth and Elisa Pinat and Jonas Posselt and P. Buford Price and Gerald T. Przybylski and Melissa Quinnan and Leif R{\"{a}}del and Ian Rae and Mohamed Rameez and Katherine Rawlins and Peter Christian Redl and Ren{\'{e}} Reimann and Elisa Resconi and Wolfgang Rhode and Mathieu Ribordy and Michael Richman and Benedikt Riedel and J. P. Rodrigues and Carsten Rott and Tim Ruhe and Bakhtiyar Ruzybayev and Dirk Ryckbosch and Sabine M. Saba and Heinz{-}Georg Sander and Juan Marcos Santander and Subir Sarkar and Kai Schatto and Florian Scheriau and Torsten Schmidt and Martin Schmitz and Sebastian Schoenen and Sebastian Sch{\"{o}}neberg and Arne Sch{\"{o}}nwald and Anne Schukraft and Lukas Schulte and David Schultz and Olaf Schulz and David Seckel and Yolanda Sestayo de la Cerra and Surujhdeo Seunarine and Rezo Shanidze and Chris Sheremata and Miles W. E. Smith and Dennis Soldin and Glenn M. Spiczak and Christian Spiering and Michael Stamatikos and Todor Stanev and Nick A. Stanisha and Alexander Stasik and Thorsten Stezelberger and Robert G. Stokstad and Achim St{\"{o}}{\ss}l and Erik A. Strahler and Rickard Str{\"{o}}m and Nora Linn Strotjohann and Gregory W. Sullivan and Henric Taavola and Ignacio J. Taboada and Alessio Tamburro and Andreas Tepe and Samvel Ter{-}Antonyan and Gordana Tesic and Serap Tilav and Patrick A. Toale and Moriah Natasha Tobin and Simona Toscano and Maria Tselengidou and Elisabeth Unger and Marcel Usner and Sofia Vallecorsa and Nick van Eijndhoven and Arne Van Overloop and Jakob van Santen and Markus Vehring and Markus Voge and Matthias Vraeghe and Christian Walck and Tilo Waldenmaier and Marius Wallraff and Christopher N. Weaver and Mark T. Wellons and Christopher H. Wendt and Stefan Westerhoff and Nathan Whitehorn and Klaus Wiebe and Christopher Wiebusch and Dawn R. Williams and Henrike Wissing and Martin Wolf and Terri R. Wood and Kurt Woschnagg and Donglian Xu and Xianwu Xu and Juan Pablo Y{\'{a}}{\~{n}}ez Garza and Gaurang B. Yodh and Shigeru Yoshida and Pavel Zarzhitsky and Jan Ziemann and Simon Zierke and Marcel Zoll}, title = {The IceProd framework: Distributed data processing for the IceCube neutrino observatory}, journal = {J. Parallel Distributed Comput.}, volume = {75}, pages = {198--211}, year = {2015}, url = {https://doi.org/10.1016/j.jpdc.2014.08.001}, doi = {10.1016/J.JPDC.2014.08.001}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jpdc/Aartsen15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jsce/Amezquita-Brooks15, author = {Luis Antonio Amezquita{-}Brooks and Diana Hernandez{-}Alcantara and Mario Francisco Gonz{\'{a}}lez{-}S{\'{a}}nchez and Juan Carlos Tud{\'{o}}n{-}Mart{\'{\i}}nez}, title = {Linear programming predictive control with actuator saturation: Experimental robustness and performance results}, journal = {J. Syst. Control. Eng.}, volume = {229}, number = {8}, pages = {700--710}, year = {2015}, url = {https://doi.org/10.1177/0959651815582130}, doi = {10.1177/0959651815582130}, timestamp = {Thu, 20 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jsce/Amezquita-Brooks15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/Anzures-GarciaS15, author = {Mario Anzures{-}Garc{\'{\i}}a and Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and Miguel J. Hornos and Patricia Paderewski{-}Rodr{\'{\i}}guez}, title = {A Software Architecture for Defining a Methodologic Approach to Develop Collaborative Applications}, journal = {Res. Comput. Sci.}, volume = {105}, pages = {9--20}, year = {2015}, url = {https://rcs.cic.ipn.mx/2015\_105/A\%20Software\%20Architecture\%20for\%20Defining\%20a\%20Methodologic\%20Approach\%20to\%20Develop\%20Collaborative.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/Anzures-GarciaS15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcs/Cruz-GutierrezP15, author = {Viridiana Cruz{-}Guti{\'{e}}rrez and Mario Alberto Posada{-}Zamora and Maya Carrillo and Luis Enrique Colmenares Guill{\'{e}}n and Abraham S{\'{a}}nchez L{\'{o}}pez}, title = {Preprocesamiento de un corpus empleando correcci{\'{o}}n probabil{\'{\i}}stica para precisar el vocabulario}, journal = {Res. Comput. Sci.}, volume = {99}, pages = {43--54}, year = {2015}, url = {https://rcs.cic.ipn.mx/2015\_99/Preprocesamiento\%20de\%20un\%20corpus\%20empleando\%20correccion\%20probabilistica\%20para\%20precisar\%20el\%20vocabulario.pdf}, timestamp = {Fri, 08 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcs/Cruz-GutierrezP15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/simulation/ManzurUSV15, author = {Laura Manzur and Jorge Mario Ulloa and Mario E. S{\'{a}}nchez and Jorge Villalobos}, title = {xArchiMate: Enterprise Architecture simulation, experimentation and analysis}, journal = {Simul.}, volume = {91}, number = {3}, pages = {276--301}, year = {2015}, url = {https://doi.org/10.1177/0037549715575188}, doi = {10.1177/0037549715575188}, timestamp = {Sat, 05 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/simulation/ManzurUSV15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tii/RizoLBRG15, author = {Mario Rizo and Marco Liserre and Emilio Jos{\'{e}} Bueno and Francisco J. Rodr{\'{\i}}guez and Carlos Giron}, title = {Voltage Control Architectures for the Universal Operation of {DPGS}}, journal = {{IEEE} Trans. Ind. Informatics}, volume = {11}, number = {2}, pages = {313--321}, year = {2015}, url = {https://doi.org/10.1109/TII.2015.2389657}, doi = {10.1109/TII.2015.2389657}, timestamp = {Thu, 25 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tii/RizoLBRG15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/titb/SomolinosCHPTSF15, author = {Roberto Somolinos and Adolfo Mu{\~{n}}oz Carrero and M. Elena Hernando and Mario Pascual Carrasco and Jes{\'{u}}s C{\'{a}}ceres Tello and Ricardo S{\'{a}}nchez{-}de{-}Madariaga and Juan A. Fragua and Pablo Serrano and Carlos Hern{\'{a}}ndez Salvador}, title = {Service for the Pseudonymization of Electronic Healthcare Records Based on {ISO/EN} 13606 for the Secondary Use of Information}, journal = {{IEEE} J. Biomed. Health Informatics}, volume = {19}, number = {6}, pages = {1937--1944}, year = {2015}, url = {https://doi.org/10.1109/JBHI.2014.2360546}, doi = {10.1109/JBHI.2014.2360546}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/titb/SomolinosCHPTSF15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ton/SanchezOBCBKW15, author = {Mario A. S{\'{a}}nchez and John S. Otto and Zachary S. Bischof and David R. Choffnes and Fabian E. Bustamante and Balachander Krishnamurthy and Walter Willinger}, title = {A Measurement Experimentation Platform at the Internet's Edge}, journal = {{IEEE/ACM} Trans. Netw.}, volume = {23}, number = {6}, pages = {1944--1958}, year = {2015}, url = {https://doi.org/10.1109/TNET.2014.2354348}, doi = {10.1109/TNET.2014.2354348}, timestamp = {Sat, 27 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ton/SanchezOBCBKW15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/approx/BrodyS15, author = {Joshua Brody and Mario S{\'{a}}nchez}, editor = {Naveen Garg and Klaus Jansen and Anup Rao and Jos{\'{e}} D. P. Rolim}, title = {Dependent Random Graphs and Multi-Party Pointer Jumping}, booktitle = {Approximation, Randomization, and Combinatorial Optimization. Algorithms and Techniques, {APPROX/RANDOM} 2015, August 24-26, 2015, Princeton, NJ, {USA}}, series = {LIPIcs}, volume = {40}, pages = {606--624}, publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik}, year = {2015}, url = {https://doi.org/10.4230/LIPIcs.APPROX-RANDOM.2015.606}, doi = {10.4230/LIPICS.APPROX-RANDOM.2015.606}, timestamp = {Thu, 20 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/approx/BrodyS15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caise/NaranjoSV15, author = {David Naranjo and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Anne Persson and Janis Stirna}, title = {The Devil in the Details: Fine-Grained Enterprise Model Weaving}, booktitle = {Advanced Information Systems Engineering Workshops - CAiSE 2015 International Workshops, Stockholm, Sweden, June 8-9, 2015, Proceedings}, series = {Lecture Notes in Business Information Processing}, volume = {215}, pages = {233--244}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-319-19243-7\_23}, doi = {10.1007/978-3-319-19243-7\_23}, timestamp = {Sun, 02 Jun 2019 21:20:00 +0200}, biburl = {https://dblp.org/rec/conf/caise/NaranjoSV15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caise/RamosSSV15, author = {Andr{\'{e}}s Ramos and Juan Pablo S{\'{a}}enz and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Khaled Gaaloul and Rainer Schmidt and Selmin Nurcan and S{\'{e}}rgio Guerreiro and Qin Ma}, title = {On the Support of Automated Analysis Chains on Enterprise Models}, booktitle = {Enterprise, Business-Process and Information Systems Modeling - 16th International Conference, {BPMDS} 2015, 20th International Conference, {EMMSAD} 2015, Held at CAiSE 2015, Stockholm, Sweden, June 8-9, 2015, Proceedings}, series = {Lecture Notes in Business Information Processing}, volume = {214}, pages = {345--359}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-319-19237-6\_22}, doi = {10.1007/978-3-319-19237-6\_22}, timestamp = {Fri, 19 Mar 2021 08:43:31 +0100}, biburl = {https://dblp.org/rec/conf/caise/RamosSSV15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/fskd/Sanchez-Camacho15, author = {Mario Garcia{-}Munoz Sanchez{-}Camacho and Hongying Wu and Carlos Alberto Nunes Cosenza and Fabio Krykhtine and F{\'{e}}lix Mora{-}Camino}, title = {Fuzzy setting of cost Index for improved flight management}, booktitle = {12th International Conference on Fuzzy Systems and Knowledge Discovery, {FSKD} 2015, Zhangjiajie, China, August 15-17, 2015}, pages = {433--438}, publisher = {{IEEE}}, year = {2015}, url = {https://doi.org/10.1109/FSKD.2015.7381981}, doi = {10.1109/FSKD.2015.7381981}, timestamp = {Wed, 16 Oct 2019 14:14:57 +0200}, biburl = {https://dblp.org/rec/conf/fskd/Sanchez-Camacho15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ibpria/RodriguezMHO15, author = {Mario Rodr{\'{\i}}guez and Carlos Medrano and El{\'{\i}}as Herrero and Carlos Orrite}, editor = {Roberto Paredes and Jaime S. Cardoso and Xos{\'{e}} M. Pardo}, title = {Spectral Clustering Using Friendship Path Similarity}, booktitle = {Pattern Recognition and Image Analysis - 7th Iberian Conference, IbPRIA 2015, Santiago de Compostela, Spain, June 17-19, 2015, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {9117}, pages = {319--326}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-319-19390-8\_36}, doi = {10.1007/978-3-319-19390-8\_36}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ibpria/RodriguezMHO15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscas/SaldanhaSZPA15, author = {M{\'{a}}rio Saldanha and Gustavo Sanchez and Bruno Zatt and Marcelo Schiavon Porto and Luciano Volcan Agostini}, title = {Complexity reduction for the 3D-HEVC depth maps coding}, booktitle = {2015 {IEEE} International Symposium on Circuits and Systems, {ISCAS} 2015, Lisbon, Portugal, May 24-27, 2015}, pages = {621--624}, publisher = {{IEEE}}, year = {2015}, url = {https://doi.org/10.1109/ISCAS.2015.7168710}, doi = {10.1109/ISCAS.2015.7168710}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iscas/SaldanhaSZPA15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iwbbio/SanchezFCAC15, author = {Horacio P{\'{e}}rez S{\'{a}}nchez and Afshin Fassihi and Jos{\'{e}} M. Cecilia and Hesham H. Ali and Mario Cannataro}, editor = {Francisco M. Ortu{\~{n}}o Guzman and Ignacio Rojas}, title = {Applications of High Performance Computing in Bioinformatics, Computational Biology and Computational Chemistry}, booktitle = {Bioinformatics and Biomedical Engineering - Third International Conference, {IWBBIO} 2015, Granada, Spain, April 15-17, 2015. Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {9044}, pages = {527--541}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-319-16480-9\_51}, doi = {10.1007/978-3-319-16480-9\_51}, timestamp = {Fri, 11 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iwbbio/SanchezFCAC15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lascas/SanchezSZPA15, author = {Gustavo Sanchez and M{\'{a}}rio Saldanha and Bruno Zatt and Marcelo Schiavon Porto and Luciano Volcan Agostini}, title = {{S-GMOF:} {A} gradient-based complexity reduction algorithm for depth-maps intra prediction on 3D-HEVC}, booktitle = {{IEEE} 6th Latin American Symposium on Circuits {\&} Systems, {LASCAS} 2015, Montevideo, Uruguay, February 24-27, 2015}, pages = {1--4}, publisher = {{IEEE}}, year = {2015}, url = {https://doi.org/10.1109/LASCAS.2015.7250455}, doi = {10.1109/LASCAS.2015.7250455}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/lascas/SanchezSZPA15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mie/MorenoGCLLSBGWC15, author = {Pedro A. Moreno and Jos{\'{e}} Luis Garcia{-}Pacheco and Jim Charvill and Ahmad Lotfi and Caroline S. Langensiepen and Alison Saunders and Kris Berckmans and Jozef Gaspersic and Louise Walton and Montserrat Carmona Rodriguez and S. Perez de la Camara and Ricardo S{\'{a}}nchez{-}de{-}Madariaga and J. Pozo and Adolfo Mu{\~{n}}oz and Mario Pascual Carrasco and Enrique J. G{\'{o}}mez}, editor = {Ronald Cornet and Lacramioara Stoicu{-}Tivadar and Alexander H{\"{o}}rbst and Carlos Luis Parra Calder{\'{o}}n and Stig Kj{\ae}r Andersen and Mira Hercigonja{-}Szekeres}, title = {iCarer: {AAL} for the Informal Carers of the Elderly}, booktitle = {Digital Healthcare Empowering Europeans - Proceedings of MIE2015, Madrid Spain, 27-29 May, 2015}, series = {Studies in Health Technology and Informatics}, volume = {210}, pages = {678--680}, publisher = {{IOS} Press}, year = {2015}, url = {https://doi.org/10.3233/978-1-61499-512-8-678}, doi = {10.3233/978-1-61499-512-8-678}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mie/MorenoGCLLSBGWC15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mie/Sanchez-de-Madariaga15, author = {Ricardo S{\'{a}}nchez{-}de{-}Madariaga and Adolfo Mu{\~{n}}oz Carrero and Roberto Somolinos and Antonio L. Castro and Iker Vel{\'{a}}zquez and Oscar Moreno and Jos{\'{e}} L. Garc{\'{\i}}a{-}Pacheco and Mario Pascual Carrasco and Carlos Hern{\'{a}}ndez Salvador}, editor = {Ronald Cornet and Lacramioara Stoicu{-}Tivadar and Alexander H{\"{o}}rbst and Carlos Luis Parra Calder{\'{o}}n and Stig Kj{\ae}r Andersen and Mira Hercigonja{-}Szekeres}, title = {Normalized medical information visualization}, booktitle = {Digital Healthcare Empowering Europeans - Proceedings of MIE2015, Madrid Spain, 27-29 May, 2015}, series = {Studies in Health Technology and Informatics}, volume = {210}, pages = {215--217}, publisher = {{IOS} Press}, year = {2015}, url = {https://doi.org/10.3233/978-1-61499-512-8-215}, doi = {10.3233/978-1-61499-512-8-215}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mie/Sanchez-de-Madariaga15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mswim/Sanchez-Hernandez15, author = {Jairo Javier Sanchez{-}Hernandez and Rolando Menchaca{-}M{\'{e}}ndez and Ricardo Menchaca{-}Mendez and Jesus Garcia{-}Diaz and Mario E. Rivero{-}Angeles and Jose Joaquin Garcia{-}Luna{-}Aceves}, editor = {J. J. Garcia{-}Luna{-}Aceves and Graciela Rom{\'{a}}n{-}Alonso and Falko Dressler and Brahim Bensaou and Antonio A. F. Loureiro}, title = {A Bloom Filter-Based Algorithm for Routing in Intermittently Connected Mobile Networks}, booktitle = {Proceedings of the 18th {ACM} International Conference on Modeling, Analysis and Simulation of Wireless and Mobile Systems, MSWiM 2015, Cancun, Mexico, November 2-6, 2015}, pages = {319--326}, publisher = {{ACM}}, year = {2015}, url = {https://doi.org/10.1145/2811587.2811609}, doi = {10.1145/2811587.2811609}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/mswim/Sanchez-Hernandez15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sepln/SiordiaMGMTV15, author = {Oscar S. Siordia and Daniela Moctezuma and Mario Graff and Sabino Miranda{-}Jim{\'{e}}nez and Eric Sadit T{\'{e}}llez and Elio{-}Aten{\'{o}}genes Villase{\~{n}}or}, editor = {Julio Villena{-}Rom{\'{a}}n and Janine Garc{\'{\i}}a{-}Morera and Miguel {\'{A}}ngel Garc{\'{\i}}a Cumbreras and Eugenio Mart{\'{\i}}nez{-}C{\'{a}}mara and Mar{\'{\i}}a Teresa Mart{\'{\i}}n{-}Valdivia and Luis Alfonso Ure{\~{n}}a L{\'{o}}pez}, title = {Sentiment Analysis for Twitter: {TASS} 2015}, booktitle = {Proceedings of {TASS} 2015: Workshop on Sentiment Analysis at {SEPLN} co-located with 31st {SEPLN} Conference {(SEPLN} 2015), Alicante, Spain, September 15, 2015}, series = {{CEUR} Workshop Proceedings}, volume = {1397}, pages = {65--70}, publisher = {CEUR-WS.org}, year = {2015}, url = {https://ceur-ws.org/Vol-1397/centroGEO\_Infotec.pdf}, timestamp = {Wed, 17 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sepln/SiordiaMGMTV15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigcomm/SanchezBKW15, author = {Mario A. S{\'{a}}nchez and Fabi{\'{a}}n E. Bustamante and Balachander Krishnamurthy and Walter Willinger}, editor = {Fabi{\'{a}}n E. Bustamante and Balachander Krishnamurthy and Walter Willinger}, title = {Experiment Coordination for Large-scale Measurement Platforms}, booktitle = {Proceedings of the 2015 {ACM} {SIGCOMM} Workshop on Crowdsourcing and Crowdsharing of Big (Internet) Data, C2B(I)D@SIGCOMM 2015, London, United Kingdom, August 17, 2015}, pages = {21--26}, publisher = {{ACM}}, year = {2015}, url = {https://doi.org/10.1145/2787394.2787401}, doi = {10.1145/2787394.2787401}, timestamp = {Tue, 06 Nov 2018 11:07:11 +0100}, biburl = {https://dblp.org/rec/conf/sigcomm/SanchezBKW15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ucami/Ferrandez-Pastor15, author = {Francisco Javier Ferr{\'{a}}ndez Pastor and Higinio Mora Mora and Jos{\'{e}}{-}Luis S{\'{a}}nchez{-}Romero and Mario Nieto{-}Hidalgo}, editor = {Juan Manuel Garc{\'{\i}}a Chamizo and Giancarlo Fortino and Sergio F. Ochoa}, title = {Smart Sensor Design for Power Signal Processing}, booktitle = {Ubiquitous Computing and Ambient Intelligence. Sensing, Processing, and Using Environmental Information - 9th International Conference, UCAmI 2015, Puerto Varas, Chile, December 1-4, 2015, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {9454}, pages = {387--393}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-319-26401-1\_36}, doi = {10.1007/978-3-319-26401-1\_36}, timestamp = {Tue, 14 May 2019 10:00:41 +0200}, biburl = {https://dblp.org/rec/conf/ucami/Ferrandez-Pastor15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:series/sci/LocesRPBH15, author = {Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and Kavita Rege and Johnatan E. Pecero and Pascal Bouvry and H{\'{e}}ctor J. {Fraire H.}}, editor = {Patricia Melin and Oscar Castillo and Janusz Kacprzyk}, title = {Trajectory Metaheuristics for the Internet Shopping Optimization Problem}, booktitle = {Design of Intelligent Systems Based on Fuzzy Logic, Neural Networks and Nature-Inspired Optimization}, series = {Studies in Computational Intelligence}, volume = {601}, pages = {527--536}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-319-17747-2\_41}, doi = {10.1007/978-3-319-17747-2\_41}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/series/sci/LocesRPBH15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/BrodyS15, author = {Joshua Brody and Mario S{\'{a}}nchez}, title = {Dependent Random Graphs and Multiparty Pointer Jumping}, journal = {CoRR}, volume = {abs/1506.01083}, year = {2015}, url = {http://arxiv.org/abs/1506.01083}, eprinttype = {arXiv}, eprint = {1506.01083}, timestamp = {Thu, 20 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/BrodyS15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/MereloGVB15, author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and Mario Garc{\'{\i}}a Valdez and Israel Blancas}, title = {There is no fast lunch: an examination of the running speed of evolutionary algorithms in several languages}, journal = {CoRR}, volume = {abs/1511.01088}, year = {2015}, url = {http://arxiv.org/abs/1511.01088}, eprinttype = {arXiv}, eprint = {1511.01088}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/MereloGVB15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eccc/BrodyS15, author = {Joshua Brody and Mario S{\'{a}}nchez}, title = {Dependent Random Graphs and Multiparty Pointer Jumping}, journal = {Electron. Colloquium Comput. Complex.}, volume = {{TR15-091}}, year = {2015}, url = {https://eccc.weizmann.ac.il/report/2015/091}, eprinttype = {ECCC}, eprint = {TR15-091}, timestamp = {Thu, 20 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eccc/BrodyS15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/computing/GansnerKWBS14, author = {Emden R. Gansner and Balachander Krishnamurthy and Walter Willinger and Fabi{\'{a}}n E. Bustamante and Mario A. S{\'{a}}nchez}, title = {Demo abstract: towards extracting semantics by visualizing large traceroute datasets}, journal = {Computing}, volume = {96}, number = {1}, pages = {81--83}, year = {2014}, url = {https://doi.org/10.1007/s00607-013-0290-8}, doi = {10.1007/S00607-013-0290-8}, timestamp = {Thu, 06 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/computing/GansnerKWBS14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/dsp/Rodriguez-DiazS14, author = {Mario A. Rodr{\'{\i}}guez{-}D{\'{\i}}az and Hermilo S{\'{a}}nchez{-}Cruz}, title = {Refined fixed double pass binary object classification for document image compression}, journal = {Digit. Signal Process.}, volume = {30}, pages = {114--130}, year = {2014}, url = {https://doi.org/10.1016/j.dsp.2014.03.007}, doi = {10.1016/J.DSP.2014.03.007}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/dsp/Rodriguez-DiazS14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ejwcn/Cortes-SanchezVLRS14, author = {Jorge Cort{\'{e}}s{-}S{\'{a}}nchez and Andr{\'{e}}s Vel{\'{a}}zquez{-}Ram{\'{\i}}rez and Andr{\'{e}}s Lucas{-}Bravo and Mario E. Rivero{-}Angeles and Victor A. Salinas{-}Reyes}, title = {On the use of electromagnetic waves as means of power supply in wireless sensor networks}, journal = {{EURASIP} J. Wirel. Commun. Netw.}, volume = {2014}, pages = {36}, year = {2014}, url = {https://doi.org/10.1186/1687-1499-2014-36}, doi = {10.1186/1687-1499-2014-36}, timestamp = {Thu, 27 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ejwcn/Cortes-SanchezVLRS14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/evi/MoraGGCRH14, author = {Antonio Miguel Mora and Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and Pedro A. Castillo and M. S. Rodr{\'{\i}}guez{-}Domingo and R. M. Hidalgo{-}Berm{\'{u}}dez}, title = {Creating autonomous agents for playing Super Mario Bros game by means of evolutionary finite state machines}, journal = {Evol. Intell.}, volume = {6}, number = {4}, pages = {205--218}, year = {2014}, url = {https://doi.org/10.1007/s12065-014-0105-7}, doi = {10.1007/S12065-014-0105-7}, timestamp = {Thu, 16 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/evi/MoraGGCRH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijns/GonzalezDRS14, author = {Mario Gonz{\'{a}}lez and David Dominguez and Francisco B. Rodr{\'{\i}}guez and {\'{A}}ngel S{\'{a}}nchez}, title = {Retrieval of noisy Fingerprint Patterns using Metric Attractor Networks}, journal = {Int. J. Neural Syst.}, volume = {24}, number = {7}, year = {2014}, url = {https://doi.org/10.1142/S0129065714500257}, doi = {10.1142/S0129065714500257}, timestamp = {Sat, 01 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijns/GonzalezDRS14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jot/GomezSFV14, author = {Paola G{\'{o}}mez and Mario E. S{\'{a}}nchez and Hector Florez and Jorge Villalobos}, title = {An approach to the co-creation of models and metamodels in Enterprise Architecture Projects}, journal = {J. Object Technol.}, volume = {13}, number = {3}, pages = {2: 1--29}, year = {2014}, url = {https://doi.org/10.5381/jot.2014.13.3.a2}, doi = {10.5381/JOT.2014.13.3.A2}, timestamp = {Wed, 17 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jot/GomezSFV14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pnas/Gavalda-Miralles14, author = {Arnau Gavald{\`{a}}{-}Miralles and David R. Choffnes and John S. Otto and Mario A. S{\'{a}}nchez and Fabi{\'{a}}n E. Bustamante and Lu{\'{\i}}s A. Nunes Amaral and Jordi Duch and Roger Guimer{\`{a}}}, title = {Impact of heterogeneity and socioeconomic factors on individual behavior in decentralized sharing ecosystems}, journal = {Proc. Natl. Acad. Sci. {USA}}, volume = {111}, number = {43}, pages = {15322--15327}, year = {2014}, url = {https://doi.org/10.1073/pnas.1309389111}, doi = {10.1073/PNAS.1309389111}, timestamp = {Thu, 16 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pnas/Gavalda-Miralles14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/polibits/JaramilloSP14, author = {Carlos Mario Zapata Jaramillo and Rafael Esteban Arango Sanchez and Leidy Diana Jim{\'{e}}nez Pinz{\'{o}}n}, title = {Mejoramiento de la consistencia entre la sintaxis textual y gr{\'{a}}fica del lenguaje de Semat}, journal = {Polibits}, volume = {49}, pages = {83--89}, year = {2014}, url = {https://doi.org/10.17562/pb-49-10}, doi = {10.17562/PB-49-10}, timestamp = {Fri, 10 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/polibits/JaramilloSP14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caise/RamosGSV14, author = {Andr{\'{e}}s Ramos and Paola G{\'{o}}mez and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Ilia Bider and Khaled Gaaloul and John Krogstie and Selmin Nurcan and Henderik Alex Proper and Rainer Schmidt and Pnina Soffer}, title = {Automated Enterprise-Level Analysis of ArchiMate Models}, booktitle = {Enterprise, Business-Process and Information Systems Modeling - 15th International Conference, {BPMDS} 2014, 19th International Conference, {EMMSAD} 2014, Held at CAiSE 2014, Thessaloniki, Greece, June 16-17, 2014. Proceedings}, series = {Lecture Notes in Business Information Processing}, volume = {175}, pages = {439--453}, publisher = {Springer}, year = {2014}, url = {https://doi.org/10.1007/978-3-662-43745-2\_30}, doi = {10.1007/978-3-662-43745-2\_30}, timestamp = {Thu, 02 Aug 2018 16:14:14 +0200}, biburl = {https://dblp.org/rec/conf/caise/RamosGSV14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caise/SanchezRV14, author = {Mario E. S{\'{a}}nchez and Julio Cesar Reyes and Jorge Villalobos}, editor = {Joseph Barjis and Robert Pergl}, title = {Extraction and Reconstruction of Enterprise Models}, booktitle = {Enterprise and Organizational Modeling and Simulation - 10th International Workshop, {EOMAS} 2014, Held at CAiSE 2014, Thessaloniki, Greece, June 16-17, 2014, Selected Papers}, series = {Lecture Notes in Business Information Processing}, volume = {191}, pages = {3--20}, publisher = {Springer}, year = {2014}, url = {https://doi.org/10.1007/978-3-662-44860-1\_1}, doi = {10.1007/978-3-662-44860-1\_1}, timestamp = {Thu, 15 Jun 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/caise/SanchezRV14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ccgrid/DiazPBSVC14, author = {Cesar O. Diaz and Johnatan E. Pecero and Pascal Bouvry and German Sotelo and Mario Villamizar and Harold E. Castro}, title = {Performance Evaluation of an IaaS Opportunistic Cloud Computing}, booktitle = {14th {IEEE/ACM} International Symposium on Cluster, Cloud and Grid Computing, CCGrid 2014, Chicago, IL, USA, May 26-29, 2014}, pages = {546--547}, publisher = {{IEEE} Computer Society}, year = {2014}, url = {https://doi.org/10.1109/CCGrid.2014.116}, doi = {10.1109/CCGRID.2014.116}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ccgrid/DiazPBSVC14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clei/DivanORCFM14, author = {Mario Jos{\'{e}} Div{\'{a}}n and Ana Oddone and Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso and Bruno Sebastian Cavallo and Marcos Alejandro Fredes and Alejandro Maximiliano Martinez}, title = {A data monitoring strategy based in snapshots for the score calculation in the housing distribution}, booktitle = {{XL} Latin American Computing Conference, {CLEI} 2014, Montevideo, Uruguay, September 15-19, 2014}, pages = {1--12}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/CLEI.2014.6965104}, doi = {10.1109/CLEI.2014.6965104}, timestamp = {Thu, 14 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/clei/DivanORCFM14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/edoc/FlorezSV14, author = {Hector Florez and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Manfred Reichert and Stefanie Rinderle{-}Ma and Georg Grossmann}, title = {Extensible Model-Based Approach for Supporting Automatic Enterprise Analysis}, booktitle = {18th {IEEE} International Enterprise Distributed Object Computing Conference, {EDOC} 2014, Ulm, Germany, September 1-5, 2014}, pages = {32--41}, publisher = {{IEEE} Computer Society}, year = {2014}, url = {https://doi.org/10.1109/EDOC.2014.15}, doi = {10.1109/EDOC.2014.15}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/edoc/FlorezSV14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/edoc/FlorezSV14a, author = {Hector Florez and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Georg Grossmann and Sylvain Hall{\'{e}} and Dimka Karastoyanova and Manfred Reichert and Stefanie Rinderle{-}Ma}, title = {iArchiMate: {A} Tool for Managing Imperfection in Enterprise Models}, booktitle = {18th {IEEE} International Enterprise Distributed Object Computing Conference Workshops and Demonstrations, {EDOC} Workshops 2014, Ulm, Germany, September 1-2, 2014}, pages = {201--210}, publisher = {{IEEE} Computer Society}, year = {2014}, url = {https://doi.org/10.1109/EDOCW.2014.38}, doi = {10.1109/EDOCW.2014.38}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/edoc/FlorezSV14a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/edoc/NaranjoSV14, author = {David Naranjo and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Georg Grossmann and Sylvain Hall{\'{e}} and Dimka Karastoyanova and Manfred Reichert and Stefanie Rinderle{-}Ma}, title = {Towards a Unified and Modular Approach for Visual Analysis of Enterprise Models}, booktitle = {18th {IEEE} International Enterprise Distributed Object Computing Conference Workshops and Demonstrations, {EDOC} Workshops 2014, Ulm, Germany, September 1-2, 2014}, pages = {77--86}, publisher = {{IEEE} Computer Society}, year = {2014}, url = {https://doi.org/10.1109/EDOCW.2014.20}, doi = {10.1109/EDOCW.2014.20}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/edoc/NaranjoSV14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceee/Dominguez-Sanchez14, author = {S. Dominguez{-}Sanchez and Mario Alfredo Reyes{-}Barranca and G. S. Abarca{-}Jimenez and Salvador Mendoza{-}Acevedo}, title = {A prototype design for an accelerometer using a multiple floating-gate {MOSFET} as a transducer}, booktitle = {11th International Conference on Electrical Engineering, Computing Science and Automatic Control, {CCE} 2014, Campeche, Mexico, September 29 - October 3, 2014}, pages = {1--6}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/ICEEE.2014.6978255}, doi = {10.1109/ICEEE.2014.6978255}, timestamp = {Wed, 16 Oct 2019 14:14:56 +0200}, biburl = {https://dblp.org/rec/conf/iceee/Dominguez-Sanchez14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceis/NaranjoSV14, author = {David Naranjo and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Slimane Hammoudi and Leszek A. Maciaszek and Jos{\'{e}} Cordeiro}, title = {PRIMROSe - {A} Tool for Enterprise Architecture Analysis and Diagnosis}, booktitle = {{ICEIS} 2014 - Proceedings of the 16th International Conference on Enterprise Information Systems, Volume 3, Lisbon, Portugal, 27-30 April, 2014}, pages = {201--213}, publisher = {SciTePress}, year = {2014}, url = {https://doi.org/10.5220/0004884702010213}, doi = {10.5220/0004884702010213}, timestamp = {Wed, 12 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iceis/NaranjoSV14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceis/NaranjoSV14a, author = {David Naranjo and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Jos{\'{e}} Cordeiro and Slimane Hammoudi and Leszek A. Maciaszek and Olivier Camp and Joaquim Filipe}, title = {PRIMROSe: {A} Graph-Based Approach for Enterprise Architecture Analysis}, booktitle = {Enterprise Information Systems - 16th International Conference, {ICEIS} 2014, Lisbon, Portugal, April 27-30, 2014, Revised Selected Papers}, series = {Lecture Notes in Business Information Processing}, volume = {227}, pages = {434--452}, publisher = {Springer}, year = {2014}, url = {https://doi.org/10.1007/978-3-319-22348-3\_24}, doi = {10.1007/978-3-319-22348-3\_24}, timestamp = {Sat, 19 Oct 2019 20:26:20 +0200}, biburl = {https://dblp.org/rec/conf/iceis/NaranjoSV14a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icete/MusialPLFBB14, author = {Jedrzej Musial and Johnatan E. Pecero and Mario C. Lopez and H{\'{e}}ctor J. {Fraire H.} and Pascal Bouvry and Jacek Blazewicz}, editor = {Mohammad S. Obaidat and Andreas Holzinger and Marten van Sinderen and Peter Dolog}, title = {How to Efficiently Solve Internet Shopping Optimization Problem with Price Sensitive Discounts?}, booktitle = {{ICE-B} 2014 - Proceedings of the 11th International Conference on e-Business, Vienna, Austria, 28-30 August, 2014}, pages = {209--215}, publisher = {SciTePress}, year = {2014}, url = {https://doi.org/10.5220/0005112602090215}, doi = {10.5220/0005112602090215}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icete/MusialPLFBB14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/SanchezSBZPA14, author = {Gustavo Sanchez and M{\'{a}}rio Saldanha and Gabriel Balota and Bruno Zatt and Marcelo Schiavon Porto and Luciano Volcan Agostini}, title = {Complexity reduction for 3D-HEVC depth maps intra-frame prediction using simplified edge detector algorithm}, booktitle = {2014 {IEEE} International Conference on Image Processing, {ICIP} 2014, Paris, France, October 27-30, 2014}, pages = {3209--3213}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/ICIP.2014.7025649}, doi = {10.1109/ICIP.2014.7025649}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icip/SanchezSBZPA14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icira/PrudencioSGL14, author = {Alejandro Prudencio and Eduardo Morales Sanchez and Mario A. Garc{\'{\i}}a and Alejandro Lozano}, editor = {Xianmin Zhang and Honghai Liu and Zhong Chen and Nianfeng F. Wang}, title = {Anthropometric and Anthropomorphic Features Applied to a Mechanical Finger}, booktitle = {Intelligent Robotics and Applications - 7th International Conference, {ICIRA} 2014, Guangzhou, China, December 17-20, 2014, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {8917}, pages = {254--265}, publisher = {Springer}, year = {2014}, url = {https://doi.org/10.1007/978-3-319-13966-1\_26}, doi = {10.1007/978-3-319-13966-1\_26}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icira/PrudencioSGL14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/imc/SanchezBKWSE14, author = {Mario A. S{\'{a}}nchez and Fabi{\'{a}}n E. Bustamante and Balachander Krishnamurthy and Walter Willinger and Georgios Smaragdakis and Jeffrey Erman}, editor = {Carey Williamson and Aditya Akella and Nina Taft}, title = {Inter-Domain Traffic Estimation for the Outsider}, booktitle = {Proceedings of the 2014 Internet Measurement Conference, {IMC} 2014, Vancouver, BC, Canada, November 5-7, 2014}, pages = {1--14}, publisher = {{ACM}}, year = {2014}, url = {https://doi.org/10.1145/2663716.2663740}, doi = {10.1145/2663716.2663740}, timestamp = {Sun, 25 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/imc/SanchezBKWSE14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iolts/Sanchez-ClementeEG14, author = {Antonio Sanchez{-}Clemente and Luis Entrena and Mario Garc{\'{\i}}a{-}Valderas}, title = {Error masking with approximate logic circuits using dynamic probability estimations}, booktitle = {2014 {IEEE} 20th International On-Line Testing Symposium, {IOLTS} 2014, Platja d'Aro, Girona, Spain, July 7-9, 2014}, pages = {134--139}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/IOLTS.2014.6873685}, doi = {10.1109/IOLTS.2014.6873685}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/iolts/Sanchez-ClementeEG14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lanmr/Anzures-GarciaSHP14, author = {Mario Anzures{-}Garc{\'{\i}}a and Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and Miguel J. Hornos and Patricia Paderewski}, editor = {Juan Carlos Acosta Guadarrama}, title = {Knowledge Representation for Development of Collaborative Applications}, booktitle = {Proceedings of the Ninth Latin American Workshop on Logic/Languages, Algorithms and New Methods of Reasoning, Valle de Bravo, Mexico, November 5-7, 2014}, series = {{CEUR} Workshop Proceedings}, volume = {1287}, pages = {1--9}, publisher = {CEUR-WS.org}, year = {2014}, url = {https://ceur-ws.org/Vol-1287/preface.pdf}, timestamp = {Fri, 10 Mar 2023 16:23:17 +0100}, biburl = {https://dblp.org/rec/conf/lanmr/Anzures-GarciaSHP14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lascas/BalotaSSZPA14, author = {Gabriel Balota and M{\'{a}}rio Saldanha and Gustavo Sanchez and Bruno Zatt and Marcelo Schiavon Porto and Luciano Volcan Agostini}, title = {Overview and quality analysis in 3D-HEVC emergent video coding standard}, booktitle = {{IEEE} 5th Latin American Symposium on Circuits and Systems, {LASCAS} 2014, Santiago, Chile, February 25-28, 2014}, pages = {1--4}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/LASCAS.2014.6820260}, doi = {10.1109/LASCAS.2014.6820260}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/lascas/BalotaSSZPA14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lascas/ReyesPTLSMH14, author = {Benjam{\'{\i}}n T. Reyes and German Paulina and Lucas Tealdi and Emanuel Labat and Raul M. Sanchez and Pablo Sergio Mandolesi and Mario Rafael Hueda}, title = {A 1.6Gb/s {CMOS} {LVDS} transmitter with a programmable pre-emphasis system}, booktitle = {{IEEE} 5th Latin American Symposium on Circuits and Systems, {LASCAS} 2014, Santiago, Chile, February 25-28, 2014}, pages = {1--4}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/LASCAS.2014.6820268}, doi = {10.1109/LASCAS.2014.6820268}, timestamp = {Mon, 20 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/lascas/ReyesPTLSMH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lascas/ReyesTPLSMH14, author = {Benjam{\'{\i}}n T. Reyes and Lucas Tealdi and German Paulina and Emanuel Labat and Raul M. Sanchez and Pablo Sergio Mandolesi and Mario Rafael Hueda}, title = {A 6-bit 2GS/s {CMOS} time-interleaved {ADC} for analysis of mixed-signal calibration techniques}, booktitle = {{IEEE} 5th Latin American Symposium on Circuits and Systems, {LASCAS} 2014, Santiago, Chile, February 25-28, 2014}, pages = {1--4}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/LASCAS.2014.6820267}, doi = {10.1109/LASCAS.2014.6820267}, timestamp = {Mon, 20 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/lascas/ReyesTPLSMH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/vcip/SanchezSBZPA14, author = {Gustavo Sanchez and M{\'{a}}rio Saldanha and Gabriel Balota and Bruno Zatt and Marcelo Schiavon Porto and Luciano Volcan Agostini}, title = {A complexity reduction algorithm for depth maps intra prediction on the 3D-HEVC}, booktitle = {2014 {IEEE} Visual Communications and Image Processing Conference, {VCIP} 2014, Valletta, Malta, December 7-10, 2014}, pages = {137--140}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/VCIP.2014.7051523}, doi = {10.1109/VCIP.2014.7051523}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/vcip/SanchezSBZPA14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:series/sci/LocesCHBPRBV14, author = {Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and Norberto Castillo{-}Garc{\'{\i}}a and H{\'{e}}ctor J. {Fraire H.} and Pascal Bouvry and Johnatan E. Pecero and Rodolfo A. Pazos Rangel and Juan Javier Gonz{\'{a}}lez Barbosa and Fevrier Valdez}, editor = {Oscar Castillo and Patricia Melin and Witold Pedrycz and Janusz Kacprzyk}, title = {A New Integer Linear Programming Model for the Cutwidth Minimization Problem of a Connected Undirected Graph}, booktitle = {Recent Advances on Hybrid Approaches for Designing Intelligent Systems}, series = {Studies in Computational Intelligence}, volume = {547}, pages = {509--517}, publisher = {Springer}, year = {2014}, url = {https://doi.org/10.1007/978-3-319-05170-3\_35}, doi = {10.1007/978-3-319-05170-3\_35}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/series/sci/LocesCHBPRBV14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cluster/CastroVSDPB13, author = {Harold E. Castro and Mario Villamizar and German Sotelo and Cesar O. Diaz and Johnatan E. Pecero and Pascal Bouvry}, title = {Green flexible opportunistic computing with task consolidation and virtualization}, journal = {Clust. Comput.}, volume = {16}, number = {3}, pages = {545--557}, year = {2013}, url = {https://doi.org/10.1007/s10586-012-0222-y}, doi = {10.1007/S10586-012-0222-Y}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cluster/CastroVSDPB13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cmpb/Martinez-ZarzuelaGPFH13, author = {Mario Mart{\'{\i}}nez{-}Zarzuela and Carlos G{\'{o}}mez and Francisco Javier D{\'{\i}}az Pernas and Alberto Fern{\'{a}}ndez and Roberto Hornero}, title = {Cross-Approximate Entropy parallel computation on GPUs for biomedical signal analysis. Application to {MEG} recordings}, journal = {Comput. Methods Programs Biomed.}, volume = {112}, number = {1}, pages = {189--199}, year = {2013}, url = {https://doi.org/10.1016/j.cmpb.2013.07.005}, doi = {10.1016/J.CMPB.2013.07.005}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cmpb/Martinez-ZarzuelaGPFH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/envsoft/RodriguezMDAHM13, author = {Juan Pablo Rodr{\'{\i}}guez and Neil Duncan McIntyre and Mario D{\'{\i}}az{-}Granados and Stefan Achleitner and Martin Hochedlinger and Cedo Maksimovic}, title = {Generating time-series of dry weather loads to sewers}, journal = {Environ. Model. Softw.}, volume = {43}, pages = {133--143}, year = {2013}, url = {https://doi.org/10.1016/j.envsoft.2013.02.007}, doi = {10.1016/J.ENVSOFT.2013.02.007}, timestamp = {Thu, 18 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/envsoft/RodriguezMDAHM13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijcis/Sanchez-GonzalezGRP13, author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and F{\'{e}}lix Garc{\'{\i}}a and Francisco Ruiz and Mario Piattini}, title = {Toward a Quality Framework for Business Process Models}, journal = {Int. J. Cooperative Inf. Syst.}, volume = {22}, number = {1}, year = {2013}, url = {https://doi.org/10.1142/S0218843013500032}, doi = {10.1142/S0218843013500032}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijcis/Sanchez-GonzalezGRP13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jamia/Sanchez-de-MadariagaCTSPMSM13, author = {Ricardo S{\'{a}}nchez{-}de{-}Madariaga and Adolfo Mu{\~{n}}oz Carrero and Jes{\'{u}}s C{\'{a}}ceres Tello and Roberto Somolinos and Mario Pascual Carrasco and Ignacio Mart{\'{\i}}nez and Carlos Hern{\'{a}}ndez Salvador and Jose Luis Monteagudo}, title = {ccML, a new mark-up language to improve {ISO/EN} 13606-based electronic health record extracts practical edition}, journal = {J. Am. Medical Informatics Assoc.}, volume = {20}, number = {2}, pages = {298--304}, year = {2013}, url = {https://doi.org/10.1136/amiajnl-2011-000722}, doi = {10.1136/AMIAJNL-2011-000722}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jamia/Sanchez-de-MadariagaCTSPMSM13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/mcs/RizoLBRH13, author = {Mario Rizo and Marco Liserre and Emilio Jos{\'{e}} Bueno and Francisco J. Rodr{\'{\i}}guez and Francisco Huerta}, title = {Universal wind turbine working in grid-connected and island operating modes}, journal = {Math. Comput. Simul.}, volume = {91}, pages = {41--51}, year = {2013}, url = {https://doi.org/10.1016/j.matcom.2012.07.006}, doi = {10.1016/J.MATCOM.2012.07.006}, timestamp = {Thu, 25 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/mcs/RizoLBRH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/Sanchez-EscobedoC13, author = {Dalila S{\'{a}}nchez{-}Escobedo and Mario Castel{\'{a}}n}, title = {3D face shape prediction from a frontal image using cylindrical coordinates and partial least squares}, journal = {Pattern Recognit. Lett.}, volume = {34}, number = {4}, pages = {389--399}, year = {2013}, url = {https://doi.org/10.1016/j.patrec.2012.09.007}, doi = {10.1016/J.PATREC.2012.09.007}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/Sanchez-EscobedoC13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rcc/SanchezV13, author = {Mario E. S{\'{a}}nchez and Jorge Villalobos}, title = {An Expanded and Refined Catalog of Time Patterns for Workflows}, journal = {Rev. Colomb. de Computaci{\'{o}}n}, volume = {14}, number = {2}, pages = {122--140}, year = {2013}, url = {https://doi.org/10.29375/25392115.2018}, doi = {10.29375/25392115.2018}, timestamp = {Mon, 18 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rcc/SanchezV13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tvlsi/GarridoGSG13, author = {Mario Garrido and Jes{\'{u}}s Grajal and Miguel A. S{\'{a}}nchez Marcos and Oscar Gustafsson}, title = {Pipelined Radix-2\({}^{\mbox{k}}\) Feedforward {FFT} Architectures}, journal = {{IEEE} Trans. Very Large Scale Integr. Syst.}, volume = {21}, number = {1}, pages = {23--32}, year = {2013}, url = {https://doi.org/10.1109/TVLSI.2011.2178275}, doi = {10.1109/TVLSI.2011.2178275}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tvlsi/GarridoGSG13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ccgrid/DiazCVPB13, author = {Cesar O. Diaz and Harold E. Castro and Mario Villamizar and Johnatan E. Pecero and Pascal Bouvry}, title = {Energy-aware {VM} Allocation on an Opportunistic Cloud Infrastructure}, booktitle = {13th {IEEE/ACM} International Symposium on Cluster, Cloud, and Grid Computing, CCGrid 2013, Delft, Netherlands, May 13-16, 2013}, pages = {663--670}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://doi.org/10.1109/CCGrid.2013.96}, doi = {10.1109/CCGRID.2013.96}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ccgrid/DiazCVPB13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cdc/Gonzalez-SanchezALZ13, author = {Mario Francisco Gonz{\'{a}}lez{-}S{\'{a}}nchez and Luis Antonio Amezquita{-}Brooks and Eduardo Lic{\'{e}}aga{-}Castro and Patricia del C. Zambrano{-}Robledo}, title = {Simplifying quadrotor controllers by using simplified design models}, booktitle = {Proceedings of the 52nd {IEEE} Conference on Decision and Control, {CDC} 2013, Florence, Italy, December 10-13, 2013}, pages = {4236--4241}, publisher = {{IEEE}}, year = {2013}, url = {https://doi.org/10.1109/CDC.2013.6760540}, doi = {10.1109/CDC.2013.6760540}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cdc/Gonzalez-SanchezALZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ecoop/GomezSV13, author = {Paola G{\'{o}}mez and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Davide Di Ruscio and Dimitris S. Kolovos and Louis M. Rose and Samir Al{-}Hilank}, title = {\emph{GraCoT}, a tool for co-creation of models and metamodels in specific domains}, booktitle = {Proceedings of the workshop on ACadeMics Tooling with Eclipse, ACME@ECOOP 2013, Montpellier, France, July 2, 2013}, pages = {5:1--5:10}, publisher = {{ACM}}, year = {2013}, url = {https://doi.org/10.1145/2491279.2491284}, doi = {10.1145/2491279.2491284}, timestamp = {Tue, 06 Nov 2018 16:59:31 +0100}, biburl = {https://dblp.org/rec/conf/ecoop/GomezSV13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ecoop/MeloSV13, author = {Ivan Melo and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Beno{\^{\i}}t Combemale and Walter Cazzola and Robert B. France}, title = {Composing graphical languages}, booktitle = {Proceedings of the First Workshop on the Globalization of Domain Specific Languages, GlobalDSL@ECOOP 2013, Montpellier, France, July 1, 2013}, pages = {12--17}, publisher = {{ACM}}, year = {2013}, url = {https://doi.org/10.1145/2489812.2489816}, doi = {10.1145/2489812.2489816}, timestamp = {Tue, 06 Nov 2018 16:59:31 +0100}, biburl = {https://dblp.org/rec/conf/ecoop/MeloSV13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/europar/LoddeFA13, author = {Mario Lodde and Jos{\'{e}} Flich and Manuel E. Acacio}, editor = {Felix Wolf and Bernd Mohr and Dieter an Mey}, title = {Towards Efficient Dynamic {LLC} Home Bank Mapping with NoC-Level Support}, booktitle = {Euro-Par 2013 Parallel Processing - 19th International Conference, Aachen, Germany, August 26-30, 2013. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {8097}, pages = {178--190}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-40047-6\_20}, doi = {10.1007/978-3-642-40047-6\_20}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/europar/LoddeFA13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hbu/RodriguezMHO13, author = {Mario Rodr{\'{\i}}guez and Carlos Medrano and El{\'{\i}}as Herrero and Carlos Orrite}, editor = {Albert Ali Salah and Hayley Hung and Oya Aran and Hatice Gunes}, title = {Transfer Learning of Human Poses for Action Recognition}, booktitle = {Human Behavior Understanding - 4th International Workshop, {HBU} 2013, Barcelona, Spain, October 22, 2013. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {8212}, pages = {89--101}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-319-02714-2\_8}, doi = {10.1007/978-3-319-02714-2\_8}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/hbu/RodriguezMHO13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ica3pp/SoteloDVCPB13, author = {German Sotelo and Cesar O. Diaz and Mario Villamizar and Harold E. Castro and Johnatan E. Pecero and Pascal Bouvry}, editor = {Joanna Kolodziej and Beniamino Di Martino and Domenico Talia and Kaiqi Xiong}, title = {Building Platform as a Service for High Performance Computing over an Opportunistic Cloud Computing}, booktitle = {Algorithms and Architectures for Parallel Processing - 13th International Conference, {ICA3PP} 2013, Vietri sul Mare, Italy, December 18-20, 2013, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {8285}, pages = {380--389}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-319-03859-9\_33}, doi = {10.1007/978-3-319-03859-9\_33}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ica3pp/SoteloDVCPB13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icsoc/PeceroDCVSB13, author = {Johnatan E. Pecero and Cesar O. Diaz and Harold E. Castro and Mario Villamizar and German Sotelo and Pascal Bouvry}, editor = {Alessio Lomuscio and Surya Nepal and Fabio Patrizi and Boualem Benatallah and Ivona Brandic}, title = {Energy Savings on a Cloud-Based Opportunistic Infrastructure}, booktitle = {Service-Oriented Computing - {ICSOC} 2013 Workshops - CCSA, CSB, PASCEB, SWESE, WESOA, and PhD Symposium, Berlin, Germany, December 2-5, 2013. Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {8377}, pages = {366--378}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-319-06859-6\_32}, doi = {10.1007/978-3-319-06859-6\_32}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icsoc/PeceroDCVSB13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ifip8-1/FlorezSV13, author = {Hector Florez and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Janis Grabis and Marite Kirikova and Jelena Zdravkovic and Janis Stirna}, title = {Embracing Imperfection in Enterprise Architecture Models}, booktitle = {Short Paper Proceedings of the 6th {IFIP} {WG} 8.1 Working Conference on the Practice of Enterprise Modeling (PoEM 2013), Riga, Latvia, November 6-7, 2013}, series = {{CEUR} Workshop Proceedings}, volume = {1023}, pages = {8--17}, publisher = {CEUR-WS.org}, year = {2013}, url = {https://ceur-ws.org/Vol-1023/paper1.pdf}, timestamp = {Fri, 10 Mar 2023 16:22:10 +0100}, biburl = {https://dblp.org/rec/conf/ifip8-1/FlorezSV13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ifip8-1/NaranjoSV13, author = {David Naranjo and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Janis Grabis and Marite Kirikova and Jelena Zdravkovic and Janis Stirna}, title = {Connecting the Dots: Examining Visualization Techniques for Enterprise Architecture Model Analysis}, booktitle = {Short Paper Proceedings of the 6th {IFIP} {WG} 8.1 Working Conference on the Practice of Enterprise Modeling (PoEM 2013), Riga, Latvia, November 6-7, 2013}, series = {{CEUR} Workshop Proceedings}, volume = {1023}, pages = {29--38}, publisher = {CEUR-WS.org}, year = {2013}, url = {https://ceur-ws.org/Vol-1023/paper3.pdf}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ifip8-1/NaranjoSV13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isami/SanchezSO13, author = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and Daniel D{\'{\i}}az S{\'{a}}nchez and Mario Mu{\~{n}}oz Organero}, editor = {Ad van Berlo and Kasper Hallenborg and Juan M. Corchado Rodr{\'{\i}}guez and Dante I. Tapia and Paulo Novais}, title = {Optimizing OSGi Services on Gateways}, booktitle = {Ambient Intelligence - Software and Applications - 4th International Symposium on Ambient Intelligence, ISAmI 2013, Salamanca, Spain, May 22-24, 2013}, series = {Advances in Intelligent Systems and Computing}, volume = {219}, pages = {155--162}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-319-00566-9\_20}, doi = {10.1007/978-3-319-00566-9\_20}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/isami/SanchezSO13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lion/Hidalgo-BermudezRMGGF13, author = {R. M. Hidalgo{-}Berm{\'{u}}dez and M. S. Rodr{\'{\i}}guez{-}Domingo and Antonio Miguel Mora and Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and Antonio Jos{\'{e}} Fern{\'{a}}ndez Leiva}, editor = {Giuseppe Nicosia and Panos M. Pardalos}, title = {Evolutionary FSM-Based Agents for Playing Super Mario Game}, booktitle = {Learning and Intelligent Optimization - 7th International Conference, {LION} 7, Catania, Italy, January 7-11, 2013, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {7997}, pages = {357--363}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-44973-4\_39}, doi = {10.1007/978-3-642-44973-4\_39}, timestamp = {Sun, 02 Jun 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/lion/Hidalgo-BermudezRMGGF13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nsdi/SanchezOBCBKW13, author = {Mario A. S{\'{a}}nchez and John S. Otto and Zachary S. Bischof and David R. Choffnes and Fabi{\'{a}}n E. Bustamante and Balachander Krishnamurthy and Walter Willinger}, editor = {Nick Feamster and Jeffrey C. Mogul}, title = {Dasu: Pushing Experiments to the Internet's Edge}, booktitle = {Proceedings of the 10th {USENIX} Symposium on Networked Systems Design and Implementation, {NSDI} 2013, Lombard, IL, USA, April 2-5, 2013}, pages = {487--499}, publisher = {{USENIX} Association}, year = {2013}, url = {https://www.usenix.org/conference/nsdi13/technical-sessions/presentation/sanchez}, timestamp = {Tue, 02 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/nsdi/SanchezOBCBKW13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pam/SanchezOBB13, author = {Mario A. S{\'{a}}nchez and John S. Otto and Zachary S. Bischof and Fabi{\'{a}}n E. Bustamante}, editor = {Matthew Roughan and Rocky K. C. Chang}, title = {Trying Broadband Characterization at Home}, booktitle = {Passive and Active Measurement - 14th International Conference, {PAM} 2013, Hong Kong, China, March 18-19, 2013. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {7799}, pages = {198--207}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-36516-4\_20}, doi = {10.1007/978-3-642-36516-4\_20}, timestamp = {Tue, 14 May 2019 10:00:52 +0200}, biburl = {https://dblp.org/rec/conf/pam/SanchezOBB13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wcsc/Ornelas-TellezGSA13, author = {Fernando Ornelas{-}Tellez and Mario Graff and Edgar N. S{\'{a}}nchez and Alma Y. Alanis}, editor = {Mo M. Jamshidi and Vladik Kreinovich and Janusz Kacprzyk}, title = {{PSO} Optimal Tracking Control for State-Dependent Coefficient Nonlinear Systems}, booktitle = {Advance Trends in Soft Computing - Proceedings of {WCSC} 2013, December 16-18, San Antonio, Texas, {USA}}, series = {Studies in Fuzziness and Soft Computing}, volume = {312}, pages = {403--410}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-319-03674-8\_38}, doi = {10.1007/978-3-319-03674-8\_38}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wcsc/Ornelas-TellezGSA13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/AartsenA13, author = {Mark G. Aartsen and Rasha U. Abbasi and Markus Ackermann and Jenni Adams and Juan Antonio Aguilar S{\'{a}}nchez and Markus Ahlers and David Altmann and Carlos A. Arg{\"{u}}elles Delgado and Jan Auffenberg and Xinhua Bai and Michael F. Baker and Steven W. Barwick and Volker Baum and Ryan Bay and James J. Beatty and Julia K. Becker Tjus and Karl{-}Heinz Becker and Segev BenZvi and Patrick Berghaus and David Berley and Elisa Bernardini and Anna Bernhard and David Z. Besson and G. Binder and Daniel Bindig and Martin Bissok and Erik Blaufuss and Jan Blumenthal and David J. Boersma and Christian Bohm and Debanjan Bose and Sebastian B{\"{o}}ser and Olga Botner and Lionel Brayeur and Hans{-}Peter Bretz and Anthony M. Brown and Ronald Bruijn and James Casey and Martin Casier and Dmitry Chirkin and Asen Christov and Brian John Christy and Ken Clark and Lew Classen and Fabian Clevermann and Stefan Coenders and Shirit Cohen and Doug F. Cowen and Angel H. Cruz Silva and Matthias Danninger and Jacob Daughhetee and James C. Davis and Melanie Day and Catherine De Clercq and Sam De Ridder and Paolo Desiati and Krijn D. de Vries and Meike de With and Tyce DeYoung and Juan Carlos D{\'{\i}}az{-}V{\'{e}}lez and Matthew Dunkman and Ryan Eagan and Benjamin Eberhardt and Bj{\"{o}}rn Eichmann and Jonathan Eisch and Sebastian Euler and Paul A. Evenson and Oladipo O. Fadiran and Ali R. Fazely and Anatoli Fedynitch and Jacob Feintzeig and Tom Feusels and Kirill Filimonov and Chad Finley and Tobias Fischer{-}Wasels and Samuel Flis and Anna Franckowiak and Katharina Frantzen and Tomasz Fuchs and Thomas K. Gaisser and Joseph S. Gallagher and Lisa Marie Gerhardt and Laura E. Gladstone and Thorsten Gl{\"{u}}senkamp and Azriel Goldschmidt and Geraldina Golup and Javier G. Gonz{\'{a}}lez and Jordan A. Goodman and Dariusz G{\'{o}}ra and Dylan T. Grandmont and Darren Grant and Pavel Gretskov and John C. Groh and Andreas Gro{\ss} and Chang Hyon Ha and Abd Al Karim Haj Ismail and Patrick Hallen and Allan Hallgren and Francis Halzen and Kael D. Hanson and Dustin Hebecker and David Heereman and Dirk Heinen and Klaus Helbing and Robert Eugene Hellauer III and Stephanie Virginia Hickford and Gary C. Hill and Kara D. Hoffman and Ruth Hoffmann and Andreas Homeier and Kotoyo Hoshina and Feifei Huang and Warren Huelsnitz and Per Olof Hulth and Klas Hultqvist and Shahid Hussain and Aya Ishihara and Emanuel Jacobi and John E. Jacobsen and Kai Jagielski and George S. Japaridze and Kyle Jero and Ola Jlelati and Basho Kaminsky and Alexander Kappes and Timo Karg and Albrecht Karle and Matthew Kauer and John Lawrence Kelley and Joanna Kiryluk and J. Kl{\"{a}}s and Spencer R. Klein and Jan{-}Hendrik K{\"{o}}hne and Georges Kohnen and Hermann Kolanoski and Lutz K{\"{o}}pke and Claudio Kopper and Sandro Kopper and D. Jason Koskinen and Marek Kowalski and Mark Krasberg and Anna Kriesten and Kai Michael Krings and G{\"{o}}sta Kroll and Jan Kunnen and Naoko Kurahashi and Takao Kuwabara and Mathieu L. M. Labare and Hagar Landsman and Michael James Larson and Mariola Lesiak{-}Bzdak and Martin Leuermann and Julia Leute and Jan L{\"{u}}nemann and Oscar A. Mac{\'{\i}}as{-}Ram{\'{\i}}rez and James Madsen and Giuliano Maggi and Reina Maruyama and Keiichi Mase and Howard S. Matis and Frank McNally and Kevin James Meagher and Martin Merck and Gonzalo Merino Ar{\'{e}}valo and Thomas Meures and Sandra Miarecki and Eike Middell and Natalie Milke and John Lester Miller and Lars Mohrmann and Teresa Montaruli and Robert M. Morse and Rolf Nahnhauer and Uwe Naumann and Hans Niederhausen and Sarah C. Nowicki and David R. Nygren and Anna Obertacke and Sirin Odrowski and Alex Olivas and Ahmad Omairat and Aongus Starbuck {\'{O}} Murchadha and Larissa Paul and Joshua A. Pepper and Carlos P{\'{e}}rez de los Heros and Carl Pfendner and Damian Pieloth and Elisa Pinat and Jonas Posselt and P. Buford Price and Gerald T. Przybylski and Melissa Quinnan and Leif R{\"{a}}del and Ian Rae and Mohamed Rameez and Katherine Rawlins and Peter Christian Redl and Ren{\'{e}} Reimann and Elisa Resconi and Wolfgang Rhode and Mathieu Ribordy and Michael Richman and Benedikt Riedel and J. P. Rodrigues and Carsten Rott and Tim Ruhe and Bakhtiyar Ruzybayev and Dirk Ryckbosch and Sabine M. Saba and Heinz{-}Georg Sander and Juan Marcos Santander and Subir Sarkar and Kai Schatto and Florian Scheriau and Torsten Schmidt and Martin Schmitz and Sebastian Schoenen and Sebastian Sch{\"{o}}neberg and Arne Sch{\"{o}}nwald and Anne Schukraft and Lukas Schulte and David Schultz and Olaf Schulz and David Seckel and Yolanda Sestayo de la Cerra and Surujhdeo Seunarine and Rezo Shanidze and Chris Sheremata and Miles W. E. Smith and Dennis Soldin and Glenn M. Spiczak and Christian Spiering and Michael Stamatikos and Todor Stanev and Nick A. Stanisha and Alexander Stasik and Thorsten Stezelberger and Robert G. Stokstad and Achim St{\"{o}}{\ss}l and Erik A. Strahler and Rickard Str{\"{o}}m and Nora Linn Strotjohann and Gregory W. Sullivan and Henric Taavola and Ignacio J. Taboada and Alessio Tamburro and Andreas Tepe and Samvel Ter{-}Antonyan and Gordana Tesic and Serap Tilav and Patrick A. Toale and Moriah Natasha Tobin and Simona Toscano and Maria Tselengidou and Elisabeth Unger and Marcel Usner and Sofia Vallecorsa and Nick van Eijndhoven and Arne Van Overloop and Jakob van Santen and Markus Vehring and Markus Voge and Matthias Vraeghe and Christian Walck and Tilo Waldenmaier and Marius Wallraff and Christopher N. Weaver and Mark T. Wellons and Christopher H. Wendt and Stefan Westerhoff and Nathan Whitehorn and Klaus Wiebe and Christopher Wiebusch and Dawn R. Williams and Henrike Wissing and Martin Wolf and Terri R. Wood and Kurt Woschnagg and Donglian Xu and Xianwu Xu and Juan Pablo Y{\'{a}}{\~{n}}ez Garza and Gaurang B. Yodh and Shigeru Yoshida and Pavel Zarzhitsky and Jan Ziemann and Simon Zierke and Marcel Zoll}, title = {The IceProd Framework: Distributed Data Processing for the IceCube Neutrino Observatory}, journal = {CoRR}, volume = {abs/1311.5904}, year = {2013}, url = {http://arxiv.org/abs/1311.5904}, eprinttype = {arXiv}, eprint = {1311.5904}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/AartsenA13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aeog/Rodriguez-GalianoPSCC12, author = {Victor F. Rodriguez{-}Galiano and Eulogio Pardo{-}Ig{\'{u}}zquiza and M. Sanchez{-}Castillo and Mario Chica{-}Olmo and Mario Chica{-}Rivas}, title = {Downscaling Landsat 7 {ETM+} thermal imagery using land surface temperature and {NDVI} images}, journal = {Int. J. Appl. Earth Obs. Geoinformation}, volume = {18}, pages = {515--527}, year = {2012}, url = {https://doi.org/10.1016/j.jag.2011.10.002}, doi = {10.1016/J.JAG.2011.10.002}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/aeog/Rodriguez-GalianoPSCC12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijbpim/SanchezPV12, author = {Mario E. S{\'{a}}nchez and Diana Puentes and Jorge Villalobos}, title = {Building a modular {YAWL} engine with Cumbia}, journal = {Int. J. Bus. Process. Integr. Manag.}, volume = {6}, number = {1}, pages = {41--51}, year = {2012}, url = {https://doi.org/10.1504/IJBPIM.2012.047912}, doi = {10.1504/IJBPIM.2012.047912}, timestamp = {Sun, 17 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijbpim/SanchezPV12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijsita/DonateGC12, author = {Mario Javier Donate and F{\'{a}}tima Guadamillas and Jes{\'{u}}s David S{\'{a}}nchez de Pablo Gonz{\'{a}}lez del Campo}, title = {Knowledge Management for Strategic Alliances: {A} Case Study}, journal = {Int. J. Strateg. Inf. Technol. Appl.}, volume = {3}, number = {3}, pages = {1--19}, year = {2012}, url = {https://doi.org/10.4018/jsita.2012070101}, doi = {10.4018/JSITA.2012070101}, timestamp = {Fri, 03 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijsita/DonateGC12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jei/Sanchez-CruzR12, author = {Hermilo S{\'{a}}nchez{-}Cruz and Mario A. Rodr{\'{\i}}guez{-}D{\'{\i}}az}, title = {Binary document image compression using a three-symbol grouped code dictionary}, journal = {J. Electronic Imaging}, volume = {21}, number = {2}, pages = {023013}, year = {2012}, url = {https://doi.org/10.1117/1.JEI.21.2.023013}, doi = {10.1117/1.JEI.21.2.023013}, timestamp = {Fri, 02 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jei/Sanchez-CruzR12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jms/DiezPAMDBLHL12, author = {Isabel de la Torre D{\'{\i}}ez and Francisco Javier D{\'{\i}}az Pernas and M{\'{\i}}riam Ant{\'{o}}n{-}Rodr{\'{\i}}guez and Mario Mart{\'{\i}}nez{-}Zarzuela and Jos{\'{e}} Fernando D{\'{\i}}ez Higuera and Daniel Boto{-}Giralda and Miguel Maldonado L{\'{o}}pez and Roberto Hornero and Mar{\'{\i}}a Isabel L{\'{o}}pez}, title = {Performance Evaluation of a Web-Based System to Exchange Electronic Health Records Using Queueing Model {(M/M/1)}}, journal = {J. Medical Syst.}, volume = {36}, number = {2}, pages = {915--924}, year = {2012}, url = {https://doi.org/10.1007/s10916-010-9555-3}, doi = {10.1007/S10916-010-9555-3}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jms/DiezPAMDBLHL12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pnc/PuypeMCSPMD12, author = {Bart Puype and Eva Mar{\'{\i}}n{-}Tordera and Didier Colle and Sergio S{\'{a}}nchez{-}L{\'{o}}pez and Mario Pickavet and Xavier Masip{-}Bruin and Piet Demeester}, title = {Prediction-based routing as {RWA} in multilayer traffic engineering}, journal = {Photonic Netw. Commun.}, volume = {23}, number = {2}, pages = {172--182}, year = {2012}, url = {https://doi.org/10.1007/s11107-011-0348-5}, doi = {10.1007/S11107-011-0348-5}, timestamp = {Tue, 29 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pnc/PuypeMCSPMD12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/Anton-CanalisHS12, author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and Mario Hern{\'{a}}ndez{-}Tejera and Elena S{\'{a}}nchez{-}Nielsen}, title = {Distance maps from unthresholded magnitudes}, journal = {Pattern Recognit.}, volume = {45}, number = {9}, pages = {3125--3130}, year = {2012}, url = {https://doi.org/10.1016/j.patcog.2012.02.010}, doi = {10.1016/J.PATCOG.2012.02.010}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/Anton-CanalisHS12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caise/ManzurSSV12, author = {Laura Manzur and John Santa and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Marko Bajec and Johann Eder}, title = {Experimentation in Executable Enterprise Architecture Models}, booktitle = {Advanced Information Systems Engineering Workshops - CAiSE 2012 International Workshops, Gda{\'{n}}sk, Poland, June 25-26, 2012. Proceedings}, series = {Lecture Notes in Business Information Processing}, volume = {112}, pages = {455--469}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-31069-0\_36}, doi = {10.1007/978-3-642-31069-0\_36}, timestamp = {Sun, 23 Dec 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/caise/ManzurSSV12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cescit/FernandezPSMSP12, author = {J. Javier Fernandez and Mario Prats and Juan Carlos Garc{\'{\i}}a S{\'{a}}nchez and Ra{\'{u}}l Mar{\'{\i}}n and Pedro J. Sanz and Antonio Pe{\~{n}}alver Benavent}, editor = {Klaus Schilling and Florian Leutert}, title = {Manipulation in the Seabed: {A} New Underwater Manipulation System for Shallow Water Intervention}, booktitle = {1st Conference on Embedded Systems, Computational Intelligence and Telematics in Control, {CESCIT} 2012, W{\"{u}}rzburg, Germany, April 03-05, 2012}, pages = {314--319}, publisher = {International Federation of Automatic Control}, year = {2012}, url = {https://doi.org/10.3182/20120403-3-DE-3010.00029}, doi = {10.3182/20120403-3-DE-3010.00029}, timestamp = {Fri, 24 Jul 2020 14:08:14 +0200}, biburl = {https://dblp.org/rec/conf/cescit/FernandezPSMSP12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cgames/SalazarMOS12, author = {Mario Gonzalez Salazar and Hugo A. Mitre{-}Hern{\'{a}}ndez and Cuauht{\'{e}}moc Lemus Olalde and Jos{\'{e}} Luis Gonz{\'{a}}lez S{\'{a}}nchez}, editor = {Quasim H. Mehdi and Adel Elmaghraby and Ian Marshall and Robert Moreton and Rammohan K. Ragade and Bego{\~{n}}a Garc{\'{\i}}a Zapirain and Julia Chariker and Mostafa M. El{-}Said and Roman V. Yampolskiy and Nickola Li Zhigiang}, title = {Proposal of Game Design Document from software engineering requirements perspective}, booktitle = {17th International Conference on Computer Games, {CGAMES} 2012, Louisville, KY, USA, July 30 - Aug. 1, 2012}, pages = {81--85}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://doi.org/10.1109/CGames.2012.6314556}, doi = {10.1109/CGAMES.2012.6314556}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cgames/SalazarMOS12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/conielecomp/Trujillo-CaballeroPSMST12, author = {Mario Arturo Trujillo{-}Caballero and Rub{\'{e}}n Posada{-}G{\'{o}}mez and Oscar Osvaldo Sandoval{-}Gonzalez and Albino Mart{\'{\i}}nez{-}Sibaja and Blanca E. Gonz{\'{a}}lez S{\'{a}}nchez and Juan Carlos Trujillo{-}Caballero}, editor = {Pedro Ba{\~{n}}uelos S{\'{a}}nchez and Roberto Rosas{-}Romero and Mauricio Javier Osorio Galindo}, title = {A remote monitoring system for a mechanotherapy device in neuromuscular rehabilitation}, booktitle = {22nd International Conference on Electrical Communications and Computers, {CONIELECOMP} 2012, Cholula, Puebla, Mexico, February 27-29, 2012}, pages = {55--58}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/CONIELECOMP.2012.6189881}, doi = {10.1109/CONIELECOMP.2012.6189881}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/conielecomp/Trujillo-CaballeroPSMST12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/edoc/NaranjoSV12, author = {David Naranjo and Mario E. S{\'{a}}nchez and Jorge Villalobos}, title = {Visual Analysis of Enterprise Models}, booktitle = {16th {IEEE} International Enterprise Distributed Object Computing Conference Workshops, {EDOC} Workshops, Beijing, China, September 10-14, 2012}, pages = {19--28}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://doi.org/10.1109/EDOCW.2012.13}, doi = {10.1109/EDOCW.2012.13}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/edoc/NaranjoSV12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/embc/GomezMPP0H12, author = {Carlos G{\'{o}}mez and Mario Mart{\'{\i}}nez{-}Zarzuela and Jes{\'{u}}s Poza and Francisco Javier D{\'{\i}}az Pernas and Alberto Fern{\'{a}}ndez and Roberto Hornero}, title = {Synchrony analysis of spontaneous {MEG} activity in Alzheimer's disease patients}, booktitle = {Annual International Conference of the {IEEE} Engineering in Medicine and Biology Society, {EMBC} 2012, San Diego, CA, USA, August 28 - September 1, 2012}, pages = {6188--6191}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/EMBC.2012.6347407}, doi = {10.1109/EMBC.2012.6347407}, timestamp = {Sat, 04 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/embc/GomezMPP0H12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/europar/LoddeFA12, author = {Mario Lodde and Jos{\'{e}} Flich and Manuel E. Acacio}, editor = {Christos Kaklamanis and Theodore S. Papatheodorou and Paul G. Spirakis}, title = {Dynamic Last-Level Cache Allocation to Reduce Area and Power Overhead in Directory Coherence Protocols}, booktitle = {Euro-Par 2012 Parallel Processing - 18th International Conference, Euro-Par 2012, Rhodes Island, Greece, August 27-31, 2012. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {7484}, pages = {206--218}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-32820-6\_22}, doi = {10.1007/978-3-642-32820-6\_22}, timestamp = {Mon, 18 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/europar/LoddeFA12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icce-berlin/SanchezSO12, author = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and Daniel D{\'{\i}}az S{\'{a}}nchez and Mario Mu{\~{n}}oz Organero}, title = {Flex-box: {A} flexible software architecture for {IPTV} set-top boxes}, booktitle = {{IEEE} Second International Conference on Consumer Electronics - Berlin, ICCE-Berlin 2012, Berlin, Germany, September 3-5, 2012}, pages = {121--125}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/ICCE-Berlin.2012.6336480}, doi = {10.1109/ICCE-BERLIN.2012.6336480}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icce-berlin/SanchezSO12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccel/SanchezSO12, author = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and Daniel D{\'{\i}}az S{\'{a}}nchez and Mario Mu{\~{n}}oz Organero}, title = {Optimizing resources on gateways using OSGi}, booktitle = {{IEEE} International Conference on Consumer Electronics, {ICCE} 2012, Las Vegas, NV, USA, January 13-16, 2012}, pages = {526--527}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/ICCE.2012.6161957}, doi = {10.1109/ICCE.2012.6161957}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iccel/SanchezSO12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/Sanchez-EscobedoC12, author = {Dalila S{\'{a}}nchez{-}Escobedo and Mario Castel{\'{a}}n}, title = {Face synthesis from a frontal pose image using partial least squares and b-splines}, booktitle = {19th {IEEE} International Conference on Image Processing, {ICIP} 2012, Lake Buena Vista, Orlando, FL, USA, September 30 - October 3, 2012}, pages = {1801--1804}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/ICIP.2012.6467231}, doi = {10.1109/ICIP.2012.6467231}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/Sanchez-EscobedoC12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iecon/RizoRRBL12, author = {Mario Rizo and Ana Rodr{\'{\i}}guez and Francisco J. Rodr{\'{\i}}guez and Emilio Bueno and Marco Liserre}, title = {Different approaches of stationary reference frames saturators}, booktitle = {38th Annual Conference on {IEEE} Industrial Electronics Society, {IECON} 2012, Montreal, QC, Canada, October 25-28, 2012}, pages = {2245--2250}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/IECON.2012.6388887}, doi = {10.1109/IECON.2012.6388887}, timestamp = {Mon, 09 Aug 2021 14:54:01 +0200}, biburl = {https://dblp.org/rec/conf/iecon/RizoRRBL12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ieeehpcs/PeceroHBPLB12, author = {Johnatan E. Pecero and H{\'{e}}ctor Joaqu{\'{\i}}n {Fraire Huacuja} and Pascal Bouvry and Alejandro {Santiago Pineda} and Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and Juan Javier Gonz{\'{a}}lez Barbosa}, editor = {Waleed W. Smari and Vesna Zeljkovic}, title = {On the energy optimization for precedence constrained applications using local search algorithms}, booktitle = {2012 International Conference on High Performance Computing {\&} Simulation, {HPCS} 2012, Madrid, Spain, July 2-6, 2012}, pages = {133--139}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/HPCSim.2012.6266902}, doi = {10.1109/HPCSIM.2012.6266902}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ieeehpcs/PeceroHBPLB12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/RankineSSV12, author = {Cassidy Rankine and G. Arturo Sanchez{-}Azofeifa and Mario Marcos do Espirito Santo and Marco Tulio S. Viera}, title = {Optical wireless sensor networks observe leaf phenology and photosynthetic radiation interception in a Brazilian tropical dry forest}, booktitle = {2012 {IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS} 2012, Munich, Germany, July 22-27, 2012}, pages = {6914--6915}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/IGARSS.2012.6352573}, doi = {10.1109/IGARSS.2012.6352573}, timestamp = {Wed, 16 Oct 2019 14:14:53 +0200}, biburl = {https://dblp.org/rec/conf/igarss/RankineSSV12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/imc/OttoSRB12, author = {John S. Otto and Mario A. S{\'{a}}nchez and John P. Rula and Fabi{\'{a}}n E. Bustamante}, editor = {John W. Byers and Jim Kurose and Ratul Mahajan and Alex C. Snoeren}, title = {Content delivery and the natural evolution of {DNS:} remote dns trends, performance issues and alternative solutions}, booktitle = {Proceedings of the 12th {ACM} {SIGCOMM} Internet Measurement Conference, {IMC} '12, Boston, MA, USA, November 14-16, 2012}, pages = {523--536}, publisher = {{ACM}}, year = {2012}, url = {https://doi.org/10.1145/2398776.2398831}, doi = {10.1145/2398776.2398831}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/imc/OttoSRB12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iolts/Sanchez-ClementeEGL12, author = {Antonio Sanchez{-}Clemente and Luis Entrena and Mario Garc{\'{\i}}a{-}Valderas and Celia L{\'{o}}pez{-}Ongil}, title = {Logic masking for {SET} Mitigation Using Approximate Logic Circuits}, booktitle = {18th {IEEE} International On-Line Testing Symposium, {IOLTS} 2012, Sitges, Spain, June 27-29, 2012}, pages = {176--181}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://doi.org/10.1109/IOLTS.2012.6313868}, doi = {10.1109/IOLTS.2012.6313868}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iolts/Sanchez-ClementeEGL12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/its/KarlovcecCP12, author = {Mario Karlovcec and Mariheida Cordova{-}Sanchez and Zachary A. Pardos}, editor = {Stefano A. Cerri and William J. Clancey and Giorgos Papadourakis and Kitty Panourgia}, title = {Knowledge Component Suggestion for Untagged Content in an Intelligent Tutoring System}, booktitle = {Intelligent Tutoring Systems - 11th International Conference, {ITS} 2012, Chania, Crete, Greece, June 14-18, 2012. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {7315}, pages = {195--200}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-30950-2\_25}, doi = {10.1007/978-3-642-30950-2\_25}, timestamp = {Sun, 02 Oct 2022 16:10:26 +0200}, biburl = {https://dblp.org/rec/conf/its/KarlovcecCP12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/models/FlorezSVV12, author = {Hector Florez and Mario E. S{\'{a}}nchez and Jorge Villalobos and Germ{\'{a}}n Vega}, title = {Coevolution assistance for enterprise architecture models}, booktitle = {Proceedings of the 6th International Workshop on Models and Evolution, ME@MoDELS 2012, Innsbruck, Austria, October 1-5, 2012}, pages = {27--32}, publisher = {{ACM}}, year = {2012}, url = {https://doi.org/10.1145/2523599.2523605}, doi = {10.1145/2523599.2523605}, timestamp = {Tue, 06 Nov 2018 16:57:17 +0100}, biburl = {https://dblp.org/rec/conf/models/FlorezSVV12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/models/GomezSFV12, author = {Paola G{\'{o}}mez and Mario E. S{\'{a}}nchez and Hector Florez and Jorge Villalobos}, editor = {Davide Di Ruscio and Alfonso Pierantonio and Juan de Lara}, title = {Co-creation of models and metamodels for enterprise architecture projects}, booktitle = {Proceedings of the 2012 Extreme Modeling Workshop, {XM} '12, Innsbruck, Austria, October 1, 2012}, pages = {21--26}, publisher = {{ACM}}, year = {2012}, url = {https://doi.org/10.1145/2467307.2467312}, doi = {10.1145/2467307.2467312}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/models/GomezSFV12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nocs/LoddeFA12, author = {Mario Lodde and Jos{\'{e}} Flich and Manuel E. Acacio}, title = {Heterogeneous NoC Design for Efficient Broadcast-based Coherence Protocol Support}, booktitle = {2012 Sixth {IEEE/ACM} International Symposium on Networks-on-Chip (NoCS), Copenhagen, Denmark, 9-11 May, 2012}, pages = {59--66}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://doi.org/10.1109/NOCS.2012.14}, doi = {10.1109/NOCS.2012.14}, timestamp = {Mon, 18 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/nocs/LoddeFA12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigcomm/OttoSRSB12, author = {John S. Otto and Mario A. S{\'{a}}nchez and John P. Rula and Ted Stein and Fabi{\'{a}}n E. Bustamante}, editor = {Lars Eggert and J{\"{o}}rg Ott and Venkata N. Padmanabhan and George Varghese}, title = {namehelp: intelligent client-side {DNS} resolution}, booktitle = {{ACM} {SIGCOMM} 2012 Conference, {SIGCOMM} '12, Helsinki, Finland - August 13 - 17, 2012}, pages = {287--288}, publisher = {{ACM}}, year = {2012}, url = {https://doi.org/10.1145/2342356.2342413}, doi = {10.1145/2342356.2342413}, timestamp = {Mon, 22 Mar 2021 16:55:03 +0100}, biburl = {https://dblp.org/rec/conf/sigcomm/OttoSRSB12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cys/SanchezJV11, author = {Mario E. S{\'{a}}nchez and Camilo Jim{\'{e}}nez and Jorge Villalobos}, title = {Model Based Testing for Workflow Enabled Applications}, journal = {Computaci{\'{o}}n y Sistemas}, volume = {14}, number = {4}, year = {2011}, url = {http://cys.cic.ipn.mx/ojs/index.php/CyS/article/view/1280}, timestamp = {Thu, 11 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cys/SanchezJV11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/GonzalezDS11, author = {Mario Gonz{\'{a}}lez and David Dominguez and {\'{A}}ngel S{\'{a}}nchez}, title = {Learning sequences of sparse correlated patterns using small-world attractor neural networks: An application to traffic videos}, journal = {Neurocomputing}, volume = {74}, number = {14-15}, pages = {2361--2367}, year = {2011}, url = {https://doi.org/10.1016/j.neucom.2011.03.014}, doi = {10.1016/J.NEUCOM.2011.03.014}, timestamp = {Sat, 01 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijon/GonzalezDS11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jvcir/Sanchez-NielsenH11, author = {Elena S{\'{a}}nchez{-}Nielsen and Mario Hern{\'{a}}ndez{-}Tejera}, title = {Heuristic algorithm for visual tracking of deformable objects}, journal = {J. Vis. Commun. Image Represent.}, volume = {22}, number = {6}, pages = {465--478}, year = {2011}, url = {https://doi.org/10.1016/j.jvcir.2011.05.005}, doi = {10.1016/J.JVCIR.2011.05.005}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jvcir/Sanchez-NielsenH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pdln/CavalieriFFPGS11, author = {Daniel Cruz Cavalieri and Teodiano Freire Bastos Filho and M{\'{a}}rio Sarcinelli Filho and Sira E. Palazuelos{-}Cagigas and Javier Mac{\'{\i}}as Guarasa and Jos{\'{e}} Luis Mart{\'{\i}}n S{\'{a}}nchez}, title = {A Part-of-Speech Tag Clustering for a Word Prediction System in Portuguese Language}, journal = {Proces. del Leng. Natural}, volume = {47}, pages = {197--205}, year = {2011}, url = {http://journal.sepln.org/sepln/ojs/ojs/index.php/pln/article/view/984}, timestamp = {Wed, 17 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pdln/CavalieriFFPGS11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/PastorelloSN11, author = {Gilberto Zonta Pastorello Jr. and G. Arturo Sanchez{-}Azofeifa and Mario A. Nascimento}, title = {Enviro-Net: From Networks of Ground-Based Sensor Systems to a Web Platform for Sensor Data Management}, journal = {Sensors}, volume = {11}, number = {6}, pages = {6454--6479}, year = {2011}, url = {https://doi.org/10.3390/s110606454}, doi = {10.3390/S110606454}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sensors/PastorelloSN11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bpm/SanchezPV11, author = {Mario E. S{\'{a}}nchez and Diana Puentes and Jorge Villalobos}, editor = {Florian Daniel and Kamel Barkaoui and Schahram Dustdar}, title = {A Modular Approach to Build Workflow Engines}, booktitle = {Business Process Management Workshops - {BPM} 2011 International Workshops, Clermont-Ferrand, France, August 29, 2011, Revised Selected Papers, Part {II}}, series = {Lecture Notes in Business Information Processing}, volume = {100}, pages = {289--300}, publisher = {Springer}, year = {2011}, url = {https://doi.org/10.1007/978-3-642-28115-0\_28}, doi = {10.1007/978-3-642-28115-0\_28}, timestamp = {Sun, 02 Jun 2019 21:21:25 +0200}, biburl = {https://dblp.org/rec/conf/bpm/SanchezPV11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eScience/Sanchez-AzofeifaRSFG11, author = {G. Arturo Sanchez{-}Azofeifa and Cassidy Rankine and Mario Marcos do Espirito Santo and Rob Fatland and Milton Garcia}, title = {Wireless Sensing Networks for Environmental Monitoring: Two Case Studies from Tropical Forests}, booktitle = {{IEEE} 7th International Conference on E-Science, e-Science 2011, Stockholm, Sweden, December 5-8, 2011}, pages = {70--76}, publisher = {{IEEE} Computer Society}, year = {2011}, url = {https://doi.org/10.1109/eScience.2011.18}, doi = {10.1109/ESCIENCE.2011.18}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/eScience/Sanchez-AzofeifaRSFG11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/enase/Sanchez-Gonzalez11, author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and Francisco Ruiz and F{\'{e}}lix Garc{\'{\i}}a and Mario Piattini}, editor = {Leszek A. Maciaszek and Kang Zhang}, title = {Improving Quality of Business Process Models}, booktitle = {Evaluation of Novel Approaches to Software Engineering - 6th International Conference, {ENASE} 2011, Beijing, China, June 8-11, 2011. Revised Selected Papers}, series = {Communications in Computer and Information Science}, volume = {275}, pages = {130--144}, publisher = {Springer}, year = {2011}, url = {https://doi.org/10.1007/978-3-642-32341-6\_9}, doi = {10.1007/978-3-642-32341-6\_9}, timestamp = {Mon, 08 Jan 2024 21:46:47 +0100}, biburl = {https://dblp.org/rec/conf/enase/Sanchez-Gonzalez11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/enase/Sanchez-GonzalezRGP11, author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and Francisco Ruiz and F{\'{e}}lix Garc{\'{\i}}a and Mario Piattini}, editor = {Leszek A. Maciaszek and Kang Zhang}, title = {Business Process Model Improvement based on Measurement Activities}, booktitle = {{ENASE} 2011 - Proceedings of the 6th International Conference on Evaluation of Novel Approaches to Software Engineering, Beijing, China, 8-11 June, 2011}, pages = {104--113}, publisher = {SciTePress}, year = {2011}, timestamp = {Sun, 05 Nov 2017 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/enase/Sanchez-GonzalezRGP11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/esem/Perez-CastilloSPGG11, author = {Ricardo P{\'{e}}rez{-}Castillo and Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and Mario Piattini and F{\'{e}}lix Garc{\'{\i}}a and Ignacio Garc{\'{\i}}a Rodr{\'{\i}}guez de Guzm{\'{a}}n}, title = {Obtaining Thresholds for the Effectiveness of Business Process Mining}, booktitle = {Proceedings of the 5th International Symposium on Empirical Software Engineering and Measurement, {ESEM} 2011, Banff, AB, Canada, September 22-23, 2011}, pages = {453--462}, publisher = {{IEEE} Computer Society}, year = {2011}, url = {https://doi.org/10.1109/ESEM.2011.64}, doi = {10.1109/ESEM.2011.64}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/esem/Perez-CastilloSPGG11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eusipco/GrajalOSGL11, author = {Jes{\'{u}}s Grajal and Omar A. Yeste Ojeda and Miguel Angel S{\'{a}}nchez and Mario Garrido and Marisa L{\'{o}}pez{-}Vallejo}, title = {Real time {FPGA} implementation of an automatic modulation classifier for electronic warfare applications}, booktitle = {Proceedings of the 19th European Signal Processing Conference, {EUSIPCO} 2011, Barcelona, Spain, August 29 - Sept. 2, 2011}, pages = {1514--1518}, publisher = {{IEEE}}, year = {2011}, url = {https://ieeexplore.ieee.org/document/7074233/}, timestamp = {Mon, 09 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eusipco/GrajalOSGL11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ibpria/Anton-CanalisHS11, author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and Mario Hern{\'{a}}ndez{-}Tejera and Elena S{\'{a}}nchez{-}Nielsen}, editor = {Jordi Vitri{\`{a}} and Jo{\~{a}}o Miguel Raposo Sanches and Mario Hern{\'{a}}ndez}, title = {Distance Maps from Unthresholded Magnitudes}, booktitle = {Pattern Recognition and Image Analysis - 5th Iberian Conference, IbPRIA 2011, Las Palmas de Gran Canaria, Spain, June 8-10, 2011. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6669}, pages = {92--99}, publisher = {Springer}, year = {2011}, url = {https://doi.org/10.1007/978-3-642-21257-4\_12}, doi = {10.1007/978-3-642-21257-4\_12}, timestamp = {Sun, 02 Oct 2022 16:02:57 +0200}, biburl = {https://dblp.org/rec/conf/ibpria/Anton-CanalisHS11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sac/RodriguezSV11, author = {Carlos Rodr{\'{\i}}guez and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {William C. Chu and W. Eric Wong and Mathew J. Palakal and Chih{-}Cheng Hung}, title = {Executable model composition: a multilevel approach}, booktitle = {Proceedings of the 2011 {ACM} Symposium on Applied Computing (SAC), TaiChung, Taiwan, March 21 - 24, 2011}, pages = {877--884}, publisher = {{ACM}}, year = {2011}, url = {https://doi.org/10.1145/1982185.1982376}, doi = {10.1145/1982185.1982376}, timestamp = {Tue, 06 Nov 2018 11:06:49 +0100}, biburl = {https://dblp.org/rec/conf/sac/RodriguezSV11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigcomm/BischofOSRCB11, author = {Zachary S. Bischof and John S. Otto and Mario A. S{\'{a}}nchez and John P. Rula and David R. Choffnes and Fabi{\'{a}}n E. Bustamante}, editor = {Nina Taft and David Wetherall}, title = {Crowdsourcing {ISP} characterization to the network edge}, booktitle = {Proceedings of the first {ACM} {SIGCOMM} workshop on Measurements up the stack, W-MUST@SIGCOMM 2011, Toronto, Ontario, Canada, August 19, 2011}, pages = {61--66}, publisher = {{ACM}}, year = {2011}, url = {https://doi.org/10.1145/2018602.2018617}, doi = {10.1145/2018602.2018617}, timestamp = {Tue, 06 Nov 2018 11:07:11 +0100}, biburl = {https://dblp.org/rec/conf/sigcomm/BischofOSRCB11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigcomm/OttoSCBS11, author = {John S. Otto and Mario A. S{\'{a}}nchez and David R. Choffnes and Fabi{\'{a}}n E. Bustamante and Georgos Siganos}, editor = {Srinivasan Keshav and J{\"{o}}rg Liebeherr and John W. Byers and Jeffrey C. Mogul}, title = {On blind mice and the elephant: understanding the network impact of a large distributed system}, booktitle = {Proceedings of the {ACM} {SIGCOMM} 2011 Conference on Applications, Technologies, Architectures, and Protocols for Computer Communications, Toronto, ON, Canada, August 15-19, 2011}, pages = {110--121}, publisher = {{ACM}}, year = {2011}, url = {https://doi.org/10.1145/2018436.2018450}, doi = {10.1145/2018436.2018450}, timestamp = {Fri, 12 Mar 2021 14:14:34 +0100}, biburl = {https://dblp.org/rec/conf/sigcomm/OttoSCBS11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigcomm/SanchezOBB11, author = {Mario A. S{\'{a}}nchez and John S. Otto and Zachary S. Bischof and Fabi{\'{a}}n E. Bustamante}, editor = {Srinivasan Keshav and J{\"{o}}rg Liebeherr and John W. Byers and Jeffrey C. Mogul}, title = {Dasu - {ISP} characterization from the edge: a BitTorrent implementation}, booktitle = {Proceedings of the {ACM} {SIGCOMM} 2011 Conference on Applications, Technologies, Architectures, and Protocols for Computer Communications, Toronto, ON, Canada, August 15-19, 2011}, pages = {454--455}, publisher = {{ACM}}, year = {2011}, url = {https://doi.org/10.1145/2018436.2018517}, doi = {10.1145/2018436.2018517}, timestamp = {Fri, 12 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sigcomm/SanchezOBB11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sis/ParraSFP11, author = {Antonio Santos{-}Olmo and Luis Enrique S{\'{a}}nchez and Eduardo Fern{\'{a}}ndez{-}Medina and Mario Piattini}, editor = {David Garcia Rosado and Luis Enrique S{\'{a}}nchez and Jan J{\"{u}}rjens}, title = {Desirable Characteristics for an {ISMS} oriented to SMEs}, booktitle = {{WOSIS} 2011 - Proceedings of the 8th International Workshop on Security in Information Systems, In conjunction with {ICEIS} 2011, Beijing, China, 8-9 June, 2011}, pages = {151--158}, publisher = {SciTePress}, year = {2011}, timestamp = {Mon, 29 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sis/ParraSFP11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tools/RodriguezSV11, author = {Carlos Rodr{\'{\i}}guez and Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Judith Bishop and Antonio Vallecillo}, title = {Metamodel Dependencies for Executable Models}, booktitle = {Objects, Models, Components, Patterns - 49th International Conference, {TOOLS} 2011, Zurich, Switzerland, June 28-30, 2011. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6705}, pages = {83--98}, publisher = {Springer}, year = {2011}, url = {https://doi.org/10.1007/978-3-642-21952-8\_8}, doi = {10.1007/978-3-642-21952-8\_8}, timestamp = {Tue, 14 May 2019 10:00:45 +0200}, biburl = {https://dblp.org/rec/conf/tools/RodriguezSV11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1106-5489, author = {Gilberto Zonta Pastorello Jr. and G. Arturo Sanchez{-}Azofeifa and Mario A. Nascimento}, title = {A Review of the Enviro-Net Project}, journal = {CoRR}, volume = {abs/1106.5489}, year = {2011}, url = {http://arxiv.org/abs/1106.5489}, eprinttype = {arXiv}, eprint = {1106.5489}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1106-5489.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bmcbi/Segura-BedmarCPM10, author = {Isabel Segura{-}Bedmar and Mario Crespo and C{\'{e}}sar de Pablo{-}S{\'{a}}nchez and Paloma Mart{\'{\i}}nez}, title = {Resolving anaphoras for the extraction of drug-drug interactions in pharmacological documents}, journal = {{BMC} Bioinform.}, volume = {11}, number = {{S-2}}, pages = {1}, year = {2010}, url = {https://doi.org/10.1186/1471-2105-11-S2-S1}, doi = {10.1186/1471-2105-11-S2-S1}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/bmcbi/Segura-BedmarCPM10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bpmj/Sanchez-GonzalezGRV10, author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and F{\'{e}}lix Garc{\'{\i}}a and Francisco Ruiz and Mario Piattini Velthuis}, title = {Measurement in business processes: a systematic review}, journal = {Bus. Process. Manag. J.}, volume = {16}, number = {1}, pages = {114--134}, year = {2010}, url = {https://doi.org/10.1108/14637151011017976}, doi = {10.1108/14637151011017976}, timestamp = {Thu, 18 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bpmj/Sanchez-GonzalezGRV10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/dam/BilbaoO10, author = {Jes{\'{u}}s Mario Bilbao and Manuel Ord{\'{o}}{\~{n}}ez}, title = {The core and the Weber set of games on augmenting systems}, journal = {Discret. Appl. Math.}, volume = {158}, number = {3}, pages = {180--188}, year = {2010}, url = {https://doi.org/10.1016/j.dam.2009.09.016}, doi = {10.1016/J.DAM.2009.09.016}, timestamp = {Thu, 11 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/dam/BilbaoO10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tie/NevesSBCRR10, author = {Francisco A. S. Neves and Helber E. P. de Souza and Fabr{\'{\i}}cio Bradaschia and Marcelo Cabral Cavalcanti and Mario Rizo and Francisco J. Rodr{\'{\i}}guez}, title = {A Space-Vector Discrete Fourier Transform for Unbalanced and Distorted Three-Phase Signals}, journal = {{IEEE} Trans. Ind. Electron.}, volume = {57}, number = {8}, pages = {2858--2867}, year = {2010}, url = {https://doi.org/10.1109/TIE.2009.2036646}, doi = {10.1109/TIE.2009.2036646}, timestamp = {Fri, 10 Dec 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tie/NevesSBCRR10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tie/SanchezVHRPJ10, author = {Ren{\'{e}} Osorio Sanchez and Nimrod V{\'{a}}zquez and Claudia Hern{\'{a}}ndez and Elias Rodr{\'{\i}}guez and Sergio Pinto and Mario A. Ju{\'{a}}rez}, title = {Electric Dynamic Modeling of {HID} Lamps for Electronic Ballast Design}, journal = {{IEEE} Trans. Ind. Electron.}, volume = {57}, number = {5}, pages = {1655--1662}, year = {2010}, url = {https://doi.org/10.1109/TIE.2009.2033095}, doi = {10.1109/TIE.2009.2033095}, timestamp = {Mon, 15 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tie/SanchezVHRPJ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/IEEEares/SanchezRFP10, author = {Luis Enrique S{\'{a}}nchez and Carlos Ruiz and Eduardo Fern{\'{a}}ndez{-}Medina and Mario Piattini}, title = {Managing the Asset Risk of SMEs}, booktitle = {{ARES} 2010, Fifth International Conference on Availability, Reliability and Security, 15-18 February 2010, Krakow, Poland}, pages = {422--429}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/ARES.2010.52}, doi = {10.1109/ARES.2010.52}, timestamp = {Sat, 27 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/IEEEares/SanchezRFP10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/centeris/SanchezPFP10, author = {Luis Enrique S{\'{a}}nchez and Antonio Santos{-}Olmo and Eduardo Fern{\'{a}}ndez{-}Medina and Mario Piattini}, editor = {Jo{\~{a}}o Eduardo Quintela Varaj{\~{a}}o and Maria Manuela Cruz{-}Cunha and Goran D. Putnik and Ant{\'{o}}nio Trigo}, title = {Security Culture in Small and Medium-Size Enterprise}, booktitle = {ENTERprise Information Systems - International Conference, {CENTERIS} 2010, Viana do Castelo, Portugal, October 20-22, 2010, Proceedings, Part {II}}, series = {Communications in Computer and Information Science}, volume = {110}, pages = {315--324}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-16419-4\_32}, doi = {10.1007/978-3-642-16419-4\_32}, timestamp = {Mon, 29 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/centeris/SanchezPFP10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cibse/Sanchez-Gonzalez10, author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and F{\'{e}}lix Garc{\'{\i}}a and Francisco Ruiz and Mario Piattini}, editor = {Xavier Franch and Itana Maria de Souza Gimenes and Juan Pablo Carvallo}, title = {{BILMA:} Entorno para la Mejora Continua de Procesos de Negocio guiada por la Medici{\'{o}}n}, booktitle = {Proceedings of the 13th Iberoamerican Conference on Software Engineering, CIbSE 2010, Cuenca, Ecuador, April 12-16, 2010}, pages = {293--298}, year = {2010}, timestamp = {Tue, 09 Feb 2021 15:58:30 +0100}, biburl = {https://dblp.org/rec/conf/cibse/Sanchez-Gonzalez10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/conielecomp/Anzures-GarciaS10, author = {Mario Anzures{-}Garc{\'{\i}}a and Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and Elizabeth L{\'{o}}pez{-}Mel{\'{e}}ndez and Gilberto Andrade{-}Andrade and Ricardo Rivera{-}Morales}, title = {Platform to supports learning based on Social Network, Web Intelligence and {CSCL}}, booktitle = {20th International Conference on Electronics, Communications and Computer, {CONIELECOMP} 2010, Cholula, Puebla, Mexico, February 22-24, 2010}, pages = {201--205}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/CONIELECOMP.2010.5440769}, doi = {10.1109/CONIELECOMP.2010.5440769}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/conielecomp/Anzures-GarciaS10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/er/Sanchez-GonzalezGMRP10, author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and F{\'{e}}lix Garc{\'{\i}}a and Jan Mendling and Francisco Ruiz and Mario Piattini}, editor = {Jeffrey Parsons and Motoshi Saeki and Peretz Shoval and Carson C. Woo and Yair Wand}, title = {Prediction of Business Process Model Quality Based on Structural Metrics}, booktitle = {Conceptual Modeling - {ER} 2010, 29th International Conference on Conceptual Modeling, Vancouver, BC, Canada, November 1-4, 2010. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6412}, pages = {458--463}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-16373-9\_35}, doi = {10.1007/978-3-642-16373-9\_35}, timestamp = {Sun, 02 Jun 2019 21:20:31 +0200}, biburl = {https://dblp.org/rec/conf/er/Sanchez-GonzalezGMRP10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/infocom/ChoffnesSB10, author = {David R. Choffnes and Mario A. S{\'{a}}nchez and Fabian E. Bustamante}, title = {Network Positioning from the Edge - An Empirical Study of the Effectiveness of Network Positioning in {P2P} Systems}, booktitle = {{INFOCOM} 2010. 29th {IEEE} International Conference on Computer Communications, Joint Conference of the {IEEE} Computer and Communications Societies, 15-19 March 2010, San Diego, CA, {USA}}, pages = {291--295}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/INFCOM.2010.5462225}, doi = {10.1109/INFCOM.2010.5462225}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/infocom/ChoffnesSB10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/jisbd/Sanchez-GonzalezGRP10, author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and F{\'{e}}lix Garc{\'{\i}}a and Francisco Ruiz and Mario Piattini}, editor = {Ernest Teniente and Silvia Abrah{\~{a}}o}, title = {Validaci{\'{o}}n Global de Medidas para Modelos Conceptuales de Procesos de Negocio mediante Meta-An{\'{a}}lisis}, booktitle = {{XV} Jornadas de Ingenier{\'{\i}}a del Software y Bases de Datos {(JISBD} 2010), Valencia, Spain, September 7-10, 2010. Actas}, pages = {293--298}, publisher = {{IBERGARCETA} Pub. {S.L.}}, year = {2010}, timestamp = {Sun, 05 Nov 2017 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/jisbd/Sanchez-GonzalezGRP10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/paams/CrespoSFAL10, author = {Mario Crespo and Daniel S{\'{a}}nchez and Luis Felipe Crespo Foix and Sonia Astorga Moreno and Antonio Le{\'{o}}n}, editor = {Yves Demazeau and Frank Dignum and Juan M. Corchado and Javier Bajo}, title = {Collaborative Dialogue Agent for {COPD} Self-management in {AMICA:} {A} First Insight}, booktitle = {Advances in Practical Applications of Agents and Multiagent Systems, 8th International Conference on Practical Applications of Agents and Multiagent Systems, {PAAMS} 2010, Salamanca, Spain, 26-28 April 2010}, series = {Advances in Intelligent and Soft Computing}, volume = {70}, pages = {75--80}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-12384-9\_10}, doi = {10.1007/978-3-642-12384-9\_10}, timestamp = {Mon, 17 Jul 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/paams/CrespoSFAL10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/trustbus/SanchezPFP10, author = {Luis Enrique S{\'{a}}nchez and Antonio Santos{-}Olmo and Eduardo Fern{\'{a}}ndez{-}Medina and Mario Piattini}, editor = {Sokratis K. Katsikas and Javier L{\'{o}}pez and Miguel Soriano}, title = {Building {ISMS} through the Reuse of Knowledge}, booktitle = {Trust, Privacy and Security in Digital Business, 7th International Conference, TrustBus 2010, Bilbao, Spain, August 30-31, 2010. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6264}, pages = {190--201}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-15152-1\_17}, doi = {10.1007/978-3-642-15152-1\_17}, timestamp = {Mon, 29 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/trustbus/SanchezPFP10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eor/BilbaoO09, author = {Jes{\'{u}}s Mario Bilbao and Manuel Ord{\'{o}}{\~{n}}ez}, title = {Axiomatizations of the Shapley value for games on augmenting systems}, journal = {Eur. J. Oper. Res.}, volume = {196}, number = {3}, pages = {1008--1014}, year = {2009}, url = {https://doi.org/10.1016/j.ejor.2008.04.028}, doi = {10.1016/J.EJOR.2008.04.028}, timestamp = {Fri, 21 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eor/BilbaoO09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jikm/Perez-SolteroBS09, author = {Alonso Perez{-}Soltero and Mario Barcelo{-}Valenzuela and Gerardo Sanchez{-}Schmitz}, title = {Design of an Ontology as a Support to the Knowledge Audit Process in Organisations}, journal = {J. Inf. Knowl. Manag.}, volume = {8}, number = {2}, pages = {147--158}, year = {2009}, url = {https://doi.org/10.1142/S0219649209002257}, doi = {10.1142/S0219649209002257}, timestamp = {Sat, 25 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jikm/Perez-SolteroBS09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jucs/SanchezPRP09, author = {Luis Enrique S{\'{a}}nchez and Antonio Santos{-}Olmo and David Garcia Rosado and Mario Piattini}, title = {Managing Security and its Maturity in Small and Medium-sized Enterprises}, journal = {J. Univers. Comput. Sci.}, volume = {15}, number = {15}, pages = {3038--3058}, year = {2009}, url = {https://doi.org/10.3217/jucs-015-15-3038}, doi = {10.3217/JUCS-015-15-3038}, timestamp = {Mon, 29 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jucs/SanchezPRP09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rasi/SanchezV009, author = {Mario E. S{\'{a}}nchez and Jorge Villalobos and Daniel Romero}, title = {Un mecanismo de coordinaci{\'{o}}n basado en m{\'{a}}quinas de estado, empleado en las aplicaciones que usan workflows}, journal = {Rev. Avances en Sistemas Inform{\'{a}}tica}, volume = {6}, number = {1}, pages = {35--44}, year = {2009}, url = {http://www.minas.medellin.unal.edu.co/index.php?option=com\_docman\&task=doc\_view\&gid=551\&tmpl=component\&format=raw\&Itemid=285}, timestamp = {Fri, 22 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rasi/SanchezV009.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/biostec/FerreiraFFSGQ09, author = {Andr{\'{e}} Ferreira and Teodiano Freire Bastos Filho and M{\'{a}}rio Sarcinelli Filho and Jos{\'{e}} Luis Mart{\'{\i}}n S{\'{a}}nchez and Juan Carlos Garc{\'{\i}}a Garc{\'{\i}}a and Manuel Mazo Quintas}, editor = {Teodiano Freire Bastos Filho and Hugo Gamboa}, title = {Evaluation of {PSD} Components and {AAR} Parameters as Input Features for a {SVM} Classifier Applied to a Robotic Wheelchair}, booktitle = {{BIODEVICES} 2009 - Proceedings of the International Conference on Biomedical Electronics and Devices, Porto, Portugal, January 14-17, 2009}, pages = {7--12}, publisher = {{INSTICC} Press}, year = {2009}, timestamp = {Thu, 21 May 2009 18:31:39 +0200}, biburl = {https://dblp.org/rec/conf/biostec/FerreiraFFSGQ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/biostec/FerreiraFFSGQ09a, author = {Andr{\'{e}} Ferreira and Teodiano Freire Bastos Filho and M{\'{a}}rio Sarcinelli Filho and Jos{\'{e}} Luis Mart{\'{\i}}n S{\'{a}}nchez and Juan Carlos Garc{\'{\i}}a Garc{\'{\i}}a and Manuel Mazo Quintas}, editor = {Ana L. N. Fred and Joaquim Filipe and Hugo Gamboa}, title = {Improvements of a Brain-Computer Interface Applied to a Robotic Wheelchair}, booktitle = {Biomedical Engineering Systems and Technologies - International Joint Conference, {BIOSTEC} 2009 Porto, Portugal, January 14-17, 2009, Revised Selected Papers}, series = {Communications in Computer and Information Science}, volume = {52}, pages = {64--73}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-11721-3\_4}, doi = {10.1007/978-3-642-11721-3\_4}, timestamp = {Sun, 06 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/biostec/FerreiraFFSGQ09a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ciarp/Sanchez-CruzR09, author = {Hermilo S{\'{a}}nchez{-}Cruz and Mario A. Rodr{\'{\i}}guez{-}D{\'{\i}}az}, editor = {Eduardo Bayro{-}Corrochano and Jan{-}Olof Eklundh}, title = {Coding Long Contour Shapes of Binary Objects}, booktitle = {Progress in Pattern Recognition, Image Analysis, Computer Vision, and Applications, 14th Iberoamerican Conference on Pattern Recognition, {CIARP} 2009, Guadalajara, Jalisco, Mexico, November 15-18, 2009. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5856}, pages = {45--52}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-10268-4\_5}, doi = {10.1007/978-3-642-10268-4\_5}, timestamp = {Tue, 14 May 2019 10:00:40 +0200}, biburl = {https://dblp.org/rec/conf/ciarp/Sanchez-CruzR09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cikm/Segura-BedmarCPM09, author = {Isabel Segura{-}Bedmar and Mario Crespo and C{\'{e}}sar de Pablo{-}S{\'{a}}nchez and Paloma Mart{\'{\i}}nez}, editor = {Doheon Lee and Russ B. Altman and Min Song and Jun Huan}, title = {DrugNerAR: linguistic rule-based anaphora resolver for drug-drug interaction extraction in pharmacological documents}, booktitle = {Proceeding of the 3rd International Workshop on Data and Text Mining in Bioinformatics, {DTMBIO} 2009, Hong Kong, China, November 6, 2009}, pages = {19--26}, publisher = {{ACM}}, year = {2009}, url = {https://doi.org/10.1145/1651318.1651324}, doi = {10.1145/1651318.1651324}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cikm/Segura-BedmarCPM09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/enc/Anzures-GarciaSHP09, author = {Mario Anzures{-}Garc{\'{\i}}a and Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and Miguel J. Hornos and Patricia Paderewski}, editor = {Alejandro P. Buchmann}, title = {Service-Based Layered Architectural Model for Building Collaborative Applications in Heterogeneous Environments}, booktitle = {2009 Mexican International Conference on Computer Science, {ENC} 2009, Mexico City, Mexico, September 21-25, 2009}, pages = {252--263}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/ENC.2009.37}, doi = {10.1109/ENC.2009.37}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/enc/Anzures-GarciaSHP09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/micai/ColungaSM09, author = {Mario Chirinos Colunga and Oscar S{\'{a}}nchez Siordia and Stephen J. Maybank}, editor = {Arturo Hern{\'{a}}ndez Aguirre and Ra{\'{u}}l Monroy Borja and Carlos A. Reyes Garc{\'{\i}}a}, title = {Leukocyte Recognition Using EM-Algorithm}, booktitle = {{MICAI} 2009: Advances in Artificial Intelligence, 8th Mexican International Conference on Artificial Intelligence, Guanajuato, Mexico, November 9-13, 2009. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5845}, pages = {545--555}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-05258-3\_48}, doi = {10.1007/978-3-642-05258-3\_48}, timestamp = {Sat, 19 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/micai/ColungaSM09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nldb/Segura-BedmarCP09, author = {Isabel Segura{-}Bedmar and Mario Crespo and C{\'{e}}sar de Pablo{-}S{\'{a}}nchez}, editor = {Helmut Horacek and Elisabeth M{\'{e}}tais and Rafael Mu{\~{n}}oz and Magdalena Wolska}, title = {Score-Based Approach for Anaphora Resolution in Drug-Drug Interactions Documents}, booktitle = {Natural Language Processing and Information Systems, 14th International Conference on Applications of Natural Language to Information Systems, {NLDB} 2009, Saarbr{\"{u}}cken, Germany, June 24-26, 2009. Revised Papers}, series = {Lecture Notes in Computer Science}, volume = {5723}, pages = {91--102}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-12550-8\_8}, doi = {10.1007/978-3-642-12550-8\_8}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/nldb/Segura-BedmarCP09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sis/SanchezPFP09, author = {Luis Enrique S{\'{a}}nchez and Antonio Santos{-}Olmo and Eduardo Fern{\'{a}}ndez{-}Medina and Mario Piattini}, editor = {Alfonso Rodr{\'{\i}}guez and Mariemma Inmaculada Yag{\"{u}}e del Valle and Eduardo Fern{\'{a}}ndez{-}Medina}, title = {{MMSM-SME:} Methodology for the Management of Security and its Maturity in {SME}}, booktitle = {Security in Information Systems, Proceedings of the 7th International Workshop on Security in Information Systems, {WOSIS} 2009, In conjunction with {ICEIS} 2009, Milan, Italy, May 2009}, pages = {67--78}, publisher = {{INSTICC} Press}, year = {2009}, timestamp = {Mon, 29 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sis/SanchezPFP09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sws/LischkaEC09, author = {Mario Lischka and Yukiko Endo and Manuel S{\'{a}}nchez Cuenca}, editor = {Ernesto Damiani and Seth Proctor and Anoop Singhal}, title = {Deductive policies with {XACML}}, booktitle = {Proceedings of the 6th {ACM} Workshop On Secure Web Services, {SWS} 2009, Chicago, Illinois, USA, November 13, 2009}, pages = {37--44}, publisher = {{ACM}}, year = {2009}, url = {https://doi.org/10.1145/1655121.1655130}, doi = {10.1145/1655121.1655130}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sws/LischkaEC09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tools/SanchezJVD09, author = {Mario E. S{\'{a}}nchez and Camilo Jim{\'{e}}nez and Jorge Villalobos and Dirk Deridder}, editor = {Manuel Oriol and Bertrand Meyer}, title = {Extensibility in Model-Based Business Process Engines}, booktitle = {Objects, Components, Models and Patterns, 47th International Conference, {TOOLS} {EUROPE} 2009, Zurich, Switzerland, June 29-July 3, 2009. Proceedings}, series = {Lecture Notes in Business Information Processing}, volume = {33}, pages = {157--174}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-02571-6\_10}, doi = {10.1007/978-3-642-02571-6\_10}, timestamp = {Mon, 30 Oct 2017 11:35:08 +0100}, biburl = {https://dblp.org/rec/conf/tools/SanchezJVD09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wecwis/AguilarSCRPCV09, author = {Elvira Rol{\'{o}}n Aguilar and Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and F{\'{e}}lix Garc{\'{\i}}a and Francisco Ruiz and Mario Piattini and Danilo Caivano and Giuseppe Visaggio}, editor = {Birgit Hofreiter and Hannes Werthner}, title = {Prediction Models for {BPMN} Usability and Maintainability}, booktitle = {2009 {IEEE} Conference on Commerce and Enterprise Computing, {CEC} 2009, Vienna, Austria, July 20-23, 2009}, pages = {383--390}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/CEC.2009.53}, doi = {10.1109/CEC.2009.53}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/wecwis/AguilarSCRPCV09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:books/igi/09/Sanchez-GonzalezD00P09, author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and Andrea Delgado and Francisco Ruiz and F{\'{e}}lix Garc{\'{\i}}a and Mario Piattini}, editor = {Jorge Cardoso and Wil M. P. van der Aalst}, title = {Measurement and Maturity of Business Processes}, booktitle = {Handbook of Research on Business Process Modeling}, pages = {532--556}, publisher = {{IGI} Global}, year = {2009}, url = {https://doi.org/10.4018/978-1-60566-288-6.ch024}, doi = {10.4018/978-1-60566-288-6.CH024}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/books/igi/09/Sanchez-GonzalezD00P09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/titb/SalvadorRMRCSFCGMM08, author = {Carlos Hern{\'{a}}ndez Salvador and Antonio Ruiz{-}Sanchez and M. A. Gonz{\'{a}}lez de Mingo and Montserrat Carmona Rodriguez and Mario Pascual Carrasco and Pilar G. Sagredo and Juan A. Fragua and Fernando Caballero{-}Martinez and Fernando Garcia{-}Lopez and J. M{\'{a}}rquez Montes and Jose Luis Monteagudo}, title = {Evaluation of a Telemedicine-Based Service for the Follow-Up and Monitoring of Patients Treated With Oral Anticoagulant Therapy}, journal = {{IEEE} Trans. Inf. Technol. Biomed.}, volume = {12}, number = {6}, pages = {696--706}, year = {2008}, url = {https://doi.org/10.1109/TITB.2008.910750}, doi = {10.1109/TITB.2008.910750}, timestamp = {Wed, 13 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/titb/SalvadorRMRCSFCGMM08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/IEEEares/Anzures-GarciaS08, author = {Mario Anzures{-}Garc{\'{\i}}a and Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez}, title = {Policy-based Group Organizational Structure Management using an Ontological Approach}, booktitle = {Proceedings of the The Third International Conference on Availability, Reliability and Security, {ARES} 2008, March 4-7, 2008, Technical University of Catalonia, Barcelona , Spain}, pages = {807--812}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/ARES.2008.186}, doi = {10.1109/ARES.2008.186}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/IEEEares/Anzures-GarciaS08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aosd/SanchezV08, author = {Mario E. S{\'{a}}nchez and Jorge Villalobos}, editor = {Omar Aldawud and Walter Cazzola and Tzilla Elrad and Jeff Gray and J{\"{o}}rg Kienzle and Dominik Stein}, title = {A flexible architecture to build workflows using aspect-oriented concepts}, booktitle = {Proceedings of the 2008 {AOSD} Workshop on Aspect-Oriented Modeling, {AOM} '08, Brussels, Belgium, April 1, 2008}, pages = {25--30}, publisher = {{ACM}}, year = {2008}, url = {https://doi.org/10.1145/1404920.1404925}, doi = {10.1145/1404920.1404925}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/aosd/SanchezV08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cisis/Anzures-GarciaS08, author = {Mario Anzures{-}Garc{\'{\i}}a and Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez}, editor = {Fatos Xhafa and Leonard Barolli}, title = {Group Organizational Structure Adaptation for Groupware Applications}, booktitle = {Second International Conference on Complex, Intelligent and Software Intensive Systems (CISIS-2008), March 4th-7th, 2008, Technical University of Catalonia, Barcelona, Spain}, pages = {435--440}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/CISIS.2008.149}, doi = {10.1109/CISIS.2008.149}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cisis/Anzures-GarciaS08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/secrypt/SanchezVFP08, author = {Luis Enrique S{\'{a}}nchez and Daniel Villafranca and Eduardo Fern{\'{a}}ndez{-}Medina and Mario Piattini}, editor = {Eduardo Fern{\'{a}}ndez{-}Medina and Manu Malek and Javier Hernando}, title = {Practical Application of a Security Management Maturity Model for SMEs based on Predefined Schemas}, booktitle = {{SECRYPT} 2008, Proceedings of the International Conference on Security and Cryptography, Porto, Portugal, July 26-29, 2008, {SECRYPT} is part of {ICETE} - The International Joint Conference on e-Business and Telecommunications}, pages = {391--398}, publisher = {{INSTICC} Press}, year = {2008}, timestamp = {Mon, 08 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/secrypt/SanchezVFP08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/his/2008, editor = {Fatos Xhafa and Francisco Herrera and Ajith Abraham and Mario K{\"{o}}ppen and Jos{\'{e}} Manuel Ben{\'{\i}}tez}, title = {8th International Conference on Hybrid Intelligent Systems {(HIS} 2008), September 10-12, 2008, Barcelona, Spain}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://ieeexplore.ieee.org/xpl/conhome/4626579/proceeding}, isbn = {978-0-7695-3326-1}, timestamp = {Wed, 16 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/his/2008.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cikm/Martinez-BazanMGNSL07, author = {Norbert Mart{\'{\i}}nez{-}Bazan and Victor Munt{\'{e}}s{-}Mulero and Sergio G{\'{o}}mez{-}Villamor and Jordi Nin and Mario{-}A. S{\'{a}}nchez{-}Mart{\'{\i}}nez and Josep Llu{\'{\i}}s Larriba{-}Pey}, editor = {M{\'{a}}rio J. Silva and Alberto H. F. Laender and Ricardo A. Baeza{-}Yates and Deborah L. McGuinness and Bj{\o}rn Olstad and {\O}ystein Haug Olsen and Andr{\'{e}} O. Falc{\~{a}}o}, title = {Dex: high-performance exploration on large graphs for information retrieval}, booktitle = {Proceedings of the Sixteenth {ACM} Conference on Information and Knowledge Management, {CIKM} 2007, Lisbon, Portugal, November 6-10, 2007}, pages = {573--582}, publisher = {{ACM}}, year = {2007}, url = {https://doi.org/10.1145/1321440.1321521}, doi = {10.1145/1321440.1321521}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cikm/Martinez-BazanMGNSL07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eurocast/Anzures-GarciaSHP07, author = {Mario Anzures{-}Garc{\'{\i}}a and Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and Miguel J. Hornos and Patricia Paderewski{-}Rodr{\'{\i}}guez}, editor = {Roberto Moreno{-}D{\'{\i}}az and Franz Pichler and Alexis Quesada{-}Arencibia}, title = {Ontology-Based Modelling of Session Management Policies for Groupware Applications}, booktitle = {Computer Aided Systems Theory - {EUROCAST} 2007, 11th International Conference on Computer Aided Systems Theory, Las Palmas de Gran Canaria, Spain, February 12-16, 2007, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {4739}, pages = {57--64}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-75867-9\_8}, doi = {10.1007/978-3-540-75867-9\_8}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eurocast/Anzures-GarciaSHP07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iasam/AzcondoOMDBRPDC07, author = {Francisco J. Azcondo and Alfredo Ortiz and Mario Ma{\~{n}}ana and F. Javier D{\'{\i}}az and Christian Bra{\~{n}}as and Carlos Renedo and Severiano P{\'{e}}rez and Fernando Delgado and Rosario Casanueva}, title = {Effects of Flicker on Different Types of 150-W High-Pressure Sodium Lamps and Ballasts}, booktitle = {Conference Record of the 2007 {IEEE} Industry Applications Conference Forty-Second {IAS} Annual Meeting, New Orleans, LA, USA, September 23-27, 2007}, pages = {833--838}, publisher = {{IEEE}}, year = {2007}, url = {https://doi.org/10.1109/07IAS.2007.131}, doi = {10.1109/07IAS.2007.131}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iasam/AzcondoOMDBRPDC07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ibpria/Anton-CanalisHS07, author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and Mario Hern{\'{a}}ndez{-}Tejera and Elena S{\'{a}}nchez{-}Nielsen}, editor = {Joan Mart{\'{\i}} and Jos{\'{e}}{-}Miguel Bened{\'{\i}} and Ana Maria Mendon{\c{c}}a and Joan Serrat}, title = {Analysis of Relevant Maxima in Distance Transform. An Application to Fast Coarse Image Segmentation}, booktitle = {Pattern Recognition and Image Analysis, Third Iberian Conference, IbPRIA 2007, Girona, Spain, June 6-8, 2007, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {4477}, pages = {97--104}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-72847-4\_14}, doi = {10.1007/978-3-540-72847-4\_14}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ibpria/Anton-CanalisHS07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icsoft/SanchezVFP07, author = {Luis Enrique S{\'{a}}nchez and Daniel Villafranca and Eduardo Fern{\'{a}}ndez{-}Medina and Mario Piattini}, editor = {Joaquim Filipe and Boris Shishkov and Markus Helfert}, title = {Scmm-Tool - Tool for Computer Automation of the Information Security Management Systems}, booktitle = {{ICSOFT} 2007, Proceedings of the Second International Conference on Software and Data Technologies, Volume SE, Barcelona, Spain, July 22-25, 2007}, pages = {311--318}, publisher = {{INSTICC} Press}, year = {2007}, timestamp = {Mon, 08 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icsoft/SanchezVFP07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/secrypt/SanchezVFP07, author = {Luis Enrique S{\'{a}}nchez and Daniel Villafranca and Eduardo Fern{\'{a}}ndez{-}Medina and Mario Piattini}, editor = {Javier Hernando and Eduardo Fern{\'{a}}ndez{-}Medina and Manu Malek}, title = {Developing a Model and a Tool to Manage the Information Security in Small and Medium Enterprises}, booktitle = {{SECRYPT} 2007, Proceedings of the International Conference on Security and Cryptography, Barcelona, Spain, July 28-13, 2007, {SECRYPT} is part of {ICETE} - The International Joint Conference on e-Business and Telecommunications}, pages = {355--362}, publisher = {{INSTICC} Press}, year = {2007}, timestamp = {Mon, 08 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/secrypt/SanchezVFP07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sis/SachezVP07, author = {Lu{\'{\i}}s Enrique Sanchez and Daniel Villafranca and Mario Piattini}, editor = {Mariemma Inmaculada Yag{\"{u}}e del Valle and Eduardo Fern{\'{a}}ndez{-}Medina}, title = {{MMISS-SME} Practical Development: Maturity Model for Information Systems Security Management in SMEs}, booktitle = {Security in Information Systems, Proceedings of the 5th International Workshop on Security in Information Systems, {WOSIS} 2007, In conjunction with {ICEIS} 2007, Funchal, Madeira, Portugal, June 2007}, pages = {233--244}, publisher = {{INSTICC} Press}, year = {2007}, timestamp = {Mon, 11 Aug 2008 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sis/SachezVP07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-0712-2684, author = {Ricardo L{\'{o}}pez{-}Ruiz and J. Gonzalez{-}Estevez and Mario G. Cosenza and J. R. S{\'{a}}nchez}, title = {An Economic Model of Coupled Exponential Maps}, journal = {CoRR}, volume = {abs/0712.2684}, year = {2007}, url = {http://arxiv.org/abs/0712.2684}, eprinttype = {arXiv}, eprint = {0712.2684}, timestamp = {Wed, 11 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-0712-2684.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rasi/RodriguezSC06, author = {Elkin Rodr{\'{\i}}guez and Andr{\'{e}}s Felipe S{\'{a}}nchez and Jorge Mario Chaverra}, title = {Desarrollo de una Herramienta para la Minimizaci{\'{o}}n de Tardanza Total en Ambientes Job Shop Apoyada en B{\'{u}}squeda Tab{\'{u}}}, journal = {Rev. Avances en Sistemas Inform{\'{a}}tica}, volume = {3}, number = {1}, pages = {75--78}, year = {2006}, url = {http://pisis.unalmed.edu.co/avances/archivos/ediciones/2006/rodriguez\_etal06.pdf}, timestamp = {Fri, 22 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rasi/RodriguezSC06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigmod/VelaFMP06, author = {Bel{\'{e}}n Vela and Eduardo Fern{\'{a}}ndez{-}Medina and Esperanza Marcos and Mario Piattini}, title = {Model driven development of secure {XML} databases}, journal = {{SIGMOD} Rec.}, volume = {35}, number = {3}, pages = {22--27}, year = {2006}, url = {https://doi.org/10.1145/1168092.1168095}, doi = {10.1145/1168092.1168095}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigmod/VelaFMP06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/IEEEares/SanchezVFP06, author = {Luis Enrique S{\'{a}}nchez and Daniel Villafranca and Eduardo Fern{\'{a}}ndez{-}Medina and Mario Piattini}, title = {Practical Approach of a Secure Management System based on {ISO/IEC} 17799}, booktitle = {Proceedings of the The First International Conference on Availability, Reliability and Security, {ARES} 2006, The International Dependability Conference - Bridging Theory and Practice, April 20-22 2006, Vienna University of Technology, Austria}, pages = {585--592}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/ARES.2006.94}, doi = {10.1109/ARES.2006.94}, timestamp = {Sat, 27 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/IEEEares/SanchezVFP06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acivs/Anton-CanalisHS06, author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and Mario Hern{\'{a}}ndez{-}Tejera and Elena S{\'{a}}nchez{-}Nielsen}, editor = {Jacques Blanc{-}Talon and Wilfried Philips and Dan C. Popescu and Paul Scheunders}, title = {AddCanny: Edge Detector for Video Processing}, booktitle = {Advanced Concepts for Intelligent Vision Systems, 8th International Conference, {ACIVS} 2006, Antwerp, Belgium, September 18-21, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4179}, pages = {501--512}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11864349\_46}, doi = {10.1007/11864349\_46}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acivs/Anton-CanalisHS06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cdc/SznaierPP06, author = {Mario Sznaier and Ricardo Salvador S{\'{a}}nchez Pe{\~{n}}a and Vicen{\c{c}} Puig}, title = {Set-Membership Identification of Parametric Systems}, booktitle = {45th {IEEE} Conference on Decision and Control, {CDC} 2006, San Diego, CA, USA, December 13-15, 2006}, pages = {151--156}, publisher = {{IEEE}}, year = {2006}, url = {https://doi.org/10.1109/CDC.2006.377561}, doi = {10.1109/CDC.2006.377561}, timestamp = {Fri, 04 Mar 2022 13:26:30 +0100}, biburl = {https://dblp.org/rec/conf/cdc/SznaierPP06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cibse/VelaFMP06, author = {Bel{\'{e}}n Vela and Eduardo Fern{\'{a}}ndez{-}Medina and Esperanza Marcos and Mario Piattini}, editor = {Jaelson Castro and Luca Cernuzzi and Silvia E. Gordillo}, title = {Una Aproximaci{\'{o}}n Dirigida por Modelos para el Dise{\~{n}}o de Bases de Datos {XML} Seguras}, booktitle = {Memorias de la {IX} Conferenci a Iberoamericana de Software Engineering (CIbSE 2006), La Plata, Argentina, Abril 24-28, 2006}, pages = {229--242}, year = {2006}, timestamp = {Tue, 21 Dec 2010 15:32:51 +0100}, biburl = {https://dblp.org/rec/conf/cibse/VelaFMP06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/fpt/MarcosGLL06, author = {Miguel A. S{\'{a}}nchez Marcos and Mario Garrido and Marisa L{\'{o}}pez{-}Vallejo and Carlos A. L{\'{o}}pez{-}Barrio}, editor = {George A. Constantinides and Wai{-}Kei Mak and Phaophak Sirisuk and Theerayod Wiangtong}, title = {Automated design space exploration of FPGA-based {FFT} architectures based on area and power estimation}, booktitle = {2006 {IEEE} International Conference on Field Programmable Technology, {FPT} 2006, Bangkok, Thailand, December 13-15, 2006}, pages = {127--134}, publisher = {{IEEE}}, year = {2006}, url = {https://doi.org/10.1109/FPT.2006.270303}, doi = {10.1109/FPT.2006.270303}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/fpt/MarcosGLL06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/glvlsi/GargSGJGK06, author = {Rajesh Garg and Mario S{\'{a}}nchez and Kanupriya Gulati and Nikhil Jayakumar and Anshul Gupta and Sunil P. Khatri}, editor = {Gang Qu and Yehea I. Ismail and Narayanan Vijaykrishnan and Hai Zhou}, title = {A design flow to optimize circuit delay by using standard cells and PLAs}, booktitle = {Proceedings of the 16th {ACM} Great Lakes Symposium on {VLSI} 2006, Philadelphia, PA, USA, April 30 - May 1, 2006}, pages = {217--222}, publisher = {{ACM}}, year = {2006}, url = {https://doi.org/10.1145/1127908.1127960}, doi = {10.1145/1127908.1127960}, timestamp = {Wed, 16 Aug 2023 21:16:32 +0200}, biburl = {https://dblp.org/rec/conf/glvlsi/GargSGJGK06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isda/Anton-CanalisHS06, author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and Mario Hern{\'{a}}ndez{-}Tejera and Elena S{\'{a}}nchez{-}Nielsen}, title = {Particle Swarms as Video Sequence Inhabitants For Object Tracking in Computer Vision}, booktitle = {Proceedings of the Sixth International Conference on Intelligent Systems Design and Applications {(ISDA} 2006), October 16-18, 2006, Jinan, China}, pages = {604--609}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/ISDA.2006.253905}, doi = {10.1109/ISDA.2006.253905}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/isda/Anton-CanalisHS06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sis/SanchezVFP06, author = {Luis Enrique S{\'{a}}nchez and Daniel Villafranca and Eduardo Fern{\'{a}}ndez{-}Medina and Mario Piattini}, editor = {Eduardo Fern{\'{a}}ndez{-}Medina and Mariemma Inmaculada Yag{\"{u}}e del Valle}, title = {Developing a Maturity Model for Information System Security Management within Small and Medium Size Enterprises}, booktitle = {Security in Information Systems, Proceedings of the 4th International Workshop on Security in Information Systems, {WOSIS} 2006, In conjunction with {ICEIS} 2006, Paphos, Cyprus, May 2006}, pages = {256--266}, publisher = {{INSTICC} Press}, year = {2006}, timestamp = {Mon, 08 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sis/SanchezVFP06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sis/VelaFMP06, author = {Bel{\'{e}}n Vela and Eduardo Fern{\'{a}}ndez{-}Medina and Esperanza Marcos and Mario Piattini}, editor = {Eduardo Fern{\'{a}}ndez{-}Medina and Mariemma Inmaculada Yag{\"{u}}e del Valle}, title = {A Model Driven Approach for Secure {XML} Database Development}, booktitle = {Security in Information Systems, Proceedings of the 4th International Workshop on Security in Information Systems, {WOSIS} 2006, In conjunction with {ICEIS} 2006, Paphos, Cyprus, May 2006}, pages = {33--46}, publisher = {{INSTICC} Press}, year = {2006}, timestamp = {Tue, 19 Sep 2006 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sis/VelaFMP06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wises/IbanezSMS06, author = {Mario Ib{\'{a}}{\~{n}}ez and Juan Jes{\'{u}}s S{\'{a}}nchez S{\'{a}}nchez and Natividad Mart{\'{\i}}nez Madrid and Ralf Seepold}, editor = {Wilfried Elmenreich and Gregor Novak and Ralf Seepold}, title = {Portable Profiles for Residential Gateways}, booktitle = {4th International Workshop on Intelligent Solutions in Embedded Systems, {WISES} 2006, Vienna, Austria, June 30, 2006}, pages = {189--200}, publisher = {{IEEE}}, year = {2006}, url = {https://doi.org/10.1109/WISES.2006.329129}, doi = {10.1109/WISES.2006.329129}, timestamp = {Fri, 27 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/wises/IbanezSMS06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acivs/Sanchez-NielsenH05, author = {Elena S{\'{a}}nchez{-}Nielsen and Mario Hern{\'{a}}ndez{-}Tejera}, editor = {Jacques Blanc{-}Talon and Wilfried Philips and Dan C. Popescu and Paul Scheunders}, title = {Heuristic Algorithm for Computing Fast Template Motion in Video Streams}, booktitle = {Advanced Concepts for Intelligent Vision Systems, 7th International Conference, {ACIVS} 2005, Antwerp, Belgium, September 20-23, 2005, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3708}, pages = {547--554}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11558484\_69}, doi = {10.1007/11558484\_69}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acivs/Sanchez-NielsenH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bvai/Sanchez-NielsenH05, author = {Elena S{\'{a}}nchez{-}Nielsen and Mario Hern{\'{a}}ndez{-}Tejera}, editor = {Massimo De Gregorio and Vito Di Maio and Maria Frucci and Carlo Musio}, title = {Heuristic Algorithms for Fast and Accurate Tracking of Moving Objects in Unrestricted Environments}, booktitle = {Brain, Vision, and Artificial Intelligence, First International Symposium, {BVAI} 2005, Naples, Italy, October 19-21, 2005, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3704}, pages = {507--516}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11565123\_49}, doi = {10.1007/11565123\_49}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/bvai/Sanchez-NielsenH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cdc/OsorioOPPJKG05, author = {Ren{\'{e}} Osorio and Marco Antonio Oliver{-}Salazar and Mario Ponce{-}Silva and Sergio Pinto and Mario A. Ju{\'{a}}rez and Reza Katebi and M. J. Grimble}, title = {Analysis and Design of Discrete-Sliding-Mode Control for a Square-Waveform-Ballast}, booktitle = {44th {IEEE} {IEEE} Conference on Decision and Control and 8th European Control Conference Control, {CDC/ECC} 2005, Seville, Spain, 12-15 December, 2005}, pages = {584--589}, publisher = {{IEEE}}, year = {2005}, url = {https://doi.org/10.1109/CDC.2005.1582219}, doi = {10.1109/CDC.2005.1582219}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cdc/OsorioOPPJKG05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cdc/PenaSP05, author = {Ricardo S. S{\'{a}}nchez Pe{\~{n}}a and Mario Sznaier and Vicen{\c{c}} Puig}, title = {Robust Interpolation using Interval Structures}, booktitle = {44th {IEEE} {IEEE} Conference on Decision and Control and 8th European Control Conference Control, {CDC/ECC} 2005, Seville, Spain, 12-15 December, 2005}, pages = {4983--4987}, publisher = {{IEEE}}, year = {2005}, url = {https://doi.org/10.1109/CDC.2005.1582951}, doi = {10.1109/CDC.2005.1582951}, timestamp = {Tue, 19 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cdc/PenaSP05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/egc/GomesDMBGHKMMRDCSGSFLNLOWBNPWFFCFTXDACHSKRG05, author = {Jorge A. T. Gomes and M{\'{a}}rio David and J. Martins and Lu{\'{\i}}s Bernardo and Ariel Garc{\'{\i}}a and Markus Hardt and Harald Kornmayer and J. Marco and R. Marco and D. Rodr{\'{\i}}guez and Iv{\'{a}}n D{\'{\i}}az and D. Cano and Jos{\'{e}} Salt and S. Gonzalez and Javier S{\'{a}}nchez and Farida Fassi and V. Lara and P. Nyczyk and Patryk Lason and Andrzej Ozieblo and Pawel Wolniewicz and Michal Bluj and Krzysztof Nawrocki and Adam Padee and Wojciech Wislicki and C. Fern{\'{a}}ndez and J. Font{\'{a}}n and Yannis Cotronis and Evangelos Floros and George Tsouloupas and Wei Xing and Marios D. Dikaiakos and J{\'{a}}n Astalos and Brian A. Coghlan and Elisa Heymann and Miquel A. Senar and C. Kanellopoulos and A. Ramos and Derek Groen}, editor = {Peter M. A. Sloot and Alfons G. Hoekstra and Thierry Priol and Alexander Reinefeld and Marian Bubak}, title = {Experience with the International Testbed in the CrossGrid Project}, booktitle = {Advances in Grid Computing - {EGC} 2005, European Grid Conference, Amsterdam, The Netherlands, February 14-16, 2005, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {3470}, pages = {98--110}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11508380\_12}, doi = {10.1007/11508380\_12}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/egc/GomesDMBGHKMMRDCSGSFLNLOWBNPWFFCFTXDACHSKRG05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcai/Sanchez-NielsenH05, author = {Elena S{\'{a}}nchez{-}Nielsen and Mario Hern{\'{a}}ndez{-}Tejera}, editor = {Leslie Pack Kaelbling and Alessandro Saffiotti}, title = {An Heuristic Search based Approach for Moving Objects Tracking}, booktitle = {IJCAI-05, Proceedings of the Nineteenth International Joint Conference on Artificial Intelligence, Edinburgh, Scotland, UK, July 30 - August 5, 2005}, pages = {1736--1737}, publisher = {Professional Book Center}, year = {2005}, url = {http://ijcai.org/Proceedings/05/Papers/post-0184.pdf}, timestamp = {Tue, 20 Aug 2019 16:16:29 +0200}, biburl = {https://dblp.org/rec/conf/ijcai/Sanchez-NielsenH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:books/idea/encyclopedia2005/BarcaMVM05, author = {Jos{\'{e}} Mar{\'{\i}}a Cavero Barca and Esperanza Marcos Mart{\'{\i}}nez and Mario Piattini and Adolfo Sanchez de Miguel}, editor = {Mehdi Khosrow{-}Pour}, title = {Data Warehouse Development}, booktitle = {Encyclopedia of Information Science and Technology {(5} Volumes)}, pages = {729--733}, publisher = {Idea Group}, year = {2005}, url = {http://www.igi-global.com/Bookstore/Chapter.aspx?TitleId=14326}, timestamp = {Sun, 09 Jul 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/books/idea/encyclopedia2005/BarcaMVM05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcsc/EchavarriaSPCC04, author = {Rodolfo Echavarr{\'{\i}}a and Victor M. Sanchez and Mario Ponce and Maria Cotorogea and Abraham Claudio}, title = {Analysis And Design Of {A} Quasi-Resonant Fast On-Load Tap Changing Regulator}, journal = {J. Circuits Syst. Comput.}, volume = {13}, number = {4}, pages = {877--899}, year = {2004}, url = {https://doi.org/10.1142/S0218126604001738}, doi = {10.1142/S0218126604001738}, timestamp = {Tue, 28 Feb 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jcsc/EchavarriaSPCC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsp/FernandezPAP04, author = {Matilde S{\'{a}}nchez Fern{\'{a}}ndez and Mario de Prado{-}Cumplido and Jer{\'{o}}nimo Arenas{-}Garc{\'{\i}}a and Fernando P{\'{e}}rez{-}Cruz}, title = {{SVM} multiregression for nonlinear channel estimation in multiple-input multiple-output systems}, journal = {{IEEE} Trans. Signal Process.}, volume = {52}, number = {8}, pages = {2298--2307}, year = {2004}, url = {https://doi.org/10.1109/TSP.2004.831028}, doi = {10.1109/TSP.2004.831028}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tsp/FernandezPAP04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wscg/Sanchez-NielsenAH04, author = {Elena S{\'{a}}nchez{-}Nielsen and Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and Mario Hern{\'{a}}ndez{-}Tejera}, title = {Hand Gesture Recognition for Human-Machine Interaction}, booktitle = {The 12-th International Conference in Central Europe on Computer Graphics, Visualization and Computer Vision'2004, {WSCG} 2004, University of West Bohemia, Campus Bory, Plzen-Bory, Czech Republic, February 2-6, 2004}, pages = {395--402}, year = {2004}, timestamp = {Wed, 24 Jul 2013 17:32:33 +0200}, biburl = {https://dblp.org/rec/conf/wscg/Sanchez-NielsenAH04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/cs-PL-0404050, author = {Puri Arenas{-}S{\'{a}}nchez and Mario Rodr{\'{\i}}guez{-}Artalejo}, title = {A General Framework For Lazy Functional Logic Programming With Algebraic Polymorphic Types}, journal = {CoRR}, volume = {cs.PL/0404050}, year = {2004}, url = {http://arxiv.org/abs/cs/0404050}, timestamp = {Fri, 10 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/cs-PL-0404050.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcmc/ClimentMOSSTV03, author = {Salvador Climent and Joaquim Mor{\'{e}} and Antoni Oliver and M{\'{\i}}riam Salvatierra and Imma S{\`{a}}nchez and Mariona Taul{\'{e}} and Llu{\"{\i}}sa Vallmanya}, title = {Bilingual Newsgroups in Catalonia: {A} Challenge for Machine Translation}, journal = {J. Comput. Mediat. Commun.}, volume = {9}, number = {1}, pages = {0}, year = {2003}, url = {https://doi.org/10.1111/j.1083-6101.2003.tb00360.x}, doi = {10.1111/J.1083-6101.2003.TB00360.X}, timestamp = {Thu, 01 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jcmc/ClimentMOSSTV03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pdln/AdurizAAABCCIFGHMMMMMMMNOPPPRSSSST03, author = {Itziar Aduriz and Alicia Ageno and Bertol Arrieta and Jose Maria Arriola and Empar Bisbal and N{\'{u}}ria Castell and Montserrat Civit and Arantza D{\'{\i}}az de Ilarraza and Bel{\'{e}}n Fern{\'{a}}ndez and Koldo Gojenola and Reda Halkoum and Raquel Marcos and Llu{\'{\i}}s M{\`{a}}rquez and Maria Ant{\`{o}}nia Mart{\'{\i}} and Patricio Mart{\'{\i}}nez{-}Barco and Antonio Molina and Paloma Moreda and Lidia Moreno and Borja Navarro and Maite Oronoz and Llu{\'{\i}}s Padr{\'{o}} and Manuel Palomar and Ferran Pla and Horacio Rodr{\'{\i}}guez and Maximiliano Saiz{-}Noeda and Emilio Sanchis and Kepa Sarasola and Armando Su{\'{a}}rez and Mariona Taul{\'{e}}}, title = {3LB: Construcci{\'{o}}n de una base de datos de {\'{a}}rboles sint{\'{a}}ctico sem{\'{a}}nticos}, journal = {Proces. del Leng. Natural}, volume = {31}, year = {2003}, url = {http://journal.sepln.org/sepln/ojs/ojs/index.php/pln/article/view/3179/1670}, timestamp = {Thu, 09 Dec 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pdln/AdurizAAABCCIFGHMMMMMMMNOPPPRSSSST03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eagc/GomesDMBMMRSGSFHGNOWBNPWFFGLCFTXDACHSMKA03, author = {Jorge A. T. Gomes and M{\'{a}}rio David and J. Martins and Lu{\'{\i}}s Bernardo and J. Marco and R. Marco and D. Rodr{\'{\i}}guez and Jos{\'{e}} Salt and S. Gonzalez and Javier S{\'{a}}nchez and A. Fuentes and Markus Hardt and Ariel Garc{\'{\i}}a and P. Nyczyk and Andrzej Ozieblo and Pawel Wolniewicz and Michal Bluj and Krzysztof Nawrocki and Adam Padee and Wojciech Wislicki and C. Fern{\'{a}}ndez and J. Font{\'{a}}n and A. G{\'{o}}mez and I. L{\'{o}}pez and Yannis Cotronis and Evangelos Floros and George Tsouloupas and Wei Xing and Marios D. Dikaiakos and J{\'{a}}n Astalos and Brian A. Coghlan and Elisa Heymann and Miquel A. Senar and Gonzalo Merino and C. Kanellopoulos and G. Dick van Albada}, editor = {Francisco Fernandez Rivera and Marian Bubak and Andr{\'{e}}s G{\'{o}}mez{-}Tato and Ramon Doallo}, title = {First Prototype of the CrossGrid Testbed}, booktitle = {Grid Computing, First European Across Grids Conference, Santiago de Compostela, Spain, February 13-14, 2003, Revised Papers}, series = {Lecture Notes in Computer Science}, volume = {2970}, pages = {67--77}, publisher = {Springer}, year = {2003}, url = {https://doi.org/10.1007/978-3-540-24689-3\_9}, doi = {10.1007/978-3-540-24689-3\_9}, timestamp = {Sun, 12 Nov 2023 02:12:58 +0100}, biburl = {https://dblp.org/rec/conf/eagc/GomesDMBMMRSGSFHGNOWBNPWFFGLCFTXDACHSMKA03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscas/EchavarriaSPCC02, author = {Rodolfo Echavarr{\'{\i}}a and Victor M. Sanchez and Mario Ponce and Maria Cotorogea and Abraham Claudio}, title = {Analysis of a power topology for a quasi-resonant fast on-load tap changing regulator}, booktitle = {Proceedings of the 2002 International Symposium on Circuits and Systems, {ISCAS} 2002, Scottsdale, Arizona, USA, May 26-29, 2002}, pages = {837--840}, publisher = {{IEEE}}, year = {2002}, url = {https://doi.org/10.1109/ISCAS.2002.1010834}, doi = {10.1109/ISCAS.2002.1010834}, timestamp = {Tue, 28 Feb 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iscas/EchavarriaSPCC02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcst/InancSPP01, author = {Tamer Inanc and Mario Sznaier and Pablo A. Parrilo and Ricardo S. S{\'{a}}nchez Pe{\~{n}}a}, title = {Robust identification with mixed parametric/nonparametric models and time/frequency-domain experiments: theory and an application}, journal = {{IEEE} Trans. Control. Syst. Technol.}, volume = {9}, number = {4}, pages = {608--617}, year = {2001}, url = {https://doi.org/10.1109/87.930971}, doi = {10.1109/87.930971}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcst/InancSPP01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tplp/Arenas-SanchezR01, author = {Puri Arenas{-}S{\'{a}}nchez and Mario Rodr{\'{\i}}guez{-}Artalejo}, title = {A General Framework for Lazy Functional Logic, Programming with Algebraic Polymorphic Types}, journal = {Theory Pract. Log. Program.}, volume = {1}, number = {2}, pages = {185--245}, year = {2001}, url = {http://journals.cambridge.org/action/displayAbstract?aid=74981}, timestamp = {Thu, 13 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tplp/Arenas-SanchezR01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iciap/NielsenLH01, author = {Elena S{\'{a}}nchez{-}Nielsen and Javier Lorenzo{-}Navarro and Mario Hern{\'{a}}ndez{-}Tejera}, title = {Increasing Efficiency of Hausdorff Approach for Tracking Real Scenes with Complex Environments}, booktitle = {11th International Conference on Image Analysis and Processing {(ICIAP} 2001), 26-28 September 2001, Palermo, Italy}, pages = {131--136}, publisher = {{IEEE} Computer Society}, year = {2001}, url = {https://doi.org/10.1109/ICIAP.2001.956997}, doi = {10.1109/ICIAP.2001.956997}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iciap/NielsenLH01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tac/ParriloPS99, author = {Pablo A. Parrilo and Ricardo S. S{\'{a}}nchez Pe{\~{n}}a and Mario Sznaier}, title = {A parametric extension of mixed time/frequency robust identification}, journal = {{IEEE} Trans. Autom. Control.}, volume = {44}, number = {2}, pages = {364--369}, year = {1999}, url = {https://doi.org/10.1109/9.746267}, doi = {10.1109/9.746267}, timestamp = {Wed, 20 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tac/ParriloPS99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/infocom/PazosSG99, author = {Carlos M. D. Pazos and Juan C. Sanchez{-}Agrelo and Mario Gerla}, title = {Using Back-Pressure to Improve {TCP} Performance with Many Flows}, booktitle = {Proceedings {IEEE} {INFOCOM} '99, The Conference on Computer Communications, Eighteenth Annual Joint Conference of the {IEEE} Computer and Communications Societies, The Future Is Now, New York, NY, USA, March 21-25, 1999}, pages = {431--438}, publisher = {{IEEE} Computer Society}, year = {1999}, url = {https://doi.org/10.1109/INFCOM.1999.751375}, doi = {10.1109/INFCOM.1999.751375}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/infocom/PazosSG99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscas/TeschPBS99, author = {Bruce J. Tesch and Philip M. Pratt and Kanti Bacrania and Mario Sanchez}, title = {A 14-b, 125 {MSPS} digital-to-analog converter and bandgap voltage reference in 0.5 um {CMOS}}, booktitle = {Proceedings of the 1999 International Symposium on Circuits and Systems, {ISCAS} 1999, Orlando, Florida, USA, May 30 - June 2, 1999}, pages = {452--455}, publisher = {{IEEE}}, year = {1999}, url = {https://doi.org/10.1109/ISCAS.1999.780765}, doi = {10.1109/ISCAS.1999.780765}, timestamp = {Wed, 03 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iscas/TeschPBS99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ppdp/Arenas-SanchezLR99, author = {Puri Arenas{-}S{\'{a}}nchez and Francisco Javier L{\'{o}}pez{-}Fraguas and Mario Rodr{\'{u}}guez{-}Arteljo}, editor = {Gopalan Nadathur}, title = {Functional Plus Logic Programming with Built-In and Symbolic Constraints}, booktitle = {Principles and Practice of Declarative Programming, International Conference PPDP'99, Paris, France, September 29 - October 1, 1999, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {1702}, pages = {152--169}, publisher = {Springer}, year = {1999}, url = {https://doi.org/10.1007/10704567\_9}, doi = {10.1007/10704567\_9}, timestamp = {Tue, 14 May 2019 10:00:46 +0200}, biburl = {https://dblp.org/rec/conf/ppdp/Arenas-SanchezLR99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/automatica/ParriloSPI98, author = {Pablo A. Parrilo and Mario Sznaier and Ricardo S. S{\'{a}}nchez Pe{\~{n}}a and Tamer Inanc}, title = {Mixed Time/Frequency-Domain Based Robust Identification}, journal = {Autom.}, volume = {34}, number = {11}, pages = {1375--1389}, year = {1998}, url = {https://doi.org/10.1016/S0005-1098(98)00083-1}, doi = {10.1016/S0005-1098(98)00083-1}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/automatica/ParriloSPI98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/plilp/Arenas-SanchezLR98, author = {Puri Arenas{-}S{\'{a}}nchez and Francisco Javier L{\'{o}}pez{-}Fraguas and Mario Rodr{\'{u}}guez{-}Arteljo}, editor = {Catuscia Palamidessi and Hugh Glaser and Karl Meinke}, title = {Embedding Multiset Constraints into a Lazy Functional Logic Language}, booktitle = {Principles of Declarative Programming, 10th International Symposium, PLILP'98 Held Jointly with the 7th International Conference, ALP'98, Pisa, Italy, September 16-18, 1998, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {1490}, pages = {429--444}, publisher = {Springer}, year = {1998}, url = {https://doi.org/10.1007/BFb0056631}, doi = {10.1007/BFB0056631}, timestamp = {Tue, 14 May 2019 10:00:35 +0200}, biburl = {https://dblp.org/rec/conf/plilp/Arenas-SanchezLR98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/slp/Arenas-SanchezR97, author = {Puri Arenas{-}S{\'{a}}nchez and Mario Rodr{\'{\i}}guez{-}Artalejo}, editor = {Jan Maluszynski}, title = {A Lazy Narrowing Calculus for Functional Logic Programming with Algebraic Polymorphic Types}, booktitle = {Logic Programming, Proceedings of the 1997 International Symposium, Port Jefferson, Long Island, NY, USA, October 13-16, 1997}, pages = {53--67}, publisher = {{MIT} Press}, year = {1997}, timestamp = {Fri, 10 Jul 2015 12:20:33 +0200}, biburl = {https://dblp.org/rec/conf/slp/Arenas-SanchezR97.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tapsoft/Arenas-SanchezR97, author = {Puri Arenas{-}S{\'{a}}nchez and Mario Rodr{\'{\i}}guez{-}Artalejo}, editor = {Michel Bidoit and Max Dauchet}, title = {A Semantic Framework for Functional Logic Programming with Algebraic Polymorphic Types}, booktitle = {TAPSOFT'97: Theory and Practice of Software Development, 7th International Joint Conference CAAP/FASE, Lille, France, April 14-18, 1997, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {1214}, pages = {453--464}, publisher = {Springer}, year = {1997}, url = {https://doi.org/10.1007/BFb0030618}, doi = {10.1007/BFB0030618}, timestamp = {Tue, 14 May 2019 10:00:50 +0200}, biburl = {https://dblp.org/rec/conf/tapsoft/Arenas-SanchezR97.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/time/SanchezS96, author = {Mario R. S{\'{a}}nchez and Anil M. Shende}, editor = {Luca Chittaro and Scott D. Goodwin and Howard J. Hamilton and Angelo Montanari}, title = {Time Accountability for Lattice Computers}, booktitle = {Proceedings of the Third International Workshop on Temporal Representation and Reasoning, TIME-96, Key West, Florida, USA, May 19-20, 1996}, pages = {211--216}, publisher = {{IEEE} Computer Society}, year = {1996}, url = {https://doi.org/10.1109/TIME.1996.555702}, doi = {10.1109/TIME.1996.555702}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/time/SanchezS96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigmod/RisheSBDOALOSS95, author = {Naphtali Rishe and Wei Sun and David Barton and Yi Deng and Cyril U. Orji and Michael Alexopoulos and Leonard Loureiro and Carlos Ordonez and Mario R. S{\'{a}}nchez and Artyom Shaposhnikov}, title = {Florida International University High Performance Database Research Center}, journal = {{SIGMOD} Rec.}, volume = {24}, number = {3}, pages = {71--76}, year = {1995}, url = {https://doi.org/10.1145/211990.212019}, doi = {10.1145/211990.212019}, timestamp = {Thu, 20 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigmod/RisheSBDOALOSS95.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
![](https://dblp.uni-trier.de/img/cog.dark.24x24.png)
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.