Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Mario Sanchez"
download as .bib file
@article{DBLP:journals/access/VilchezMembrillaPPSS24,
author = {Jos{\'{e}} Antonio Vilchez{-}Membrilla and
Mario Fern{\'{a}}ndez Pantoja and
Ana Pilar Valerga Puerta and
Victor Hugo Oliveira e Souza and
Clemente Cobos S{\'{a}}nchez},
title = {Design of Transcranial Magnetic Stimulation Coils With Optimized Stimulation
Depth},
journal = {{IEEE} Access},
volume = {12},
pages = {1330--1340},
year = {2024},
url = {https://doi.org/10.1109/ACCESS.2023.3346173},
doi = {10.1109/ACCESS.2023.3346173},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/VilchezMembrillaPPSS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computers/AndresSanchezOSG24,
author = {Jorge de Andr{\'{e}}s{-}S{\'{a}}nchez and
Mario Arias Oliva and
Mar Souto{-}Romero and
Jaume Gen{\'{e}}{-}Albesa},
title = {Assessing the Acceptance of Cyborg Technology with a Hedonic Technology
Acceptance Model},
journal = {Comput.},
volume = {13},
number = {3},
pages = {82},
year = {2024},
url = {https://doi.org/10.3390/computers13030082},
doi = {10.3390/COMPUTERS13030082},
timestamp = {Sat, 04 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/computers/AndresSanchezOSG24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dcg/KolesnikS24,
author = {Brett Kolesnik and
Mario Sanchez},
title = {The Geometry of Random Tournaments},
journal = {Discret. Comput. Geom.},
volume = {71},
number = {4},
pages = {1343--1351},
year = {2024},
url = {https://doi.org/10.1007/s00454-023-00571-4},
doi = {10.1007/S00454-023-00571-4},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dcg/KolesnikS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nn/VillaizanValleladoSCS24,
author = {Mario Villaiz{\'{a}}n{-}Vallelado and
Matteo Salvatori and
Bel{\'{e}}n Carro and
Antonio Javier S{\'{a}}nchez{-}Esguevillas},
title = {Graph Neural Network contextual embedding for Deep Learning on tabular
data},
journal = {Neural Networks},
volume = {173},
pages = {106180},
year = {2024},
url = {https://doi.org/10.1016/j.neunet.2024.106180},
doi = {10.1016/J.NEUNET.2024.106180},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nn/VillaizanValleladoSCS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/software/LorenzoLopezMJPHP24,
author = {Alvaro Lorenzo{-}Lopez and
Ashley Morris and
Owain Jones and
Alexander B. Phillips and
Mario Hern{\'{a}}ndez{-}Tejera and
Adrian Penate{-}Sanchez},
title = {Developing a Reconfigurable Architecture for the Remote Operation
of Marine Autonomous Systems},
journal = {{IEEE} Softw.},
volume = {41},
number = {4},
pages = {160--170},
year = {2024},
url = {https://doi.org/10.1109/MS.2023.3317065},
doi = {10.1109/MS.2023.3317065},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/software/LorenzoLopezMJPHP24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/EntrenaSGPGLS23,
author = {Luis Entrena and
Antonio J. Sanchez{-}Clemente and
Luis {\'{A}}ngel Garc{\'{\i}}a{-}Astudillo and
Marta Portela{-}Garc{\'{\i}}a and
Mario Garc{\'{\i}}a{-}Valderas and
Almudena Lindoso and
Roberto Sarmiento},
title = {Formal Verification of Fault-Tolerant Hardware Designs},
journal = {{IEEE} Access},
volume = {11},
pages = {116127--116140},
year = {2023},
url = {https://doi.org/10.1109/ACCESS.2023.3325616},
doi = {10.1109/ACCESS.2023.3325616},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/EntrenaSGPGLS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/OrtizTorresMSMR23,
author = {Gerardo Ortiz{-}Torres and
Jesse Yoe Rumbo Morales and
Ren{\'{e}} Osorio S{\'{a}}nchez and
Mario Mart{\'{\i}}nez{-}Garc{\'{\i}}a and
Marco Antonio Rodr{\'{\i}}guez{-}Blanco},
title = {Fault Tolerant Control via Input-Output Linearization Method for LED-Driver
Using a Boost Converter},
journal = {{IEEE} Access},
volume = {11},
pages = {10390--10397},
year = {2023},
url = {https://doi.org/10.1109/ACCESS.2023.3235348},
doi = {10.1109/ACCESS.2023.3235348},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/OrtizTorresMSMR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bspc/MadrugaCP23,
author = {Mario Madruga and
Yolanda Campos{-}Roca and
Carlos J. P{\'{e}}rez},
title = {Addressing smartphone mismatch in Parkinson's disease detection aid
systems based on speech},
journal = {Biomed. Signal Process. Control.},
volume = {80},
number = {Part},
pages = {104281},
year = {2023},
url = {https://doi.org/10.1016/j.bspc.2022.104281},
doi = {10.1016/J.BSPC.2022.104281},
timestamp = {Thu, 01 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bspc/MadrugaCP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/complexity/RoldanCaballeroPHSPRVMGM23,
author = {Alfredo Rold{\'{a}}n{-}Caballero and
Jose Humberto P{\'{e}}rez{-}Cruz and
Eduardo Hern{\'{a}}ndez{-}M{\'{a}}rquez and
Jos{\'{e}} Rafael Garc{\'{\i}}a S{\'{a}}nchez and
Mario Ponce{-}Silva and
Jos{\'{e}} de Jes{\'{u}}s Rubio and
Miguel Gabriel Villarreal{-}Cervantes and
Jes{\'{u}}s Mart{\'{\i}}nez{-}Mart{\'{\i}}nez and
Enrique Garc{\'{\i}}a{-}Trinidad and
Alejandro Mendoza{-}Chegue},
title = {Synchronization of a New Chaotic System Using Adaptive Control: Design
and Experimental Implementation},
journal = {Complex.},
volume = {2023},
pages = {2881192:1--2881192:22},
year = {2023},
url = {https://doi.org/10.1155/2023/2881192},
doi = {10.1155/2023/2881192},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/complexity/RoldanCaballeroPHSPRVMGM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/comsur/BeltranPSBBPPC23,
author = {Enrique Tom{\'{a}}s Mart{\'{\i}}nez Beltr{\'{a}}n and
Mario Quiles P{\'{e}}rez and
Pedro Miguel S{\'{a}}nchez S{\'{a}}nchez and
Sergio L{\'{o}}pez Bernal and
G{\'{e}}r{\^{o}}me Bovet and
Manuel Gil P{\'{e}}rez and
Gregorio Mart{\'{\i}}nez P{\'{e}}rez and
Alberto Huertas Celdr{\'{a}}n},
title = {Decentralized Federated Learning: Fundamentals, State of the Art,
Frameworks, Trends, and Challenges},
journal = {{IEEE} Commun. Surv. Tutorials},
volume = {25},
number = {4},
pages = {2983--3013},
year = {2023},
url = {https://doi.org/10.1109/COMST.2023.3315746},
doi = {10.1109/COMST.2023.3315746},
timestamp = {Sun, 17 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/comsur/BeltranPSBBPPC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/VillarFEMP23,
author = {Erika Yolanda Aguilar del Villar and
Mario Alberto S{\'{a}}nchez Flores and
Jes{\'{u}}s Jaime Moreno Escobar and
Oswaldo Morales Matamoros and
Ricardo Tejeida Padilla},
title = {Power Spectral Analysis of Bioacoustic Signals Emitted by a Bottlenose
Dolphin when Performing Assisted Therapy},
journal = {Computaci{\'{o}}n y Sistemas (CyS)},
volume = {27},
number = {1},
year = {2023},
url = {https://cys.cic.ipn.mx/ojs/index.php/CyS/article/view/4564},
timestamp = {Tue, 23 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cys/VillarFEMP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eait/RojasSanchezPF23,
author = {Mario A. Rojas{-}S{\'{a}}nchez and
Pedro R. Palos{-}Sanchez and
Jos{\'{e}} A. Folgado{-}Fern{\'{a}}ndez},
title = {Systematic literature review and bibliometric analysis on virtual
reality and education},
journal = {Educ. Inf. Technol.},
volume = {28},
number = {1},
pages = {155--192},
year = {2023},
url = {https://doi.org/10.1007/s10639-022-11167-5},
doi = {10.1007/S10639-022-11167-5},
timestamp = {Tue, 28 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eait/RojasSanchezPF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esi/CabreraQCSGSL23,
author = {Diego Cabrera and
Mar{\'{\i}}a J. Quinteros and
Mariela Cerrada and
Ren{\'{e}}{-}Vinicio S{\'{a}}nchez and
Mario Guallpa and
Fernando Sancho and
Chuan Li},
title = {Rainfall Forecasting using a Bayesian framework and Long Short-Term
Memory Multi-model Estimation based on an hourly meteorological monitoring
network. Case of study: Andean Ecuadorian Tropical City},
journal = {Earth Sci. Informatics},
volume = {16},
number = {2},
pages = {1373--1388},
year = {2023},
url = {https://doi.org/10.1007/s12145-023-00958-0},
doi = {10.1007/S12145-023-00958-0},
timestamp = {Tue, 30 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/esi/CabreraQCSGSL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/SanchezZasVVLMB23,
author = {Carmen S{\'{a}}nchez{-}Zas and
V{\'{\i}}ctor A. Villagr{\'{a}} and
Mario Vega{-}Barbas and
Xavier Larriva{-}Novo and
Jos{\'{e}} Ignacio Moreno and
Julio Berrocal},
title = {Ontology-based approach to real-time risk management and cyber-situational
awareness},
journal = {Future Gener. Comput. Syst.},
volume = {141},
pages = {462--472},
year = {2023},
url = {https://doi.org/10.1016/j.future.2022.12.006},
doi = {10.1016/J.FUTURE.2022.12.006},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/fgcs/SanchezZasVVLMB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcise/PenaCMCS23,
author = {Mario Pe{\~{n}}a and
Mariela Cerrada and
Rub{\'{e}}n Medina and
Diego Cabrera and
Ren{\'{e}}{-}Vinicio S{\'{a}}nchez},
title = {Poincar{\'{e}} Plot Features and Statistical Features From Current
and Vibration Signals for Fault Severity Classification of Helical
Gear Tooth Breaks},
journal = {J. Comput. Inf. Sci. Eng.},
volume = {23},
number = {2},
year = {2023},
url = {https://doi.org/10.1115/1.4054574},
doi = {10.1115/1.4054574},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcise/PenaCMCS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jirs/SanchezSanchezHGRFFF23,
author = {A. G. Sanchez{-}Sanchez and
Eduardo Gamaliel Hern{\'{a}}ndez{-}Mart{\'{\i}}nez and
Jaime Gonz{\'{a}}lez{-}Sierra and
Mario Ramirez{-}Neria and
Jos{\'{e}}{-}Job Flores{-}Godoy and
Enrique D. Ferreira and
Guillermo Fern{\'{a}}ndez{-}Anaya},
title = {Leader-Follower Power-based Formation Control Applied to Differential-drive
Mobile Robots},
journal = {J. Intell. Robotic Syst.},
volume = {107},
number = {1},
pages = {6},
year = {2023},
url = {https://doi.org/10.1007/s10846-022-01796-w},
doi = {10.1007/S10846-022-01796-W},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jirs/SanchezSanchezHGRFFF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kybernetes/BuitragoFlorezSRHH23,
author = {Francisco Buitrago{-}Florez and
Mario Sanchez and
Vanessa Perez Romanello and
Carola Hernandez and
Marcela Hern{\'{a}}ndez Hoyos},
title = {A systematic approach for curriculum redesign of introductory courses
in engineering: a programming course case study},
journal = {Kybernetes},
volume = {52},
number = {10},
pages = {3904--3917},
year = {2023},
url = {https://doi.org/10.1108/K-10-2021-0957},
doi = {10.1108/K-10-2021-0957},
timestamp = {Sat, 27 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/kybernetes/BuitragoFlorezSRHH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/OlivaONREMN23,
author = {Diego Oliva and
No{\'{e}} Ortega{-}S{\'{a}}nchez and
Mario A. Navarro and
Alfonso Ramos{-}Michel and
Mohammed El{-}Abd and
Seyed Jalaleddin Mousavirad and
Mohammad H. Nadimi{-}Shahraki},
title = {Segmentation of thermographies from electronic systems by using the
global-best brain storm optimization algorithm},
journal = {Multim. Tools Appl.},
volume = {82},
number = {29},
pages = {44911--44941},
year = {2023},
url = {https://doi.org/10.1007/s11042-023-15059-9},
doi = {10.1007/S11042-023-15059-9},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mta/OlivaONREMN23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/GirardRTAANPBABGOBPBSDSCBPFS23,
author = {Gabriel Girard and
Jonathan Rafael{-}Patino and
Rapha{\"{e}}l Truffet and
Dogu Baran Aydogan and
Nagesh Adluru and
Veena A. Nair and
Vivek Prabhakaran and
Barbara B. Bendlin and
Andrew L. Alexander and
Sara Bosticardo and
Ilaria Gabusi and
Mario Ocampo{-}Pineda and
Matteo Battocchio and
Zuzana Piskorova and
Pietro Bontempi and
Simona Schiavi and
Alessandro Daducci and
Aleksandra Stafiej and
Dominika Ciupek and
Fabian Bogusz and
Tomasz Pieciak and
Matteo Frigo and
Sara Sedlar and
Samuel Deslauriers{-}Gauthier and
Ivana Kojcic and
Mauro Zucchelli and
Hiba Laghrissi and
Yang Ji and
Rachid Deriche and
Kurt G. Schilling and
Bennett A. Landman and
Alberto Cacciola and
Gianpaolo Antonio Basile and
Salvatore Bertino and
Nancy Newlin and
Praitayini Kanakaraj and
Francois Rheault and
Patryk Filipiak and
Timothy M. Shepherd and
Ying{-}Chia Lin and
Dimitris G. Placantonakis and
Fernando E. Boada and
Steven H. Baete and
Erick Hernandez{-}Gutierrez and
Alonso Ramirez{-}Manzanares and
Ricardo Coronado{-}Leija and
Pablo Stack{-}S{\'{a}}nchez and
Luis Concha and
Maxime Descoteaux and
Sina Mansour L and
Caio Seguin and
Andrew Zalesky and
Kenji Marshall and
Erick Jorge Canales{-}Rodr{\'{\i}}guez and
Ye Wu and
Sahar Ahmad and
Pew{-}Thian Yap and
Antoine Th{\'{e}}berge and
Florence Gagnon and
Fr{\'{e}}d{\'{e}}ric Massi and
Elda Fischi Gomez and
Remy Gardier and
Juan Luis Villarreal{-}Haro and
Marco Pizzolato and
Emmanuel Caruyer and
Jean{-}Philippe Thiran},
title = {Tractography passes the test: Results from the diffusion-simulated
connectivity (disco) challenge},
journal = {NeuroImage},
volume = {277},
pages = {120231},
year = {2023},
url = {https://doi.org/10.1016/j.neuroimage.2023.120231},
doi = {10.1016/J.NEUROIMAGE.2023.120231},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/GirardRTAANPBABGOBPBSDSCBPFS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/HerreraCoyCHBCDSF23,
author = {Mar{\'{\i}}a Camila Herrera{-}Coy and
Laura Paola Calder{\'{o}}n and
Iv{\'{a}}n Leonardo Herrera{-}P{\'{e}}rez and
Paul Esteban Bravo{-}L{\'{o}}pez and
Christian Conoscenti and
Jorge Delgado and
Mario S{\'{a}}nchez{-}G{\'{o}}mez and
Tom{\'{a}}s Fern{\'{a}}ndez},
title = {Landslide Susceptibility Analysis on the Vicinity of Bogot{\'{a}}-Villavicencio
Road (Eastern Cordillera of the Colombian Andes)},
journal = {Remote. Sens.},
volume = {15},
number = {15},
pages = {3870},
year = {2023},
url = {https://doi.org/10.3390/rs15153870},
doi = {10.3390/RS15153870},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/HerreraCoyCHBCDSF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/Fernandez-Gorgojo23,
author = {Mario Fern{\'{a}}ndez{-}Gorgojo and
Diana Salas{-}G{\'{o}}mez and
Pascual S{\'{a}}nchez{-}Juan and
Esther Laguna{-}Bercero and
Mar{\'{\i}}a Isabel P{\'{e}}rez{-}N{\'{u}}{\~{n}}ez},
title = {Analysis of Dynamic Plantar Pressure and Influence of Clinical-Functional
Measures on Their Performance in Subjects with Bimalleolar Ankle Fracture
at 6 and 12 Months Post-Surgery},
journal = {Sensors},
volume = {23},
number = {8},
pages = {3975},
year = {2023},
url = {https://doi.org/10.3390/s23083975},
doi = {10.3390/S23083975},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/Fernandez-Gorgojo23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/GraciaOCISDA23,
author = {Desir{\'{e}}e I. Gracia and
Mario Ort{\'{\i}}z and
Tatiana Candela and
Eduardo I{\'{a}}{\~{n}}ez and
Rosa M. S{\'{a}}nchez and
Carmina D{\'{\i}}az and
Jos{\'{e}} Mar{\'{\i}}a Azor{\'{\i}}n},
title = {Design and Evaluation of a Potential Non-Invasive Neurostimulation
Strategy for Treating Persistent Anosmia in Post-COVID-19 Patients},
journal = {Sensors},
volume = {23},
number = {13},
pages = {5880},
year = {2023},
url = {https://doi.org/10.3390/s23135880},
doi = {10.3390/S23135880},
timestamp = {Thu, 31 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/GraciaOCISDA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/MartinezAPMBABL23,
author = {Raquel Martinez and
Alberto Arroyo and
Alberto Pigazo and
Mario Manana and
Eduardo Bayona and
Francisco J. Azcondo and
Sergio Bustamante and
Alberto Laso},
title = {Acoustic Noise-Based Detection of Ferroresonance Events in Isolated
Neutral Power Systems with Inductive Voltage Transformers},
journal = {Sensors},
volume = {23},
number = {1},
pages = {195},
year = {2023},
url = {https://doi.org/10.3390/s23010195},
doi = {10.3390/S23010195},
timestamp = {Thu, 26 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/MartinezAPMBABL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/Sanchez-Fernandez23,
author = {Luis Pastor S{\'{a}}nchez{-}Fern{\'{a}}ndez and
Luis Alejandro S{\'{a}}nchez{-}P{\'{e}}rez and
Jos{\'{e}} Juan Carbajal Hern{\'{a}}ndez and
Mario Alberto Hern{\'{a}}ndez{-}Guerrero and
Lucrecia P{\'{e}}rez{-}Echazabal},
title = {Buildings' Biaxial Tilt Assessment Using Inertial Wireless Sensors
and a Parallel Training Model},
journal = {Sensors},
volume = {23},
number = {11},
pages = {5352},
year = {2023},
url = {https://doi.org/10.3390/s23115352},
doi = {10.3390/S23115352},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/Sanchez-Fernandez23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clihc/Sanchez-RinzaSL23,
author = {B{\'{a}}rbara Emma S{\'{a}}nchez{-}Rinza and
Carlos Ignacio Robledo S{\'{a}}nchez and
Mario Rossainz L{\'{o}}pez},
title = {Usability in a Mixed Cryptography and Hardware Security System},
booktitle = {Proceedings of the {XI} Latin American Conference on Human Computer
Interaction, {CLIHC} 2023, Puebla, Mexico, 30 October 2023- 1 November
2023},
pages = {10:1--10:5},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3630970.3631051},
doi = {10.1145/3630970.3631051},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/clihc/Sanchez-RinzaSL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/VelandiaHBSV23,
author = {Paula Velandia and
Andrea Herrera and
L. Mar{\'{\i}}a Jos{\'{e}} Bonilla and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Tiago Prince Sales and
Sybren de Kinderen and
Henderik A. Proper and
Luise Pufahl and
Dimka Karastoyanova and
Marten van Sinderen},
title = {Driving Innovation in Industry 4.0 Through Business Model Simulation},
booktitle = {Enterprise Design, Operations, and Computing. {EDOC} 2023 Workshops
- IDAMS, iRESEARCH, MIDas4CS, SoEA4EE, {EDOC} Forum, Demonstrations
Track and Doctoral Consortium, Groningen, The Netherlands, October
30 - November 3, 2023, Revised Selected Papers},
series = {Lecture Notes in Business Information Processing},
volume = {498},
pages = {23--38},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-54712-6\_2},
doi = {10.1007/978-3-031-54712-6\_2},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/edoc/VelandiaHBSV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icaisc/SanchezMQ23,
author = {Sergio Sanchez and
Javier Machacuay and
Mario Quinde},
editor = {Leszek Rutkowski and
Rafal Scherer and
Marcin Korytkowski and
Witold Pedrycz and
Ryszard Tadeusiewicz and
Jacek M. Zurada},
title = {Federated Learning for Human Activity Recognition on the MHealth Dataset},
booktitle = {Artificial Intelligence and Soft Computing - 22nd International Conference,
{ICAISC} 2023, Zakopane, Poland, June 18-22, 2023, Proceedings, Part
{I}},
series = {Lecture Notes in Computer Science},
volume = {14125},
pages = {215--225},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-42505-9\_19},
doi = {10.1007/978-3-031-42505-9\_19},
timestamp = {Sun, 24 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icaisc/SanchezMQ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/BravoMPRM23,
author = {J. Juan Avil{\'{e}}s Bravo and
Alfredo Morales{-}S{\'{a}}nchez and
Liliana Palacios{-}Huerta and
J. Federico Ramirez Rios and
Mario Moreno},
title = {Improved Photoluminescence Intensity of Silicon Rich Oxide Film by
Surface Etching},
booktitle = {20th International Conference on Electrical Engineering, Computing
Science and Automatic Control, {CCE} 2023, Mexico City, Mexico, October
25-27, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CCE60043.2023.10332833},
doi = {10.1109/CCE60043.2023.10332833},
timestamp = {Wed, 03 Jan 2024 08:34:23 +0100},
biburl = {https://dblp.org/rec/conf/iceee/BravoMPRM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/CazcarraBesBLDDSC23,
author = {Victor Cazcarra{-}Bes and
Mario Busquier and
Juan M. Lopez{-}Sanchez and
Michael Duersch and
Shaunak De and
Craig Stringham and
Davide Castelleti},
title = {Assessment of Multi-Temporal Capella {SAR} Data for Change Detection
and Crop Monitoring},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2023, Pasadena, CA, USA, July 16-21, 2023},
pages = {3410--3413},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IGARSS52108.2023.10281689},
doi = {10.1109/IGARSS52108.2023.10281689},
timestamp = {Tue, 07 Nov 2023 16:21:25 +0100},
biburl = {https://dblp.org/rec/conf/igarss/CazcarraBesBLDDSC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/VillarroyaCarpioBLE23,
author = {Arturo Villarroya{-}Carpio and
Mario Busquier and
Juan M. Lopez{-}Sanchez and
Marcus E. Engdahl},
title = {{C-} and X-Band Repeat-Pass Coherence for Crop-Type Mapping and Monitoring},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2023, Pasadena, CA, USA, July 16-21, 2023},
pages = {425--428},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IGARSS52108.2023.10281890},
doi = {10.1109/IGARSS52108.2023.10281890},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/VillarroyaCarpioBLE23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vts/AhmadilivaniBBBDTGJRRST23,
author = {Mohammad Hasan Ahmadilivani and
Mario Barbareschi and
Salvatore Barone and
Alberto Bosio and
Masoud Daneshtalab and
Salvatore Della Torca and
Gabriele Gavarini and
Maksim Jenihhin and
Jaan Raik and
Annachiara Ruospo and
Ernesto S{\'{a}}nchez and
Mahdi Taheri},
title = {Special Session: Approximation and Fault Resiliency of {DNN} Accelerators},
booktitle = {41st {IEEE} {VLSI} Test Symposium, {VTS} 2023, San Diego, CA, USA,
April 24-26, 2023},
pages = {1--10},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/VTS56346.2023.10140043},
doi = {10.1109/VTS56346.2023.10140043},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vts/AhmadilivaniBBBDTGJRRST23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/23/SavaglioSFACMRRB23,
author = {Claudio Savaglio and
Giandomenico Spezzano and
Giancarlo Fortino and
Mario Alejandro Paguay Alvarado and
Fabio Capparelli and
Gianmarco Marcello and
Luigi Rachiele and
Francesco Raco and
Samantha Genoveva Sanchez Basantes},
editor = {Franco Cicirelli and
Antonio Guerrieri and
Andrea Vinci and
Giandomenico Spezzano},
title = {Edge Intelligence Against {COVID-19:} {A} Smart University Campus
Case Study},
booktitle = {IoT Edge Solutions for Cognitive Buildings - Technology, Communications
and Computing},
pages = {221--243},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-15160-6\_10},
doi = {10.1007/978-3-031-15160-6\_10},
timestamp = {Sun, 25 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/sp/23/SavaglioSFACMRRB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2303-06455,
author = {Mario Villaiz{\'{a}}n{-}Vallelado and
Matteo Salvatori and
Bel{\'{e}}n Carro Mart{\'{\i}}nez and
Antonio Javier S{\'{a}}nchez{-}Esguevillas},
title = {Graph Neural Network contextual embedding for Deep Learning on Tabular
Data},
journal = {CoRR},
volume = {abs/2303.06455},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2303.06455},
doi = {10.48550/ARXIV.2303.06455},
eprinttype = {arXiv},
eprint = {2303.06455},
timestamp = {Thu, 16 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2303-06455.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-04645,
author = {Mohammad Hasan Ahmadilivani and
Mario Barbareschi and
Salvatore Barone and
Alberto Bosio and
Masoud Daneshtalab and
Salvatore Della Torca and
Gabriele Gavarini and
Maksim Jenihhin and
Jaan Raik and
Annachiara Ruospo and
Ernesto S{\'{a}}nchez and
Mahdi Taheri},
title = {Special Session: Approximation and Fault Resiliency of {DNN} Accelerators},
journal = {CoRR},
volume = {abs/2306.04645},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.04645},
doi = {10.48550/ARXIV.2306.04645},
eprinttype = {arXiv},
eprint = {2306.04645},
timestamp = {Wed, 14 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-04645.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Calderon-Ramirez22,
author = {Mario Calder{\'{o}}n{-}Ram{\'{\i}}rez and
Jes{\'{u}}s A. G{\'{o}}mez{-}N{\'{a}}fate and
Ramiro Rico{-}Mart{\'{\i}}nez and
Ram{\'{o}}n Rodr{\'{\i}}guez{-}Castro and
Micael{-}G. Bravo{-}S{\'{a}}nchez and
Luis A. Alcaraz{-}Caracheo},
title = {Improvement of Ohmic Pasteurization in Mango Pulp Through {CFD} and
{RSM}},
journal = {{IEEE} Access},
volume = {10},
pages = {81380--81389},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3193391},
doi = {10.1109/ACCESS.2022.3193391},
timestamp = {Thu, 25 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/Calderon-Ramirez22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Garza-FabreSAB22,
author = {Mario Garza{-}Fabre and
Aar{\'{o}}n Leonardo S{\'{a}}nchez{-}Mart{\'{\i}}nez and
Edwin Aldana{-}Bobadilla and
Ricardo Landa Becerra},
title = {Decision Making in Evolutionary Multiobjective Clustering: {A} Machine
Learning Challenge},
journal = {{IEEE} Access},
volume = {10},
pages = {117281--117303},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3219854},
doi = {10.1109/ACCESS.2022.3219854},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/Garza-FabreSAB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Maya-RodriguezL22,
author = {Mario C. Maya{-}Rodriguez and
Mario A. L{\'{o}}pez{-}Pacheco and
Yair Lozano{-}Hern{\'{a}}ndez and
Victor G. S{\'{a}}nchez{-}Meza and
Luis A. Cantera Cantera and
Ren{\'{e}} Tolentino{-}Eslava},
title = {Integration of {CNN} in a Dynamic Model-Based Controller for Control
of a 2DOF Helicopter With Tail Rotor Perturbations},
journal = {{IEEE} Access},
volume = {10},
pages = {73474--73483},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3189353},
doi = {10.1109/ACCESS.2022.3189353},
timestamp = {Thu, 25 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/Maya-RodriguezL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/SanchezAMCO22,
author = {Daniel Jim{\'{e}}nez S{\'{a}}nchez and
Mikel Ariz and
Jos{\'{e}} M{\'{a}}rio Morgado and
Iv{\'{a}}n Cort{\'{e}}s{-}Dom{\'{\i}}nguez and
Carlos Ortiz{-}de{-}Sol{\'{o}}rzano},
title = {Corrigendum to: {NMF-RI:} blind spectral unmixing of highly mixed
multispectral flow and image cytometry data},
journal = {Bioinform.},
volume = {38},
number = {6},
pages = {1779},
year = {2022},
url = {https://doi.org/10.1093/bioinformatics/btab796},
doi = {10.1093/BIOINFORMATICS/BTAB796},
timestamp = {Tue, 22 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/SanchezAMCO22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/GalvezGGA22,
author = {Alba Maribel S{\'{a}}nchez G{\'{a}}lvez and
Ricardo {\'{A}}lvarez{-}Gonz{\'{a}}lez and
Sully S{\'{a}}nchez G{\'{a}}lvez and
Mario Anzures{-}Garc{\'{\i}}a},
title = {Model to Predict the Result of a Soccer Match Based on the Number
of Goals Scored by a Single Team},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {26},
number = {1},
year = {2022},
url = {https://doi.org/10.13053/cys-26-1-4172},
doi = {10.13053/CYS-26-1-4172},
timestamp = {Fri, 09 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cys/GalvezGGA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ec/SanchezG22,
author = {Claudia N. S{\'{a}}nchez and
Mario Graff},
title = {Selection Heuristics on Semantic Genetic Programming for Classification
Problems},
journal = {Evol. Comput.},
volume = {30},
number = {2},
pages = {253--289},
year = {2022},
url = {https://doi.org/10.1162/evco\_a\_00297},
doi = {10.1162/EVCO\_A\_00297},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ec/SanchezG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esi/Gonzalez-Herrera22,
author = {Roger Gonzalez{-}Herrera and
Mario Cortazar{-}Cepeda and
Ismael S{\'{a}}nchez{-}Pinto and
Javier Canto{-}Rios},
title = {A homogeneous approach in modeling a coastal karst aquifer},
journal = {Earth Sci. Informatics},
volume = {15},
number = {3},
pages = {1825--1840},
year = {2022},
url = {https://doi.org/10.1007/s12145-022-00841-4},
doi = {10.1007/S12145-022-00841-4},
timestamp = {Sat, 10 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/esi/Gonzalez-Herrera22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/GomezCSCV22,
author = {Manuel J. Gomez and
Mario Calder{\'{o}}n and
Victor S{\'{a}}nchez and
F{\'{e}}lix J. Garc{\'{\i}}a Clemente and
Jos{\'{e}} A. Ruip{\'{e}}rez{-}Valiente},
title = {Large scale analysis of open {MOOC} reviews to support learners' course
selection},
journal = {Expert Syst. Appl.},
volume = {210},
pages = {118400},
year = {2022},
url = {https://doi.org/10.1016/j.eswa.2022.118400},
doi = {10.1016/J.ESWA.2022.118400},
timestamp = {Mon, 27 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eswa/GomezCSCV22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/DivanRG22,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso and
Silvio Miguel Gonnet},
title = {Measurement project interoperability for real-time data gathering
systems},
journal = {Future Gener. Comput. Syst.},
volume = {129},
pages = {298--314},
year = {2022},
url = {https://doi.org/10.1016/j.future.2021.11.031},
doi = {10.1016/J.FUTURE.2021.11.031},
timestamp = {Wed, 23 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/fgcs/DivanRG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieee-rita/JiSPNJ22,
author = {Yi Peng Ji and
Ra{\'{u}}l Marticorena S{\'{a}}nchez and
Carlos Pardo{-}Aguilar and
Carlos L{\'{o}}pez Nozal and
Mario Juez{-}Gil},
title = {Activity and Dropout Tracking in Moodle Using UBUMonitor Application},
journal = {Rev. Iberoam. de Tecnol. del Aprendiz.},
volume = {17},
number = {3},
pages = {307--317},
year = {2022},
url = {https://doi.org/10.1109/RITA.2022.3191279},
doi = {10.1109/RITA.2022.3191279},
timestamp = {Thu, 22 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieee-rita/JiSPNJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/infsof/CrespoNSTP22,
author = {Yania Crespo and
Carlos L{\'{o}}pez Nozal and
Ra{\'{u}}l Marticorena S{\'{a}}nchez and
Margarita Gonzalo Tasis and
Mario Piattini},
title = {The role of awareness and gamification on technical debt management},
journal = {Inf. Softw. Technol.},
volume = {150},
pages = {106946},
year = {2022},
url = {https://doi.org/10.1016/j.infsof.2022.106946},
doi = {10.1016/J.INFSOF.2022.106946},
timestamp = {Sat, 10 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/infsof/CrespoNSTP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/js/Mendez-MonroyMT22,
author = {Paul E. Mendez{-}Monroy and
E. Cruz May and
Mario Jim{\'{e}}nez Torres and
J. L. G{\'{o}}mez Hern{\'{a}}ndez and
M. Canto Romero and
Israel Sanchez Dominguez and
Oscar May{-}Tzuc and
Ali Bassam},
title = {IoT System for the Continuous Electrical and Environmental Monitoring
into Mexican Social Housing Evaluated under Tropical Climate Conditions},
journal = {J. Sensors},
volume = {2022},
pages = {1--20},
year = {2022},
url = {https://doi.org/10.1155/2022/5508713},
doi = {10.1155/2022/5508713},
timestamp = {Mon, 23 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/js/Mendez-MonroyMT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lgrs/Romero-PuigLB22,
author = {Noelia Romero{-}Puig and
Juan M. Lopez{-}Sanchez and
Mario Busquier},
title = {Evaluation of PolInSAR Observables for Crop-Type Mapping Using Bistatic
TanDEM-X Data},
journal = {{IEEE} Geosci. Remote. Sens. Lett.},
volume = {19},
pages = {1--5},
year = {2022},
url = {https://doi.org/10.1109/LGRS.2022.3175689},
doi = {10.1109/LGRS.2022.3175689},
timestamp = {Mon, 13 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/lgrs/Romero-PuigLB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/BiffiSDHSAABCDF22,
author = {Carlo Biffi and
Pietro Salvagnini and
Nhan Ngo Dinh and
Cesare Hassan and
Prateek Sharma and
Giulio Antonelli and
Halim Awadie and
Sebastian Bernhofer and
Sabela Carballal and
M{\'{a}}rio Dinis{-}Ribeiro and
Agn{\`{e}}s Fern{\'{a}}ndez{-}Clotet and
Gloria Fern{\'{a}}ndez{-}Esparrach and
Ian Gralnek and
Yuta Higasa and
Taku Hirabayashi and
Tatsuki Hirai and
Mineo Iwatate and
Miki Kawano and
Markus Mader and
Andreas Maieron and
Sebastian Mattes and
Tastuya Nakai and
Ingrid Ordas and
Raquel Ortig{\~{a}}o and
Oswaldo Ortiz Z{\'{u}}{\~{n}}iga and
Maria Pellis{\'{e}} and
Cl{\'{a}}udia Pinto and
Florian Riedl and
Ariadna S{\'{a}}nchez and
Emanuel Steiner and
Yukari Tanaka and
Andrea Cherubini},
title = {A novel {AI} device for real-time optical characterization of colorectal
polyps},
journal = {npj Digit. Medicine},
volume = {5},
year = {2022},
url = {https://doi.org/10.1038/s41746-022-00633-6},
doi = {10.1038/S41746-022-00633-6},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/BiffiSDHSAABCDF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/BiffiSDHSAABCDF22a,
author = {Carlo Biffi and
Pietro Salvagnini and
Nhan Ngo Dinh and
Cesare Hassan and
Prateek Sharma and
Giulio Antonelli and
Halim Awadie and
Sebastian Bernhofer and
Sabela Carballal and
M{\'{a}}rio Dinis{-}Ribeiro and
Agn{\`{e}}s Fern{\'{a}}ndez{-}Clotet and
Gloria Fern{\'{a}}ndez{-}Esparrach and
Ian Gralnek and
Yuta Higasa and
Taku Hirabayashi and
Tatsuki Hirai and
Mineo Iwatate and
Miki Kawano and
Markus Mader and
Andreas Maieron and
Sebastian Mattes and
Tastuya Nakai and
Ingrid Ordas and
Raquel Ortig{\~{a}}o and
Oswaldo Ortiz Z{\'{u}}{\~{n}}iga and
Maria Pellis{\'{e}} and
Cl{\'{a}}udia Pinto and
Florian Riedl and
Ariadna S{\'{a}}nchez and
Emanuel Steiner and
Yukari Tanaka and
Andrea Cherubini},
title = {Author Correction: {A} novel {AI} device for real-time optical characterization
of colorectal polyps},
journal = {npj Digit. Medicine},
volume = {5},
year = {2022},
url = {https://doi.org/10.1038/s41746-022-00669-8},
doi = {10.1038/S41746-022-00669-8},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/BiffiSDHSAABCDF22a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/Rio-BarralSGA22,
author = {Pablo del R{\'{\i}}o{-}Barral and
Mario Soil{\'{a}}n and
Silvia Mar{\'{\i}}a Gonz{\'{a}}lez{-}Collazo and
Pedro Arias},
title = {Pavement Crack Detection and Clustering via Region-Growing Algorithm
from 3D {MLS} Point Clouds},
journal = {Remote. Sens.},
volume = {14},
number = {22},
pages = {5866},
year = {2022},
url = {https://doi.org/10.3390/rs14225866},
doi = {10.3390/RS14225866},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/remotesensing/Rio-BarralSGA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/Almanza-OjedaRC22,
author = {Dora Luz Almanza{-}Ojeda and
Daniela Rodriguez{-}Sotelo and
Rogelio Castro{-}Sanchez and
Rene Martinez{-}Celorio and
Mario Alberto Ibarra{-}Manzano},
title = {Stokes Dynamic Polarimeter for Non-Organic and Organic Samples Characterization},
journal = {Sensors},
volume = {22},
number = {6},
pages = {2155},
year = {2022},
url = {https://doi.org/10.3390/s22062155},
doi = {10.3390/S22062155},
timestamp = {Wed, 18 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/Almanza-OjedaRC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/Contreras-Hernandez22,
author = {Jose L. Contreras{-}Hernandez and
Dora Luz Almanza{-}Ojeda and
Sergio Ledesma and
Arturo Garcia{-}Perez and
Rogelio Castro{-}Sanchez and
Miguel A. Gomez{-}Martinez and
Mario Alberto Ibarra{-}Manzano},
title = {Geometric Analysis of Signals for Inference of Multiple Faults in
Induction Motors},
journal = {Sensors},
volume = {22},
number = {7},
pages = {2622},
year = {2022},
url = {https://doi.org/10.3390/s22072622},
doi = {10.3390/S22072622},
timestamp = {Wed, 18 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/Contreras-Hernandez22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/Fernandez-Gorgojo22,
author = {Mario Fern{\'{a}}ndez{-}Gorgojo and
Diana Salas{-}G{\'{o}}mez and
Pascual S{\'{a}}nchez{-}Juan and
David Barbado and
Esther Laguna{-}Bercero and
Mar{\'{\i}}a Isabel P{\'{e}}rez{-}N{\'{u}}{\~{n}}ez},
title = {Clinical-Functional Evaluation and Test-Retest Reliability of the
{G-WALK} Sensor in Subjects with Bimalleolar Ankle Fractures 6 Months
after Surgery},
journal = {Sensors},
volume = {22},
number = {8},
pages = {3050},
year = {2022},
url = {https://doi.org/10.3390/s22083050},
doi = {10.3390/S22083050},
timestamp = {Thu, 02 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/Fernandez-Gorgojo22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/BusquierLTF22,
author = {Mario Busquier and
Juan M. Lopez{-}Sanchez and
Francesca Ticconi and
Nicolas Floury},
title = {Combination of Time Series of L-, C-, and X-Band {SAR} Images for
Land Cover and Crop Classification},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {15},
pages = {8266--8286},
year = {2022},
url = {https://doi.org/10.1109/JSTARS.2022.3207574},
doi = {10.1109/JSTARS.2022.3207574},
timestamp = {Tue, 18 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/BusquierLTF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/SaldanhaSMA22,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Configurable Fast Block Partitioning for {VVC} Intra Coding Using
Light Gradient Boosting Machine},
journal = {{IEEE} Trans. Circuits Syst. Video Technol.},
volume = {32},
number = {6},
pages = {3947--3960},
year = {2022},
url = {https://doi.org/10.1109/TCSVT.2021.3108671},
doi = {10.1109/TCSVT.2021.3108671},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcsv/SaldanhaSMA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/Vilchez-Membrilla22,
author = {Jos{\'{e}} Antonio Vilchez{-}Membrilla and
Ignacio Mateos and
{\'{A}}ngel Quir{\'{o}}s{-}Oloz{\'{a}}bal and
Mario Fern{\'{a}}ndez Pantoja and
Clemente Cobos S{\'{a}}nchez},
title = {{PCB} Transducer Coil Design for a Low-Noise Magnetic Measurement
System in Space Missions},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {71},
pages = {1--9},
year = {2022},
url = {https://doi.org/10.1109/TIM.2022.3217843},
doi = {10.1109/TIM.2022.3217843},
timestamp = {Tue, 08 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tim/Vilchez-Membrilla22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnsm/RaghuramuCSSKCL22,
author = {Arun Raghuramu and
Lianjie Cao and
Puneet Sharma and
Mario S{\'{a}}nchez and
Joon{-}Myung Kang and
Chen{-}Nee Chuah and
David Lee and
Vinay Saxena},
title = {Metered Boot: Trusted Framework for Application Usage Rights Management
in Virtualized Ecosystems},
journal = {{IEEE} Trans. Netw. Serv. Manag.},
volume = {19},
number = {3},
pages = {2238--2250},
year = {2022},
url = {https://doi.org/10.1109/TNSM.2022.3159191},
doi = {10.1109/TNSM.2022.3159191},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tnsm/RaghuramuCSSKCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/Vilchez-Membrilla22,
author = {Jos{\'{e}} Antonio Vilchez{-}Membrilla and
Clemente Cobos S{\'{a}}nchez and
Carmen Torres Montijano and
Ana Pilar Valerga Puerta and
Mario Fern{\'{a}}ndez Pantoja},
title = {Design of Optimal Coils for Deep Transcranial Magnetic Stimulation},
booktitle = {44th Annual International Conference of the {IEEE} Engineering in
Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland,
United Kingdom, July 11-15, 2022},
pages = {3447--3450},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/EMBC48229.2022.9871354},
doi = {10.1109/EMBC48229.2022.9871354},
timestamp = {Tue, 08 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/Vilchez-Membrilla22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/SaldanhaSMA22,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Fast Transform Decision Scheme for {VVC} Intra-Frame Prediction Using
Decision Trees},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2022,
Austin, TX, USA, May 27 - June 1, 2022},
pages = {1948--1952},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISCAS48785.2022.9938000},
doi = {10.1109/ISCAS48785.2022.9938000},
timestamp = {Thu, 17 Nov 2022 15:59:17 +0100},
biburl = {https://dblp.org/rec/conf/iscas/SaldanhaSMA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micai/Sanchez-Martinez22,
author = {Aar{\'{o}}n Leonardo S{\'{a}}nchez{-}Mart{\'{\i}}nez and
Mario Garza{-}Fabre and
Ricardo Landa Becerra and
Edwin Aldana{-}Bobadilla},
editor = {Obdulia Pichardo{-}Lagunas and
Juan Mart{\'{\i}}nez{-}Miranda and
Bella Mart{\'{\i}}nez{-}Seis},
title = {Machine Learning-Based Decision Making in Evolutionary Multiobjective
Clustering},
booktitle = {Advances in Computational Intelligence - 21st Mexican International
Conference on Artificial Intelligence, {MICAI} 2022, Monterrey, Mexico,
October 24-29, 2022, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {13612},
pages = {123--137},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-19493-1\_10},
doi = {10.1007/978-3-031-19493-1\_10},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/micai/Sanchez-Martinez22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/riiforum/SanchezGMG22,
author = {Mar{\'{\i}}a de los {\'{A}}ngeles T{\'{a}}rraga S{\'{a}}nchez and
Mar{\'{\i}}a del Mar Ballesteros Garc{\'{\i}}a and
H{\'{e}}ctor Migall{\'{o}}n and
Otoniel L{\'{o}}pez Granado},
editor = {Anna Visvizi and
Orlando Troisi and
Mara Grimaldi},
title = {Reinforcement Learning Through Gamification and Open Online Resources
in Elementary School},
booktitle = {Research and Innovation Forum 2022: Rupture, Resilience and Recovery
in the Post-Covid World, {RIIFORUM} 2022, Athens, Greece, April 20-22,
2022},
series = {Springer Proceedings in Complexity},
pages = {455--463},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-19560-0\_37},
doi = {10.1007/978-3-031-19560-0\_37},
timestamp = {Fri, 21 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/riiforum/SanchezGMG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/AhujaDPSGSYNRSZ22,
author = {Satyajeet Singh Ahuja and
Vinayak Dangui and
Kirtesh Patil and
Manikandan Somasundaram and
Varun Gupta and
Mario A. S{\'{a}}nchez and
Guanqing Yan and
Max Noormohammadpour and
Alaleh Razmjoo and
Grace Smith and
Hao Zhong and
Abhinav Triguna and
Soshant Bali and
Yuxiang Xiang and
Yilun Chen and
Prabhakaran Ganesan and
Mikel Jimenez Fernandez and
Petr Lapukhov and
Guyue Liu and
Ying Zhang},
editor = {Fernando Kuipers and
Ariel Orda},
title = {Network entitlement: contract-based network sharing with agility and
{SLO} guarantees},
booktitle = {{SIGCOMM} '22: {ACM} {SIGCOMM} 2022 Conference, Amsterdam, The Netherlands,
August 22 - 26, 2022},
pages = {250--263},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3544216.3544245},
doi = {10.1145/3544216.3544245},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigcomm/AhujaDPSGSYNRSZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sepln/2022iberlef,
editor = {Manuel Montes{-}y{-}G{\'{o}}mez and
Julio Gonzalo and
Francisco Rangel and
Marco Casavantes and
Miguel {\'{A}}ngel {\'{A}}lvare Carmona and
Gemma Bel{-}Enguix and
Hugo Jair Escalante and
Larissa A. de Freitas and
Antonio Miranda{-}Escalada and
Francisco J. Rodr{\'{\i}}guez{-}Sanchez and
Aiala Ros{\'{a}} and
Marco Antonio Sobrevilla Cabezudo and
Mariona Taul{\'{e}} and
Rafael Valencia{-}Garc{\'{\i}}a},
title = {Proceedings of the Iberian Languages Evaluation Forum (IberLEF 2022)
co-located with the Conference of the Spanish Society for Natural
Language Processing {(SEPLN} 2022), {A} Coru{\~{n}}a, Spain, September
20, 2022},
series = {{CEUR} Workshop Proceedings},
volume = {3202},
publisher = {CEUR-WS.org},
year = {2022},
url = {https://ceur-ws.org/Vol-3202},
urn = {urn:nbn:de:0074-3202-9},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sepln/2022iberlef.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-06967,
author = {Manuel J. Gomez and
Mario Calder{\'{o}}n and
Victor S{\'{a}}nchez and
F{\'{e}}lix J. Garc{\'{\i}}a Clemente and
Jos{\'{e}} A. Ruip{\'{e}}rez{-}Valiente},
title = {Large Scale Analysis of Open {MOOC} Reviews to Support Learners' Course
Selection},
journal = {CoRR},
volume = {abs/2201.06967},
year = {2022},
url = {https://arxiv.org/abs/2201.06967},
eprinttype = {arXiv},
eprint = {2201.06967},
timestamp = {Mon, 27 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2201-06967.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-08413,
author = {Enrique Tom{\'{a}}s Mart{\'{\i}}nez Beltr{\'{a}}n and
Mario Quiles P{\'{e}}rez and
Pedro Miguel S{\'{a}}nchez S{\'{a}}nchez and
Sergio L{\'{o}}pez Bernal and
G{\'{e}}r{\^{o}}me Bovet and
Manuel Gil P{\'{e}}rez and
Gregorio Mart{\'{\i}}nez P{\'{e}}rez and
Alberto Huertas Celdr{\'{a}}n},
title = {Decentralized Federated Learning: Fundamentals, State-of-the-art,
Frameworks, Trends, and Challenges},
journal = {CoRR},
volume = {abs/2211.08413},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.08413},
doi = {10.48550/ARXIV.2211.08413},
eprinttype = {arXiv},
eprint = {2211.08413},
timestamp = {Wed, 23 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-08413.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/MadrugaCP21,
author = {Mario Madruga and
Yolanda Campos{-}Roca and
C. J. P{\'{e}}rez},
title = {Multicondition Training for Noise-Robust Detection of Benign Vocal
Fold Lesions From Recorded Speech},
journal = {{IEEE} Access},
volume = {9},
pages = {1707--1722},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2020.3046873},
doi = {10.1109/ACCESS.2020.3046873},
timestamp = {Mon, 25 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/MadrugaCP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SanchezCOA21,
author = {Melissa S{\'{a}}nchez and
Jorge M. Cruz{-}Duarte and
Jos{\'{e}} Carlos Ortiz{-}Bayliss and
Iv{\'{a}}n Amaya},
title = {Sequence-Based Selection Hyper-Heuristic Model via MAP-Elites},
journal = {{IEEE} Access},
volume = {9},
pages = {116500--116527},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3106815},
doi = {10.1109/ACCESS.2021.3106815},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/SanchezCOA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SanchezPANL21,
author = {H{\'{e}}ctor Corrales S{\'{a}}nchez and
Noelia Hern{\'{a}}ndez Parra and
Ignacio Parra Alonso and
Eduardo M. Nebot and
David Fern{\'{a}}ndez Llorca},
title = {Are We Ready for Accurate and Unbiased Fine-Grained Vehicle Classification
in Realistic Environments?},
journal = {{IEEE} Access},
volume = {9},
pages = {116338--116355},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3104340},
doi = {10.1109/ACCESS.2021.3104340},
timestamp = {Fri, 21 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/SanchezPANL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/artmed/NaranjoPCM21,
author = {Lizbeth Naranjo and
Carlos J. P{\'{e}}rez and
Yolanda Campos{-}Roca and
Mario Madruga},
title = {Replication-based regularization approaches to diagnose Reinke's edema
by using voice recordings},
journal = {Artif. Intell. Medicine},
volume = {120},
pages = {102162},
year = {2021},
url = {https://doi.org/10.1016/j.artmed.2021.102162},
doi = {10.1016/J.ARTMED.2021.102162},
timestamp = {Thu, 01 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/artmed/NaranjoPCM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bdr/LealCCGGDSSKGXL21,
author = {F{\'{a}}tima Leal and
Adriana E. Chis and
Simon Caton and
Horacio Gonz{\'{a}}lez{-}V{\'{e}}lez and
Juan M. Garc{\'{\i}}a{-}G{\'{o}}mez and
Marta Dur{\'{a}} and
Angel S{\'{a}}nchez{-}Garc{\'{\i}}a and
Carlos S{\'{a}}ez and
Anthony Karageorgos and
Vassilis C. Gerogiannis and
Apostolos Xenakis and
Efthymios N. Lallas and
Theodoros Ntounas and
Eleni Vasileiou and
Georgios Mountzouris and
Barbara Otti and
Penelope Pucci and
Rossano Papini and
David Cerrai and
Mariola Mier},
title = {Smart Pharmaceutical Manufacturing: Ensuring End-to-End Traceability
and Data Integrity in Medicine Production},
journal = {Big Data Res.},
volume = {24},
pages = {100172},
year = {2021},
url = {https://doi.org/10.1016/j.bdr.2020.100172},
doi = {10.1016/J.BDR.2020.100172},
timestamp = {Tue, 12 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bdr/LealCCGGDSSKGXL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijgi/LuacesFFOBDL21,
author = {Miguel R. Luaces and
Jes{\'{u}}s A. Fisteus and
Luis S{\'{a}}nchez Fern{\'{a}}ndez and
Mario Mu{\~{n}}oz Organero and
Jes{\'{u}}s Balado and
Luc{\'{\i}}a D{\'{\i}}az{-}Vilari{\~{n}}o and
Henrique Lorenzo},
title = {Accessible Routes Integrating Data from Multiple Sources},
journal = {{ISPRS} Int. J. Geo Inf.},
volume = {10},
number = {1},
pages = {7},
year = {2021},
url = {https://doi.org/10.3390/ijgi10010007},
doi = {10.3390/IJGI10010007},
timestamp = {Wed, 07 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijgi/LuacesFFOBDL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/GonzalezSDR21,
author = {Mario Gonz{\'{a}}lez and
{\'{A}}ngel S{\'{a}}nchez and
David Dominguez and
Francisco B. Rodr{\'{\i}}guez},
title = {Ensemble of diluted attractor networks with optimized topology for
fingerprint retrieval},
journal = {Neurocomputing},
volume = {442},
pages = {269--280},
year = {2021},
url = {https://doi.org/10.1016/j.neucom.2021.02.033},
doi = {10.1016/J.NEUCOM.2021.02.033},
timestamp = {Sat, 01 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/GonzalezSDR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijris/DivanR21,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
title = {Strategies based on IoT for supporting the decision-making in agriculture:
a systematic literature mapping},
journal = {Int. J. Reason. based Intell. Syst.},
volume = {13},
number = {3},
pages = {155--171},
year = {2021},
url = {https://doi.org/10.1504/IJRIS.2021.117080},
doi = {10.1504/IJRIS.2021.117080},
timestamp = {Mon, 25 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijris/DivanR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iotj/DivanRPM21,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso and
Juan Esteban Panebianco and
Mariano J. M{\'{e}}ndez},
title = {IoT-Based Approaches for Monitoring the Particulate Matter and Its
Impact on Health},
journal = {{IEEE} Internet Things J.},
volume = {8},
number = {15},
pages = {11983--12003},
year = {2021},
url = {https://doi.org/10.1109/JIOT.2021.3068898},
doi = {10.1109/JIOT.2021.3068898},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iotj/DivanRPM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/RiveraFGPS21,
author = {Gilberto Rivera and
Rogelio Florencia and
Mario Guerrero and
Ra{\'{u}}l Porras and
Julia Patricia S{\'{a}}nchez{-}Sol{\'{\i}}s},
title = {Online multi-criteria portfolio analysis through compromise programming
models built on the underlying principles of fuzzy outranking},
journal = {Inf. Sci.},
volume = {580},
pages = {734--755},
year = {2021},
url = {https://doi.org/10.1016/j.ins.2021.08.087},
doi = {10.1016/J.INS.2021.08.087},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/isci/RiveraFGPS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iwc/Bustos-LopezASP21,
author = {Maritza Bustos{-}L{\'{o}}pez and
Giner Alor{-}Hern{\'{a}}ndez and
Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
Mario Andr{\'{e}}s Paredes{-}Valverde and
Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate},
title = {EduRecomSys: An Educational Resource Recommender System Based on Collaborative
Filtering and Emotion Detection},
journal = {Interact. Comput.},
volume = {32},
number = {4},
pages = {407--432},
year = {2021},
url = {https://doi.org/10.1093/iwc/iwab001},
doi = {10.1093/IWC/IWAB001},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iwc/Bustos-LopezASP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jei/SaldanhaSMA21,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Fast block partitioning scheme for chrominance intra prediction of
versatile video coding standard},
journal = {J. Electronic Imaging},
volume = {30},
number = {5},
year = {2021},
url = {https://doi.org/10.1117/1.jei.30.5.053009},
doi = {10.1117/1.JEI.30.5.053009},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jei/SaldanhaSMA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jis/Sanchez-Cervantes21,
author = {Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
Giner Alor{-}Hern{\'{a}}ndez and
Mario Andr{\'{e}}s Paredes{-}Valverde and
Lisbeth Rodr{\'{\i}}guez{-}Mazahua and
Rafael Valencia{-}Garc{\'{\i}}a},
title = {NaLa-Search: {A} multimodal, interaction-based architecture for faceted
search on linked open data},
journal = {J. Inf. Sci.},
volume = {47},
number = {6},
year = {2021},
url = {https://doi.org/10.1177/0165551520930918},
doi = {10.1177/0165551520930918},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jis/Sanchez-Cervantes21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jvcir/SaldanhaSMA21,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Performance analysis of {VVC} intra coding},
journal = {J. Vis. Commun. Image Represent.},
volume = {79},
pages = {103202},
year = {2021},
url = {https://doi.org/10.1016/j.jvcir.2021.103202},
doi = {10.1016/J.JVCIR.2021.103202},
timestamp = {Wed, 03 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jvcir/SaldanhaSMA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/DivanR21,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
title = {Metadata-based measurements transmission verified by a Merkle Tree},
journal = {Knowl. Based Syst.},
volume = {219},
pages = {106871},
year = {2021},
url = {https://doi.org/10.1016/j.knosys.2021.106871},
doi = {10.1016/J.KNOSYS.2021.106871},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/kbs/DivanR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/paa/RodriguezOM21,
author = {Mario Rodr{\'{\i}}guez and
Carlos Orrite and
Carlos Medrano},
title = {Space-time flexible kernel for recognizing activities from wearable
cameras},
journal = {Pattern Anal. Appl.},
volume = {24},
number = {2},
pages = {843--852},
year = {2021},
url = {https://doi.org/10.1007/s10044-020-00942-0},
doi = {10.1007/S10044-020-00942-0},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/paa/RodriguezOM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/Rubio-TevesDPSP21,
author = {Mario Rubio{-}Teves and
Sergio Diez{-}Hermano and
C{\'{e}}sar Porrero and
Abel Sanchez{-}Jimenez and
Luc{\'{\i}}a Prensa and
Francisco Clasc{\'{a}} and
Mar{\'{\i}}a Garc{\'{\i}}a{-}Amado and
Jos{\'{e}} Antonio Villacorta{-}Atienza},
title = {Benchmarking of tools for axon length measurement in individually-labeled
projection neurons},
journal = {PLoS Comput. Biol.},
volume = {17},
number = {12},
year = {2021},
url = {https://doi.org/10.1371/journal.pcbi.1009051},
doi = {10.1371/JOURNAL.PCBI.1009051},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/Rubio-TevesDPSP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/BusquierVLPSA21,
author = {Mario Busquier and
Rub{\'{e}}n Valcarce{-}Di{\~{n}}eiro and
Juan M. Lopez{-}Sanchez and
Javier Plaza and
Nilda S{\'{a}}nchez and
Benjam{\'{\i}}n Arias{-}P{\'{e}}rez},
title = {Fusion of Multi-Temporal {PAZ} and Sentinel-1 Data for Crop Classification},
journal = {Remote. Sens.},
volume = {13},
number = {19},
pages = {3915},
year = {2021},
url = {https://doi.org/10.3390/rs13193915},
doi = {10.3390/RS13193915},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/remotesensing/BusquierVLPSA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkde/GatziouraVJS21,
author = {Anna Gatzioura and
Jo{\~{a}}o Vinagre and
Al{\'{\i}}pio M{\'{a}}rio Jorge and
Miquel S{\`{a}}nchez{-}Marr{\`{e}}},
title = {A Hybrid Recommender System for Improving Automatic Playlist Continuation},
journal = {{IEEE} Trans. Knowl. Data Eng.},
volume = {33},
number = {5},
pages = {1819--1830},
year = {2021},
url = {https://doi.org/10.1109/TKDE.2019.2952099},
doi = {10.1109/TKDE.2019.2952099},
timestamp = {Thu, 16 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tkde/GatziouraVJS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmsd/NaranjoS21,
author = {David Naranjo and
Mario E. S{\'{a}}nchez},
editor = {Boris Shishkov},
title = {View and Viewpoint Reconstruction for Assisting the Preparation of
Participatory Modeling Sessions},
booktitle = {Business Modeling and Software Design - 11th International Symposium,
{BMSD} 2021, Sofia, Bulgaria, July 5-7, 2021, Proceedings},
series = {Lecture Notes in Business Information Processing},
volume = {422},
pages = {306--316},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-79976-2\_19},
doi = {10.1007/978-3-030-79976-2\_19},
timestamp = {Tue, 31 Aug 2021 10:24:53 +0200},
biburl = {https://dblp.org/rec/conf/bmsd/NaranjoS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caip/TapiaGEJPCL21,
author = {Luis Sanchez Tapia and
Antonio Gomez and
Mario Esparza and
Venkatesh Jatla and
Marios Pattichis and
Sylvia Celed{\'{o}}n{-}Pattichis and
Carlos L{\'{o}}pez Leiva},
editor = {Nicolas Tsapatsoulis and
Andreas Panayides and
Theo Theocharides and
Andreas Lanitis and
Constantinos S. Pattichis and
Mario Vento},
title = {Bilingual Speech Recognition by Estimating Speaker Geometry from Video
Data},
booktitle = {Computer Analysis of Images and Patterns - 19th International Conference,
{CAIP} 2021, Virtual Event, September 28-30, 2021, Proceedings, Part
{I}},
series = {Lecture Notes in Computer Science},
volume = {13052},
pages = {79--89},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-89128-2\_8},
doi = {10.1007/978-3-030-89128-2\_8},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/caip/TapiaGEJPCL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/GonzalezRVHPPST21,
author = {Ruben Vasallo Gonz{\'{a}}lez and
Antonio Robles{-}G{\'{o}}mez and
Rafael Pastor Vargas and
Juan Mario Haut and
Nicol{\'{a}}s A. Passadore and
Mercedes Eugenia Paoletti and
Carlos Luis S{\'{a}}nchez{-}Bocanegra and
Llanos Tobarra and
Karla A. Chac{\'{o}}n{-}Vargas and
Roberto Hern{\'{a}}ndez Berlinches and
Francesc Saig{\'{\i}} Rubi{\'{o}}},
editor = {Jo{\~{a}}o Rafael Almeida and
Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
Linlin Shen and
Bridget Kane and
Agma J. M. Traina and
Paolo Soda and
Jos{\'{e}} Lu{\'{\i}}s Oliveira},
title = {A Recommendation System for Electronic Health Records in the Context
of the {HOPE} Project},
booktitle = {34th {IEEE} International Symposium on Computer-Based Medical Systems,
{CBMS} 2021, Aveiro, Portugal, June 7-9, 2021},
pages = {603--608},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/CBMS52027.2021.00108},
doi = {10.1109/CBMS52027.2021.00108},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cbms/GonzalezRVHPPST21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/IzuLMS21,
author = {Cruz Izu and
Violetta Lonati and
Anna Morpurgo and
Mario S{\'{a}}nchez},
title = {An Inventory of Goals from {CS1} Programs Processing a Data Series},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2021, Lincoln, NE,
USA, October 13-16, 2021},
pages = {1--8},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/FIE49875.2021.9637360},
doi = {10.1109/FIE49875.2021.9637360},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fie/IzuLMS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icai2/MachadoSV21,
author = {Paola Lara Machado and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Hector Florez and
Mar{\'{\i}}a Florencia Pollo Cattaneo},
title = {Enterprise Modeling: {A} Multi-perspective Tool-Supported Approach},
booktitle = {Applied Informatics - Fourth International Conference, {ICAI} 2021,
Buenos Aires, Argentina, October 28-30, 2021, Proceedings},
series = {Communications in Computer and Information Science},
volume = {1455},
pages = {465--480},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-89654-6\_33},
doi = {10.1007/978-3-030-89654-6\_33},
timestamp = {Sun, 15 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icai2/MachadoSV21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/Lopez-TapiaSRAF21,
author = {Andrea L{\'{o}}pez{-}Tapia and
Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
Mario Alfredo Reyes{-}Barranca and
Griselda Stephany Abarca{-}Jimenez and
Luis Mart{\'{\i}}n Flores{-}Nava},
title = {Micromotors unit based on {CMOS-MEMS} technology integrated on a single
chip},
booktitle = {18th International Conference on Electrical Engineering, Computing
Science and Automatic Control, {CCE} 2021, Mexico City, Mexico, November
10-12, 2021},
pages = {1--6},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/CCE53527.2021.9633117},
doi = {10.1109/CCE53527.2021.9633117},
timestamp = {Mon, 03 Jan 2022 22:36:53 +0100},
biburl = {https://dblp.org/rec/conf/iceee/Lopez-TapiaSRAF21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwann/GonzalezSDR21,
author = {Mario Gonz{\'{a}}lez and
{\'{A}}ngel S{\'{a}}nchez and
David Dominguez and
Francisco B. Rodr{\'{\i}}guez},
editor = {Ignacio Rojas and
Gonzalo Joya and
Andreu Catal{\`{a}}},
title = {Fine-Tuning of Patterns Assignment to Subnetworks Increases the Capacity
of an Attractor Network Ensemble},
booktitle = {Advances in Computational Intelligence - 16th International Work-Conference
on Artificial Neural Networks, {IWANN} 2021, Virtual Event, June 16-18,
2021, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {12862},
pages = {236--247},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-85099-9\_19},
doi = {10.1007/978-3-030-85099-9\_19},
timestamp = {Sat, 01 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iwann/GonzalezSDR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micai/Suarez-RamirezD21,
author = {Cuauhtemoc Daniel Suarez{-}Ramirez and
Mario Alberto Duran{-}Vega and
H{\'{e}}ctor M. S{\'{a}}nchez C. and
Miguel Gonz{\'{a}}lez{-}Mendoza and
Leonardo Chang and
John M. Marshall},
editor = {Ildar Z. Batyrshin and
Alexander F. Gelbukh and
Grigori Sidorov},
title = {Deep Learning Architectures Applied to Mosquito Count Regressions
in {US} Datasets},
booktitle = {Advances in Computational Intelligence - 20th Mexican International
Conference on Artificial Intelligence, {MICAI} 2021, Mexico City,
Mexico, October 25-30, 2021, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {13067},
pages = {199--212},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-89817-5\_15},
doi = {10.1007/978-3-030-89817-5\_15},
timestamp = {Mon, 24 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/micai/Suarez-RamirezD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ondm/UrenaGSGNGG21,
author = {Mario Ure{\~{n}}a and
Rub{\'{e}}n Guillem and
Sabahat Shaheen and
Sergi Garc{\'{\i}}a and
Elham Nazemosadat and
Itandehui Gris{-}S{\'{a}}nchez and
Ivana Gasulla},
title = {Specialty fibers exploiting spatial multiplexing for signal processing
in radio access networks},
booktitle = {International Conference on Optical Network Design and Modeling, {ONDM}
2021, Gothenburg, Sweden, June 28 - July 1, 2021},
pages = {1--3},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.23919/ONDM51796.2021.9492430},
doi = {10.23919/ONDM51796.2021.9492430},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ondm/UrenaGSGNGG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vcip/SaldanhaSMA21,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Analysis of {VVC} Intra Prediction Block Partitioning Structure},
booktitle = {International Conference on Visual Communications and Image Processing,
{VCIP} 2021, Munich, Germany, December 5-8, 2021},
pages = {1--5},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/VCIP53242.2021.9675347},
doi = {10.1109/VCIP53242.2021.9675347},
timestamp = {Tue, 25 Jan 2022 09:48:31 +0100},
biburl = {https://dblp.org/rec/conf/vcip/SaldanhaSMA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vcip/SaldanhaSMA21a,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Learning-Based Complexity Reduction Scheme for {VVC} Intra-Frame Prediction},
booktitle = {International Conference on Visual Communications and Image Processing,
{VCIP} 2021, Munich, Germany, December 5-8, 2021},
pages = {1--5},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/VCIP53242.2021.9675394},
doi = {10.1109/VCIP53242.2021.9675394},
timestamp = {Tue, 25 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vcip/SaldanhaSMA21a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/worldcist/MoralesMTAM21,
author = {C. Santiago Morales and
Mario Raul Morales{-}Morales and
Glenda Toala S{\'{a}}nchez and
B. Alicia Andrade and
Milton Giovanny Moncayo},
editor = {{\'{A}}lvaro Rocha and
Hojjat Adeli and
Gintautas Dzemyda and
Fernando Moreira and
Ana Maria Ramalho Correia},
title = {Business Decision Making Based on Social Media Analysis},
booktitle = {Trends and Applications in Information Systems and Technologies -
Volume 2, WorldCIST 2021, Terceira Island, Azores, Portugal, 30 March
- 2 April, 2021},
series = {Advances in Intelligent Systems and Computing},
volume = {1366},
pages = {203--213},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-72651-5\_20},
doi = {10.1007/978-3-030-72651-5\_20},
timestamp = {Wed, 22 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/worldcist/MoralesMTAM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-02009,
author = {Eric Sadit Tellez and
Sabino Miranda{-}Jim{\'{e}}nez and
Mario Graff and
Daniela Moctezuma and
Oscar S. Siordia and
Elio{-}Aten{\'{o}}genes Villase{\~{n}}or},
title = {A Case Study of Spanish Text Transformations for Twitter Sentiment
Analysis},
journal = {CoRR},
volume = {abs/2106.02009},
year = {2021},
url = {https://arxiv.org/abs/2106.02009},
eprinttype = {arXiv},
eprint = {2106.02009},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-02009.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-13463,
author = {Luis Sanchez Tapia and
Antonio Gomez and
Mario Esparza and
Venkatesh Jatla and
Marios Pattichis and
Sylvia Celed{\'{o}}n{-}Pattichis and
Carlos LopezLeiva},
title = {Bilingual Speech Recognition by Estimating Speaker Geometry from Video
Data},
journal = {CoRR},
volume = {abs/2112.13463},
year = {2021},
url = {https://arxiv.org/abs/2112.13463},
eprinttype = {arXiv},
eprint = {2112.13463},
timestamp = {Tue, 04 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-13463.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aada/DivanR20,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
title = {Optimizing Data Transmission from IoT Devices Through Weighted Online
Data Changing Detectors},
journal = {Adv. Data Sci. Adapt. Anal.},
volume = {12},
number = {2},
pages = {2041001:1--2041001:33},
year = {2020},
url = {https://doi.org/10.1142/S2424922X20410016},
doi = {10.1142/S2424922X20410016},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aada/DivanR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Sanchez-AvilaMF20,
author = {Mario S{\'{a}}nchez{-}{\'{A}}vila and
Marcos Antonio Mouri{\~{n}}o{-}Garc{\'{\i}}a and
Jes{\'{u}}s A. Fisteus and
Luis S{\'{a}}nchez Fern{\'{a}}ndez},
title = {Detection of Barriers to Mobility in the Smart City Using Twitter},
journal = {{IEEE} Access},
volume = {8},
pages = {168429--168438},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.3022834},
doi = {10.1109/ACCESS.2020.3022834},
timestamp = {Wed, 28 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/Sanchez-AvilaMF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SanchezCOCTA20,
author = {Melissa S{\'{a}}nchez and
Jorge M. Cruz{-}Duarte and
Jos{\'{e}} Carlos Ortiz{-}Bayliss and
Hector G. Ceballos and
Hugo Terashima{-}Mar{\'{\i}}n and
Iv{\'{a}}n Amaya},
title = {A Systematic Review of Hyper-Heuristics on Combinatorial Optimization
Problems},
journal = {{IEEE} Access},
volume = {8},
pages = {128068--128095},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.3009318},
doi = {10.1109/ACCESS.2020.3009318},
timestamp = {Mon, 21 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/SanchezCOCTA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/caee/Jimenez-Ramirez20,
author = {Omar Jim{\'{e}}nez{-}Ram{\'{\i}}rez and
Jos{\'{e}} A. C{\'{a}}rdenas{-}Valderrama and
Alejandro A. Ordo{\~{n}}ez{-}S{\'{a}}nchez and
Mario Alan Quiroz{-}Ju{\'{a}}rez and
Rub{\'{e}}n V{\'{a}}zquez{-}Medina},
title = {Digital proportional-derivative controller implemented in low-resource
microcontrollers},
journal = {Comput. Appl. Eng. Educ.},
volume = {28},
number = {6},
pages = {1671--1682},
year = {2020},
url = {https://doi.org/10.1002/cae.22346},
doi = {10.1002/CAE.22346},
timestamp = {Thu, 17 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/caee/Jimenez-Ramirez20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ci/Paredes-Valverde20,
author = {Mario Andr{\'{e}}s Paredes{-}Valverde and
Giner Alor{-}Hern{\'{a}}ndez and
Jorge Luis Garc{\'{\i}}a{-}Alcaraz and
Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and
Luis Omar Colombo{-}Mendoza and
Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes},
title = {IntelliHome: An internet of things-based system for electrical energy
saving in smart home environment},
journal = {Comput. Intell.},
volume = {36},
number = {1},
pages = {203--224},
year = {2020},
url = {https://doi.org/10.1111/coin.12252},
doi = {10.1111/COIN.12252},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ci/Paredes-Valverde20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cleiej/DivanR20,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
title = {A Real-Time Entity Monitoring based on States and Scenarios},
journal = {{CLEI} Electron. J.},
volume = {23},
number = {1},
year = {2020},
url = {https://doi.org/10.19153/cleiej.23.1.2},
doi = {10.19153/CLEIEJ.23.1.2},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cleiej/DivanR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/Gonzalez-Briceno20,
author = {Gaspar Gonz{\'{a}}lez{-}Brice{\~{n}}o and
Abraham S{\'{a}}nchez and
Susana Ortega{-}Cisneros and
Mario Salvador Garcia Contreras and
German Alonso Pinedo Diaz and
Eduardo Ulises Moya{-}S{\'{a}}nchez},
title = {Artificial Intelligence-Based Referral System for Patients With Diabetic
Retinopathy},
journal = {Computer},
volume = {53},
number = {10},
pages = {77--87},
year = {2020},
url = {https://doi.org/10.1109/MC.2020.3004392},
doi = {10.1109/MC.2020.3004392},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/computer/Gonzalez-Briceno20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/Sanchez-GalvezA20,
author = {Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Mario Anzures{-}Garc{\'{\i}}a and
{\'{A}}lvaro Campos Gregorio},
title = {Weighted Bidirectional Graph-based Academic Curricula Model to Support
the Tutorial Competence},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {24},
number = {2},
year = {2020},
url = {https://doi.org/10.13053/cys-24-2-3397},
doi = {10.13053/CYS-24-2-3397},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cys/Sanchez-GalvezA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/digearth/SoilanRFA20,
author = {Mario Soil{\'{a}}n and
Bel{\'{e}}n Riveiro and
Jes{\'{u}}s Balado and
Pedro Arias},
title = {Comparison of heuristic and deep learning-based methods for ground
classification from aerial point clouds},
journal = {Int. J. Digit. Earth},
volume = {13},
number = {10},
pages = {1115--1134},
year = {2020},
url = {https://doi.org/10.1080/17538947.2019.1663948},
doi = {10.1080/17538947.2019.1663948},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/digearth/SoilanRFA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijgi/FernandezPGCCSD20,
author = {Tom{\'{a}}s Fern{\'{a}}ndez and
Jos{\'{e}} Luis P{\'{e}}rez{-}Garc{\'{\i}}a and
Jos{\'{e}} Miguel G{\'{o}}mez{-}L{\'{o}}pez and
Javier Cardenal and
Julio Calero and
Mario S{\'{a}}nchez{-}G{\'{o}}mez and
Jorge Delgado and
Joaqu{\'{\i}}n Tovar{-}Pescador},
title = {Multitemporal Analysis of Gully Erosion in Olive Groves by Means of
Digital Elevation Models Obtained with Aerial Photogrammetric and
LiDAR Data},
journal = {{ISPRS} Int. J. Geo Inf.},
volume = {9},
number = {4},
pages = {260},
year = {2020},
url = {https://doi.org/10.3390/ijgi9040260},
doi = {10.3390/IJGI9040260},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijgi/FernandezPGCCSD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/NaveiraSCGGPCMC20,
author = {Miguel Ramos Naveira and
Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
Jes{\'{u}}s Barros Castro and
Lino Carrajo Garc{\'{\i}}a and
Guillermo V{\'{a}}zquez Gonz{\'{a}}lez and
Santiago P{\'{e}}rez and
Mario Pascual Carrasco and
Fernando Mart{\'{\i}}n{-}S{\'{a}}nchez and
Adolfo Mu{\~{n}}oz Carrero},
title = {An Archetype Query Language interpreter into MongoDB: Managing NoSQL
standardized Electronic Health Record extracts systems},
journal = {J. Biomed. Informatics},
volume = {101},
pages = {103339},
year = {2020},
url = {https://doi.org/10.1016/j.jbi.2019.103339},
doi = {10.1016/J.JBI.2019.103339},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jbi/NaveiraSCGGPCMC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jifs/Anzures-GarciaS20,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez},
title = {{PROMISE:} PRoposing an Ontological Model for developing collaboratIve
SystEms},
journal = {J. Intell. Fuzzy Syst.},
volume = {39},
number = {2},
pages = {2545--2557},
year = {2020},
url = {https://doi.org/10.3233/JIFS-179913},
doi = {10.3233/JIFS-179913},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jifs/Anzures-GarciaS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jiii/LaraSV20,
author = {Paola Lara and
Mario S{\'{a}}nchez and
Jorge Villalobos},
title = {Enterprise modeling and operational technologies {(OT)} application
in the oil and gas industry},
journal = {J. Ind. Inf. Integr.},
volume = {19},
pages = {100160},
year = {2020},
url = {https://doi.org/10.1016/j.jii.2020.100160},
doi = {10.1016/J.JII.2020.100160},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jiii/LaraSV20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kais/Salas-ZarateASP20,
author = {Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and
Giner Alor{-}Hern{\'{a}}ndez and
Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
Mario Andr{\'{e}}s Paredes{-}Valverde and
Jorge Luis Garc{\'{\i}}a{-}Alcaraz and
Rafael Valencia{-}Garc{\'{\i}}a},
title = {Review of English literature on figurative language applied to social
networks},
journal = {Knowl. Inf. Syst.},
volume = {62},
number = {6},
pages = {2105--2137},
year = {2020},
url = {https://doi.org/10.1007/s10115-019-01425-3},
doi = {10.1007/S10115-019-01425-3},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/kais/Salas-ZarateASP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lgrs/BusquierLB20,
author = {Mario Busquier and
Juan M. Lopez{-}Sanchez and
Damian Bargiel},
title = {Added Value of Coherent Copolar Polarimetry at X-Band for Crop-Type
Mapping},
journal = {{IEEE} Geosci. Remote. Sens. Lett.},
volume = {17},
number = {5},
pages = {819--823},
year = {2020},
url = {https://doi.org/10.1109/LGRS.2019.2933738},
doi = {10.1109/LGRS.2019.2933738},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/lgrs/BusquierLB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/Alvarez-Arenald20,
author = {Angel {\'{A}}lvarez{-}Arenal and
H{\'{e}}ctor deLlanos{-}Lanchares and
Elena Mart{\'{\i}}n Fern{\'{a}}ndez and
Mario Mauvezin{-}Quevedo and
Mar{\'{\i}}a Luisa S{\'{a}}nchez Rodr{\'{\i}}guez and
Francisco Javier de Cos Juez},
title = {An artificial neural network model for the prediction of bruxism by
means of occlusal variables},
journal = {Neural Comput. Appl.},
volume = {32},
number = {5},
pages = {1259--1267},
year = {2020},
url = {https://doi.org/10.1007/s00521-018-3715-7},
doi = {10.1007/S00521-018-3715-7},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nca/Alvarez-Arenald20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Anzures-GarciaS20,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez},
title = {Enfoque sem{\'{a}}ntico de pol{\'{\i}}ticas para gestionar
la conciencia de grupo en Groupware},
journal = {Res. Comput. Sci.},
volume = {149},
number = {8},
pages = {1117--1132},
year = {2020},
url = {https://rcs.cic.ipn.mx/2020\_149\_8/Enfoque\%20semantico\%20de\%20politicas\%20para\%20gestionar\%20la\%20conciencia\%20de\%20grupo\%20en\%20Groupware.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/Anzures-GarciaS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/BricenoSMODCC20,
author = {Gaspar Gonz{\'{a}}lez{-}Brice{\~{n}}o and
Abraham S{\'{a}}nchez and
Eduardo Ulises Moya{-}S{\'{a}}nchez and
Susana Ortega{-}Cisneros and
German Alonso Pinedo Diaz and
Mario Salvador Garcia Contreras and
Beatriz Alvarado Castillo},
title = {Automatic Cropping of Retinal Fundus Photographs using Convolutional
Neural Networks},
journal = {Res. Comput. Sci.},
volume = {149},
number = {5},
pages = {161--167},
year = {2020},
url = {https://rcs.cic.ipn.mx/2020\_149\_5/Automatic\%20Cropping\%20of\%20Retinal\%20Fundus\%20Photographs\%20using\%20Convolutional\%20Neural\%20Networks.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/BricenoSMODCC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/EnriquezGLSPRG20,
author = {Karen Andrea Guerrero Enr{\'{\i}}quez and
Octavio Jim{\'{e}}nez Gonz{\'{a}}lez and
Roberto Pacheco L{\'{o}}pez and
Javier Medrano S{\'{a}}nchez and
Mario Murguia Perez and
Ang{\'{e}}lica Hern{\'{a}}ndez Rayas and
Martha Alicia Hern{\'{a}}ndez Gonz{\'{a}}lez},
title = {An{\'{a}}lisis y caracterizaci{\'{o}}n de espectros Raman
de tejido neopl{\'{a}}sico e hiperpl{\'{a}}sico de pr{\'{o}}stata},
journal = {Res. Comput. Sci.},
volume = {149},
number = {2},
pages = {87--94},
year = {2020},
url = {https://rcs.cic.ipn.mx/2020\_149\_2/Analisis\%20y\%20caracterizacion\%20de\%20espectros\%20Raman\%20de\%20tejido\%20neoplasico\%20e\%20hiperplasico\%20de\%20prostata.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/EnriquezGLSPRG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/EstrellaTM20,
author = {Guillermo Fern{\'{a}}ndez Estrella and
Joel Antonio Trejo{-}S{\'{a}}nchez and
Mario Ren{\'{a}}n Moreno{-}Sabido},
title = {Sistema multi-agente para el control de tr{\'{a}}fico urbano
para veh{\'{\i}}culos de prioridad},
journal = {Res. Comput. Sci.},
volume = {149},
number = {8},
pages = {713--723},
year = {2020},
url = {https://rcs.cic.ipn.mx/2020\_149\_8/Sistema\%20multi-agente\%20para\%20el\%20control\%20de\%20trafico\%20urbano\%20para\%20vehiculos\%20de\%20prioridad.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/EstrellaTM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/BusquierLMNGM20,
author = {Mario Busquier and
Juan M. Lopez{-}Sanchez and
Alejandro Mestre{-}Quereda and
Elena Navarro and
Maria P. Gonz{\'{a}}lez{-}Dugo and
Luciano Mateos},
title = {Exploring TanDEM-X Interferometric Products for Crop-Type Mapping},
journal = {Remote. Sens.},
volume = {12},
number = {11},
pages = {1774},
year = {2020},
url = {https://doi.org/10.3390/rs12111774},
doi = {10.3390/RS12111774},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/BusquierLMNGM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/SoilanJSR20,
author = {Mario Soil{\'{a}}n and
Andr{\'{e}}s Justo and
Ana S{\'{a}}nchez{-}Rodr{\'{\i}}guez and
Bel{\'{e}}n Riveiro},
title = {3D Point Cloud to {BIM:} Semi-Automated Framework to Define {IFC}
Alignment Entities from MLS-Acquired LiDAR Data of Highway Roads},
journal = {Remote. Sens.},
volume = {12},
number = {14},
pages = {2301},
year = {2020},
url = {https://doi.org/10.3390/rs12142301},
doi = {10.3390/RS12142301},
timestamp = {Fri, 31 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/SoilanJSR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ress/LozanoZS20,
author = {Jorge{-}Mario Lozano and
Santiago Zuluaga and
Mauricio S{\'{a}}nchez{-}Silva},
title = {Developing flexible management strategies in infrastructure: The sequential
expansion problem for infrastructure analysis {(SEPIA)}},
journal = {Reliab. Eng. Syst. Saf.},
volume = {200},
pages = {106951},
year = {2020},
url = {https://doi.org/10.1016/j.ress.2020.106951},
doi = {10.1016/J.RESS.2020.106951},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ress/LozanoZS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/Guerra-SerranoS20,
author = {Juan Guerra{-}Serrano and
Angel S{\'{a}}nchez{-}Roca and
Guillermo Gonz{\'{a}}lez{-}Yero and
Mario C. S{\'{a}}nchez{-}Orozco and
Mercedes P{\'{e}}rez de la Parte and
Emilio Jim{\'{e}}nez Mac{\'{\i}}as and
Julio Blanco{-}Fern{\'{a}}ndez},
title = {New Arc Stability Index for Industrial {AC} Three-Phase Electric Arc
Furnaces Based on Acoustic Signals},
journal = {Sensors},
volume = {20},
number = {23},
pages = {6840},
year = {2020},
url = {https://doi.org/10.3390/s20236840},
doi = {10.3390/S20236840},
timestamp = {Sat, 25 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/Guerra-SerranoS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/SanchezTSGMRPHM20,
author = {Jos{\'{e}} Rafael Garc{\'{\i}}a S{\'{a}}nchez and
Salvador Tavera{-}Mosqueda and
Ram{\'{o}}n Silva{-}Ortigoza and
V{\'{\i}}ctor Manuel Hern{\'{a}}ndez Guzm{\'{a}}n and
Magdalena Marciano{-}Melchor and
Jos{\'{e}} de Jes{\'{u}}s Rubio and
Mario Ponce{-}Silva and
Miguel Hern{\'{a}}ndez{-}Bola{\~{n}}os and
Jes{\'{u}}s Mart{\'{\i}}nez{-}Mart{\'{\i}}nez},
title = {A Novel Dynamic Three-Level Tracking Controller for Mobile Robots
Considering Actuators and Power Stage Subsystems: Experimental Assessment},
journal = {Sensors},
volume = {20},
number = {17},
pages = {4959},
year = {2020},
url = {https://doi.org/10.3390/s20174959},
doi = {10.3390/S20174959},
timestamp = {Fri, 25 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/SanchezTSGMRPHM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/SaldanhaSMA20,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Tile Adaptation for Workload Balancing of 3D-HEVC Encoder in Homogeneous
Multicore Systems},
journal = {{IEEE} Trans. Circuits Syst. {I} Fundam. Theory Appl.},
volume = {67-I},
number = {5},
pages = {1704--1714},
year = {2020},
url = {https://doi.org/10.1109/TCSI.2020.2977297},
doi = {10.1109/TCSI.2020.2977297},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcas/SaldanhaSMA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/SanchezSFCAM20,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Ramon Fernandes and
Rodrigo Cataldo and
Luciano Agostini and
C{\'{e}}sar A. M. Marcon},
title = {3D-HEVC Bipartition Modes Encoder and Decoder Design Targeting High-Resolution
Videos},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {67-I},
number = {2},
pages = {415--427},
year = {2020},
url = {https://doi.org/10.1109/TCSI.2019.2929977},
doi = {10.1109/TCSI.2019.2929977},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcas/SanchezSFCAM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tce/SanchezSO20,
author = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and
Daniel D{\'{\i}}az S{\'{a}}nchez and
Mario Mu{\~{n}}oz Organero},
title = {Specification and Unattended Deployment of Home Networks at the Edge
of the Network},
journal = {{IEEE} Trans. Consumer Electron.},
volume = {66},
number = {4},
pages = {279--288},
year = {2020},
url = {https://doi.org/10.1109/TCE.2020.3018543},
doi = {10.1109/TCE.2020.3018543},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tce/SanchezSO20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/SaldanhaSMA20,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Fast 3D-HEVC Depth Map Encoding Using Machine Learning},
journal = {{IEEE} Trans. Circuits Syst. Video Technol.},
volume = {30},
number = {3},
pages = {850--861},
year = {2020},
url = {https://doi.org/10.1109/TCSVT.2019.2898122},
doi = {10.1109/TCSVT.2019.2898122},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcsv/SaldanhaSMA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tii/SantAnaHSSAN20,
author = {Jean Michel de Souza Sant'Ana and
Arliones Hoeller and
Richard Demo Souza and
Samuel Montejo Sanchez and
Hirley Alves and
Mario de Noronha{-}Neto},
title = {Hybrid Coded Replication in LoRa Networks},
journal = {{IEEE} Trans. Ind. Informatics},
volume = {16},
number = {8},
pages = {5577--5585},
year = {2020},
url = {https://doi.org/10.1109/TII.2020.2966120},
doi = {10.1109/TII.2020.2966120},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tii/SantAnaHSSAN20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ahfe/Sanchez-MatuteZ20,
author = {Mario Raul Sanchez{-}Matute and
Carolina Zayas{-}M{\'{a}}rquez and
Mar{\'{\i}}a Marcela Sol{\'{\i}}s{-}Quinteros and
Luis Alfredo {\'{A}}vila{-}L{\'{o}}pez},
editor = {Waldemar Karwowski and
Ravindra S. Goonetilleke and
Shuping Xiong and
Richard H. M. Goossens and
Atsuo Murata},
title = {Improvement of Efficiency in the Productivity of an Aerospace, Maritime
and Military Company in Tijuana, Baja California; Mexico},
booktitle = {Advances in Physical, Social {\&} Occupational Ergonomics - Proceedings
of the {AHFE} 2020 Virtual Conferences on Physical Ergonomics and
Human Factors, Social {\&} Occupational Ergonomics and Cross-Cultural
Decision Making, July 16-20, 2020, {USA}},
series = {Advances in Intelligent Systems and Computing},
volume = {1215},
pages = {421--436},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-51549-2\_56},
doi = {10.1007/978-3-030-51549-2\_56},
timestamp = {Tue, 07 Nov 2023 08:36:40 +0100},
biburl = {https://dblp.org/rec/conf/ahfe/Sanchez-MatuteZ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/SanchezOACCT20,
author = {Xavier S{\'{a}}nchez and
Jos{\'{e}} Carlos Ortiz{-}Bayliss and
Iv{\'{a}}n Amaya and
Jorge M. Cruz{-}Duarte and
Santiago Enrique Conant{-}Pablos and
Hugo Terashima{-}Mar{\'{\i}}n},
title = {A Preliminary Study on Feature-independent Hyper-heuristics for the
0/1 Knapsack Problem},
booktitle = {{IEEE} Congress on Evolutionary Computation, {CEC} 2020, Glasgow,
United Kingdom, July 19-24, 2020},
pages = {1--8},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/CEC48606.2020.9185671},
doi = {10.1109/CEC48606.2020.9185671},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cec/SanchezOACCT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cosecivi/RomeroSSMP20,
author = {Diego Romero and
Mario S{\'{a}}nchez and
Jos{\'{e}} M. Sierra and
Maximiliano Miranda and
Federico Peinado},
editor = {Ra{\'{u}}l Lara{-}Cabrera and
Antonio Jos{\'{e}} Fern{\'{a}}ndez Leiva},
title = {Developing an automated planning tool for non-player character behavior},
booktitle = {Proceedings of the {VI} Congreso de la Sociedad Espa{\~{n}}ola para
las Ciencias del Videojuego, On-line, October 7-8, 2020},
series = {{CEUR} Workshop Proceedings},
volume = {2719},
pages = {69--77},
publisher = {CEUR-WS.org},
year = {2020},
url = {https://ceur-ws.org/Vol-2719/paper7.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:22 +0100},
biburl = {https://dblp.org/rec/conf/cosecivi/RomeroSSMP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/MadrugaCP20,
author = {Mario Madruga and
Yolanda Campos{-}Roca and
Carlos J. P{\'{e}}rez},
title = {Robustness Assessment of Automatic Reinke's Edema Diagnosis Systems},
booktitle = {2020 {IEEE} International Conference on Acoustics, Speech and Signal
Processing, {ICASSP} 2020, Barcelona, Spain, May 4-8, 2020},
pages = {891--895},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICASSP40776.2020.9053676},
doi = {10.1109/ICASSP40776.2020.9053676},
timestamp = {Thu, 01 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/MadrugaCP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icecsys/MouraSSMPA20,
author = {Christopher Moura and
M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Marcelo Schiavon Porto and
Luciano Agostini},
title = {Fast Intra Mode Decision for 3D-HEVC Depth Map Coding using Decision
Trees},
booktitle = {27th {IEEE} International Conference on Electronics, Circuits and
Systems, {ICECS} 2020, Glasgow, Scotland, UK, November 23-25, 2020},
pages = {1--4},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICECS49266.2020.9294919},
doi = {10.1109/ICECS49266.2020.9294919},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icecsys/MouraSSMPA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/Lopez-TapiaRASF20,
author = {Andrea L{\'{o}}pez{-}Tapia and
Mario Alfredo Reyes{-}Barranca and
Griselda Stephany Abarca{-}Jimenez and
Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
Luis Mart{\'{\i}}n Flores{-}Nava},
title = {Design of position sensor of a linear micromotor based on {CMOS-MEMS}
technology},
booktitle = {17th International Conference on Electrical Engineering, Computing
Science and Automatic Control, {CCE} 2020, Mexico City, Mexico, November
11-13, 2020},
pages = {1--6},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/CCE50788.2020.9299123},
doi = {10.1109/CCE50788.2020.9299123},
timestamp = {Sun, 07 Feb 2021 14:11:06 +0100},
biburl = {https://dblp.org/rec/conf/iceee/Lopez-TapiaRASF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/MenesesMSM20,
author = {Maricela Meneses and
Mario Moreno and
Alfredo Morales{-}S{\'{a}}nchez and
J. C{\'{e}}sar Mendoza},
title = {Effect of the thermal treatments on the emission of a-Si1-xCx: {H}
films},
booktitle = {17th International Conference on Electrical Engineering, Computing
Science and Automatic Control, {CCE} 2020, Mexico City, Mexico, November
11-13, 2020},
pages = {1--5},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/CCE50788.2020.9299172},
doi = {10.1109/CCE50788.2020.9299172},
timestamp = {Thu, 20 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iceee/MenesesMSM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/Sanchez-Marquez20,
author = {Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
Mario Alfredo Reyes{-}Barranca and
Griselda Stephany Abarca{-}Jimenez and
Andrea L{\'{o}}pez{-}Tapia and
Luis Mart{\'{\i}}n Flores{-}Nava},
title = {Proposal for a rotary micromotor structure based on {CMOS-MEMS} technology},
booktitle = {17th International Conference on Electrical Engineering, Computing
Science and Automatic Control, {CCE} 2020, Mexico City, Mexico, November
11-13, 2020},
pages = {1--6},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/CCE50788.2020.9299176},
doi = {10.1109/CCE50788.2020.9299176},
timestamp = {Sun, 07 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iceee/Sanchez-Marquez20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icict2/Barcelo-Valenzuela20,
author = {Mario Barcelo{-}Valenzuela and
Carlos Maximiliano Leal{-}Pompa and
Gerardo Sanchez{-}Schmitz},
title = {An {IT} Service Management Methodology for an Electoral Public Institution},
booktitle = {3rd International Conference on Information and Computer Technologies,
{ICICT} 2020, San Jose, CA, USA, March 9-12, 2020},
pages = {219--223},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICICT50521.2020.00041},
doi = {10.1109/ICICT50521.2020.00041},
timestamp = {Tue, 19 May 2020 15:34:02 +0200},
biburl = {https://dblp.org/rec/conf/icict2/Barcelo-Valenzuela20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/SaldanhaSMA20,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Complexity Analysis Of {VVC} Intra Coding},
booktitle = {{IEEE} International Conference on Image Processing, {ICIP} 2020,
Abu Dhabi, United Arab Emirates, October 25-28, 2020},
pages = {3119--3123},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICIP40778.2020.9190970},
doi = {10.1109/ICIP40778.2020.9190970},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/SaldanhaSMA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/SaldanhaSMA20,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Fast Partitioning Decision Scheme for Versatile Video Coding Intra-Frame
Prediction},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2020,
Sevilla, Spain, October 10-21, 2020},
pages = {1--5},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISCAS45731.2020.9180980},
doi = {10.1109/ISCAS45731.2020.9180980},
timestamp = {Mon, 18 Jan 2021 08:38:59 +0100},
biburl = {https://dblp.org/rec/conf/iscas/SaldanhaSMA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iticse/SanchezS20,
author = {Mario S{\'{a}}nchez and
Pedro Salazar},
editor = {Michail N. Giannakos and
Guttorm Sindre and
Andrew Luxton{-}Reilly and
Monica Divitini},
title = {A feedback-oriented platform for deliberate programming practice},
booktitle = {Proceedings of the 2020 {ACM} Conference on Innovation and Technology
in Computer Science Education, ITiCSE 2020, Trondheim, Norway, June
15-19, 2020},
pages = {531--532},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3341525.3393996},
doi = {10.1145/3341525.3393996},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iticse/SanchezS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micai/Lara-CardenasSA20,
author = {Erick Lara{-}C{\'{a}}rdenas and
Xavier S{\'{a}}nchez{-}D{\'{\i}}az and
Iv{\'{a}}n Amaya and
Jorge M. Cruz{-}Duarte and
Jos{\'{e}} Carlos Ortiz{-}Bayliss},
editor = {Lourdes Mart{\'{\i}}nez{-}Villase{\~{n}}or and
Oscar Herrera{-}Alc{\'{a}}ntara and
Hiram E. Ponce and
F{\'{e}}lix Castro{-}Espinoza},
title = {A Genetic Programming Framework for Heuristic Generation for the Job-Shop
Scheduling Problem},
booktitle = {Advances in Soft Computing - 19th Mexican International Conference
on Artificial Intelligence, {MICAI} 2020, Mexico City, Mexico, October
12-17, 2020, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {12468},
pages = {284--295},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-60884-2\_21},
doi = {10.1007/978-3-030-60884-2\_21},
timestamp = {Mon, 21 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/micai/Lara-CardenasSA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ssci/Silva-GalvezOLO20,
author = {Arturo Silva{-}G{\'{a}}lvez and
Jorge Orozco{-}Sanchez and
Erick Lara{-}C{\'{a}}rdenas and
Jos{\'{e}} Carlos Ortiz{-}Bayliss and
Iv{\'{a}}n Amaya and
Jorge M. Cruz{-}Duarte and
Hugo Terashima{-}Mar{\'{\i}}n},
title = {Discovering Action Regions for Solving the Bin Packing Problem through
Hyper-heuristics},
booktitle = {2020 {IEEE} Symposium Series on Computational Intelligence, {SSCI}
2020, Canberra, Australia, December 1-4, 2020},
pages = {822--828},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/SSCI47803.2020.9308538},
doi = {10.1109/SSCI47803.2020.9308538},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ssci/Silva-GalvezOLO20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ssiai/TapiaPCL20,
author = {Luis Sanchez Tapia and
Marios S. Pattichis and
Sylvia Celed{\'{o}}n{-}Pattichis and
Carlos L{\'{o}}pez Leiva},
title = {The Importance of the Instantaneous Phase for Face Detection using
Simple Convolutional Neural Networks},
booktitle = {{IEEE} Southwest Symposium on Image Analysis and Interpretation, {SSIAI}
2020, Albuquerque, NM, USA, March 29-31, 2020},
pages = {1--4},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/SSIAI49293.2020.9094589},
doi = {10.1109/SSIAI49293.2020.9094589},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ssiai/TapiaPCL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2001-08168,
author = {Jean Michel de Souza Sant'Ana and
Arliones Hoeller and
Richard Demo Souza and
Samuel Montejo S{\'{a}}nchez and
Hirley Alves and
Mario de Noronha{-}Neto},
title = {Hybrid Coded Replication in LoRa Networks},
journal = {CoRR},
volume = {abs/2001.08168},
year = {2020},
url = {https://arxiv.org/abs/2001.08168},
eprinttype = {arXiv},
eprint = {2001.08168},
timestamp = {Fri, 24 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2001-08168.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Perez-MedinaGPV19,
author = {Jorge Luis P{\'{e}}rez{-}Medina and
Mario Gonz{\'{a}}lez and
Hennry Mauricio Pilco and
Karina Beatriz Jimenes Vargas and
Patricia Acosta{-}Vargas and
Sandra Sanchez{-}Gordon and
Tania Calle{-}Jimenez and
Danilo Esparza and
Yves Rybarczyk},
title = {Usability Study of a Web-Based Platform for Home Motor Rehabilitation},
journal = {{IEEE} Access},
volume = {7},
pages = {7932--7947},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2018.2889257},
doi = {10.1109/ACCESS.2018.2889257},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/Perez-MedinaGPV19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Sanchez-Martinez19,
author = {Juan Jose Sanchez{-}Martinez and
Mario Perez{-}Escribano and
Enrique Marquez{-}Segura},
title = {Synthesis of Dual-Band Bandpass Filters With Short-Circuited Multiconductor
Transmission Lines and Shunt Open Stubs},
journal = {{IEEE} Access},
volume = {7},
pages = {24071--24081},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2018.2886657},
doi = {10.1109/ACCESS.2018.2886657},
timestamp = {Fri, 12 Apr 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/Sanchez-Martinez19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ascom/SanchezDLBCGQAC19,
author = {Bruno S{\'{a}}nchez and
Mariano Dom{\'{\i}}nguez and
Marcelo Lares and
Martin Beroiz and
Juan B. Cabral and
Sebasti{\'{a}}n Gurovich and
Cecilia Qui{\~{n}}ones and
Rodolfo A. Artola and
Carlos A. Colazo and
Mat{\'{\i}}as E. Schneiter and
Carla Girardini and
Marina Tornatore and
Jos Luis Nilo Castell{\'{o}}n and
Diego Garc{\'{\i}}a Lambas and
Mario C. D{\'{\i}}az},
title = {Machine learning on difference image analysis: {A} comparison of methods
for transient detection},
journal = {Astron. Comput.},
volume = {28},
pages = {100284},
year = {2019},
url = {https://doi.org/10.1016/j.ascom.2019.05.002},
doi = {10.1016/J.ASCOM.2019.05.002},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ascom/SanchezDLBCGQAC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bise/LaraSV19,
author = {Paola Lara and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {{OT} Modeling: The Enterprise Beyond {IT}},
journal = {Bus. Inf. Syst. Eng.},
volume = {61},
number = {4},
pages = {399--411},
year = {2019},
url = {https://doi.org/10.1007/s12599-018-0543-3},
doi = {10.1007/S12599-018-0543-3},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bise/LaraSV19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/Perez-CastilloS19,
author = {Yunierkis P{\'{e}}rez{-}Castillo and
Stellamaris Sotomayor{-}Burneo and
Karina Beatriz Jimenes Vargas and
Mario Salvador Gonz{\'{a}}lez{-}Rodr{\'{\i}}guez and
Maykel Cruz{-}Monteagudo and
Vinicio Armijos{-}Jaramillo and
M. Nat{\'{a}}lia Dias Soeiro Cordeiro and
Fernanda Borges and
Aminael S{\'{a}}nchez{-}Rodr{\'{\i}}guez and
Eduardo Tejera},
title = {CompScore: Boosting Structure-Based Virtual Screening Performance
by Incorporating Docking Scoring Function Components into Consensus
Scoring},
journal = {J. Chem. Inf. Model.},
volume = {59},
number = {9},
pages = {3655--3666},
year = {2019},
url = {https://doi.org/10.1021/acs.jcim.9b00343},
doi = {10.1021/ACS.JCIM.9B00343},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/Perez-CastilloS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/MuhlbergerSTOBB19,
author = {G{\"{u}}nter M{\"{u}}hlberger and
Louise Seaward and
Melissa Terras and
Sofia Ares Oliveira and
Vicente Bosch and
Maximilian Bryan and
Sebastian Colutto and
Herv{\'{e}} D{\'{e}}jean and
Markus Diem and
Stefan Fiel and
Basilis Gatos and
Albert Greinoecker and
Tobias Gr{\"{u}}ning and
G{\"{u}}nter Hackl and
Vili Haukkovaara and
Gerhard Heyer and
Lauri Hirvonen and
Tobias Hodel and
Matti Jokinen and
Philip Kahle and
Mario Kallio and
Fr{\'{e}}d{\'{e}}ric Kaplan and
Florian Kleber and
Roger Labahn and
Eva Maria Lang and
S{\"{o}}ren Laube and
Gundram Leifert and
Georgios Louloudis and
Rory McNicholl and
Jean{-}Luc Meunier and
Johannes Michael and
Elena M{\"{u}}hlbauer and
Nathanael Philipp and
Ioannis Pratikakis and
Joan Puigcerver P{\'{e}}rez and
Hannelore Putz and
George Retsinas and
Ver{\'{o}}nica Romero and
Robert Sablatnig and
Joan{-}Andreu S{\'{a}}nchez and
Philip Schofield and
Giorgos Sfikas and
Christian Sieber and
Nikolaos Stamatopoulos and
Tobias Strau{\ss} and
Tamara Terbul and
Alejandro H. Toselli and
Berthold Ulreich and
Mauricio Villegas and
Enrique Vidal and
Johanna Walcher and
Max Weidemann and
Herbert Wurster and
Konstantinos Zagoris},
title = {Transforming scholarship in the archives through handwritten text
recognition},
journal = {J. Documentation},
volume = {75},
number = {5},
pages = {954--976},
year = {2019},
url = {https://doi.org/10.1108/JD-07-2018-0114},
doi = {10.1108/JD-07-2018-0114},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jd/MuhlbergerSTOBB19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocs/PrimsCAMLSCD19,
author = {Oriol Tint{\'{o}} Prims and
Miguel Castrillo and
Mario C. Acosta and
Oriol Mula{-}Valls and
Alicia Sanchez Lorente and
Kim Serradell and
Ana Cort{\'{e}}s and
Francisco J. Doblas{-}Reyes},
title = {Finding, analysing and solving {MPI} communication bottlenecks in
Earth System models},
journal = {J. Comput. Sci.},
volume = {36},
year = {2019},
url = {https://doi.org/10.1016/j.jocs.2018.04.015},
doi = {10.1016/J.JOCS.2018.04.015},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jocs/PrimsCAMLSCD19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/PremiCDGCAAPGSG19,
author = {Enrico Premi and
Vince D. Calhoun and
Matteo Diano and
Stefano Gazzina and
Maura Cosseddu and
Antonella Alberici and
Silvana Archetti and
Donata Paternic{\`{o}} and
Roberto Gasparotti and
John van Swieten and
Daniela Galimberti and
Raquel S{\'{a}}nchez{-}Valle and
Robert Laforce Jr. and
Fermin Moreno and
Matthis Synofzik and
Caroline Graff and
Mario Masellis and
Maria Carmela Tartaglia and
Miren Zulaica},
title = {The inner fluctuations of the brain in presymptomatic Frontotemporal
Dementia: The chronnectome fingerprint},
journal = {NeuroImage},
volume = {189},
pages = {645--654},
year = {2019},
url = {https://doi.org/10.1016/j.neuroimage.2019.01.080},
doi = {10.1016/J.NEUROIMAGE.2019.01.080},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/PremiCDGCAAPGSG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pdln/AraujoMDLSCC19,
author = {Lourdes Araujo and
Juan Mart{\'{\i}}nez{-}Romo and
Andr{\'{e}}s Duque and
Fernando L{\'{o}}pez{-}Ostenero and
Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
Adolfo Mu{\~{n}}oz Carrero and
Mario Pascual Carrasco},
title = {{EXTRAE:} EXTRacci{\'{o}}n de Asociaciones entre Enfermedades
y otros conceptos m{\'{e}}dicos},
journal = {Proces. del Leng. Natural},
volume = {63},
pages = {171--174},
year = {2019},
url = {http://journal.sepln.org/sepln/ojs/ojs/index.php/pln/article/view/6112},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pdln/AraujoMDLSCC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/BendallMILPOJMR19,
author = {Matthew L. Bendall and
Miguel de Mulder and
Luis Pedro I{\~{n}}iguez and
Aar{\'{o}}n Lecanda{-}S{\'{a}}nchez and
Marcos P{\'{e}}rez{-}Losada and
Mario A. Ostrowski and
R. Brad Jones and
Lubbertus C. F. Mulder and
Gustavo Reyes{-}Ter{\'{a}}n and
Keith A. Crandall and
Christopher E. Ormsby and
Douglas F. Nixon},
title = {Telescope: Characterization of the retrotranscriptome by accurate
estimation of transposable element expression},
journal = {PLoS Comput. Biol.},
volume = {15},
number = {9},
year = {2019},
url = {https://doi.org/10.1371/journal.pcbi.1006453},
doi = {10.1371/JOURNAL.PCBI.1006453},
timestamp = {Mon, 26 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/BendallMILPOJMR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/SernaLALG19,
author = {Mario Serna and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Mart{\'{\i}}n Estrada Analco and
Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Elberfeld E. P{\'{e}}rez G.},
title = {Navegaci{\'{o}}n de robots m{\'{o}}viles utilizando algoritmos
Bugs extendidos},
journal = {Res. Comput. Sci.},
volume = {148},
number = {8},
pages = {159--171},
year = {2019},
url = {https://rcs.cic.ipn.mx/2019\_148\_8/Navegacion\%20de\%20robots\%20moviles\%20utilizando\%20algoritmos\%20Bugs\%20extendidos.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/SernaLALG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/Mate-GonzalezSB19,
author = {Miguel {\'{A}}ngel Mat{\'{e}}{-}Gonz{\'{a}}lez and
Luis Javier S{\'{a}}nchez{-}Aparicio and
Cristina S{\'{a}}ez Bl{\'{a}}zquez and
Pedro Carrasco Garc{\'{\i}}a and
David {\'{A}}lvarez{-}Alonso and
Mar{\'{\i}}a de Andr{\'{e}}s{-}Herrero and
Juan Carlos Garc{\'{\i}}a{-}Davalillo and
Diego Gonz{\'{a}}lez{-}Aguilera and
Mario Hern{\'{a}}ndez Ruiz and
Luis Jord{\'{a}} Bordehore and
Carlos L{\'{o}}pez Carnicero and
Roc{\'{\i}}o Mora},
title = {On the Combination of Remote Sensing and Geophysical Methods for the
Digitalization of the San L{\'{a}}zaro Middle Paleolithic Rock
Shelter (Segovia, Central Iberia, Spain)},
journal = {Remote. Sens.},
volume = {11},
number = {17},
pages = {2035},
year = {2019},
url = {https://doi.org/10.3390/rs11172035},
doi = {10.3390/RS11172035},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/Mate-GonzalezSB19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/QSS19,
author = {J. Antonio Guzm{\'{a}}n Q. and
G. Arturo Sanchez{-}Azofeifa and
Mario Marcos do Espirito Santo},
title = {{MODIS} and {PROBA-V} {NDVI} Products Differ when Compared with Observations
from Phenological Towers at Four Tropical Dry Forests in the Americas},
journal = {Remote. Sens.},
volume = {11},
number = {19},
pages = {2316},
year = {2019},
url = {https://doi.org/10.3390/rs11192316},
doi = {10.3390/RS11192316},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/QSS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/Sanchez-Rodriguez19,
author = {Ana S{\'{a}}nchez{-}Rodr{\'{\i}}guez and
Mario Soil{\'{a}}n and
Manuel Cabaleiro and
Pedro Arias},
title = {Automated Inspection of Railway Tunnels' Power Line Using LiDAR Point
Clouds},
journal = {Remote. Sens.},
volume = {11},
number = {21},
pages = {2567},
year = {2019},
url = {https://doi.org/10.3390/rs11212567},
doi = {10.3390/RS11212567},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/remotesensing/Sanchez-Rodriguez19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/TomasPNCPRCCBML19,
author = {Roberto Tom{\'{a}}s and
Jos{\'{e}} Ignacio Pag{\'{a}}n and
Jos{\'{e}} A. Navarro and
Miguel Cano and
Jos{\'{e}} Luis Pastor and
Adri{\'{a}}n J. Riquelme and
Mar{\'{\i}}a Cuevas{-}Gonz{\'{a}}lez and
Michele Crosetto and
Anna Barra and
Oriol Monserrat and
Juan M. Lopez{-}Sanchez and
Alfredo Ram{\'{o}}n and
Salvador Ivorra and
Matteo Del Soldato and
Lorenzo Solari and
Silvia Bianchini and
Federico Raspini and
Fabrizio Novali and
Alessandro Ferretti and
Mario Costantini and
Francesco Trillo and
Gerardo Herrera and
Nicola Casagli},
title = {Semi-Automatic Identification and Pre-Screening of Geological-Geotechnical
Deformational Processes Using Persistent Scatterer Interferometry
Datasets},
journal = {Remote. Sens.},
volume = {11},
number = {14},
pages = {1675},
year = {2019},
url = {https://doi.org/10.3390/rs11141675},
doi = {10.3390/RS11141675},
timestamp = {Thu, 16 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/remotesensing/TomasPNCPRCCBML19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sivp/SanchezSAM19,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Luciano Agostini and
C{\'{e}}sar A. M. Marcon},
title = {Analysis of parallel encoding using tiles in 3D High Efficiency Video
Coding},
journal = {Signal Image Video Process.},
volume = {13},
number = {6},
pages = {1079--1086},
year = {2019},
url = {https://doi.org/10.1007/s11760-019-01450-3},
doi = {10.1007/S11760-019-01450-3},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sivp/SanchezSAM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/soco/PenaBLTPSMGC19,
author = {Alejandro Pe{\~{n}}a and
Isis Bonet and
Christian Lochmuller and
Marta S. Tabares and
Carlos C. Piedrahita and
Carmen C. S{\'{a}}nchez and
Lillyana Mar{\'{\i}}a Giraldo Mar{\'{\i}}n and
Mario Gongora and
Francisco Chiclana},
title = {A fuzzy {ELECTRE} structure methodology to assess big data maturity
in healthcare SMEs},
journal = {Soft Comput.},
volume = {23},
number = {20},
pages = {10537--10550},
year = {2019},
url = {https://doi.org/10.1007/s00500-018-3625-8},
doi = {10.1007/S00500-018-3625-8},
timestamp = {Tue, 03 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/soco/PenaBLTPSMGC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/WuMS19,
author = {Chenchen Wu and
Mario E. Maga{\~{n}}a and
Eduardo Cotilla Sanchez},
title = {Dynamic Frequency and Amplitude Estimation for Three-Phase Unbalanced
Power Systems Using the Unscented Kalman Filter},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {68},
number = {9},
pages = {3387--3395},
year = {2019},
url = {https://doi.org/10.1109/TIM.2018.2875605},
doi = {10.1109/TIM.2018.2875605},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tim/WuMS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/LaraSHVV19,
author = {Paola Lara and
Mario E. S{\'{a}}nchez and
Andrea Herrera and
Karol Valdivieso and
Jorge Villalobos},
editor = {Cinzia Cappiello and
Marcela Ruiz},
title = {Modeling Reverse Logistics Networks: {A} Case Study for {\unicode{8232}}E-Waste
Management Policy},
booktitle = {Information Systems Engineering in Responsible Information Systems
- CAiSE Forum 2019, Rome, Italy, June 3-7, 2019, Proceedings},
series = {Lecture Notes in Business Information Processing},
volume = {350},
pages = {158--169},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-21297-1\_14},
doi = {10.1007/978-3-030-21297-1\_14},
timestamp = {Fri, 31 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/caise/LaraSHVV19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cisis-spain/SanchezMDE19,
author = {Mar{\'{\i}}a Jes{\'{u}}s Santos S{\'{a}}nchez and
Mario Miguel and
Araceli Queiruga Dios and
Ascensi{\'{o}}n Hern{\'{a}}ndez Encinas},
editor = {Francisco Mart{\'{\i}}nez{-}{\'{A}}lvarez and
Alicia Troncoso Lora and
Jos{\'{e}} Ant{\'{o}}nio S{\'{a}}ez Mu{\~{n}}oz and
H{\'{e}}ctor Quinti{\'{a}}n and
Emilio Corchado},
title = {Looking for the Antidote for Contaminated Water: Learning Through
an Escape Game},
booktitle = {International Joint Conference: 12th International Conference on Computational
Intelligence in Security for Information Systems {(CISIS} 2019) and
10th International Conference on EUropean Transnational Education
{(ICEUTE} 2019) - Seville, Spain, May 13-15, 2019, Proceedings},
series = {Advances in Intelligent Systems and Computing},
volume = {951},
pages = {217--226},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-20005-3\_22},
doi = {10.1007/978-3-030-20005-3\_22},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cisis-spain/SanchezMDE19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/citi/Machorro-CanoPA19,
author = {Isaac Machorro{-}Cano and
Mario Andr{\'{e}}s Paredes{-}Valverde and
Giner Alor{-}Hern{\'{a}}ndez and
Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and
M{\'{o}}nica Guadalupe Segura Ozuna and
Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes},
editor = {Rafael Valencia{-}Garc{\'{\i}}a and
Gema Alcaraz{-}M{\'{a}}rmol and
Javier del Cioppo{-}Morstadt and
N{\'{e}}stor Vera{-}Lucio and
Martha Bucaram{-}Leverone},
title = {PESSHIoT: Smart Platform for Monitoring and Controlling Smart Home
Devices and Sensors},
booktitle = {Technologies and Innovation - 5th International Conference, {CITI}
2019, Guayaquil, Ecuador, December 2-5, 2019, Proceedings},
series = {Communications in Computer and Information Science},
volume = {1124},
pages = {137--150},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-34989-9\_11},
doi = {10.1007/978-3-030-34989-9\_11},
timestamp = {Thu, 19 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/citi/Machorro-CanoPA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clei/DivanR19,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
title = {Incorporating Scenarios and States Definitions on Real-Time Entity
Monitoring in PAbMM},
booktitle = {{XLV} Latin American Computing Conference, {CLEI} 2019, Panama, September
30 - October 4, 2019},
pages = {1--10},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CLEI47609.2019.235072},
doi = {10.1109/CLEI47609.2019.235072},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/clei/DivanR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conielecomp/Ordonez-Sanchez19,
author = {Alejandro A. Ordo{\~{n}}ez{-}S{\'{a}}nchez and
Omar Jim{\'{e}}nez{-}Ram{\'{\i}}rez and
Jos{\'{e}} A. C{\'{a}}rdenas{-}Valderrama and
Mario Alan Quiroz{-}Ju{\'{a}}rez and
Leonardo Palacios{-}Luengas and
Rub{\'{e}}n V{\'{a}}zquez{-}Medina},
title = {Generator of Synthetic Dopaminergic Signals},
booktitle = {International Conference on Electronics, Communications and Computers,
{CONIELECOMP} 2019, Cholula, Mexico, February 27 - March 1, 2019},
pages = {31--35},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CONIELECOMP.2019.8673110},
doi = {10.1109/CONIELECOMP.2019.8673110},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/conielecomp/Ordonez-Sanchez19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci-collab/LopezGAMCS19,
author = {Mario Rossainz L{\'{o}}pez and
Carmen Cer{\'{o}}n Garnica and
Etelvina Archundia{-}Sierra and
Ana Patricia Cervantes M{\'{a}}rquez and
David Carrasco{-}Lim{\'{o}}n and
B{\'{a}}rbara S{\'{a}}nchez{-}Rinza},
editor = {Pablo H. Ruiz and
Vanessa Agredo Delgado},
title = {Parallel Simulation of Digital Logic Circuits Using Message Passing
via {CSP} as an Educational Tool},
booktitle = {Human-Computer Interaction - 5th Iberoamerican Workshop, HCI-Collab
2019, Puebla, Mexico, June 19-21, 2019, Revised Selected Papers},
series = {Communications in Computer and Information Science},
volume = {1114},
pages = {284--298},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-37386-3\_21},
doi = {10.1007/978-3-030-37386-3\_21},
timestamp = {Fri, 31 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hci-collab/LopezGAMCS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci-collab/Sanchez-GalvezL19,
author = {Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Juan Manuel Fern{\'{a}}ndez Luna and
Mario Anzures{-}Garc{\'{\i}}a},
editor = {Pablo H. Ruiz and
Vanessa Agredo Delgado},
title = {A Groupware Usability-Oriented Evaluation Methodology Based on a Fuzzy
Linguistic Approach},
booktitle = {Human-Computer Interaction - 5th Iberoamerican Workshop, HCI-Collab
2019, Puebla, Mexico, June 19-21, 2019, Revised Selected Papers},
series = {Communications in Computer and Information Science},
volume = {1114},
pages = {1--16},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-37386-3\_1},
doi = {10.1007/978-3-030-37386-3\_1},
timestamp = {Fri, 31 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hci-collab/Sanchez-GalvezL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/Lopez-TapiaRASF19,
author = {Andrea L{\'{o}}pez{-}Tapia and
Mario Alfredo Reyes{-}Barranca and
Griselda Stephany Abarca{-}Jimenez and
Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
Luis Mart{\'{\i}}n Flores{-}Nava and
Oliverio Arellano{-}C{\'{a}}rdenas},
title = {Design and analysis of the mechanical structure of a linear micromotor
based on {CMOS-MEMS} technology},
booktitle = {16th International Conference on Electrical Engineering, Computing
Science and Automatic Control, {CCE} 2019, Mexico City, Mexico, September
11-13, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICEEE.2019.8884566},
doi = {10.1109/ICEEE.2019.8884566},
timestamp = {Fri, 27 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iceee/Lopez-TapiaRASF19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/Sanchez-Marquez19,
author = {Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
Mario Alfredo Reyes{-}Barranca and
Griselda Stephany Abarca{-}Jimenez and
Andrea L{\'{o}}pez{-}Tapia and
Luis Mart{\'{\i}}n Flores{-}Nava and
Oliverio Arellano{-}C{\'{a}}rdenas},
title = {Proposal of a speed sensor based on {FGMOS} for a {MEMS} rotatory
micromotor},
booktitle = {16th International Conference on Electrical Engineering, Computing
Science and Automatic Control, {CCE} 2019, Mexico City, Mexico, September
11-13, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICEEE.2019.8884574},
doi = {10.1109/ICEEE.2019.8884574},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iceee/Sanchez-Marquez19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/BernabeGFPHPP19,
author = {Sergio Bernab{\'{e}} and
Carlos Garc{\'{\i}}a and
Rub{\'{e}}n Fern{\'{a}}ndez{-}Beltran and
Mercedes Eugenia Paoletti and
Juan Mario Haut and
Javier Plaza and
Antonio Plaza},
title = {Open Multi-Processing Acceleration for Unsupervised Land Cover Categorization
Using Probabilistic Latent Semantic Analysis},
booktitle = {2019 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2019, Yokohama, Japan, July 28 - August 2, 2019},
pages = {9835--9838},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/IGARSS.2019.8898507},
doi = {10.1109/IGARSS.2019.8898507},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/BernabeGFPHPP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/SaldanhaSZMA19,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
Bruno Zatt and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {{TITAN:} Tile Timing-Aware Balancing Algorithm for Speeding Up the
3D-HEVC Intra Coding},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2019,
Sapporo, Japan, May 26-29, 2019},
pages = {1--5},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISCAS.2019.8702475},
doi = {10.1109/ISCAS.2019.8702475},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/SaldanhaSZMA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwann/DavilaGPDSR19,
author = {Carlos D{\'{a}}vila and
Mario Gonz{\'{a}}lez and
Jorge Luis P{\'{e}}rez{-}Medina and
David Dominguez and
{\'{A}}ngel S{\'{a}}nchez and
Francisco B. Rodr{\'{\i}}guez},
editor = {Ignacio Rojas and
Gonzalo Joya and
Andreu Catal{\`{a}}},
title = {Ensemble of Attractor Networks for 2D Gesture Retrieval},
booktitle = {Advances in Computational Intelligence - 15th International Work-Conference
on Artificial Neural Networks, {IWANN} 2019, Gran Canaria, Spain,
June 12-14, 2019, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {11507},
pages = {488--499},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-20518-8\_41},
doi = {10.1007/978-3-030-20518-8\_41},
timestamp = {Sat, 01 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iwann/DavilaGPDSR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwann/GonzalezDDSR19,
author = {Mario Gonz{\'{a}}lez and
Carlos D{\'{a}}vila and
David Dominguez and
{\'{A}}ngel S{\'{a}}nchez and
Francisco B. Rodr{\'{\i}}guez},
editor = {Ignacio Rojas and
Gonzalo Joya and
Andreu Catal{\`{a}}},
title = {Fingerprint Retrieval Using a Specialized Ensemble of Attractor Networks},
booktitle = {Advances in Computational Intelligence - 15th International Work-Conference
on Artificial Neural Networks, {IWANN} 2019, Gran Canaria, Spain,
June 12-14, 2019, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {11507},
pages = {709--719},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-20518-8\_59},
doi = {10.1007/978-3-030-20518-8\_59},
timestamp = {Sat, 01 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iwann/GonzalezDDSR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwann/Nimo-JarquezRRY19,
author = {Dami{\'{a}}n Nimo{-}J{\'{a}}rquez and
Magaly Margarita Narvaez{-}Rios and
Mario Rivas{-}S{\'{a}}nchez and
Andr{\'{e}}s Y{\'{a}}{\~{n}}ez and
Guillermo B{\'{a}}rcena{-}Gonz{\'{a}}lez and
Maria De La Paz Guerrero{-}Lebrero and
Elisa Guerrero and
Pedro L. Galindo},
editor = {Ignacio Rojas and
Gonzalo Joya and
Andreu Catal{\`{a}}},
title = {{AL4LA:} Active Learning for Text Labeling Based on Paragraph Vectors},
booktitle = {Advances in Computational Intelligence - 15th International Work-Conference
on Artificial Neural Networks, {IWANN} 2019, Gran Canaria, Spain,
June 12-14, 2019, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {11506},
pages = {679--687},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-20521-8\_56},
doi = {10.1007/978-3-030-20521-8\_56},
timestamp = {Tue, 16 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iwann/Nimo-JarquezRRY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19,
author = {Ziawasch Abedjan and
Nozha Boujemaa and
Stuart Campbell and
Patricia Casla and
Supriyo Chatterjea and
Sergio Consoli and
Crist{\'{o}}bal Costa Soria and
Paul Czech and
Marija Despenic and
Chiara Garattini and
Dirk Hamelinck and
Adrienne Heinrich and
Wessel Kraaij and
Jacek Kustra and
Aizea Lojo and
Marga Martin Sanchez and
Miguel Angel Mayer and
Matteo Melideo and
Ernestina Menasalvas and
Frank M{\o}ller Aarestrup and
Elvira Narro Artigot and
Milan Petkovic and
Diego Reforgiato Recupero and
Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
Gisele Roesems Kerremans and
Roland Roller and
M{\'{a}}rio Rom{\~{a}}o and
Stefan R{\"{u}}ping and
Felix Sasaki and
Wouter Spek and
Nenad Stojanovic and
Jack Thoms and
Andrejs Vasiljevs and
Wilfried Verachtert and
Roel Wuyts},
editor = {Sergio Consoli and
Diego Reforgiato Recupero and
Milan Petkovic},
title = {Data Science in Healthcare: Benefits, Challenges and Opportunities},
booktitle = {Data Science for Healthcare - Methodologies and Applications},
pages = {3--38},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-05249-2\_1},
doi = {10.1007/978-3-030-05249-2\_1},
timestamp = {Fri, 22 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/igisc/2019,
editor = {Oscar S. Siordia and
Jos{\'{e}} Luis Silv{\'{a}}n{-}C{\'{a}}rdenas and
Alejandro Molina{-}Villegas and
Gandhi Hern{\'{a}}ndez{-}Chan and
Pablo L{\'{o}}pez{-}Ram{\'{\i}}rez and
Rodrigo Tapia{-}McClung and
Karime Gonz{\'{a}}lez Zuccolotto and
Mario Chirinos Colunga},
title = {Proceedings of the 1st International Conference on Geospatial Information
Sciences, iGISc 2019, M{\'{e}}rida, Yucat{\'{a}}n, M{\'{e}}xico,
October 23-25, 2019},
series = {Kalpa Publications in Computing},
volume = {13},
publisher = {EasyChair},
year = {2019},
url = {https://easychair.org/publications/volume/iGISc\_2019},
timestamp = {Fri, 10 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igisc/2019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-07066,
author = {Claudia N. S{\'{a}}nchez and
Mario Graff},
title = {Selection Heuristics on Semantic Genetic Programming for Classification
Problems},
journal = {CoRR},
volume = {abs/1907.07066},
year = {2019},
url = {http://arxiv.org/abs/1907.07066},
eprinttype = {arXiv},
eprint = {1907.07066},
timestamp = {Tue, 23 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1907-07066.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/candc/ModicaSPOMC18,
author = {Maria Vittoria Modica and
Jonathan Reinoso S{\'{a}}nchez and
Andrea Pasquadibisceglie and
Marco Oliverio and
Paolo Mariottini and
Manuela Cervelli},
title = {Anti-haemostatic compounds from the vampire snail \emph{Cumia reticulata}:
Molecular cloning and \emph{in-silico} structure-function analysis},
journal = {Comput. Biol. Chem.},
volume = {75},
pages = {168--177},
year = {2018},
url = {https://doi.org/10.1016/j.compbiolchem.2018.05.014},
doi = {10.1016/J.COMPBIOLCHEM.2018.05.014},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/candc/ModicaSPOMC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/comcom/Sanchez-GarciaG18,
author = {Jes{\'{u}}s S{\'{a}}nchez{-}Garc{\'{\i}}a and
Jos{\'{e}} M. Garc{\'{\i}}a{-}Campos and
Mario Arzamendia and
Daniel Guti{\'{e}}rrez{-}Reina and
Sergio L. Toral Mar{\'{\i}}n and
Derlis Gregor},
title = {A survey on unmanned aerial and aquatic vehicle multi-hop networks:
Wireless communications, evaluation tools and applications},
journal = {Comput. Commun.},
volume = {119},
pages = {43--65},
year = {2018},
url = {https://doi.org/10.1016/j.comcom.2018.02.002},
doi = {10.1016/J.COMCOM.2018.02.002},
timestamp = {Tue, 15 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/comcom/Sanchez-GarciaG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/Anzures-GarciaS18,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Miguel J. Hornos and
Patricia Paderewski{-}Rodr{\'{\i}}guez},
title = {A Workflow Ontology to support Knowledge Management in a Group's organizational
structure},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {22},
number = {1},
year = {2018},
url = {https://doi.org/10.13053/cys-22-1-2781},
doi = {10.13053/CYS-22-1-2781},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cys/Anzures-GarciaS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/GonzalezSDA18,
author = {Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
Jorge Cerezo S{\'{a}}nchez and
Mario Bustillo D{\'{\i}}az and
Apolonio Ata{-}P{\'{e}}rez},
title = {Recognition and Classification of Sign Language for Spanish},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {22},
number = {1},
year = {2018},
url = {https://doi.org/10.13053/cys-22-1-2780},
doi = {10.13053/CYS-22-1-2780},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cys/GonzalezSDA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/Saldana-Gonzalez18,
author = {Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
Jorge Cerezo S{\'{a}}nchez and
Mario Bustillo D{\'{\i}}az and
Apolonio Ata{-}P{\'{e}}rez},
title = {Vision System for the Navigation of a Mobile Robot},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {22},
number = {1},
year = {2018},
url = {https://doi.org/10.13053/cys-22-1-2770},
doi = {10.13053/CYS-22-1-2770},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cys/Saldana-Gonzalez18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/Sanchez-ReyesRT18,
author = {Sergio S{\'{a}}nchez{-}Reyes and
Mario E. Rivero{-}Angeles and
No{\'{e}} Torres{-}Cruz},
title = {Teletraffic Analysis for VoIP Services in {WLAN} Systems with Handoff
Capabilities},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {22},
number = {3},
year = {2018},
url = {https://doi.org/10.13053/cys-22-3-2749},
doi = {10.13053/CYS-22-3-2749},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cys/Sanchez-ReyesRT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fini/Ruiz-GomezGPMTC18,
author = {Sa{\'{u}}l J. Ruiz{-}G{\'{o}}mez and
Carlos G{\'{o}}mez and
Jes{\'{u}}s Poza and
Mario Mart{\'{\i}}nez{-}Zarzuela and
Miguel {\'{A}}ngel Tola{-}Arribas and
M{\'{o}}nica Cano and
Roberto Hornero},
title = {Measuring Alterations of Spontaneous {EEG} Neural Coupling in Alzheimer's
Disease and Mild Cognitive Impairment by Means of Cross-Entropy Metrics},
journal = {Frontiers Neuroinformatics},
volume = {12},
pages = {76},
year = {2018},
url = {https://doi.org/10.3389/fninf.2018.00076},
doi = {10.3389/FNINF.2018.00076},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fini/Ruiz-GomezGPMTC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-spr/MunozMS18,
author = {Juan Pablo Mu{\~{n}}oz and
Mario E. Maga{\~{n}}a and
Eduardo Cotilla Sanchez},
title = {Adaptive master-slave unscented Kalman filter for grid voltage frequency
estimation},
journal = {{IET} Signal Process.},
volume = {12},
number = {4},
pages = {496--505},
year = {2018},
url = {https://doi.org/10.1049/iet-spr.2016.0199},
doi = {10.1049/IET-SPR.2016.0199},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iet-spr/MunozMS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jifs/PenaCAJLMGS18,
author = {Mario Pe{\~{n}}a and
Mariela Cerrada and
Ximena Alvarez and
Diana Jad{\'{a}}n and
Pablo Lucero and
Barrag{\'{a}}n Milton and
Rodrigo Guam{\'{a}}n and
Ren{\'{e}}{-}Vinicio S{\'{a}}nchez},
title = {Feature engineering based on ANOVA, cluster validity assessment and
{KNN} for fault diagnosis in bearings},
journal = {J. Intell. Fuzzy Syst.},
volume = {34},
number = {6},
pages = {3451--3462},
year = {2018},
url = {https://doi.org/10.3233/JIFS-169525},
doi = {10.3233/JIFS-169525},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jifs/PenaCAJLMGS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jucs/Bustos-LopezASS18,
author = {Maritza Bustos{-}L{\'{o}}pez and
Giner Alor{-}Hern{\'{a}}ndez and
Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and
Mario Andr{\'{e}}s Paredes{-}Valverde},
title = {EduRP: an Educational Resources Platform based on Opinion Mining and
Semantic Web},
journal = {J. Univers. Comput. Sci.},
volume = {24},
number = {11},
pages = {1515--1535},
year = {2018},
url = {http://www.jucs.org/jucs\_24\_11/edurp\_an\_educational\_resources},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jucs/Bustos-LopezASS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/DiazLSVL18,
author = {Enrique D{\'{\i}}az and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Mario Serna and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca}},
title = {Planificaci{\'{o}}n reactiva de movimientos en tiempo real para
robots m{\'{o}}viles},
journal = {Res. Comput. Sci.},
volume = {147},
number = {7},
pages = {115--128},
year = {2018},
url = {https://rcs.cic.ipn.mx/2018\_147\_7/Planificacion\%20reactiva\%20de\%20movimientos\%20en\%20tiempo\%20real\%20para\%20robots\%20moviles.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/DiazLSVL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Lopez-RamirezMS18,
author = {Pablo L{\'{o}}pez{-}Ram{\'{\i}}rez and
Alejandro Molina{-}Villegas and
Oscar S{\'{a}}nchez Siordia and
Mario Chirinos Colunga and
Gandhi Hern{\'{a}}ndez{-}Chan},
title = {Regular Activity Patterns in Spatio-Temporal Events Databases: Multi-Scale
Extraction of Geolocated Tweets},
journal = {Res. Comput. Sci.},
volume = {147},
number = {12},
pages = {137--150},
year = {2018},
url = {https://rcs.cic.ipn.mx/2018\_147\_12/Regular\%20Activity\%20Patterns\%20in\%20Spatio-Temporal\%20Events\%20Databases\_\%20Multi-Scale\%20Extraction.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/Lopez-RamirezMS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/Nieto-HidalgoGG18,
author = {Mario Nieto{-}Hidalgo and
Antonio Javier Gallego and
Pablo Gil and
Antonio Pertusa},
title = {Two-Stage Convolutional Neural Network for Ship and Spill Detection
Using {SLAR} Images},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {56},
number = {9},
pages = {5217--5230},
year = {2018},
url = {https://doi.org/10.1109/TGRS.2018.2812619},
doi = {10.1109/TGRS.2018.2812619},
timestamp = {Fri, 02 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/Nieto-HidalgoGG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/MorianoRBMR18,
author = {Javier Moriano and
Mario Rizo and
Emilio Jos{\'{e}} Bueno and
Rocio Martin and
Francisco J. Rodr{\'{\i}}guez},
title = {A Novel Multifrequency Current Reference Calculation to Mitigate Active
Power Fluctuations},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {65},
number = {1},
pages = {810--818},
year = {2018},
url = {https://doi.org/10.1109/TIE.2017.2686319},
doi = {10.1109/TIE.2017.2686319},
timestamp = {Thu, 25 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/MorianoRBMR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/OsorioAVPSMB18,
author = {Ren{\'{e}} Osorio and
J. Marcos Alonso and
Nimrod V{\'{a}}zquez and
Sergio Pinto and
Felipe De Jesus Sorcia{-}Vazquez and
Mario Mart{\'{\i}}nez{-}Garc{\'{\i}}a and
Luis Manuel Barrera},
title = {Fuzzy Logic Control With an Improved Algorithm for Integrated {LED}
Drivers},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {65},
number = {9},
pages = {6994--7003},
year = {2018},
url = {https://doi.org/10.1109/TIE.2018.2795565},
doi = {10.1109/TIE.2018.2795565},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/OsorioAVPSMB18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/urban/OrganeroRF18,
author = {Mario Mu{\~{n}}oz Organero and
Ramona Ruiz{-}Blazquez and
Luis S{\'{a}}nchez Fern{\'{a}}ndez},
title = {Automatic detection of traffic lights, street crossings and urban
roundabouts combining outlier detection and deep learning classification
techniques based on {GPS} traces while driving},
journal = {Comput. Environ. Urban Syst.},
volume = {68},
pages = {1--8},
year = {2018},
url = {https://doi.org/10.1016/j.compenvurbsys.2017.09.005},
doi = {10.1016/J.COMPENVURBSYS.2017.09.005},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/urban/OrganeroRF18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcis/RomeroSV18,
author = {Mar{\'{\i}}a Camila Romero and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Executable Business Model Blueprints},
booktitle = {24th Americas Conference on Information Systems, {AMCIS} 2018, New
Orleans, LA, USA, August 16-18, 2018},
publisher = {Association for Information Systems},
year = {2018},
url = {https://aisel.aisnet.org/amcis2018/Enterprise/Presentations/5},
timestamp = {Mon, 22 Oct 2018 17:24:45 +0200},
biburl = {https://dblp.org/rec/conf/amcis/RomeroSV18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/appis/Barcena-Gonzalez18,
author = {Guillermo B{\'{a}}rcena{-}Gonz{\'{a}}lez and
Maria De La Paz Guerrero{-}Lebrero and
Elisa Guerrero and
D. F. Reyes and
B. Nu{\~{n}}ez{-}Moraleda and
Mario Rivas{-}S{\'{a}}nchez and
Andr{\'{e}}s Y{\'{a}}{\~{n}}ez and
David Gonz{\'{a}}lez and
Pedro L. Galindo},
editor = {Nicolai Petkov and
Nicola Strisciuglio and
Carlos Manuel Travieso{-}Gonz{\'{a}}lez},
title = {Application of Super-Resolution Techniques to Transmission Electron
Microscopy Images},
booktitle = {Applications of Intelligent Systems - Proceedings of the 1st International
{APPIS} Conference 2018, Las Palmas de Gran Canaria, Spain, 8-12 January
2018},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {310},
pages = {42--49},
publisher = {{IOS} Press},
year = {2018},
url = {https://doi.org/10.3233/978-1-61499-929-4-42},
doi = {10.3233/978-1-61499-929-4-42},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/appis/Barcena-Gonzalez18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccia/GatziouraSJ18,
author = {Anna Gatzioura and
Miquel S{\`{a}}nchez{-}Marr{\`{e}} and
Al{\'{\i}}pio M{\'{a}}rio Jorge},
editor = {Zoe Falomir and
Karina Gibert and
Enric Plaza},
title = {A Study on Contextual Influences on Automatic Playlist Continuation},
booktitle = {Artificial Intelligence Research and Development - Current Challenges,
New Trends and Applications, {CCIA} 2018, 21st International Conference
of the Catalan Association for Artificial Intelligence, Alt Empord{\`{a}},
Catalonia, Spain, 8-10th October 2018},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {308},
pages = {156--165},
publisher = {{IOS} Press},
year = {2018},
url = {https://doi.org/10.3233/978-1-61499-918-8-156},
doi = {10.3233/978-1-61499-918-8-156},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ccia/GatziouraSJ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/citi/Ochoa-Hernandez18,
author = {Jos{\'{e}} Luis Ochoa{-}Hern{\'{a}}ndez and
Mario Barcelo{-}Valenzuela and
Gerardo Sanchez{-}Schmitz and
Raquel Torres Peralta},
editor = {Rafael Valencia{-}Garc{\'{\i}}a and
Gema Alcaraz{-}M{\'{a}}rmol and
Javier del Cioppo{-}Morstadt and
N{\'{e}}stor Vera{-}Lucio and
Martha Bucaram{-}Leverone},
title = {Concept Identification from Single-Documents},
booktitle = {Technologies and Innovation - 4th International Conference, {CITI}
2018, Guayaquil, Ecuador, November 6-9, 2018, Proceedings},
series = {Communications in Computer and Information Science},
volume = {883},
pages = {158--173},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-00940-3\_12},
doi = {10.1007/978-3-030-00940-3\_12},
timestamp = {Tue, 16 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/citi/Ochoa-Hernandez18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/AlmagroMIP18,
author = {Mario Almagro and
Soto Montalvo and
Arantza D{\'{\i}}az de Ilarraza and
Alicia P{\'{e}}rez},
editor = {Linda Cappellato and
Nicola Ferro and
Jian{-}Yun Nie and
Laure Soulier},
title = {{MAMTRA-MED} at {CLEF} eHealth 2018: {A} Combination of Information
Retrieval Techniques and Neural Networks for {ICD-10} Coding of Death
Certificates},
booktitle = {Working Notes of {CLEF} 2018 - Conference and Labs of the Evaluation
Forum, Avignon, France, September 10-14, 2018},
series = {{CEUR} Workshop Proceedings},
volume = {2125},
publisher = {CEUR-WS.org},
year = {2018},
url = {https://ceur-ws.org/Vol-2125/paper\_110.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:36 +0100},
biburl = {https://dblp.org/rec/conf/clef/AlmagroMIP18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/KristanLMFPZVBL18,
author = {Matej Kristan and
Ales Leonardis and
Jiri Matas and
Michael Felsberg and
Roman P. Pflugfelder and
Luka Cehovin Zajc and
Tom{\'{a}}s Voj{\'{\i}}r and
Goutam Bhat and
Alan Lukezic and
Abdelrahman Eldesokey and
Gustavo Fern{\'{a}}ndez and
{\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and
{\'{A}}lvaro Iglesias{-}Arias and
A. Aydin Alatan and
Abel Gonz{\'{a}}lez{-}Garc{\'{\i}}a and
Alfredo Petrosino and
Alireza Memarmoghadam and
Andrea Vedaldi and
Andrej Muhic and
Anfeng He and
Arnold W. M. Smeulders and
Asanka G. Perera and
Bo Li and
Boyu Chen and
Changick Kim and
Changsheng Xu and
Changzhen Xiong and
Cheng Tian and
Chong Luo and
Chong Sun and
Cong Hao and
Daijin Kim and
Deepak Mishra and
Deming Chen and
Dong Wang and
Dongyoon Wee and
Efstratios Gavves and
Erhan Gundogdu and
Erik Velasco{-}Salido and
Fahad Shahbaz Khan and
Fan Yang and
Fei Zhao and
Feng Li and
Francesco Battistone and
George De Ath and
Gorthi R. K. Sai Subrahmanyam and
Guilherme Sousa Bastos and
Haibin Ling and
Hamed Kiani Galoogahi and
Hankyeol Lee and
Haojie Li and
Haojie Zhao and
Heng Fan and
Honggang Zhang and
Horst Possegger and
Houqiang Li and
Huchuan Lu and
Hui Zhi and
Huiyun Li and
Hyemin Lee and
Hyung Jin Chang and
Isabela Drummond and
Jack Valmadre and
Jaime Spencer Martin and
Javaan Singh Chahl and
Jin Young Choi and
Jing Li and
Jinqiao Wang and
Jinqing Qi and
Jinyoung Sung and
Joakim Johnander and
Jo{\~{a}}o F. Henriques and
Jongwon Choi and
Joost van de Weijer and
Jorge Rodr{\'{\i}}guez Herranz and
Jos{\'{e}} M. Mart{\'{\i}}nez and
Josef Kittler and
Junfei Zhuang and
Junyu Gao and
Klemen Grm and
Lichao Zhang and
Lijun Wang and
Lingxiao Yang and
Litu Rout and
Liu Si and
Luca Bertinetto and
Lutao Chu and
Manqiang Che and
Mario Edoardo Maresca and
Martin Danelljan and
Ming{-}Hsuan Yang and
Mohamed H. Abdelpakey and
Mohamed S. Shehata and
Myunggu Kang and
Namhoon Lee and
Ning Wang and
Ondrej Miksik and
Payman Moallem and
Pablo Vicente{-}Mo{\~{n}}ivar and
Pedro Senna and
Peixia Li and
Philip H. S. Torr and
Priya Mariam Raju and
Ruihe Qian and
Qiang Wang and
Qin Zhou and
Qing Guo and
Rafael Martin Nieto and
Rama Krishna Sai Subrahmanyam Gorthi and
Ran Tao and
Richard Bowden and
Richard M. Everson and
Runling Wang and
Sangdoo Yun and
Seokeon Choi and
Sergio Vivas and
Shuai Bai and
Shuangping Huang and
Sihang Wu and
Simon Hadfield and
Siwen Wang and
Stuart Golodetz and
Ming Tang and
Tianyang Xu and
Tianzhu Zhang and
Tobias Fischer and
Vincenzo Santopietro and
Vitomir Struc and
Wei Wang and
Wangmeng Zuo and
Wei Feng and
Wei Wu and
Wei Zou and
Weiming Hu and
Wengang Zhou and
Wenjun Zeng and
Xiaofan Zhang and
Xiaohe Wu and
Xiao{-}Jun Wu and
Xinmei Tian and
Yan Li and
Yan Lu and
Yee Wei Law and
Yi Wu and
Yiannis Demiris and
Yicai Yang and
Yifan Jiao and
Yuhong Li and
Yunhua Zhang and
Yuxuan Sun and
Zheng Zhang and
Zheng Zhu and
Zhen{-}Hua Feng and
Zhihui Wang and
Zhiqun He},
editor = {Laura Leal{-}Taix{\'{e}} and
Stefan Roth},
title = {The Sixth Visual Object Tracking {VOT2018} Challenge Results},
booktitle = {Computer Vision - {ECCV} 2018 Workshops - Munich, Germany, September
8-14, 2018, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {11129},
pages = {3--53},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-11009-3\_1},
doi = {10.1007/978-3-030-11009-3\_1},
timestamp = {Mon, 26 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eccv/KristanLMFPZVBL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/SaldanhaSMA18,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Volcan Agostini},
title = {Fast 3D-Hevc Depth Maps Intra-Frame Prediction Using Data Mining},
booktitle = {2018 {IEEE} International Conference on Acoustics, Speech and Signal
Processing, {ICASSP} 2018, Calgary, AB, Canada, April 15-20, 2018},
pages = {1738--1742},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ICASSP.2018.8462283},
doi = {10.1109/ICASSP.2018.8462283},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/SaldanhaSMA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipmu/ValdezGLG18,
author = {Mario Garc{\'{\i}}a Valdez and
Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Lucero Lara and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez},
editor = {Jes{\'{u}}s Medina and
Manuel Ojeda{-}Aciego and
Jos{\'{e}} Luis Verdegay Galdeano and
Irina Perfilieva and
Bernadette Bouchon{-}Meunier and
Ronald R. Yager},
title = {Increasing Performance via Gamification in a Volunteer-Based Evolutionary
Computation System},
booktitle = {Information Processing and Management of Uncertainty in Knowledge-Based
Systems. Applications - 17th International Conference, {IPMU} 2018,
C{\'{a}}diz, Spain, June 11-15, 2018, Proceedings, Part {III}},
series = {Communications in Computer and Information Science},
volume = {855},
pages = {342--353},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-319-91479-4\_29},
doi = {10.1007/978-3-319-91479-4\_29},
timestamp = {Thu, 07 Jan 2021 08:57:40 +0100},
biburl = {https://dblp.org/rec/conf/ipmu/ValdezGLG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ni/GarciaMFNMS18,
author = {Jessica Juarez Garc{\'{\i}}a and
Adriana Jord{\'{a}}n Morales and
Lizbeth Garc{\'{\i}}a Fern{\'{a}}ndez and
Reyna Rosas Negrete and
Mario Enrique Rend{\'{o}}n Macias and
Sylvia Claudine Ram{\'{\i}}rez S{\'{a}}nchez},
editor = {Ann Kristin Roteg{\aa}rd and
Diane J. Skiba and
Sayonara F. F. Barbosa and
Angelica G. Davalos Alc{\'{a}}zar},
title = {Use of Distraction to Reduce Pain in Venipunture when a Venoclysis
Is Placed},
booktitle = {Nursing Informatics 2018 - {ICT} to Improve Quality and Safety at
the Point of Care, Proceedings of the 14th International Congress
on Nursing Informatics, Guadalajara, Mexico, June 6-8, 2018},
series = {Studies in Health Technology and Informatics},
volume = {250},
pages = {24--25},
publisher = {{IOS} Press},
year = {2018},
url = {https://doi.org/10.3233/978-1-61499-872-3-24},
doi = {10.3233/978-1-61499-872-3-24},
timestamp = {Tue, 09 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ni/GarciaMFNMS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rice/SanchezGSG18,
author = {Claudia N. S{\'{a}}nchez and
Sebasti{\'{a}}n Guti{\'{e}}rrez and
Julieta Dom{\'{\i}}nguez{-}Soberanes and
Mario Graff},
title = {Landscape images distance using kullback leibler divergence},
booktitle = {Proceedings of the 2018 {IEEE} International Conference on Research
in Intelligent and Computing in Engineering, {RICE} 2018, San Salvador,
El Salvador, August 22-24, 2018},
pages = {1--5},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/RICE.2018.8627908},
doi = {10.1109/RICE.2018.8627908},
timestamp = {Tue, 23 Apr 2024 09:24:14 +0200},
biburl = {https://dblp.org/rec/conf/rice/SanchezGSG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbcci/SanchezSAM18,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Luciano Volcan Agostini and
C{\'{e}}sar A. M. Marcon},
title = {Hardware-Oriented Wedgelet Evaluation Skip for {DMM-1} in 3D-HEVC},
booktitle = {31st Symposium on Integrated Circuits and Systems Design, {SBCCI}
2018, Bento Gon{\c{c}}alves, RS, Brazil, August 27-31, 2018},
pages = {1--5},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/SBCCI.2018.8533231},
doi = {10.1109/SBCCI.2018.8533231},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sbcci/SanchezSAM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sepln/GraffMTMSOS18,
author = {Mario Graff and
Sabino Miranda{-}Jim{\'{e}}nez and
Eric Sadit Tellez and
Daniela Moctezuma and
Vladimir Salgado and
Jos{\'{e}} Ortiz{-}Bejar and
Claudia N. S{\'{a}}nchez},
editor = {Paolo Rosso and
Julio Gonzalo and
Raquel Mart{\'{\i}}nez and
Soto Montalvo and
Jorge Carrillo de Albornoz},
title = {{INGEOTEC} at {MEX-A3T:} Author Profiling and Aggressiveness Analysis
in Twitter Using {\(\mu\)}TC and EvoMSA},
booktitle = {Proceedings of the Third Workshop on Evaluation of Human Language
Technologies for Iberian Languages (IberEval 2018) co-located with
34th Conference of the Spanish Society for Natural Language Processing
{(SEPLN} 2018), Sevilla, Spain, September 18th, 2018},
series = {{CEUR} Workshop Proceedings},
volume = {2150},
pages = {128--133},
publisher = {CEUR-WS.org},
year = {2018},
url = {https://ceur-ws.org/Vol-2150/MEX-A3T\_paper6.pdf},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sepln/GraffMTMSOS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/NaranjoSMBG17,
author = {Claudia Carricarte Naranjo and
Lazaro M. Sanchez{-}Rodriguez and
Marta Brown Mart{\'{\i}}nez and
Mario Est{\'{e}}vez B{\'{a}}ez and
Andr{\'{e}}s Machado Garc{\'{\i}}a},
title = {Permutation entropy analysis of heart rate variability for the assessment
of cardiovascular autonomic neuropathy in type 1 diabetes mellitus},
journal = {Comput. Biol. Medicine},
volume = {86},
pages = {90--97},
year = {2017},
url = {https://doi.org/10.1016/j.compbiomed.2017.05.003},
doi = {10.1016/J.COMPBIOMED.2017.05.003},
timestamp = {Wed, 02 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cbm/NaranjoSMBG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/GonzalezDSR17,
author = {Mario Gonz{\'{a}}lez and
David Dominguez and
{\'{A}}ngel S{\'{a}}nchez and
Francisco B. Rodr{\'{\i}}guez},
title = {Increase attractor capacity using an ensembled neural network},
journal = {Expert Syst. Appl.},
volume = {71},
pages = {206--215},
year = {2017},
url = {https://doi.org/10.1016/j.eswa.2016.11.035},
doi = {10.1016/J.ESWA.2016.11.035},
timestamp = {Sat, 01 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eswa/GonzalezDSR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/TellezMGMSV17,
author = {Eric Sadit Tellez and
Sabino Miranda{-}Jim{\'{e}}nez and
Mario Graff and
Daniela Moctezuma and
Oscar S. Siordia and
Elio{-}Aten{\'{o}}genes Villase{\~{n}}or},
title = {A case study of Spanish text transformations for twitter sentiment
analysis},
journal = {Expert Syst. Appl.},
volume = {81},
pages = {457--471},
year = {2017},
url = {https://doi.org/10.1016/j.eswa.2017.03.071},
doi = {10.1016/J.ESWA.2017.03.071},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eswa/TellezMGMSV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ett/ContrerasCT17,
author = {David Contreras and
Mario Castro and
David S{\'{a}}nchez de la Torre},
title = {Performance evaluation of bluetooth low energy in indoor positioning
systems},
journal = {Trans. Emerg. Telecommun. Technol.},
volume = {28},
number = {1},
year = {2017},
url = {https://doi.org/10.1002/ett.2864},
doi = {10.1002/ETT.2864},
timestamp = {Wed, 04 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ett/ContrerasCT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcopi/LorancaAVLSD17,
author = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Mart{\'{\i}}n Estrada Analco and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Jorge Cerezo S{\'{a}}nchez and
Mario Bustillo D{\'{\i}}az},
title = {Quadratic Assignation Problem: {A} solution approach with parallel
{GRASP}},
journal = {Int. J. Comb. Optim. Probl. Informatics},
volume = {8},
number = {3},
pages = {33--38},
year = {2017},
url = {https://ijcopi.org/index.php/ojs/article/view/16},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijcopi/LorancaAVLSD17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcta/OsorioAPMVPM17,
author = {Ren{\'{e}} Osorio and
Jos{\'{e}} Marcos Alonso and
Sergio Pinto and
Gilberto Mart{\'{\i}}nez and
Nimrod V{\'{a}}zquez and
Mario Ponce{-}Silva and
A. J. Martinez},
title = {Simplified electrical modelling of power LEDs for {DC-DC} converter
analysis and simulation},
journal = {Int. J. Circuit Theory Appl.},
volume = {45},
number = {11},
pages = {1760--1772},
year = {2017},
url = {https://doi.org/10.1002/cta.2355},
doi = {10.1002/CTA.2355},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijcta/OsorioAPMVPM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jaihc/PastorMSNC17,
author = {Francisco Javier Ferr{\'{a}}ndez Pastor and
Higinio Mora Mora and
Jos{\'{e}}{-}Luis S{\'{a}}nchez{-}Romero and
Mario Nieto{-}Hidalgo and
Juan Manuel Garc{\'{\i}}a Chamizo},
title = {Interpreting human activity from electrical consumption data using
reconfigurable hardware and hidden Markov models},
journal = {J. Ambient Intell. Humaniz. Comput.},
volume = {8},
number = {4},
pages = {469--483},
year = {2017},
url = {https://doi.org/10.1007/s12652-016-0431-y},
doi = {10.1007/S12652-016-0431-Y},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jaihc/PastorMSNC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jrtip/SaldanhaSZPA17,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini},
title = {Energy-aware scheme for the 3D-HEVC depth maps prediction},
journal = {J. Real Time Image Process.},
volume = {13},
number = {1},
pages = {55--69},
year = {2017},
url = {https://doi.org/10.1007/s11554-016-0597-8},
doi = {10.1007/S11554-016-0597-8},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jrtip/SaldanhaSZPA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/Sanchez-de-Madariaga17,
author = {Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
Adolfo Mu{\~{n}}oz and
Raimundo Lozano{-}Rub{\'{\i}} and
Pablo Serrano{-}Balazote and
Antonio L. Castro and
Oscar Moreno and
Mario Pascual Carrasco},
title = {Examining database persistence of {ISO/EN} 13606 standardized electronic
health record extracts: relational vs. NoSQL approaches},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {17},
number = {1},
pages = {123:1--123:14},
year = {2017},
url = {https://doi.org/10.1186/s12911-017-0515-4},
doi = {10.1186/S12911-017-0515-4},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/Sanchez-de-Madariaga17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/DudasCBTBFPLAAB17,
author = {Gytis Dudas and
Luiz Max Carvalho and
Trevor Bedford and
Andrew J. Tatem and
Guy Baele and
Nuno R. Faria and
Daniel J. Park and
Jason T. Ladner and
Armando Arias and
Danny Asogun and
Filip Bielejec and
Sarah L. Caddy and
Matthew Cotten and
Jonathan D'Ambrozio and
Simon Dellicour and
Antonino Di Caro and
Joseph W. Diclaro and
Sophie Duraffour and
Michael J. Elmore and
Lawrence S. Fakoli and
Ousmane Faye and
Merle L. Gilbert and
Sahr M. Gevao and
Stephen Gire and
Adrianne Gladden{-}Young and
Andreas Gnirke and
Augustine Goba and
Donald S. Grant and
Bart L. Haagmans and
Julian A. Hiscox and
Umaru Jah and
Jeffrey R. Kugelman and
Di Liu and
Jia Lu and
Christine M. Malboeuf and
Suzanne Mate and
David A. Matthews and
Christian B. Matranga and
Luke W. Meredith and
James Qu and
Joshua Quick and
Suzan D. Pas and
My V. T. Phan and
Georgios Pollakis and
Chantal B. Reusken and
Mariano Sanchez{-}Lockhart and
Stephen F. Schaffner and
John S. Schieffelin and
Rachel S. G. Sealfon and
Etienne Simon{-}Loriere and
Saskia L. Smits and
Kilian Stoecker and
Lucy Thorne and
Ekaete Alice Tobin and
Mohamed A. Vandi and
Simon J. Watson and
Kendra West and
Shannon Whitmer and
Michael R. Wiley and
Sarah M. Winnicki and
Shirlee Wohl and
Roman W{\"{o}}lfel and
Nathan L. Yozwiak and
Kristian G. Andersen and
Sylvia O. Blyden and
Fatorma Bolay and
Miles W. Carroll and
Bernice Dahn and
Boubacar Diallo and
Pierre Formenty and
Christophe Fraser and
George F. Gao and
Robert F. Garry and
Ian Goodfellow and
Stephan G{\"{u}}nther and
Christian T. Happi and
Edward C. Holmes and
Brima Kargbo and
Sakoba Ke{\"{\i}}ta and
Paul Kellam and
Marion Koopmans and
Jens H. Kuhn and
Nicholas J. Loman and
N'Faly Magassouba and
Dhamari Naidoo and
Stuart T. Nichol and
Tolbert Nyenswah and
Gustavo F. Palacios and
Oliver G. Pybus and
Pardis C. Sabeti and
Amadou Sall and
Ute Str{\"{o}}her and
Isatta Wurie and
Marc A. Suchard and
Philippe Lemey and
Andrew Rambaut},
title = {Virus genomes reveal factors that spread and sustained the Ebola epidemic},
journal = {Nat.},
volume = {544},
number = {7650},
pages = {309--315},
year = {2017},
url = {https://doi.org/10.1038/nature22040},
doi = {10.1038/NATURE22040},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nature/DudasCBTBFPLAAB17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pdln/SanchezPVAA17,
author = {Francisco Garc{\'{\i}}a{-}S{\'{a}}nchez and
Mario Andr{\'{e}}s Paredes{-}Valverde and
Rafael Valencia{-}Garc{\'{\i}}a and
Gema Alcaraz{-}M{\'{a}}rmol and
{\'{A}}ngela Almela},
title = {{KBS4FIA:} Leveraging advanced knowledge-based systems for financial
information analysis},
journal = {Proces. del Leng. Natural},
volume = {59},
pages = {145--148},
year = {2017},
url = {http://journal.sepln.org/sepln/ojs/ojs/index.php/pln/article/view/5507},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pdln/SanchezPVAA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/TellezMGMSS17,
author = {Eric Sadit Tellez and
Sabino Miranda{-}Jim{\'{e}}nez and
Mario Graff and
Daniela Moctezuma and
Ranyart Rodrigo Su{\'{a}}rez and
Oscar S{\'{a}}nchez Siordia},
title = {A simple approach to multilingual polarity classification in Twitter},
journal = {Pattern Recognit. Lett.},
volume = {94},
pages = {68--74},
year = {2017},
url = {https://doi.org/10.1016/j.patrec.2017.05.024},
doi = {10.1016/J.PATREC.2017.05.024},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/prl/TellezMGMSS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sosym/Sanchez-Gonzalez17,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
F{\'{e}}lix Garc{\'{\i}}a and
Francisco Ruiz and
Mario Piattini},
title = {A case study about the improvement of business process models driven
by indicators},
journal = {Softw. Syst. Model.},
volume = {16},
number = {3},
pages = {759--788},
year = {2017},
url = {https://doi.org/10.1007/s10270-015-0482-0},
doi = {10.1007/S10270-015-0482-0},
timestamp = {Fri, 18 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sosym/Sanchez-Gonzalez17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/ReyesSPH17,
author = {Benjam{\'{\i}}n T. Reyes and
Raul M. Sanchez and
Ariel L. Pola and
Mario R. Hueda},
title = {Design and Experimental Evaluation of a Time-Interleaved {ADC} Calibration
Algorithm for Application in High-Speed Communication Systems},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {64-I},
number = {5},
pages = {1019--1030},
year = {2017},
url = {https://doi.org/10.1109/TCSI.2016.2636209},
doi = {10.1109/TCSI.2016.2636209},
timestamp = {Mon, 20 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcas/ReyesSPH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/RodriguezOMM17,
author = {Mario Rodr{\'{\i}}guez and
Carlos Orrite and
Carlos Medrano and
Dimitrios Makris},
title = {One-Shot Learning of Human Activity With an {MAP} Adapted {GMM} and
Simplex-HMM},
journal = {{IEEE} Trans. Cybern.},
volume = {47},
number = {7},
pages = {1769--1780},
year = {2017},
url = {https://doi.org/10.1109/TCYB.2016.2558447},
doi = {10.1109/TCYB.2016.2558447},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcyb/RodriguezOMM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/GarridoSVG17,
author = {Mario Garrido and
Miguel Angel S{\'{a}}nchez and
Mar{\'{\i}}a Luisa L{\'{o}}pez Vallejo and
Jes{\'{u}}s Grajal},
title = {A 4096-Point Radix-4 Memory-Based {FFT} Using {DSP} Slices},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {25},
number = {1},
pages = {375--379},
year = {2017},
url = {https://doi.org/10.1109/TVLSI.2016.2567784},
doi = {10.1109/TVLSI.2016.2567784},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvlsi/GarridoSVG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bis/SaenzCSV17,
author = {Juan Pablo S{\'{a}}enz and
Steve C{\'{a}}rdenas and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Witold Abramowicz},
title = {Semi-automated Model-Based Generation of Enterprise Architecture Deliverables},
booktitle = {Business Information Systems - 20th International Conference, {BIS}
2017, Poznan, Poland, June 28-30, 2017, Proceedings},
series = {Lecture Notes in Business Information Processing},
volume = {288},
pages = {59--73},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-59336-4\_5},
doi = {10.1007/978-3-319-59336-4\_5},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bis/SaenzCSV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clihc/GomezSLR17,
author = {Nancy Lizbeth Cruz G{\'{o}}mez and
{\'{A}}ngel Quintero S{\'{a}}nchez and
Eneas Kevin Garc{\'{\i}}a L{\'{o}}pez and
Mario Alberto Moreno Rocha},
title = {{SBK:} Smart Braille Keyboard for Learning Braille Literacy in Blind
or Visually Impaired People},
booktitle = {Proceedings of the 8th Latin American Conference on Human-Computer
Interaction, {CLIHC} '17, Antigua Guatemala, Guatemala, November 8-10,
2017},
pages = {26:1--26:4},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3151470.3156645},
doi = {10.1145/3151470.3156645},
timestamp = {Mon, 06 Nov 2023 17:08:49 +0100},
biburl = {https://dblp.org/rec/conf/clihc/GomezSLR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clihc/HerreraGSC17,
author = {Andres E. Acevedo Herrera and
Garc{\'{\i}}a Gonz{\'{a}}lez Gabriel and
Luis {\'{A}}ngel Ort{\'{\i}}z S{\'{a}}nchez and
Mario David May Cuevas},
title = {Light Cane: An Augmented Blind Cane to Help Users to Cross the Street},
booktitle = {Proceedings of the 8th Latin American Conference on Human-Computer
Interaction, {CLIHC} '17, Antigua Guatemala, Guatemala, November 8-10,
2017},
pages = {13:1--13:4},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3151470.3156635},
doi = {10.1145/3151470.3156635},
timestamp = {Thu, 25 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/clihc/HerreraGSC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clihc/RochaSLG17,
author = {Mario Alberto Moreno Rocha and
{\'{A}}ngel Quintero S{\'{a}}nchez and
Eneas Kevin Garc{\'{\i}}a L{\'{o}}pez and
Nancy Lizbeth Cruz G{\'{o}}mez},
title = {Incorporating Technology into Braille Learning Through a User-Centered
Methodology},
booktitle = {Proceedings of the 8th Latin American Conference on Human-Computer
Interaction, {CLIHC} '17, Antigua Guatemala, Guatemala, November 8-10,
2017},
pages = {15:1--15:4},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3151470.3156638},
doi = {10.1145/3151470.3156638},
timestamp = {Thu, 25 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/clihc/RochaSLG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conf-irm/GiraldoHSV17,
author = {David Giraldo and
Andrea Herrera and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Analysis of {ICT} services by observing "fit for use" attributes},
booktitle = {2017 International Conference on Information Resources Management
- Democratization and Participation: People's Roles in Digital World,
{CONF-IRM} 2017, Santiago de Chile, Chile, May 17-19, 2017},
pages = {3},
year = {2017},
url = {http://aisel.aisnet.org/confirm2017/3},
timestamp = {Tue, 22 Aug 2017 11:34:43 +0200},
biburl = {https://dblp.org/rec/conf/conf-irm/GiraldoHSV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csedu/CasasSV17,
author = {Lina Casas and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Paula Escudeiro and
Gennaro Costagliola and
Susan Zvacek and
James Onohuome Uhomoibhi and
Bruce M. McLaren},
title = {Using an {IT} Laboratory for Training {IT} Architects},
booktitle = {{CSEDU} 2017 - Proceedings of the 9th International Conference on
Computer Supported Education, Volume 1, Porto, Portugal, April 21-23,
2017},
pages = {108--119},
publisher = {SciTePress},
year = {2017},
url = {https://doi.org/10.5220/0006319901080119},
doi = {10.5220/0006319901080119},
timestamp = {Fri, 16 Jun 2017 14:43:56 +0200},
biburl = {https://dblp.org/rec/conf/csedu/CasasSV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/RodriguezOMM17,
author = {Mario Rodr{\'{\i}}guez and
Carlos Orrite and
Carlos Medrano and
Dimitrios Makris},
title = {Fast Simplex-HMM for One-Shot Learning Activity Recognition},
booktitle = {2017 {IEEE} Conference on Computer Vision and Pattern Recognition
Workshops, {CVPR} Workshops 2017, Honolulu, HI, USA, July 21-26, 2017},
pages = {1259--1266},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/CVPRW.2017.166},
doi = {10.1109/CVPRW.2017.166},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/RodriguezOMM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/NaranjoSV17,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Sylvain Hall{\'{e}} and
Roger Villemaire and
Robert Lagerstr{\"{o}}m},
title = {Visualizing the Bias of Enterprise Metamodels towards Nuanced Concepts},
booktitle = {21st {IEEE} International Enterprise Distributed Object Computing
Conference, {EDOC} 2017, Quebec City, QC, Canada, October 10-13, 2017},
pages = {30--39},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/EDOC.2017.14},
doi = {10.1109/EDOC.2017.14},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/edoc/NaranjoSV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emoocs/RivoMCCMGAAA17,
author = {Manuel Sanjurjo Rivo and
Mario Merino and
Filippo Cichocki and
Xin Chen and
David Morante and
Daniel P{\'{e}}rez Grande and
Gonzalo S{\'{a}}nchez Arriaga and
Manuel Soler Arnedo and
Eduardo Ahedo},
editor = {Carlos Delgado Kloos and
Carlos Alario{-}Hoyos and
Rocael Hern{\'{a}}ndez Rizzardini},
title = {The Conquest of Space: un Curso {MOOC} y {SPOC} en Ingenier{\'{\i}}a
Aeroespacial},
booktitle = {Actas de la Jornada de MOOCs en Espa{\~{n}}ol en EMOOCs 2017, EMOOCs-ES
2017, Madrid, Spain, May 26, 2017},
series = {{CEUR} Workshop Proceedings},
volume = {1836},
pages = {91--97},
publisher = {CEUR-WS.org},
year = {2017},
url = {https://ceur-ws.org/Vol-1836/10.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:15 +0100},
biburl = {https://dblp.org/rec/conf/emoocs/RivoMCCMGAAA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/SanchezSAM17,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Luciano Volcan Agostini and
C{\'{e}}sar A. M. Marcon},
title = {Depth modeling modes complexity control system for the 3D-HEVC video
encoder},
booktitle = {25th European Signal Processing Conference, {EUSIPCO} 2017, Kos, Greece,
August 28 - September 2, 2017},
pages = {1021--1025},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.23919/EUSIPCO.2017.8081362},
doi = {10.23919/EUSIPCO.2017.8081362},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eusipco/SanchezSAM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/SanchezSZPAM17,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini and
C{\'{e}}sar A. M. Marcon},
title = {Edge-aware depth motion estimation - {A} complexity reduction scheme
for 3D-HEVC},
booktitle = {25th European Signal Processing Conference, {EUSIPCO} 2017, Kos, Greece,
August 28 - September 2, 2017},
pages = {1524--1528},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.23919/EUSIPCO.2017.8081464},
doi = {10.23919/EUSIPCO.2017.8081464},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eusipco/SanchezSZPAM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/GuervosBCRGRVHR17,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Israel Blancas{-}Alvarez and
Pedro A. Castillo and
Gustavo Romero and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
V{\'{\i}}ctor M. Rivas and
Mario Garc{\'{\i}}a Valdez and
Amaury Hern{\'{a}}ndez{-}{\'{A}}guila and
Mario Rom{\'{a}}n},
editor = {Giovanni Squillero and
Kevin Sim},
title = {Ranking Programming Languages for Evolutionary Algorithm Operations},
booktitle = {Applications of Evolutionary Computation - 20th European Conference,
EvoApplications 2017, Amsterdam, The Netherlands, April 19-21, 2017,
Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {10199},
pages = {689--704},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-55849-3\_44},
doi = {10.1007/978-3-319-55849-3\_44},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/evoW/GuervosBCRGRVHR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/MereloCGV17,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Paloma de las Cuevas and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Mario Garc{\'{\i}}a Valdez},
editor = {Giovanni Squillero and
Kevin Sim},
title = {A Performance Assessment of Evolutionary Algorithms in Volunteer Computing
Environments: The Importance of Entropy},
booktitle = {Applications of Evolutionary Computation - 20th European Conference,
EvoApplications 2017, Amsterdam, The Netherlands, April 19-21, 2017,
Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {10199},
pages = {806--821},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-55849-3\_52},
doi = {10.1007/978-3-319-55849-3\_52},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/evoW/MereloCGV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ibpria/RodriguezOM17,
author = {Mario Rodr{\'{\i}}guez and
Carlos Orrite and
Carlos Medrano},
editor = {Lu{\'{\i}}s A. Alexandre and
Jos{\'{e}} Salvador S{\'{a}}nchez and
Jo{\~{a}}o M. F. Rodrigues},
title = {Space-Time Flexible Kernel for Recognizing Activities from Wearable
Cameras},
booktitle = {Pattern Recognition and Image Analysis - 8th Iberian Conference, IbPRIA
2017, Faro, Portugal, June 20-23, 2017, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {10255},
pages = {511--518},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-58838-4\_56},
doi = {10.1007/978-3-319-58838-4\_56},
timestamp = {Tue, 07 May 2024 20:05:10 +0200},
biburl = {https://dblp.org/rec/conf/ibpria/RodriguezOM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icar/SanchezR17,
author = {O. Nelson Andres Sanchez and
Mario Fernando De la Rosa Rosero},
title = {Path planning and following using genetic algorithms to solve the
multi-travel salesman problem in dynamic scenarios},
booktitle = {18th International Conference on Advanced Robotics, {ICAR} 2017, Hong
Kong, China, July 10-12, 2017},
pages = {204--209},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICAR.2017.8023519},
doi = {10.1109/ICAR.2017.8023519},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/icar/SanchezR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/TintoACCSSD17,
author = {Oriol Tint{\'{o}} and
Mario C. Acosta and
Miguel Castrillo and
Ana Cort{\'{e}}s and
Alicia Sanchez Lorente and
Kim Serradell and
Francisco J. Doblas{-}Reyes},
editor = {Petros Koumoutsakos and
Michael Lees and
Valeria V. Krzhizhanovskaya and
Jack J. Dongarra and
Peter M. A. Sloot},
title = {Optimizing domain decomposition in an ocean model: the case of {NEMO}},
booktitle = {International Conference on Computational Science, {ICCS} 2017, 12-14
June 2017, Zurich, Switzerland},
series = {Procedia Computer Science},
volume = {108},
pages = {776--785},
publisher = {Elsevier},
year = {2017},
url = {https://doi.org/10.1016/j.procs.2017.05.257},
doi = {10.1016/J.PROCS.2017.05.257},
timestamp = {Thu, 08 Jul 2021 16:04:01 +0200},
biburl = {https://dblp.org/rec/conf/iccS/TintoACCSSD17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceis/RomeroSV17,
author = {Mar{\'{\i}}a Camila Romero and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Slimane Hammoudi and
Michal Smialek and
Olivier Camp and
Joaquim Filipe},
title = {Business Model Pattern Execution - {A} System Dynamics Application},
booktitle = {{ICEIS} 2017 - Proceedings of the 19th International Conference on
Enterprise Information Systems, Volume 3, Porto, Portugal, April 26-29,
2017},
pages = {440--447},
publisher = {SciTePress},
year = {2017},
url = {https://doi.org/10.5220/0006369704400447},
doi = {10.5220/0006369704400447},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iceis/RomeroSV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ict4ageingwell/OCaoimhMFVCNVWJ17,
author = {R{\'{o}}n{\'{a}}n O'Caoimh and
D. William Molloy and
Carol Fitzgerald and
Lex van Velsen and
Miriam Cabrita and
Mohammad Hossein Nassabi and
Frederiek de Vette and
Marit Dekker{-}van Weering and
Stephanie Jansen{-}Kosterink and
Wander Kenter and
Sanne Frazer and
Am{\'{e}}lia P. Rauter and
Maria Ant{\'{o}}nia Amaral Turkman and
Mar{\'{\i}}lia Antunes and
Feridun Turkman and
Marta Sousa Silva and
Alice Martins and
Helena S. Costa and
T{\^{a}}nia Gon{\c{c}}alves Albuquerque and
Ant{\'{o}}nio E. N. Ferreira and
Mario Scherillo and
Vincenzo De Luca and
Maddalena Illario and
Alejandro Garc{\'{\i}}a{-}Rudolph and
Rocio Sanchez{-}Carrion and
Javier Solana S{\'{a}}nchez and
Enrique J. G{\'{o}}mez Aguilera and
Hermie Hermens and
Miriam M. R. Vollenbroek{-}Hutten},
editor = {Carsten R{\"{o}}cker and
John O'Donoghue and
Martina Ziefle and
Leszek A. Maciaszek and
William Molloy},
title = {Healthcare Recommendations from the Personalised {ICT} Supported Service
for Independent Living and Active Ageing {(PERSSILAA)} Study},
booktitle = {Proceedings of the 3rd International Conference on Information and
Communication Technologies for Ageing Well and e-Health, ICT4AgeingWell
2017, Porto, Portugal, April 28-29, 2017},
pages = {91--103},
publisher = {{SCITEPRESS}},
year = {2017},
url = {https://doi.org/10.5220/0006331800910103},
doi = {10.5220/0006331800910103},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ict4ageingwell/OCaoimhMFVCNVWJ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ict4ageingwell/OCaoimhMFVCNVWJ17a,
author = {R{\'{o}}n{\'{a}}n O'Caoimh and
D. William Molloy and
Carol Fitzgerald and
Lex van Velsen and
Miriam Cabrita and
Mohammad Hossein Nassabi and
Frederiek de Vette and
Marit Dekker{-}van Weering and
Stephanie Jansen{-}Kosterink and
Wander Kenter and
Sanne Frazer and
Am{\'{e}}lia P. Rauter and
Maria Ant{\'{o}}nia Amaral Turkman and
Mar{\'{\i}}lia Antunes and
Feridun Turkman and
Marta Sousa Silva and
Alice Martins and
Helena S. Costa and
T{\^{a}}nia Gon{\c{c}}alves Albuquerque and
Ant{\'{o}}nio E. N. Ferreira and
Mario Scherillo and
Vincenzo De Luca and
Pasquale Abete and
Annamaria Colao and
Alejandro Garc{\'{\i}}a{-}Rudolph and
Rocio Sanchez{-}Carrion and
Javier Solana S{\'{a}}nchez and
Enrique J. G{\'{o}}mez Aguilera and
Maddalena Illario and
Hermie Hermens and
Miriam M. R. Vollenbroek{-}Hutten},
editor = {Carsten R{\"{o}}cker and
John O'Donoghue and
Martina Ziefle and
Leszek A. Maciaszek and
William Molloy},
title = {ICT-Supported Interventions Targeting Pre-frailty: Healthcare Recommendations
from the Personalised {ICT} Supported Service for Independent Living
and Active Ageing {(PERSSILAA)} Study},
booktitle = {Information and Communication Technologies for Ageing Well and e-Health
- Third International Conference, {ICT4AWE} 2017, Porto, Portugal,
April 28-29, 2017, Revised Selected Papers},
series = {Communications in Computer and Information Science},
volume = {869},
pages = {69--92},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-93644-4\_4},
doi = {10.1007/978-3-319-93644-4\_4},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ict4ageingwell/OCaoimhMFVCNVWJ17a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/ZhangWBKS17,
author = {Ying Zhang and
Wenfei Wu and
Sujata Banerjee and
Joon{-}Myung Kang and
Mario A. S{\'{a}}nchez},
title = {SLA-verifier: Stateful and quantitative verification for service chaining},
booktitle = {2017 {IEEE} Conference on Computer Communications, {INFOCOM} 2017,
Atlanta, GA, USA, May 1-4, 2017},
pages = {1--9},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/INFOCOM.2017.8057041},
doi = {10.1109/INFOCOM.2017.8057041},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/infocom/ZhangWBKS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwann/GonzalezDSR17,
author = {Mario Gonz{\'{a}}lez and
David Dominguez and
{\'{A}}ngel S{\'{a}}nchez and
Francisco B. Rodr{\'{\i}}guez},
editor = {Ignacio Rojas and
Gonzalo Joya and
Andreu Catal{\`{a}}},
title = {Capacity and Retrieval of a Modular Set of Diluted Attractor Networks
with Respect to the Global Number of Neurons},
booktitle = {Advances in Computational Intelligence - 14th International Work-Conference
on Artificial Neural Networks, {IWANN} 2017, Cadiz, Spain, June 14-16,
2017, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {10305},
pages = {497--506},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-59153-7\_43},
doi = {10.1007/978-3-319-59153-7\_43},
timestamp = {Sat, 01 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iwann/GonzalezDSR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwann/Rivas-SanchezGV17,
author = {Mario Rivas{-}S{\'{a}}nchez and
Maria De La Paz Guerrero{-}Lebrero and
Elisa Guerrero V{\'{a}}zquez and
Guillermo B{\'{a}}rcena{-}Gonzalez and
Jaime Martel and
Pedro L. Galindo},
editor = {Ignacio Rojas and
Gonzalo Joya and
Andreu Catal{\`{a}}},
title = {Using Deep Learning for Image Similarity in Product Matching},
booktitle = {Advances in Computational Intelligence - 14th International Work-Conference
on Artificial Neural Networks, {IWANN} 2017, Cadiz, Spain, June 14-16,
2017, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {10305},
pages = {281--290},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-59153-7\_25},
doi = {10.1007/978-3-319-59153-7\_25},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iwann/Rivas-SanchezGV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/GonzalezSVCRZPS17,
author = {S. A. Gonzalez and
Enrique Mario Spinelli and
Alejandro L. Veiga and
D. F. Coral and
M. B. Fernandez van Raap and
P. Mendoza Zelis and
G. A. Pasquevich and
F. H. Sanchez},
title = {Portable electromagnetic field applicator for magnetic hyperthermia
experiments},
booktitle = {8th {IEEE} Latin American Symposium on Circuits {\&} Systems,
{LASCAS} 2017, Bariloche, Argentina, February 20-23, 2017},
pages = {1--4},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/LASCAS.2017.7948091},
doi = {10.1109/LASCAS.2017.7948091},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/lascas/GonzalezSVCRZPS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/somet/Sotelo-GarridoN17,
author = {Mario Sotelo{-}Garrido and
Mariko Nakano{-}Miyatake and
Gabriel Sanchez{-}Perez and
Manuel Cedillo{-}Hernandez and
H{\'{e}}ctor P{\'{e}}rez{-}Meana},
editor = {Hamido Fujita and
Ali Selamat and
Sigeru Omatu},
title = {Software Protection Against Illegal Copy Using Software Watermarking},
booktitle = {New Trends in Intelligent Software Methodologies, Tools and Techniques
- Proceedings of the 16th International Conference, SoMeT{\_}17, Kitakyushu
City, Japan, September 26-28, 2017},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {297},
pages = {503--511},
publisher = {{IOS} Press},
year = {2017},
url = {https://doi.org/10.3233/978-1-61499-800-6-503},
doi = {10.3233/978-1-61499-800-6-503},
timestamp = {Tue, 15 Nov 2022 15:22:38 +0100},
biburl = {https://dblp.org/rec/conf/somet/Sotelo-GarridoN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ucami/Garcia-SanchezT17,
author = {Mario Garc{\'{\i}}a{-}S{\'{a}}nchez and
Miguel A. Teruel and
Elena Navarro and
Pascual Gonz{\'{a}}lez and
Antonio Fern{\'{a}}ndez{-}Caballero},
editor = {Sergio F. Ochoa and
Pritpal Singh and
Jos{\'{e}} Bravo},
title = {A Distributed Tool to Perform Dynamic Therapies for Social Cognitive
Deficit Through Avatars},
booktitle = {Ubiquitous Computing and Ambient Intelligence - 11th International
Conference, UCAmI 2017, Philadelphia, PA, USA, November 7-10, 2017,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {10586},
pages = {731--741},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-67585-5\_71},
doi = {10.1007/978-3-319-67585-5\_71},
timestamp = {Mon, 07 Nov 2022 21:23:28 +0100},
biburl = {https://dblp.org/rec/conf/ucami/Garcia-SanchezT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/HuacujaLCPR17,
author = {H{\'{e}}ctor Joaqu{\'{\i}}n {Fraire Huacuja} and
Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
Norberto Castillo{-}Garc{\'{\i}}a and
Johnatan E. Pecero and
Rodolfo A. Pazos Rangel},
editor = {Patricia Melin and
Oscar Castillo and
Janusz Kacprzyk},
title = {Solving the Cut Width Optimization Problem with a Genetic Algorithm
Approach},
booktitle = {Nature-Inspired Design of Hybrid Intelligent Systems},
series = {Studies in Computational Intelligence},
volume = {667},
pages = {729--738},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-47054-2\_48},
doi = {10.1007/978-3-319-47054-2\_48},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/series/sci/HuacujaLCPR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/Arias-FisteusFM17,
author = {Jes{\'{u}}s Arias{-}Fisteus and
Luis S{\'{a}}nchez Fern{\'{a}}ndez and
V{\'{\i}}ctor Corcoba Maga{\~{n}}a and
Mario Mu{\~{n}}oz Organero and
Jorge Yago Fern{\'{a}}ndez Rodr{\'{\i}}guez and
Juan Antonio {\'{A}}lvarez{-}Garc{\'{\i}}a},
title = {A Scalable Data Streaming Infrastructure for Smart Cities},
journal = {CoRR},
volume = {abs/1703.02755},
year = {2017},
url = {http://arxiv.org/abs/1703.02755},
eprinttype = {arXiv},
eprint = {1703.02755},
timestamp = {Wed, 28 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/Arias-FisteusFM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/amcs/LocesMPHBB16,
author = {Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
Jedrzej Musial and
Johnatan E. Pecero and
H{\'{e}}ctor Joaqu{\'{\i}}n {Fraire Huacuja} and
Jacek Blazewicz and
Pascal Bouvry},
title = {Exact and heuristic approaches to solve the Internet shopping optimization
problem with delivery costs},
journal = {Int. J. Appl. Math. Comput. Sci.},
volume = {26},
number = {2},
pages = {391--406},
year = {2016},
url = {https://doi.org/10.1515/amcs-2016-0028},
doi = {10.1515/AMCS-2016-0028},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/amcs/LocesMPHBB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/crossroads/Sanchez16,
author = {Daniel L{\'{o}}pez S{\'{a}}nchez},
title = {"ANN" helps Mario rescue Princess Toadstool},
journal = {{XRDS}},
volume = {23},
number = {1},
pages = {18--19},
year = {2016},
url = {https://doi.org/10.1145/2983465},
doi = {10.1145/2983465},
timestamp = {Fri, 03 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/crossroads/Sanchez16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cviu/Sanchez-Escobedo16,
author = {Dalila S{\'{a}}nchez{-}Escobedo and
Mario Castel{\'{a}}n and
William A. P. Smith},
title = {Statistical 3D face shape estimation from occluding contours},
journal = {Comput. Vis. Image Underst.},
volume = {142},
pages = {111--124},
year = {2016},
url = {https://doi.org/10.1016/j.cviu.2015.08.012},
doi = {10.1016/J.CVIU.2015.08.012},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cviu/Sanchez-Escobedo16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fi/ParraSRFP16,
author = {Antonio Santos{-}Olmo and
Luis Enrique S{\'{a}}nchez and
David Garcia Rosado and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
title = {Applying the Action-Research Method to Develop a Methodology to Reduce
the Installation and Maintenance Times of Information Security Management
Systems},
journal = {Future Internet},
volume = {8},
number = {3},
pages = {36},
year = {2016},
url = {https://doi.org/10.3390/fi8030036},
doi = {10.3390/FI8030036},
timestamp = {Mon, 29 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fi/ParraSRFP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhis/LorancaRVALZGD16,
author = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Jorge A. Ruiz{-}Vanoye and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
Mart{\'{\i}}n Estrada Analco and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Alberto Ochoa{-}Zezzatti and
Gerardo {Mart{\'{\i}}nez Guzman} and
Mario Bustillo D{\'{\i}}az},
title = {An approximation method for the P-median problem: {A} bioinspired
tabu search and variable neighborhood search partitioning approach},
journal = {Int. J. Hybrid Intell. Syst.},
volume = {13},
number = {2},
pages = {87--98},
year = {2016},
url = {https://doi.org/10.3233/HIS-160227},
doi = {10.3233/HIS-160227},
timestamp = {Fri, 03 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijhis/LorancaRVALZGD16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/infsof/Barcelo-Valenzuela16,
author = {Mario Barcelo{-}Valenzuela and
Patricia Shihemy Carrillo{-}Villafa{\~{n}}a and
Alonso Perez{-}Soltero and
Gerardo Sanchez{-}Schmitz},
title = {A framework to acquire explicit knowledge stored on different versions
of software},
journal = {Inf. Softw. Technol.},
volume = {70},
pages = {40--48},
year = {2016},
url = {https://doi.org/10.1016/j.infsof.2015.09.007},
doi = {10.1016/J.INFSOF.2015.09.007},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/infsof/Barcelo-Valenzuela16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ivc/RodriguezOMM16,
author = {Mario Rodr{\'{\i}}guez and
Carlos Orrite and
Carlos Medrano and
Dimitrios Makris},
title = {A Time Flexible Kernel framework for video-based activity recognition},
journal = {Image Vis. Comput.},
volume = {48-49},
pages = {26--36},
year = {2016},
url = {https://doi.org/10.1016/j.imavis.2015.12.006},
doi = {10.1016/J.IMAVIS.2015.12.006},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ivc/RodriguezOMM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jvis/VictoriaRRPO16,
author = {{\'{A}}yax Hernando Torres Victoria and
Mario S{\'{a}}nchez Rosas and
Fernando Arag{\'{o}}n Rivera and
Salom{\'{o}}n Peralta and
Abraham Medina Ovando},
title = {Visualization of isotherms around a heated horizontal cylinder embedded
in a porous medium},
journal = {J. Vis.},
volume = {19},
number = {4},
pages = {631--641},
year = {2016},
url = {https://doi.org/10.1007/s12650-016-0363-9},
doi = {10.1007/S12650-016-0363-9},
timestamp = {Thu, 09 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jvis/VictoriaRRPO16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/Lozano-LozanoMG16,
author = {Mario Lozano{-}Lozano and
Lydia Mart{\'{\i}}n{-}Mart{\'{\i}}n and
Noelia Galiano{-}Castillo and
Francisco {\'{A}}lvarez{-}Salvago and
Irene Cantarero{-}Villanueva and
Carolina Fern{\'{a}}ndez{-}Lao and
Carmen S{\'{a}}nchez{-}Salado and
Manuel Arroyo Morales},
title = {Integral strategy to supportive care in breast cancer survivors through
occupational therapy and a m-health system: design of a randomized
clinical trial},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {16},
pages = {150:1--150:10},
year = {2016},
url = {https://doi.org/10.1186/s12911-016-0394-0},
doi = {10.1186/S12911-016-0394-0},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/Lozano-LozanoMG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Anzures-GarciaS16,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Miguel J. Hornos and
Patricia Paderewski{-}Rodr{\'{\i}}guez},
title = {Semantic Formalism for Modelling the Group Interaction},
journal = {Res. Comput. Sci.},
volume = {118},
pages = {137--147},
year = {2016},
url = {https://rcs.cic.ipn.mx/2016\_118/Semantic\%20Formalism\%20for\%20Modelling\%20the\%20Group\%20Interaction.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/Anzures-GarciaS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Anzures-GarciaS16a,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Miguel J. Hornos and
Patricia Paderewski{-}Rodr{\'{\i}}guez},
title = {Knowledge-based Workflow Ontology for Group Organizational Structure},
journal = {Res. Comput. Sci.},
volume = {123},
pages = {79--90},
year = {2016},
url = {https://rcs.cic.ipn.mx/2016\_123/Knowledge-based\%20Workflow\%20Ontology\%20for\%20Group\%20Organizational\%20Structure.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/Anzures-GarciaS16a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/DominguezHPHC16,
author = {Mario Hernandez Dominguez and
Jos{\'{e}}{-}Isidro Hern{\'{a}}ndez{-}Vega and
Dolores{-}Gabriela Palomares{-}Gorham and
Carlos Hern{\'{a}}ndez{-}Santos and
Jonam L. S{\'{a}}nchez Cuevas},
title = {A {BDI} Agent System for the Collaboration of the Unmanned Aerial
Vehicle},
journal = {Res. Comput. Sci.},
volume = {121},
pages = {113--124},
year = {2016},
url = {https://rcs.cic.ipn.mx/2016\_121/A\%20BDI\%20Agent\%20System\%20for\%20the\%20Collaboration\%20of\%20the\%20Unmanned\%20Aerial\%20Vehicle.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/DominguezHPHC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/LopezCPML16,
author = {Abraham S{\'{a}}nchez L{\'{o}}pez and
Viridiana Cruz{-}Guti{\'{e}}rrez and
Mario Alberto Posada{-}Zamora and
M. Teresa Torrijos M. and
Mar{\'{\i}}a Auxilio Osorio Lama},
title = {Estudio del an{\'{a}}lisis de componentes principales en bases
de datos de calidad del aire},
journal = {Res. Comput. Sci.},
volume = {120},
pages = {9--19},
year = {2016},
url = {https://rcs.cic.ipn.mx/2016\_120/Estudio\%20del\%20analisis\%20de\%20componentes\%20principales\%20en\%20bases\%20de\%20datos\%20de\%20calidad\%20del\%20aire.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/LopezCPML16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/LorancaVDASSL16,
author = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
Mario Bustillo D{\'{\i}}az and
Mart{\'{\i}}n Estrada Analco and
Jorge Cerezo S{\'{a}}nchez and
Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
Abraham S{\'{a}}nchez L{\'{o}}pez},
title = {Methodology for Location-Allocation Problem},
journal = {Res. Comput. Sci.},
volume = {123},
pages = {91--98},
year = {2016},
url = {https://rcs.cic.ipn.mx/2016\_123/Methodology\%20for\%20Location-Allocation\%20Problem.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/LorancaVDASSL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Saldana-Gonzalez16,
author = {Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
Jorge Cerezo S{\'{a}}nchez and
Mario Bustillo D{\'{\i}}az and
Apolonio Ata P{\'{e}}rez and
Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Gerardo {Mart{\'{\i}}nez Guzman} and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez},
title = {Dise{\~{n}}o de un robot m{\'{o}}vil controlado por un agente
reactivo en tiempo real},
journal = {Res. Comput. Sci.},
volume = {125},
pages = {17--26},
year = {2016},
url = {https://rcs.cic.ipn.mx/2016\_125/Diseno\%20de\%20un\%20robot\%20movil\%20controlado\%20por\%20un\%20agente\%20reactivo\%20en\%20tiempo\%20real.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/Saldana-Gonzalez16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/SanchezSDA16,
author = {Jorge Cerezo S{\'{a}}nchez and
Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
Mario Bustillo D{\'{\i}}az and
Apolonio Ata{-}P{\'{e}}rez},
title = {Sistema de planificaci{\'{o}}n de trayectorias utilizando visi{\'{o}}n
artificial},
journal = {Res. Comput. Sci.},
volume = {128},
pages = {141--148},
year = {2016},
url = {https://rcs.cic.ipn.mx/2016\_128/Sistema\%20de\%20planificacion\%20de\%20trayectorias\%20utilizando\%20vision\%20artificial.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/SanchezSDA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/SanchezSDPFLG16,
author = {Jorge Cerezo S{\'{a}}nchez and
Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
Mario Mauricio Bustillo D{\'{\i}}az and
Apolonio Ata P{\'{e}}rez and
Jos{\'{e}} Andr{\'{e}}s V{\'{a}}zquez Flores and
Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Gerardo {Mart{\'{\i}}nez Guzman}},
title = {Sistema de reconocimiento y clasificaci{\'{o}}n de se{\~{n}}as
para el lenguaje espa{\~{n}}ol},
journal = {Res. Comput. Sci.},
volume = {124},
pages = {73--80},
year = {2016},
url = {https://rcs.cic.ipn.mx/2016\_124/Sistema\%20de\%20reconocimiento\%20y\%20clasificacion\%20de\%20senas\%20para\%20el\%20lenguaje\%20espanol.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/SanchezSDPFLG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/RiveiroDCSA16,
author = {Bel{\'{e}}n Riveiro and
Luc{\'{\i}}a D{\'{\i}}az{-}Vilari{\~{n}}o and
Borja Conde{-}Carnero and
Mario Soil{\'{a}}n and
Pedro Arias},
title = {Automatic Segmentation and Shape-Based Classification of Retro-Reflective
Traffic Signs from Mobile LiDAR Data},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {9},
number = {1},
pages = {295--303},
year = {2016},
url = {https://doi.org/10.1109/JSTARS.2015.2461680},
doi = {10.1109/JSTARS.2015.2461680},
timestamp = {Tue, 31 Mar 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/RiveiroDCSA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tetc/BarrioOS16,
author = {Cesar Morillas Barrio and
Mario Mu{\~{n}}oz Organero and
Joaqu{\'{\i}}n S{\'{a}}nchez{-}Soriano},
title = {Can Gamification Improve the Benefits of Student Response Systems
in Learning? An Experimental Study},
journal = {{IEEE} Trans. Emerg. Top. Comput.},
volume = {4},
number = {3},
pages = {429--438},
year = {2016},
url = {https://doi.org/10.1109/TETC.2015.2497459},
doi = {10.1109/TETC.2015.2497459},
timestamp = {Fri, 15 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tetc/BarrioOS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/alife/Garcia-ValdezGC16,
author = {Mario Garc{\'{\i}}a{-}Valdez and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Paloma de las Cuevas and
Juan Juli{\'{a}}n Merelo},
editor = {Tom Froese and
Jes{\'{u}}s Mario Siqueiros{-}Garc{\'{\i}}a and
Wendy Aguilar and
Eduardo J. Izquierdo and
Hiroki Sayama and
Carlos Gershenson},
title = {The human in the loop: volunteer-based metacomputers as a socio-technical
system},
booktitle = {Fifteenth International Conference on the Simulation and Synthesis
of Living Systems, {ALIFE} 2016, Cancun, Mexico, July 4-6, 2016},
pages = {648--655},
publisher = {{MIT} Press},
year = {2016},
url = {https://doi.org/10.7551/978-0-262-33936-0-ch103},
doi = {10.7551/978-0-262-33936-0-CH103},
timestamp = {Thu, 20 Jun 2024 22:18:45 +0200},
biburl = {https://dblp.org/rec/conf/alife/Garcia-ValdezGC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/FlorezSV16,
author = {Hector Florez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Rainer Schmidt and
Wided Gu{\'{e}}dria and
Ilia Bider and
S{\'{e}}rgio Guerreiro},
title = {Analysis of Imprecise Enterprise Models},
booktitle = {Enterprise, Business-Process and Information Systems Modeling - 17th
International Conference, {BPMDS} 2016, 21st International Conference,
{EMMSAD} 2016, Held at CAiSE 2016, Ljubljana, Slovenia, June 13-14,
2016, Proceedings},
series = {Lecture Notes in Business Information Processing},
volume = {248},
pages = {349--364},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-39429-9\_22},
doi = {10.1007/978-3-319-39429-9\_22},
timestamp = {Fri, 19 Mar 2021 08:43:31 +0100},
biburl = {https://dblp.org/rec/conf/caise/FlorezSV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/FelsbergKMLPHBE16,
author = {Michael Felsberg and
Matej Kristan and
Jiri Matas and
Ales Leonardis and
Roman P. Pflugfelder and
Gustav H{\"{a}}ger and
Amanda Berg and
Abdelrahman Eldesokey and
J{\"{o}}rgen Ahlberg and
Luka Cehovin and
Tom{\'{a}}s Voj{\'{\i}}r and
Alan Lukezic and
Gustavo Fern{\'{a}}ndez and
Alfredo Petrosino and
{\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and
Andr{\'{e}}s Sol{\'{\i}}s Montero and
Anton Varfolomieiev and
Aykut Erdem and
Bohyung Han and
Chang{-}Ming Chang and
Dawei Du and
Erkut Erdem and
Fahad Shahbaz Khan and
Fatih Porikli and
Fei Zhao and
Filiz Bunyak and
Francesco Battistone and
Gao Zhu and
Guna Seetharaman and
Hongdong Li and
Honggang Qi and
Horst Bischof and
Horst Possegger and
Hyeonseob Nam and
Jack Valmadre and
Jianke Zhu and
Jiayi Feng and
Jochen Lang and
Jos{\'{e}} M. Mart{\'{\i}}nez and
Kannappan Palaniappan and
Karel Lebeda and
Ke Gao and
Krystian Mikolajczyk and
Longyin Wen and
Luca Bertinetto and
Mahdieh Poostchi and
Mario Edoardo Maresca and
Martin Danelljan and
Michael Arens and
Ming Tang and
Mooyeol Baek and
Nana Fan and
Noor Al{-}Shakarji and
Ondrej Miksik and
Osman Akin and
Philip H. S. Torr and
Qingming Huang and
Rafael Martin Nieto and
Rengarajan Pelapur and
Richard Bowden and
Robert Lagani{\`{e}}re and
Sebastian Bernd Krah and
Shengkun Li and
Shizeng Yao and
Simon Hadfield and
Siwei Lyu and
Stefan Becker and
Stuart Golodetz and
Tao Hu and
Thomas Mauthner and
Vincenzo Santopietro and
Wenbo Li and
Wolfgang H{\"{u}}bner and
Xin Li and
Yang Li and
Zhan Xu and
Zhenyu He},
editor = {Gang Hua and
Herv{\'{e}} J{\'{e}}gou},
title = {The Thermal Infrared Visual Object Tracking {VOT-TIR2016} Challenge
Results},
booktitle = {Computer Vision - {ECCV} 2016 Workshops - Amsterdam, The Netherlands,
October 8-10 and 15-16, 2016, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {9914},
pages = {824--849},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-48881-3\_55},
doi = {10.1007/978-3-319-48881-3\_55},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eccv/FelsbergKMLPHBE16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/KristanLMFPCVHL16,
author = {Matej Kristan and
Ales Leonardis and
Jiri Matas and
Michael Felsberg and
Roman P. Pflugfelder and
Luka Cehovin and
Tom{\'{a}}s Voj{\'{\i}}r and
Gustav H{\"{a}}ger and
Alan Lukezic and
Gustavo Fern{\'{a}}ndez and
Abhinav Gupta and
Alfredo Petrosino and
Alireza Memarmoghadam and
{\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and
Andr{\'{e}}s Sol{\'{\i}}s Montero and
Andrea Vedaldi and
Andreas Robinson and
Andy Jinhua Ma and
Anton Varfolomieiev and
A. Aydin Alatan and
Aykut Erdem and
Bernard Ghanem and
Bin Liu and
Bohyung Han and
Brais Mart{\'{\i}}nez and
Chang{-}Ming Chang and
Changsheng Xu and
Chong Sun and
Daijin Kim and
Dapeng Chen and
Dawei Du and
Deepak Mishra and
Dit{-}Yan Yeung and
Erhan Gundogdu and
Erkut Erdem and
Fahad Shahbaz Khan and
Fatih Porikli and
Fei Zhao and
Filiz Bunyak and
Francesco Battistone and
Gao Zhu and
Giorgio Roffo and
Gorthi R. K. Sai Subrahmanyam and
Guilherme Sousa Bastos and
Guna Seetharaman and
Henry Medeiros and
Hongdong Li and
Honggang Qi and
Horst Bischof and
Horst Possegger and
Huchuan Lu and
Hyemin Lee and
Hyeonseob Nam and
Hyung Jin Chang and
Isabela Drummond and
Jack Valmadre and
Jae{-}chan Jeong and
Jaeil Cho and
Jae{-}Yeong Lee and
Jianke Zhu and
Jiayi Feng and
Jin Gao and
Jin Young Choi and
Jingjing Xiao and
Ji{-}Wan Kim and
Jiyeoup Jeong and
Jo{\~{a}}o F. Henriques and
Jochen Lang and
Jongwon Choi and
Jos{\'{e}} M. Mart{\'{\i}}nez and
Junliang Xing and
Junyu Gao and
Kannappan Palaniappan and
Karel Lebeda and
Ke Gao and
Krystian Mikolajczyk and
Lei Qin and
Lijun Wang and
Longyin Wen and
Luca Bertinetto and
Madan Kumar Rapuru and
Mahdieh Poostchi and
Mario Edoardo Maresca and
Martin Danelljan and
Matthias Mueller and
Mengdan Zhang and
Michael Arens and
Michel F. Valstar and
Ming Tang and
Mooyeol Baek and
Muhammad Haris Khan and
Naiyan Wang and
Nana Fan and
Noor Al{-}Shakarji and
Ondrej Miksik and
Osman Akin and
Payman Moallem and
Pedro Senna and
Philip H. S. Torr and
Pong C. Yuen and
Qingming Huang and
Rafael Martin Nieto and
Rengarajan Pelapur and
Richard Bowden and
Robert Lagani{\`{e}}re and
Rustam Stolkin and
Ryan Walsh and
Sebastian Bernd Krah and
Shengkun Li and
Shengping Zhang and
Shizeng Yao and
Simon Hadfield and
Simone Melzi and
Siwei Lyu and
Siyi Li and
Stefan Becker and
Stuart Golodetz and
Sumithra Kakanuru and
Sunglok Choi and
Tao Hu and
Thomas Mauthner and
Tianzhu Zhang and
Tony P. Pridmore and
Vincenzo Santopietro and
Weiming Hu and
Wenbo Li and
Wolfgang H{\"{u}}bner and
Xiangyuan Lan and
Xiaomeng Wang and
Xin Li and
Yang Li and
Yiannis Demiris and
Yifan Wang and
Yuankai Qi and
Zejian Yuan and
Zexiong Cai and
Zhan Xu and
Zhenyu He and
Zhizhen Chi},
editor = {Gang Hua and
Herv{\'{e}} J{\'{e}}gou},
title = {The Visual Object Tracking {VOT2016} Challenge Results},
booktitle = {Computer Vision - {ECCV} 2016 Workshops - Amsterdam, The Netherlands,
October 8-10 and 15-16, 2016, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {9914},
pages = {777--823},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-48881-3\_54},
doi = {10.1007/978-3-319-48881-3\_54},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eccv/KristanLMFPCVHL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/er/LaraSV16,
author = {Paola Lara and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Isabelle Comyn{-}Wattiau and
Katsumi Tanaka and
Il{-}Yeol Song and
Shuichiro Yamamoto and
Motoshi Saeki},
title = {Bridging the {IT} and {OT} Worlds Using an Extensible Modeling Language},
booktitle = {Conceptual Modeling - 35th International Conference, {ER} 2016, Gifu,
Japan, November 14-17, 2016, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9974},
pages = {122--129},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-46397-1\_10},
doi = {10.1007/978-3-319-46397-1\_10},
timestamp = {Thu, 23 Jun 2022 19:56:58 +0200},
biburl = {https://dblp.org/rec/conf/er/LaraSV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/MereloCBRGFRV16,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Pedro A. Castillo and
Israel Blancas and
Gustavo Romero and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Antonio Fern{\'{a}}ndez{-}Ares and
V{\'{\i}}ctor M. Rivas and
Mario Garc{\'{\i}}a Valdez},
editor = {Giovanni Squillero and
Paolo Burelli},
title = {Benchmarking Languages for Evolutionary Algorithms},
booktitle = {Applications of Evolutionary Computation - 19th European Conference,
EvoApplications 2016, Porto, Portugal, March 30 - April 1, 2016, Proceedings,
Part {II}},
series = {Lecture Notes in Computer Science},
volume = {9598},
pages = {27--41},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-31153-1\_3},
doi = {10.1007/978-3-319-31153-1\_3},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/evoW/MereloCBRGFRV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/MereloCGCRV16,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Pedro A. Castillo and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Paloma de las Cuevas and
Nuria Rico and
Mario Garc{\'{\i}}a Valdez},
editor = {Tobias Friedrich and
Frank Neumann and
Andrew M. Sutton},
title = {Performance for the Masses: Experiments with {A} Web Based Architecture
to Harness Volunteer Resources for Low Cost Distributed Evolutionary
Computation},
booktitle = {Proceedings of the 2016 on Genetic and Evolutionary Computation Conference,
Denver, CO, USA, July 20 - 24, 2016},
pages = {837--844},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2908812.2908849},
doi = {10.1145/2908812.2908849},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gecco/MereloCGCRV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/MereloCGCV16,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Pedro A. Castillo and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Paloma de las Cuevas and
Mario Garc{\'{\i}}a Valdez},
editor = {Tobias Friedrich and
Frank Neumann and
Andrew M. Sutton},
title = {NodIO: {A} Framework and Architecture for Pool-based Evolutionary
Computation},
booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2016, Denver,
CO, USA, July 20-24, 2016, Companion Material Proceedings},
pages = {1323--1330},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2908961.2931723},
doi = {10.1145/2908961.2931723},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gecco/MereloCGCV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icecsys/SanchezSPZAM16,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Marcelo Schiavon Porto and
Bruno Zatt and
Luciano Volcan Agostini and
C{\'{e}}sar A. M. Marcon},
title = {Real-time simplified edge detector architecture for 3D-HEVC depth
maps coding},
booktitle = {2016 {IEEE} International Conference on Electronics, Circuits and
Systems, {ICECS} 2016, Monte Carlo, Monaco, December 11-14, 2016},
pages = {352--355},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICECS.2016.7841205},
doi = {10.1109/ICECS.2016.7841205},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icecsys/SanchezSPZAM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/Dominguez-Sanchez16,
author = {S. Dominguez{-}Sanchez and
Salvador Mendoza{-}Acevedo and
Mario Alfredo Reyes{-}Barranca and
Luis M. Flores{-}Nava and
Jose A. Moreno{-}Cadenas},
title = {Assessment of the possibility to couple a photo sensor to a Floating-gate
{MOS} transistor},
booktitle = {13th International Conference on Electrical Engineering, Computing
Science and Automatic Control, {CCE} 2016, Mexico City, Mexico, September
26-30, 2016},
pages = {1--5},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICEEE.2016.7751201},
doi = {10.1109/ICEEE.2016.7751201},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iceee/Dominguez-Sanchez16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceis/RomeroSV16,
author = {Mar{\'{\i}}a Camila Romero and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Slimane Hammoudi and
Leszek A. Maciaszek and
Michele Missikoff and
Olivier Camp and
Jos{\'{e}} Cordeiro},
title = {Weaving Business Model Patterns - Understanding Business Models},
booktitle = {{ICEIS} 2016 - Proceedings of the 18th International Conference on
Enterprise Information Systems, Volume 2, Rome, Italy, April 25-28,
2016},
pages = {496--505},
publisher = {SciTePress},
year = {2016},
url = {https://doi.org/10.5220/0005838104960505},
doi = {10.5220/0005838104960505},
timestamp = {Thu, 15 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iceis/RomeroSV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceis/RomeroSV16a,
author = {Mar{\'{\i}}a Camila Romero and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Slimane Hammoudi and
Leszek A. Maciaszek and
Michele Missikoff and
Olivier Camp and
Jos{\'{e}} Cordeiro},
title = {Business Model Loom: {A} Pattern-Based Approach Towards the Definition
of Business Models},
booktitle = {Enterprise Information Systems - 18th International Conference, {ICEIS}
2016, Rome, Italy, April 25-28, 2016, Revised Selected Papers},
series = {Lecture Notes in Business Information Processing},
volume = {291},
pages = {463--487},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-62386-3\_21},
doi = {10.1007/978-3-319-62386-3\_21},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iceis/RomeroSV16a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/OrriteRM16,
author = {Carlos Orrite and
Mario Rodr{\'{\i}}guez and
Carlos Medrano},
title = {One-shot learning of temporal sequences using a distance dependent
Chinese Restaurant Process},
booktitle = {23rd International Conference on Pattern Recognition, {ICPR} 2016,
Canc{\'{u}}n, Mexico, December 4-8, 2016},
pages = {2694--2699},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICPR.2016.7900042},
doi = {10.1109/ICPR.2016.7900042},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpr/OrriteRM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/MorianoBMRR16,
author = {Javier Moriano and
Emilio Bueno and
Rocio Martin and
Francisco Javier Rodr{\'{\i}}guez and
Mario Rizo},
title = {Multi-frequency stationary frame grid synchronization using multiple
reduced order generalized integrators},
booktitle = {{IECON} 2016 - 42nd Annual Conference of the {IEEE} Industrial Electronics
Society, Florence, Italy, October 23-26, 2016},
pages = {2349--2354},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/IECON.2016.7793332},
doi = {10.1109/IECON.2016.7793332},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iecon/MorianoBMRR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcci/GuervosBCRGSVHR16,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Israel Blancas{-}Alvarez and
Pedro A. Castillo and
Gustavo Romero and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
V{\'{\i}}ctor Manuel Rivas Santos and
Mario Garc{\'{\i}}a Valdez and
Amaury Hern{\'{a}}ndez{-}{\'{A}}guila and
Mario Rom{\'{a}}n},
editor = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Fernando Mel{\'{\i}}cio and
Jos{\'{e}} Manuel Cadenas and
Ant{\'{o}}nio Dourado and
Kurosh Madani and
Ant{\'{o}}nio E. B. Ruano and
Joaquim Filipe},
title = {Ranking the Performance of Compiled and Interpreted Languages in Genetic
Algorithms},
booktitle = {Proceedings of the 8th International Joint Conference on Computational
Intelligence, {IJCCI} 2016, Volume 1: ECTA, Porto, Portugal, November
9-11, 2016},
pages = {164--170},
publisher = {SciTePress},
year = {2016},
url = {https://doi.org/10.5220/0006048101640170},
doi = {10.5220/0006048101640170},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcci/GuervosBCRGSVHR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/SaldanhaZPAS16,
author = {M{\'{a}}rio Saldanha and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini and
Gustavo Sanchez},
title = {Solutions for {DMM-1} complexity reduction in 3D-HEVC based on gradient
calculation},
booktitle = {{IEEE} 7th Latin American Symposium on Circuits {\&} Systems,
{LASCAS} 2016, Florianopolis, Brazil, February 28 - March 2, 2016},
pages = {211--214},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/LASCAS.2016.7451047},
doi = {10.1109/LASCAS.2016.7451047},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lascas/SaldanhaZPAS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/SanchezRPH16,
author = {Raul M. Sanchez and
Benjam{\'{\i}}n T. Reyes and
Ariel L. Pola and
Mario Rafael Hueda},
title = {An FPGA-based emulation platform for evaluation of time-interleaved
{ADC} calibration systems},
booktitle = {{IEEE} 7th Latin American Symposium on Circuits {\&} Systems,
{LASCAS} 2016, Florianopolis, Brazil, February 28 - March 2, 2016},
pages = {187--190},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/LASCAS.2016.7451041},
doi = {10.1109/LASCAS.2016.7451041},
timestamp = {Mon, 20 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/lascas/SanchezRPH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micai/Cruz-GutierrezP16,
author = {Viridiana Cruz{-}Guti{\'{e}}rrez and
Mario Alberto Posada{-}Zamora and
Abraham S{\'{a}}nchez L{\'{o}}pez},
editor = {Obdulia Pichardo{-}Lagunas and
Sabino Miranda{-}Jim{\'{e}}nez},
title = {An Efficient Expert System for Diabetes with a Bayesian Inference
Engine},
booktitle = {Advances in Soft Computing - 15th Mexican International Conference
on Artificial Intelligence, {MICAI} 2016, Canc{\'{u}}n, Mexico,
October 23-28, 2016, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {10062},
pages = {54--64},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-62428-0\_5},
doi = {10.1007/978-3-319-62428-0\_5},
timestamp = {Tue, 14 May 2019 10:00:49 +0200},
biburl = {https://dblp.org/rec/conf/micai/Cruz-GutierrezP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/GuervosVCGCR16,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Mario Garc{\'{\i}}a Valdez and
Pedro {\'{A}}ngel Castillo Valdivieso and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Paloma de las Cuevas and
Nuria Rico},
title = {NodIO, a JavaScript framework for volunteer-based evolutionary algorithms
: first results},
journal = {CoRR},
volume = {abs/1601.01607},
year = {2016},
url = {http://arxiv.org/abs/1601.01607},
eprinttype = {arXiv},
eprint = {1601.01607},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/GuervosVCGCR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/Poncela-Casasnovas16,
author = {Julia Poncela{-}Casasnovas and
Mario Guti{\'{e}}rrez{-}Roig and
Carlos Gracia{-}L{\'{a}}zaro and
Juli{\'{a}}n Vicens and
Jes{\'{u}}s G{\'{o}}mez{-}Garde{\~{n}}es and
Josep Perello and
Yamir Moreno and
Jordi Duch and
{\'{A}}ngel S{\'{a}}nchez},
title = {Humans display a reduced set of consistent behavioral phenotypes in
dyadic games},
journal = {CoRR},
volume = {abs/1608.02015},
year = {2016},
url = {http://arxiv.org/abs/1608.02015},
eprinttype = {arXiv},
eprint = {1608.02015},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/Poncela-Casasnovas16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/TellezMGMSS16,
author = {Eric Sadit Tellez and
Sabino Miranda{-}Jim{\'{e}}nez and
Mario Graff and
Daniela Moctezuma and
Ranyart Rodrigo Su{\'{a}}rez and
Oscar S{\'{a}}nchez Siordia},
title = {A Simple Approach to Multilingual Polarity Classification in Twitter},
journal = {CoRR},
volume = {abs/1612.05270},
year = {2016},
url = {http://arxiv.org/abs/1612.05270},
eprinttype = {arXiv},
eprint = {1612.05270},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/TellezMGMSS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jam/Filobello-NinoV15,
author = {Uriel Filobello{-}Ni{\~{n}}o and
H{\'{e}}ctor V{\'{a}}zquez{-}Leal and
Karem Boubaker and
Arturo Sarmiento{-}Reyes and
Agustin Perez{-}Sesma and
Alejandro D{\'{\i}}az{-}S{\'{a}}nchez and
V{\'{\i}}ctor Manuel Jimenez{-}Fernandez and
Juan Cervantes{-}Perez and
Jesus Sanchez{-}Orea and
Jesus Huerta{-}Chua and
Luis J. Morales{-}Mendoza and
Mario Gonzalez{-}Lee and
Carlos Hern{\'{a}}ndez{-}Mej{\'{\i}}a and
Francisco Javier Gonzalez{-}Martinez},
title = {Nonlinearities Distribution Homotopy Perturbation Method Applied to
Solve Nonlinear Problems: Thomas-Fermi Equation as a Case Study},
journal = {J. Appl. Math.},
volume = {2015},
pages = {405108:1--405108:9},
year = {2015},
url = {https://doi.org/10.1155/2015/405108},
doi = {10.1155/2015/405108},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jam/Filobello-NinoV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jei/SanchezSBZPA15,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Gabriel Balota and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini},
title = {DMMFast: a complexity reduction scheme for three-dimensional high-efficiency
video coding intraframe depth map coding},
journal = {J. Electronic Imaging},
volume = {24},
number = {2},
pages = {023011},
year = {2015},
url = {https://doi.org/10.1117/1.JEI.24.2.023011},
doi = {10.1117/1.JEI.24.2.023011},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jei/SanchezSBZPA15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jot/NaranjoSV15,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Evaluating the capabilities of Enterprise Architecture modeling tools
for Visual Analysis},
journal = {J. Object Technol.},
volume = {14},
number = {1},
pages = {3:1--32},
year = {2015},
url = {https://doi.org/10.5381/jot.2015.14.1.a3},
doi = {10.5381/JOT.2015.14.1.A3},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jot/NaranjoSV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/Aartsen15,
author = {Mark G. Aartsen and
Rasha U. Abbasi and
Markus Ackermann and
Jenni Adams and
Juan Antonio Aguilar S{\'{a}}nchez and
Markus Ahlers and
David Altmann and
Carlos A. Arg{\"{u}}elles Delgado and
Jan Auffenberg and
Xinhua Bai and
Michael F. Baker and
Steven W. Barwick and
Volker Baum and
Ryan Bay and
James J. Beatty and
Julia K. Becker Tjus and
Karl{-}Heinz Becker and
Segev BenZvi and
Patrick Berghaus and
David Berley and
Elisa Bernardini and
Anna Bernhard and
David Z. Besson and
G. Binder and
Daniel Bindig and
Martin Bissok and
Erik Blaufuss and
Jan Blumenthal and
David J. Boersma and
Christian Bohm and
Debanjan Bose and
Sebastian B{\"{o}}ser and
Olga Botner and
Lionel Brayeur and
Hans{-}Peter Bretz and
Anthony M. Brown and
Ronald Bruijn and
James Casey and
Martin Casier and
Dmitry Chirkin and
Asen Christov and
Brian John Christy and
Ken Clark and
Lew Classen and
Fabian Clevermann and
Stefan Coenders and
Shirit Cohen and
Doug F. Cowen and
Angel H. Cruz Silva and
Matthias Danninger and
Jacob Daughhetee and
James C. Davis and
Melanie Day and
Catherine De Clercq and
Sam De Ridder and
Paolo Desiati and
Krijn D. de Vries and
Meike de With and
Tyce DeYoung and
Juan Carlos D{\'{\i}}az{-}V{\'{e}}lez and
Matthew Dunkman and
Ryan Eagan and
Benjamin Eberhardt and
Bj{\"{o}}rn Eichmann and
Jonathan Eisch and
Sebastian Euler and
Paul A. Evenson and
Oladipo O. Fadiran and
Ali R. Fazely and
Anatoli Fedynitch and
Jacob Feintzeig and
Tom Feusels and
Kirill Filimonov and
Chad Finley and
Tobias Fischer{-}Wasels and
Samuel Flis and
Anna Franckowiak and
Katharina Frantzen and
Tomasz Fuchs and
Thomas K. Gaisser and
Joseph S. Gallagher and
Lisa Marie Gerhardt and
Laura E. Gladstone and
Thorsten Gl{\"{u}}senkamp and
Azriel Goldschmidt and
Geraldina Golup and
Javier G. Gonz{\'{a}}lez and
Jordan A. Goodman and
Dariusz G{\'{o}}ra and
Dylan T. Grandmont and
Darren Grant and
Pavel Gretskov and
John C. Groh and
Andreas Gro{\ss} and
Chang Hyon Ha and
Abd Al Karim Haj Ismail and
Patrick Hallen and
Allan Hallgren and
Francis Halzen and
Kael D. Hanson and
Dustin Hebecker and
David Heereman and
Dirk Heinen and
Klaus Helbing and
Robert Eugene Hellauer III and
Stephanie Virginia Hickford and
Gary C. Hill and
Kara D. Hoffman and
Ruth Hoffmann and
Andreas Homeier and
Kotoyo Hoshina and
Feifei Huang and
Warren Huelsnitz and
Per Olof Hulth and
Klas Hultqvist and
Shahid Hussain and
Aya Ishihara and
Emanuel Jacobi and
John E. Jacobsen and
Kai Jagielski and
George S. Japaridze and
Kyle Jero and
Ola Jlelati and
Basho Kaminsky and
Alexander Kappes and
Timo Karg and
Albrecht Karle and
Matthew Kauer and
John Lawrence Kelley and
Joanna Kiryluk and
J. Kl{\"{a}}s and
Spencer R. Klein and
Jan{-}Hendrik K{\"{o}}hne and
Georges Kohnen and
Hermann Kolanoski and
Lutz K{\"{o}}pke and
Claudio Kopper and
Sandro Kopper and
D. Jason Koskinen and
Marek Kowalski and
Mark Krasberg and
Anna Kriesten and
Kai Michael Krings and
G{\"{o}}sta Kroll and
Jan Kunnen and
Naoko Kurahashi and
Takao Kuwabara and
Mathieu L. M. Labare and
Hagar Landsman and
Michael James Larson and
Mariola Lesiak{-}Bzdak and
Martin Leuermann and
Julia Leute and
Jan L{\"{u}}nemann and
Oscar A. Mac{\'{\i}}as{-}Ram{\'{\i}}rez and
James Madsen and
Giuliano Maggi and
Reina Maruyama and
Keiichi Mase and
Howard S. Matis and
Frank McNally and
Kevin James Meagher and
Martin Merck and
Gonzalo Merino Ar{\'{e}}valo and
Thomas Meures and
Sandra Miarecki and
Eike Middell and
Natalie Milke and
John Lester Miller and
Lars Mohrmann and
Teresa Montaruli and
Robert M. Morse and
Rolf Nahnhauer and
Uwe Naumann and
Hans Niederhausen and
Sarah C. Nowicki and
David R. Nygren and
Anna Obertacke and
Sirin Odrowski and
Alex Olivas and
Ahmad Omairat and
Aongus Starbuck {\'{O}} Murchadha and
Larissa Paul and
Joshua A. Pepper and
Carlos P{\'{e}}rez de los Heros and
Carl Pfendner and
Damian Pieloth and
Elisa Pinat and
Jonas Posselt and
P. Buford Price and
Gerald T. Przybylski and
Melissa Quinnan and
Leif R{\"{a}}del and
Ian Rae and
Mohamed Rameez and
Katherine Rawlins and
Peter Christian Redl and
Ren{\'{e}} Reimann and
Elisa Resconi and
Wolfgang Rhode and
Mathieu Ribordy and
Michael Richman and
Benedikt Riedel and
J. P. Rodrigues and
Carsten Rott and
Tim Ruhe and
Bakhtiyar Ruzybayev and
Dirk Ryckbosch and
Sabine M. Saba and
Heinz{-}Georg Sander and
Juan Marcos Santander and
Subir Sarkar and
Kai Schatto and
Florian Scheriau and
Torsten Schmidt and
Martin Schmitz and
Sebastian Schoenen and
Sebastian Sch{\"{o}}neberg and
Arne Sch{\"{o}}nwald and
Anne Schukraft and
Lukas Schulte and
David Schultz and
Olaf Schulz and
David Seckel and
Yolanda Sestayo de la Cerra and
Surujhdeo Seunarine and
Rezo Shanidze and
Chris Sheremata and
Miles W. E. Smith and
Dennis Soldin and
Glenn M. Spiczak and
Christian Spiering and
Michael Stamatikos and
Todor Stanev and
Nick A. Stanisha and
Alexander Stasik and
Thorsten Stezelberger and
Robert G. Stokstad and
Achim St{\"{o}}{\ss}l and
Erik A. Strahler and
Rickard Str{\"{o}}m and
Nora Linn Strotjohann and
Gregory W. Sullivan and
Henric Taavola and
Ignacio J. Taboada and
Alessio Tamburro and
Andreas Tepe and
Samvel Ter{-}Antonyan and
Gordana Tesic and
Serap Tilav and
Patrick A. Toale and
Moriah Natasha Tobin and
Simona Toscano and
Maria Tselengidou and
Elisabeth Unger and
Marcel Usner and
Sofia Vallecorsa and
Nick van Eijndhoven and
Arne Van Overloop and
Jakob van Santen and
Markus Vehring and
Markus Voge and
Matthias Vraeghe and
Christian Walck and
Tilo Waldenmaier and
Marius Wallraff and
Christopher N. Weaver and
Mark T. Wellons and
Christopher H. Wendt and
Stefan Westerhoff and
Nathan Whitehorn and
Klaus Wiebe and
Christopher Wiebusch and
Dawn R. Williams and
Henrike Wissing and
Martin Wolf and
Terri R. Wood and
Kurt Woschnagg and
Donglian Xu and
Xianwu Xu and
Juan Pablo Y{\'{a}}{\~{n}}ez Garza and
Gaurang B. Yodh and
Shigeru Yoshida and
Pavel Zarzhitsky and
Jan Ziemann and
Simon Zierke and
Marcel Zoll},
title = {The IceProd framework: Distributed data processing for the IceCube
neutrino observatory},
journal = {J. Parallel Distributed Comput.},
volume = {75},
pages = {198--211},
year = {2015},
url = {https://doi.org/10.1016/j.jpdc.2014.08.001},
doi = {10.1016/J.JPDC.2014.08.001},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jpdc/Aartsen15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsce/Amezquita-Brooks15,
author = {Luis Antonio Amezquita{-}Brooks and
Diana Hernandez{-}Alcantara and
Mario Francisco Gonz{\'{a}}lez{-}S{\'{a}}nchez and
Juan Carlos Tud{\'{o}}n{-}Mart{\'{\i}}nez},
title = {Linear programming predictive control with actuator saturation: Experimental
robustness and performance results},
journal = {J. Syst. Control. Eng.},
volume = {229},
number = {8},
pages = {700--710},
year = {2015},
url = {https://doi.org/10.1177/0959651815582130},
doi = {10.1177/0959651815582130},
timestamp = {Thu, 20 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsce/Amezquita-Brooks15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Anzures-GarciaS15,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Miguel J. Hornos and
Patricia Paderewski{-}Rodr{\'{\i}}guez},
title = {A Software Architecture for Defining a Methodologic Approach to Develop
Collaborative Applications},
journal = {Res. Comput. Sci.},
volume = {105},
pages = {9--20},
year = {2015},
url = {https://rcs.cic.ipn.mx/2015\_105/A\%20Software\%20Architecture\%20for\%20Defining\%20a\%20Methodologic\%20Approach\%20to\%20Develop\%20Collaborative.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/Anzures-GarciaS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Cruz-GutierrezP15,
author = {Viridiana Cruz{-}Guti{\'{e}}rrez and
Mario Alberto Posada{-}Zamora and
Maya Carrillo and
Luis Enrique Colmenares Guill{\'{e}}n and
Abraham S{\'{a}}nchez L{\'{o}}pez},
title = {Preprocesamiento de un corpus empleando correcci{\'{o}}n probabil{\'{\i}}stica
para precisar el vocabulario},
journal = {Res. Comput. Sci.},
volume = {99},
pages = {43--54},
year = {2015},
url = {https://rcs.cic.ipn.mx/2015\_99/Preprocesamiento\%20de\%20un\%20corpus\%20empleando\%20correccion\%20probabilistica\%20para\%20precisar\%20el\%20vocabulario.pdf},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcs/Cruz-GutierrezP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/ManzurUSV15,
author = {Laura Manzur and
Jorge Mario Ulloa and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {xArchiMate: Enterprise Architecture simulation, experimentation and
analysis},
journal = {Simul.},
volume = {91},
number = {3},
pages = {276--301},
year = {2015},
url = {https://doi.org/10.1177/0037549715575188},
doi = {10.1177/0037549715575188},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simulation/ManzurUSV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tii/RizoLBRG15,
author = {Mario Rizo and
Marco Liserre and
Emilio Jos{\'{e}} Bueno and
Francisco J. Rodr{\'{\i}}guez and
Carlos Giron},
title = {Voltage Control Architectures for the Universal Operation of {DPGS}},
journal = {{IEEE} Trans. Ind. Informatics},
volume = {11},
number = {2},
pages = {313--321},
year = {2015},
url = {https://doi.org/10.1109/TII.2015.2389657},
doi = {10.1109/TII.2015.2389657},
timestamp = {Thu, 25 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tii/RizoLBRG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/SomolinosCHPTSF15,
author = {Roberto Somolinos and
Adolfo Mu{\~{n}}oz Carrero and
M. Elena Hernando and
Mario Pascual Carrasco and
Jes{\'{u}}s C{\'{a}}ceres Tello and
Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
Juan A. Fragua and
Pablo Serrano and
Carlos Hern{\'{a}}ndez Salvador},
title = {Service for the Pseudonymization of Electronic Healthcare Records
Based on {ISO/EN} 13606 for the Secondary Use of Information},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {19},
number = {6},
pages = {1937--1944},
year = {2015},
url = {https://doi.org/10.1109/JBHI.2014.2360546},
doi = {10.1109/JBHI.2014.2360546},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/titb/SomolinosCHPTSF15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ton/SanchezOBCBKW15,
author = {Mario A. S{\'{a}}nchez and
John S. Otto and
Zachary S. Bischof and
David R. Choffnes and
Fabian E. Bustamante and
Balachander Krishnamurthy and
Walter Willinger},
title = {A Measurement Experimentation Platform at the Internet's Edge},
journal = {{IEEE/ACM} Trans. Netw.},
volume = {23},
number = {6},
pages = {1944--1958},
year = {2015},
url = {https://doi.org/10.1109/TNET.2014.2354348},
doi = {10.1109/TNET.2014.2354348},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ton/SanchezOBCBKW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/approx/BrodyS15,
author = {Joshua Brody and
Mario S{\'{a}}nchez},
editor = {Naveen Garg and
Klaus Jansen and
Anup Rao and
Jos{\'{e}} D. P. Rolim},
title = {Dependent Random Graphs and Multi-Party Pointer Jumping},
booktitle = {Approximation, Randomization, and Combinatorial Optimization. Algorithms
and Techniques, {APPROX/RANDOM} 2015, August 24-26, 2015, Princeton,
NJ, {USA}},
series = {LIPIcs},
volume = {40},
pages = {606--624},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2015},
url = {https://doi.org/10.4230/LIPIcs.APPROX-RANDOM.2015.606},
doi = {10.4230/LIPICS.APPROX-RANDOM.2015.606},
timestamp = {Thu, 20 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/approx/BrodyS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/NaranjoSV15,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Anne Persson and
Janis Stirna},
title = {The Devil in the Details: Fine-Grained Enterprise Model Weaving},
booktitle = {Advanced Information Systems Engineering Workshops - CAiSE 2015 International
Workshops, Stockholm, Sweden, June 8-9, 2015, Proceedings},
series = {Lecture Notes in Business Information Processing},
volume = {215},
pages = {233--244},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-19243-7\_23},
doi = {10.1007/978-3-319-19243-7\_23},
timestamp = {Sun, 02 Jun 2019 21:20:00 +0200},
biburl = {https://dblp.org/rec/conf/caise/NaranjoSV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/RamosSSV15,
author = {Andr{\'{e}}s Ramos and
Juan Pablo S{\'{a}}enz and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Khaled Gaaloul and
Rainer Schmidt and
Selmin Nurcan and
S{\'{e}}rgio Guerreiro and
Qin Ma},
title = {On the Support of Automated Analysis Chains on Enterprise Models},
booktitle = {Enterprise, Business-Process and Information Systems Modeling - 16th
International Conference, {BPMDS} 2015, 20th International Conference,
{EMMSAD} 2015, Held at CAiSE 2015, Stockholm, Sweden, June 8-9, 2015,
Proceedings},
series = {Lecture Notes in Business Information Processing},
volume = {214},
pages = {345--359},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-19237-6\_22},
doi = {10.1007/978-3-319-19237-6\_22},
timestamp = {Fri, 19 Mar 2021 08:43:31 +0100},
biburl = {https://dblp.org/rec/conf/caise/RamosSSV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fskd/Sanchez-Camacho15,
author = {Mario Garcia{-}Munoz Sanchez{-}Camacho and
Hongying Wu and
Carlos Alberto Nunes Cosenza and
Fabio Krykhtine and
F{\'{e}}lix Mora{-}Camino},
title = {Fuzzy setting of cost Index for improved flight management},
booktitle = {12th International Conference on Fuzzy Systems and Knowledge Discovery,
{FSKD} 2015, Zhangjiajie, China, August 15-17, 2015},
pages = {433--438},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/FSKD.2015.7381981},
doi = {10.1109/FSKD.2015.7381981},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/fskd/Sanchez-Camacho15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ibpria/RodriguezMHO15,
author = {Mario Rodr{\'{\i}}guez and
Carlos Medrano and
El{\'{\i}}as Herrero and
Carlos Orrite},
editor = {Roberto Paredes and
Jaime S. Cardoso and
Xos{\'{e}} M. Pardo},
title = {Spectral Clustering Using Friendship Path Similarity},
booktitle = {Pattern Recognition and Image Analysis - 7th Iberian Conference, IbPRIA
2015, Santiago de Compostela, Spain, June 17-19, 2015, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9117},
pages = {319--326},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-19390-8\_36},
doi = {10.1007/978-3-319-19390-8\_36},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ibpria/RodriguezMHO15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/SaldanhaSZPA15,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini},
title = {Complexity reduction for the 3D-HEVC depth maps coding},
booktitle = {2015 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
2015, Lisbon, Portugal, May 24-27, 2015},
pages = {621--624},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ISCAS.2015.7168710},
doi = {10.1109/ISCAS.2015.7168710},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/SaldanhaSZPA15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwbbio/SanchezFCAC15,
author = {Horacio P{\'{e}}rez S{\'{a}}nchez and
Afshin Fassihi and
Jos{\'{e}} M. Cecilia and
Hesham H. Ali and
Mario Cannataro},
editor = {Francisco M. Ortu{\~{n}}o Guzman and
Ignacio Rojas},
title = {Applications of High Performance Computing in Bioinformatics, Computational
Biology and Computational Chemistry},
booktitle = {Bioinformatics and Biomedical Engineering - Third International Conference,
{IWBBIO} 2015, Granada, Spain, April 15-17, 2015. Proceedings, Part
{II}},
series = {Lecture Notes in Computer Science},
volume = {9044},
pages = {527--541},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-16480-9\_51},
doi = {10.1007/978-3-319-16480-9\_51},
timestamp = {Fri, 11 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iwbbio/SanchezFCAC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/SanchezSZPA15,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini},
title = {{S-GMOF:} {A} gradient-based complexity reduction algorithm for depth-maps
intra prediction on 3D-HEVC},
booktitle = {{IEEE} 6th Latin American Symposium on Circuits {\&} Systems,
{LASCAS} 2015, Montevideo, Uruguay, February 24-27, 2015},
pages = {1--4},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/LASCAS.2015.7250455},
doi = {10.1109/LASCAS.2015.7250455},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lascas/SanchezSZPA15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mie/MorenoGCLLSBGWC15,
author = {Pedro A. Moreno and
Jos{\'{e}} Luis Garcia{-}Pacheco and
Jim Charvill and
Ahmad Lotfi and
Caroline S. Langensiepen and
Alison Saunders and
Kris Berckmans and
Jozef Gaspersic and
Louise Walton and
Montserrat Carmona Rodriguez and
S. Perez de la Camara and
Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
J. Pozo and
Adolfo Mu{\~{n}}oz and
Mario Pascual Carrasco and
Enrique J. G{\'{o}}mez},
editor = {Ronald Cornet and
Lacramioara Stoicu{-}Tivadar and
Alexander H{\"{o}}rbst and
Carlos Luis Parra Calder{\'{o}}n and
Stig Kj{\ae}r Andersen and
Mira Hercigonja{-}Szekeres},
title = {iCarer: {AAL} for the Informal Carers of the Elderly},
booktitle = {Digital Healthcare Empowering Europeans - Proceedings of MIE2015,
Madrid Spain, 27-29 May, 2015},
series = {Studies in Health Technology and Informatics},
volume = {210},
pages = {678--680},
publisher = {{IOS} Press},
year = {2015},
url = {https://doi.org/10.3233/978-1-61499-512-8-678},
doi = {10.3233/978-1-61499-512-8-678},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mie/MorenoGCLLSBGWC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mie/Sanchez-de-Madariaga15,
author = {Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
Adolfo Mu{\~{n}}oz Carrero and
Roberto Somolinos and
Antonio L. Castro and
Iker Vel{\'{a}}zquez and
Oscar Moreno and
Jos{\'{e}} L. Garc{\'{\i}}a{-}Pacheco and
Mario Pascual Carrasco and
Carlos Hern{\'{a}}ndez Salvador},
editor = {Ronald Cornet and
Lacramioara Stoicu{-}Tivadar and
Alexander H{\"{o}}rbst and
Carlos Luis Parra Calder{\'{o}}n and
Stig Kj{\ae}r Andersen and
Mira Hercigonja{-}Szekeres},
title = {Normalized medical information visualization},
booktitle = {Digital Healthcare Empowering Europeans - Proceedings of MIE2015,
Madrid Spain, 27-29 May, 2015},
series = {Studies in Health Technology and Informatics},
volume = {210},
pages = {215--217},
publisher = {{IOS} Press},
year = {2015},
url = {https://doi.org/10.3233/978-1-61499-512-8-215},
doi = {10.3233/978-1-61499-512-8-215},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mie/Sanchez-de-Madariaga15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mswim/Sanchez-Hernandez15,
author = {Jairo Javier Sanchez{-}Hernandez and
Rolando Menchaca{-}M{\'{e}}ndez and
Ricardo Menchaca{-}Mendez and
Jesus Garcia{-}Diaz and
Mario E. Rivero{-}Angeles and
Jose Joaquin Garcia{-}Luna{-}Aceves},
editor = {J. J. Garcia{-}Luna{-}Aceves and
Graciela Rom{\'{a}}n{-}Alonso and
Falko Dressler and
Brahim Bensaou and
Antonio A. F. Loureiro},
title = {A Bloom Filter-Based Algorithm for Routing in Intermittently Connected
Mobile Networks},
booktitle = {Proceedings of the 18th {ACM} International Conference on Modeling,
Analysis and Simulation of Wireless and Mobile Systems, MSWiM 2015,
Cancun, Mexico, November 2-6, 2015},
pages = {319--326},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2811587.2811609},
doi = {10.1145/2811587.2811609},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mswim/Sanchez-Hernandez15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sepln/SiordiaMGMTV15,
author = {Oscar S. Siordia and
Daniela Moctezuma and
Mario Graff and
Sabino Miranda{-}Jim{\'{e}}nez and
Eric Sadit T{\'{e}}llez and
Elio{-}Aten{\'{o}}genes Villase{\~{n}}or},
editor = {Julio Villena{-}Rom{\'{a}}n and
Janine Garc{\'{\i}}a{-}Morera and
Miguel {\'{A}}ngel Garc{\'{\i}}a Cumbreras and
Eugenio Mart{\'{\i}}nez{-}C{\'{a}}mara and
Mar{\'{\i}}a Teresa Mart{\'{\i}}n{-}Valdivia and
Luis Alfonso Ure{\~{n}}a L{\'{o}}pez},
title = {Sentiment Analysis for Twitter: {TASS} 2015},
booktitle = {Proceedings of {TASS} 2015: Workshop on Sentiment Analysis at {SEPLN}
co-located with 31st {SEPLN} Conference {(SEPLN} 2015), Alicante,
Spain, September 15, 2015},
series = {{CEUR} Workshop Proceedings},
volume = {1397},
pages = {65--70},
publisher = {CEUR-WS.org},
year = {2015},
url = {https://ceur-ws.org/Vol-1397/centroGEO\_Infotec.pdf},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sepln/SiordiaMGMTV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/SanchezBKW15,
author = {Mario A. S{\'{a}}nchez and
Fabi{\'{a}}n E. Bustamante and
Balachander Krishnamurthy and
Walter Willinger},
editor = {Fabi{\'{a}}n E. Bustamante and
Balachander Krishnamurthy and
Walter Willinger},
title = {Experiment Coordination for Large-scale Measurement Platforms},
booktitle = {Proceedings of the 2015 {ACM} {SIGCOMM} Workshop on Crowdsourcing
and Crowdsharing of Big (Internet) Data, C2B(I)D@SIGCOMM 2015, London,
United Kingdom, August 17, 2015},
pages = {21--26},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2787394.2787401},
doi = {10.1145/2787394.2787401},
timestamp = {Tue, 06 Nov 2018 11:07:11 +0100},
biburl = {https://dblp.org/rec/conf/sigcomm/SanchezBKW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ucami/Ferrandez-Pastor15,
author = {Francisco Javier Ferr{\'{a}}ndez Pastor and
Higinio Mora Mora and
Jos{\'{e}}{-}Luis S{\'{a}}nchez{-}Romero and
Mario Nieto{-}Hidalgo},
editor = {Juan Manuel Garc{\'{\i}}a Chamizo and
Giancarlo Fortino and
Sergio F. Ochoa},
title = {Smart Sensor Design for Power Signal Processing},
booktitle = {Ubiquitous Computing and Ambient Intelligence. Sensing, Processing,
and Using Environmental Information - 9th International Conference,
UCAmI 2015, Puerto Varas, Chile, December 1-4, 2015, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9454},
pages = {387--393},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-26401-1\_36},
doi = {10.1007/978-3-319-26401-1\_36},
timestamp = {Tue, 14 May 2019 10:00:41 +0200},
biburl = {https://dblp.org/rec/conf/ucami/Ferrandez-Pastor15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/LocesRPBH15,
author = {Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
Kavita Rege and
Johnatan E. Pecero and
Pascal Bouvry and
H{\'{e}}ctor J. {Fraire H.}},
editor = {Patricia Melin and
Oscar Castillo and
Janusz Kacprzyk},
title = {Trajectory Metaheuristics for the Internet Shopping Optimization Problem},
booktitle = {Design of Intelligent Systems Based on Fuzzy Logic, Neural Networks
and Nature-Inspired Optimization},
series = {Studies in Computational Intelligence},
volume = {601},
pages = {527--536},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-17747-2\_41},
doi = {10.1007/978-3-319-17747-2\_41},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/series/sci/LocesRPBH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/BrodyS15,
author = {Joshua Brody and
Mario S{\'{a}}nchez},
title = {Dependent Random Graphs and Multiparty Pointer Jumping},
journal = {CoRR},
volume = {abs/1506.01083},
year = {2015},
url = {http://arxiv.org/abs/1506.01083},
eprinttype = {arXiv},
eprint = {1506.01083},
timestamp = {Thu, 20 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/BrodyS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/MereloGVB15,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Mario Garc{\'{\i}}a Valdez and
Israel Blancas},
title = {There is no fast lunch: an examination of the running speed of evolutionary
algorithms in several languages},
journal = {CoRR},
volume = {abs/1511.01088},
year = {2015},
url = {http://arxiv.org/abs/1511.01088},
eprinttype = {arXiv},
eprint = {1511.01088},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/MereloGVB15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eccc/BrodyS15,
author = {Joshua Brody and
Mario S{\'{a}}nchez},
title = {Dependent Random Graphs and Multiparty Pointer Jumping},
journal = {Electron. Colloquium Comput. Complex.},
volume = {{TR15-091}},
year = {2015},
url = {https://eccc.weizmann.ac.il/report/2015/091},
eprinttype = {ECCC},
eprint = {TR15-091},
timestamp = {Thu, 20 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eccc/BrodyS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computing/GansnerKWBS14,
author = {Emden R. Gansner and
Balachander Krishnamurthy and
Walter Willinger and
Fabi{\'{a}}n E. Bustamante and
Mario A. S{\'{a}}nchez},
title = {Demo abstract: towards extracting semantics by visualizing large traceroute
datasets},
journal = {Computing},
volume = {96},
number = {1},
pages = {81--83},
year = {2014},
url = {https://doi.org/10.1007/s00607-013-0290-8},
doi = {10.1007/S00607-013-0290-8},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/computing/GansnerKWBS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dsp/Rodriguez-DiazS14,
author = {Mario A. Rodr{\'{\i}}guez{-}D{\'{\i}}az and
Hermilo S{\'{a}}nchez{-}Cruz},
title = {Refined fixed double pass binary object classification for document
image compression},
journal = {Digit. Signal Process.},
volume = {30},
pages = {114--130},
year = {2014},
url = {https://doi.org/10.1016/j.dsp.2014.03.007},
doi = {10.1016/J.DSP.2014.03.007},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dsp/Rodriguez-DiazS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejwcn/Cortes-SanchezVLRS14,
author = {Jorge Cort{\'{e}}s{-}S{\'{a}}nchez and
Andr{\'{e}}s Vel{\'{a}}zquez{-}Ram{\'{\i}}rez and
Andr{\'{e}}s Lucas{-}Bravo and
Mario E. Rivero{-}Angeles and
Victor A. Salinas{-}Reyes},
title = {On the use of electromagnetic waves as means of power supply in wireless
sensor networks},
journal = {{EURASIP} J. Wirel. Commun. Netw.},
volume = {2014},
pages = {36},
year = {2014},
url = {https://doi.org/10.1186/1687-1499-2014-36},
doi = {10.1186/1687-1499-2014-36},
timestamp = {Thu, 27 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ejwcn/Cortes-SanchezVLRS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/evi/MoraGGCRH14,
author = {Antonio Miguel Mora and
Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Pedro A. Castillo and
M. S. Rodr{\'{\i}}guez{-}Domingo and
R. M. Hidalgo{-}Berm{\'{u}}dez},
title = {Creating autonomous agents for playing Super Mario Bros game by means
of evolutionary finite state machines},
journal = {Evol. Intell.},
volume = {6},
number = {4},
pages = {205--218},
year = {2014},
url = {https://doi.org/10.1007/s12065-014-0105-7},
doi = {10.1007/S12065-014-0105-7},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/evi/MoraGGCRH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijns/GonzalezDRS14,
author = {Mario Gonz{\'{a}}lez and
David Dominguez and
Francisco B. Rodr{\'{\i}}guez and
{\'{A}}ngel S{\'{a}}nchez},
title = {Retrieval of noisy Fingerprint Patterns using Metric Attractor Networks},
journal = {Int. J. Neural Syst.},
volume = {24},
number = {7},
year = {2014},
url = {https://doi.org/10.1142/S0129065714500257},
doi = {10.1142/S0129065714500257},
timestamp = {Sat, 01 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijns/GonzalezDRS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jot/GomezSFV14,
author = {Paola G{\'{o}}mez and
Mario E. S{\'{a}}nchez and
Hector Florez and
Jorge Villalobos},
title = {An approach to the co-creation of models and metamodels in Enterprise
Architecture Projects},
journal = {J. Object Technol.},
volume = {13},
number = {3},
pages = {2: 1--29},
year = {2014},
url = {https://doi.org/10.5381/jot.2014.13.3.a2},
doi = {10.5381/JOT.2014.13.3.A2},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jot/GomezSFV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pnas/Gavalda-Miralles14,
author = {Arnau Gavald{\`{a}}{-}Miralles and
David R. Choffnes and
John S. Otto and
Mario A. S{\'{a}}nchez and
Fabi{\'{a}}n E. Bustamante and
Lu{\'{\i}}s A. Nunes Amaral and
Jordi Duch and
Roger Guimer{\`{a}}},
title = {Impact of heterogeneity and socioeconomic factors on individual behavior
in decentralized sharing ecosystems},
journal = {Proc. Natl. Acad. Sci. {USA}},
volume = {111},
number = {43},
pages = {15322--15327},
year = {2014},
url = {https://doi.org/10.1073/pnas.1309389111},
doi = {10.1073/PNAS.1309389111},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pnas/Gavalda-Miralles14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/polibits/JaramilloSP14,
author = {Carlos Mario Zapata Jaramillo and
Rafael Esteban Arango Sanchez and
Leidy Diana Jim{\'{e}}nez Pinz{\'{o}}n},
title = {Mejoramiento de la consistencia entre la sintaxis textual y gr{\'{a}}fica
del lenguaje de Semat},
journal = {Polibits},
volume = {49},
pages = {83--89},
year = {2014},
url = {https://doi.org/10.17562/pb-49-10},
doi = {10.17562/PB-49-10},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/polibits/JaramilloSP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/RamosGSV14,
author = {Andr{\'{e}}s Ramos and
Paola G{\'{o}}mez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Ilia Bider and
Khaled Gaaloul and
John Krogstie and
Selmin Nurcan and
Henderik Alex Proper and
Rainer Schmidt and
Pnina Soffer},
title = {Automated Enterprise-Level Analysis of ArchiMate Models},
booktitle = {Enterprise, Business-Process and Information Systems Modeling - 15th
International Conference, {BPMDS} 2014, 19th International Conference,
{EMMSAD} 2014, Held at CAiSE 2014, Thessaloniki, Greece, June 16-17,
2014. Proceedings},
series = {Lecture Notes in Business Information Processing},
volume = {175},
pages = {439--453},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-662-43745-2\_30},
doi = {10.1007/978-3-662-43745-2\_30},
timestamp = {Thu, 02 Aug 2018 16:14:14 +0200},
biburl = {https://dblp.org/rec/conf/caise/RamosGSV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/SanchezRV14,
author = {Mario E. S{\'{a}}nchez and
Julio Cesar Reyes and
Jorge Villalobos},
editor = {Joseph Barjis and
Robert Pergl},
title = {Extraction and Reconstruction of Enterprise Models},
booktitle = {Enterprise and Organizational Modeling and Simulation - 10th International
Workshop, {EOMAS} 2014, Held at CAiSE 2014, Thessaloniki, Greece,
June 16-17, 2014, Selected Papers},
series = {Lecture Notes in Business Information Processing},
volume = {191},
pages = {3--20},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-662-44860-1\_1},
doi = {10.1007/978-3-662-44860-1\_1},
timestamp = {Thu, 15 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/caise/SanchezRV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/DiazPBSVC14,
author = {Cesar O. Diaz and
Johnatan E. Pecero and
Pascal Bouvry and
German Sotelo and
Mario Villamizar and
Harold E. Castro},
title = {Performance Evaluation of an IaaS Opportunistic Cloud Computing},
booktitle = {14th {IEEE/ACM} International Symposium on Cluster, Cloud and Grid
Computing, CCGrid 2014, Chicago, IL, USA, May 26-29, 2014},
pages = {546--547},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/CCGrid.2014.116},
doi = {10.1109/CCGRID.2014.116},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ccgrid/DiazPBSVC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clei/DivanORCFM14,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Ana Oddone and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso and
Bruno Sebastian Cavallo and
Marcos Alejandro Fredes and
Alejandro Maximiliano Martinez},
title = {A data monitoring strategy based in snapshots for the score calculation
in the housing distribution},
booktitle = {{XL} Latin American Computing Conference, {CLEI} 2014, Montevideo,
Uruguay, September 15-19, 2014},
pages = {1--12},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/CLEI.2014.6965104},
doi = {10.1109/CLEI.2014.6965104},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/clei/DivanORCFM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/FlorezSV14,
author = {Hector Florez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Manfred Reichert and
Stefanie Rinderle{-}Ma and
Georg Grossmann},
title = {Extensible Model-Based Approach for Supporting Automatic Enterprise
Analysis},
booktitle = {18th {IEEE} International Enterprise Distributed Object Computing
Conference, {EDOC} 2014, Ulm, Germany, September 1-5, 2014},
pages = {32--41},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/EDOC.2014.15},
doi = {10.1109/EDOC.2014.15},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/edoc/FlorezSV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/FlorezSV14a,
author = {Hector Florez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Georg Grossmann and
Sylvain Hall{\'{e}} and
Dimka Karastoyanova and
Manfred Reichert and
Stefanie Rinderle{-}Ma},
title = {iArchiMate: {A} Tool for Managing Imperfection in Enterprise Models},
booktitle = {18th {IEEE} International Enterprise Distributed Object Computing
Conference Workshops and Demonstrations, {EDOC} Workshops 2014, Ulm,
Germany, September 1-2, 2014},
pages = {201--210},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/EDOCW.2014.38},
doi = {10.1109/EDOCW.2014.38},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/edoc/FlorezSV14a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/NaranjoSV14,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Georg Grossmann and
Sylvain Hall{\'{e}} and
Dimka Karastoyanova and
Manfred Reichert and
Stefanie Rinderle{-}Ma},
title = {Towards a Unified and Modular Approach for Visual Analysis of Enterprise
Models},
booktitle = {18th {IEEE} International Enterprise Distributed Object Computing
Conference Workshops and Demonstrations, {EDOC} Workshops 2014, Ulm,
Germany, September 1-2, 2014},
pages = {77--86},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/EDOCW.2014.20},
doi = {10.1109/EDOCW.2014.20},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/edoc/NaranjoSV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/Dominguez-Sanchez14,
author = {S. Dominguez{-}Sanchez and
Mario Alfredo Reyes{-}Barranca and
G. S. Abarca{-}Jimenez and
Salvador Mendoza{-}Acevedo},
title = {A prototype design for an accelerometer using a multiple floating-gate
{MOSFET} as a transducer},
booktitle = {11th International Conference on Electrical Engineering, Computing
Science and Automatic Control, {CCE} 2014, Campeche, Mexico, September
29 - October 3, 2014},
pages = {1--6},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ICEEE.2014.6978255},
doi = {10.1109/ICEEE.2014.6978255},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/iceee/Dominguez-Sanchez14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceis/NaranjoSV14,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Slimane Hammoudi and
Leszek A. Maciaszek and
Jos{\'{e}} Cordeiro},
title = {PRIMROSe - {A} Tool for Enterprise Architecture Analysis and Diagnosis},
booktitle = {{ICEIS} 2014 - Proceedings of the 16th International Conference on
Enterprise Information Systems, Volume 3, Lisbon, Portugal, 27-30
April, 2014},
pages = {201--213},
publisher = {SciTePress},
year = {2014},
url = {https://doi.org/10.5220/0004884702010213},
doi = {10.5220/0004884702010213},
timestamp = {Wed, 12 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iceis/NaranjoSV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceis/NaranjoSV14a,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Jos{\'{e}} Cordeiro and
Slimane Hammoudi and
Leszek A. Maciaszek and
Olivier Camp and
Joaquim Filipe},
title = {PRIMROSe: {A} Graph-Based Approach for Enterprise Architecture Analysis},
booktitle = {Enterprise Information Systems - 16th International Conference, {ICEIS}
2014, Lisbon, Portugal, April 27-30, 2014, Revised Selected Papers},
series = {Lecture Notes in Business Information Processing},
volume = {227},
pages = {434--452},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-22348-3\_24},
doi = {10.1007/978-3-319-22348-3\_24},
timestamp = {Sat, 19 Oct 2019 20:26:20 +0200},
biburl = {https://dblp.org/rec/conf/iceis/NaranjoSV14a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icete/MusialPLFBB14,
author = {Jedrzej Musial and
Johnatan E. Pecero and
Mario C. Lopez and
H{\'{e}}ctor J. {Fraire H.} and
Pascal Bouvry and
Jacek Blazewicz},
editor = {Mohammad S. Obaidat and
Andreas Holzinger and
Marten van Sinderen and
Peter Dolog},
title = {How to Efficiently Solve Internet Shopping Optimization Problem with
Price Sensitive Discounts?},
booktitle = {{ICE-B} 2014 - Proceedings of the 11th International Conference on
e-Business, Vienna, Austria, 28-30 August, 2014},
pages = {209--215},
publisher = {SciTePress},
year = {2014},
url = {https://doi.org/10.5220/0005112602090215},
doi = {10.5220/0005112602090215},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icete/MusialPLFBB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/SanchezSBZPA14,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Gabriel Balota and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini},
title = {Complexity reduction for 3D-HEVC depth maps intra-frame prediction
using simplified edge detector algorithm},
booktitle = {2014 {IEEE} International Conference on Image Processing, {ICIP} 2014,
Paris, France, October 27-30, 2014},
pages = {3209--3213},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ICIP.2014.7025649},
doi = {10.1109/ICIP.2014.7025649},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/SanchezSBZPA14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icira/PrudencioSGL14,
author = {Alejandro Prudencio and
Eduardo Morales Sanchez and
Mario A. Garc{\'{\i}}a and
Alejandro Lozano},
editor = {Xianmin Zhang and
Honghai Liu and
Zhong Chen and
Nianfeng F. Wang},
title = {Anthropometric and Anthropomorphic Features Applied to a Mechanical
Finger},
booktitle = {Intelligent Robotics and Applications - 7th International Conference,
{ICIRA} 2014, Guangzhou, China, December 17-20, 2014, Proceedings,
Part {I}},
series = {Lecture Notes in Computer Science},
volume = {8917},
pages = {254--265},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-13966-1\_26},
doi = {10.1007/978-3-319-13966-1\_26},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icira/PrudencioSGL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/imc/SanchezBKWSE14,
author = {Mario A. S{\'{a}}nchez and
Fabi{\'{a}}n E. Bustamante and
Balachander Krishnamurthy and
Walter Willinger and
Georgios Smaragdakis and
Jeffrey Erman},
editor = {Carey Williamson and
Aditya Akella and
Nina Taft},
title = {Inter-Domain Traffic Estimation for the Outsider},
booktitle = {Proceedings of the 2014 Internet Measurement Conference, {IMC} 2014,
Vancouver, BC, Canada, November 5-7, 2014},
pages = {1--14},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2663716.2663740},
doi = {10.1145/2663716.2663740},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/imc/SanchezBKWSE14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iolts/Sanchez-ClementeEG14,
author = {Antonio Sanchez{-}Clemente and
Luis Entrena and
Mario Garc{\'{\i}}a{-}Valderas},
title = {Error masking with approximate logic circuits using dynamic probability
estimations},
booktitle = {2014 {IEEE} 20th International On-Line Testing Symposium, {IOLTS}
2014, Platja d'Aro, Girona, Spain, July 7-9, 2014},
pages = {134--139},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/IOLTS.2014.6873685},
doi = {10.1109/IOLTS.2014.6873685},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/iolts/Sanchez-ClementeEG14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lanmr/Anzures-GarciaSHP14,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Miguel J. Hornos and
Patricia Paderewski},
editor = {Juan Carlos Acosta Guadarrama},
title = {Knowledge Representation for Development of Collaborative Applications},
booktitle = {Proceedings of the Ninth Latin American Workshop on Logic/Languages,
Algorithms and New Methods of Reasoning, Valle de Bravo, Mexico, November
5-7, 2014},
series = {{CEUR} Workshop Proceedings},
volume = {1287},
pages = {1--9},
publisher = {CEUR-WS.org},
year = {2014},
url = {https://ceur-ws.org/Vol-1287/preface.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:17 +0100},
biburl = {https://dblp.org/rec/conf/lanmr/Anzures-GarciaSHP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/BalotaSSZPA14,
author = {Gabriel Balota and
M{\'{a}}rio Saldanha and
Gustavo Sanchez and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini},
title = {Overview and quality analysis in 3D-HEVC emergent video coding standard},
booktitle = {{IEEE} 5th Latin American Symposium on Circuits and Systems, {LASCAS}
2014, Santiago, Chile, February 25-28, 2014},
pages = {1--4},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/LASCAS.2014.6820260},
doi = {10.1109/LASCAS.2014.6820260},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lascas/BalotaSSZPA14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/ReyesPTLSMH14,
author = {Benjam{\'{\i}}n T. Reyes and
German Paulina and
Lucas Tealdi and
Emanuel Labat and
Raul M. Sanchez and
Pablo Sergio Mandolesi and
Mario Rafael Hueda},
title = {A 1.6Gb/s {CMOS} {LVDS} transmitter with a programmable pre-emphasis
system},
booktitle = {{IEEE} 5th Latin American Symposium on Circuits and Systems, {LASCAS}
2014, Santiago, Chile, February 25-28, 2014},
pages = {1--4},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/LASCAS.2014.6820268},
doi = {10.1109/LASCAS.2014.6820268},
timestamp = {Mon, 20 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/lascas/ReyesPTLSMH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/ReyesTPLSMH14,
author = {Benjam{\'{\i}}n T. Reyes and
Lucas Tealdi and
German Paulina and
Emanuel Labat and
Raul M. Sanchez and
Pablo Sergio Mandolesi and
Mario Rafael Hueda},
title = {A 6-bit 2GS/s {CMOS} time-interleaved {ADC} for analysis of mixed-signal
calibration techniques},
booktitle = {{IEEE} 5th Latin American Symposium on Circuits and Systems, {LASCAS}
2014, Santiago, Chile, February 25-28, 2014},
pages = {1--4},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/LASCAS.2014.6820267},
doi = {10.1109/LASCAS.2014.6820267},
timestamp = {Mon, 20 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/lascas/ReyesTPLSMH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vcip/SanchezSBZPA14,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Gabriel Balota and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini},
title = {A complexity reduction algorithm for depth maps intra prediction on
the 3D-HEVC},
booktitle = {2014 {IEEE} Visual Communications and Image Processing Conference,
{VCIP} 2014, Valletta, Malta, December 7-10, 2014},
pages = {137--140},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/VCIP.2014.7051523},
doi = {10.1109/VCIP.2014.7051523},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vcip/SanchezSBZPA14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/LocesCHBPRBV14,
author = {Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
Norberto Castillo{-}Garc{\'{\i}}a and
H{\'{e}}ctor J. {Fraire H.} and
Pascal Bouvry and
Johnatan E. Pecero and
Rodolfo A. Pazos Rangel and
Juan Javier Gonz{\'{a}}lez Barbosa and
Fevrier Valdez},
editor = {Oscar Castillo and
Patricia Melin and
Witold Pedrycz and
Janusz Kacprzyk},
title = {A New Integer Linear Programming Model for the Cutwidth Minimization
Problem of a Connected Undirected Graph},
booktitle = {Recent Advances on Hybrid Approaches for Designing Intelligent Systems},
series = {Studies in Computational Intelligence},
volume = {547},
pages = {509--517},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-05170-3\_35},
doi = {10.1007/978-3-319-05170-3\_35},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/series/sci/LocesCHBPRBV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cluster/CastroVSDPB13,
author = {Harold E. Castro and
Mario Villamizar and
German Sotelo and
Cesar O. Diaz and
Johnatan E. Pecero and
Pascal Bouvry},
title = {Green flexible opportunistic computing with task consolidation and
virtualization},
journal = {Clust. Comput.},
volume = {16},
number = {3},
pages = {545--557},
year = {2013},
url = {https://doi.org/10.1007/s10586-012-0222-y},
doi = {10.1007/S10586-012-0222-Y},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cluster/CastroVSDPB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/Martinez-ZarzuelaGPFH13,
author = {Mario Mart{\'{\i}}nez{-}Zarzuela and
Carlos G{\'{o}}mez and
Francisco Javier D{\'{\i}}az Pernas and
Alberto Fern{\'{a}}ndez and
Roberto Hornero},
title = {Cross-Approximate Entropy parallel computation on GPUs for biomedical
signal analysis. Application to {MEG} recordings},
journal = {Comput. Methods Programs Biomed.},
volume = {112},
number = {1},
pages = {189--199},
year = {2013},
url = {https://doi.org/10.1016/j.cmpb.2013.07.005},
doi = {10.1016/J.CMPB.2013.07.005},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cmpb/Martinez-ZarzuelaGPFH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/RodriguezMDAHM13,
author = {Juan Pablo Rodr{\'{\i}}guez and
Neil Duncan McIntyre and
Mario D{\'{\i}}az{-}Granados and
Stefan Achleitner and
Martin Hochedlinger and
Cedo Maksimovic},
title = {Generating time-series of dry weather loads to sewers},
journal = {Environ. Model. Softw.},
volume = {43},
pages = {133--143},
year = {2013},
url = {https://doi.org/10.1016/j.envsoft.2013.02.007},
doi = {10.1016/J.ENVSOFT.2013.02.007},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/envsoft/RodriguezMDAHM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcis/Sanchez-GonzalezGRP13,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
F{\'{e}}lix Garc{\'{\i}}a and
Francisco Ruiz and
Mario Piattini},
title = {Toward a Quality Framework for Business Process Models},
journal = {Int. J. Cooperative Inf. Syst.},
volume = {22},
number = {1},
year = {2013},
url = {https://doi.org/10.1142/S0218843013500032},
doi = {10.1142/S0218843013500032},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijcis/Sanchez-GonzalezGRP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/Sanchez-de-MadariagaCTSPMSM13,
author = {Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
Adolfo Mu{\~{n}}oz Carrero and
Jes{\'{u}}s C{\'{a}}ceres Tello and
Roberto Somolinos and
Mario Pascual Carrasco and
Ignacio Mart{\'{\i}}nez and
Carlos Hern{\'{a}}ndez Salvador and
Jose Luis Monteagudo},
title = {ccML, a new mark-up language to improve {ISO/EN} 13606-based electronic
health record extracts practical edition},
journal = {J. Am. Medical Informatics Assoc.},
volume = {20},
number = {2},
pages = {298--304},
year = {2013},
url = {https://doi.org/10.1136/amiajnl-2011-000722},
doi = {10.1136/AMIAJNL-2011-000722},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/Sanchez-de-MadariagaCTSPMSM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mcs/RizoLBRH13,
author = {Mario Rizo and
Marco Liserre and
Emilio Jos{\'{e}} Bueno and
Francisco J. Rodr{\'{\i}}guez and
Francisco Huerta},
title = {Universal wind turbine working in grid-connected and island operating
modes},
journal = {Math. Comput. Simul.},
volume = {91},
pages = {41--51},
year = {2013},
url = {https://doi.org/10.1016/j.matcom.2012.07.006},
doi = {10.1016/J.MATCOM.2012.07.006},
timestamp = {Thu, 25 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mcs/RizoLBRH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/Sanchez-EscobedoC13,
author = {Dalila S{\'{a}}nchez{-}Escobedo and
Mario Castel{\'{a}}n},
title = {3D face shape prediction from a frontal image using cylindrical coordinates
and partial least squares},
journal = {Pattern Recognit. Lett.},
volume = {34},
number = {4},
pages = {389--399},
year = {2013},
url = {https://doi.org/10.1016/j.patrec.2012.09.007},
doi = {10.1016/J.PATREC.2012.09.007},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/prl/Sanchez-EscobedoC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcc/SanchezV13,
author = {Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {An Expanded and Refined Catalog of Time Patterns for Workflows},
journal = {Rev. Colomb. de Computaci{\'{o}}n},
volume = {14},
number = {2},
pages = {122--140},
year = {2013},
url = {https://doi.org/10.29375/25392115.2018},
doi = {10.29375/25392115.2018},
timestamp = {Mon, 18 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rcc/SanchezV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/GarridoGSG13,
author = {Mario Garrido and
Jes{\'{u}}s Grajal and
Miguel A. S{\'{a}}nchez Marcos and
Oscar Gustafsson},
title = {Pipelined Radix-2\({}^{\mbox{k}}\) Feedforward {FFT} Architectures},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {21},
number = {1},
pages = {23--32},
year = {2013},
url = {https://doi.org/10.1109/TVLSI.2011.2178275},
doi = {10.1109/TVLSI.2011.2178275},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvlsi/GarridoGSG13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/DiazCVPB13,
author = {Cesar O. Diaz and
Harold E. Castro and
Mario Villamizar and
Johnatan E. Pecero and
Pascal Bouvry},
title = {Energy-aware {VM} Allocation on an Opportunistic Cloud Infrastructure},
booktitle = {13th {IEEE/ACM} International Symposium on Cluster, Cloud, and Grid
Computing, CCGrid 2013, Delft, Netherlands, May 13-16, 2013},
pages = {663--670},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/CCGrid.2013.96},
doi = {10.1109/CCGRID.2013.96},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ccgrid/DiazCVPB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/Gonzalez-SanchezALZ13,
author = {Mario Francisco Gonz{\'{a}}lez{-}S{\'{a}}nchez and
Luis Antonio Amezquita{-}Brooks and
Eduardo Lic{\'{e}}aga{-}Castro and
Patricia del C. Zambrano{-}Robledo},
title = {Simplifying quadrotor controllers by using simplified design models},
booktitle = {Proceedings of the 52nd {IEEE} Conference on Decision and Control,
{CDC} 2013, Florence, Italy, December 10-13, 2013},
pages = {4236--4241},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/CDC.2013.6760540},
doi = {10.1109/CDC.2013.6760540},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cdc/Gonzalez-SanchezALZ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/GomezSV13,
author = {Paola G{\'{o}}mez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Davide Di Ruscio and
Dimitris S. Kolovos and
Louis M. Rose and
Samir Al{-}Hilank},
title = {\emph{GraCoT}, a tool for co-creation of models and metamodels in
specific domains},
booktitle = {Proceedings of the workshop on ACadeMics Tooling with Eclipse, ACME@ECOOP
2013, Montpellier, France, July 2, 2013},
pages = {5:1--5:10},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2491279.2491284},
doi = {10.1145/2491279.2491284},
timestamp = {Tue, 06 Nov 2018 16:59:31 +0100},
biburl = {https://dblp.org/rec/conf/ecoop/GomezSV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/MeloSV13,
author = {Ivan Melo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Beno{\^{\i}}t Combemale and
Walter Cazzola and
Robert B. France},
title = {Composing graphical languages},
booktitle = {Proceedings of the First Workshop on the Globalization of Domain Specific
Languages, GlobalDSL@ECOOP 2013, Montpellier, France, July 1, 2013},
pages = {12--17},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2489812.2489816},
doi = {10.1145/2489812.2489816},
timestamp = {Tue, 06 Nov 2018 16:59:31 +0100},
biburl = {https://dblp.org/rec/conf/ecoop/MeloSV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/europar/LoddeFA13,
author = {Mario Lodde and
Jos{\'{e}} Flich and
Manuel E. Acacio},
editor = {Felix Wolf and
Bernd Mohr and
Dieter an Mey},
title = {Towards Efficient Dynamic {LLC} Home Bank Mapping with NoC-Level Support},
booktitle = {Euro-Par 2013 Parallel Processing - 19th International Conference,
Aachen, Germany, August 26-30, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8097},
pages = {178--190},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-40047-6\_20},
doi = {10.1007/978-3-642-40047-6\_20},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/europar/LoddeFA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hbu/RodriguezMHO13,
author = {Mario Rodr{\'{\i}}guez and
Carlos Medrano and
El{\'{\i}}as Herrero and
Carlos Orrite},
editor = {Albert Ali Salah and
Hayley Hung and
Oya Aran and
Hatice Gunes},
title = {Transfer Learning of Human Poses for Action Recognition},
booktitle = {Human Behavior Understanding - 4th International Workshop, {HBU} 2013,
Barcelona, Spain, October 22, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8212},
pages = {89--101},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-319-02714-2\_8},
doi = {10.1007/978-3-319-02714-2\_8},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hbu/RodriguezMHO13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ica3pp/SoteloDVCPB13,
author = {German Sotelo and
Cesar O. Diaz and
Mario Villamizar and
Harold E. Castro and
Johnatan E. Pecero and
Pascal Bouvry},
editor = {Joanna Kolodziej and
Beniamino Di Martino and
Domenico Talia and
Kaiqi Xiong},
title = {Building Platform as a Service for High Performance Computing over
an Opportunistic Cloud Computing},
booktitle = {Algorithms and Architectures for Parallel Processing - 13th International
Conference, {ICA3PP} 2013, Vietri sul Mare, Italy, December 18-20,
2013, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {8285},
pages = {380--389},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-319-03859-9\_33},
doi = {10.1007/978-3-319-03859-9\_33},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ica3pp/SoteloDVCPB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsoc/PeceroDCVSB13,
author = {Johnatan E. Pecero and
Cesar O. Diaz and
Harold E. Castro and
Mario Villamizar and
German Sotelo and
Pascal Bouvry},
editor = {Alessio Lomuscio and
Surya Nepal and
Fabio Patrizi and
Boualem Benatallah and
Ivona Brandic},
title = {Energy Savings on a Cloud-Based Opportunistic Infrastructure},
booktitle = {Service-Oriented Computing - {ICSOC} 2013 Workshops - CCSA, CSB, PASCEB,
SWESE, WESOA, and PhD Symposium, Berlin, Germany, December 2-5, 2013.
Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {8377},
pages = {366--378},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-319-06859-6\_32},
doi = {10.1007/978-3-319-06859-6\_32},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icsoc/PeceroDCVSB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip8-1/FlorezSV13,
author = {Hector Florez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Janis Grabis and
Marite Kirikova and
Jelena Zdravkovic and
Janis Stirna},
title = {Embracing Imperfection in Enterprise Architecture Models},
booktitle = {Short Paper Proceedings of the 6th {IFIP} {WG} 8.1 Working Conference
on the Practice of Enterprise Modeling (PoEM 2013), Riga, Latvia,
November 6-7, 2013},
series = {{CEUR} Workshop Proceedings},
volume = {1023},
pages = {8--17},
publisher = {CEUR-WS.org},
year = {2013},
url = {https://ceur-ws.org/Vol-1023/paper1.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:10 +0100},
biburl = {https://dblp.org/rec/conf/ifip8-1/FlorezSV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip8-1/NaranjoSV13,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Janis Grabis and
Marite Kirikova and
Jelena Zdravkovic and
Janis Stirna},
title = {Connecting the Dots: Examining Visualization Techniques for Enterprise
Architecture Model Analysis},
booktitle = {Short Paper Proceedings of the 6th {IFIP} {WG} 8.1 Working Conference
on the Practice of Enterprise Modeling (PoEM 2013), Riga, Latvia,
November 6-7, 2013},
series = {{CEUR} Workshop Proceedings},
volume = {1023},
pages = {29--38},
publisher = {CEUR-WS.org},
year = {2013},
url = {https://ceur-ws.org/Vol-1023/paper3.pdf},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ifip8-1/NaranjoSV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isami/SanchezSO13,
author = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and
Daniel D{\'{\i}}az S{\'{a}}nchez and
Mario Mu{\~{n}}oz Organero},
editor = {Ad van Berlo and
Kasper Hallenborg and
Juan M. Corchado Rodr{\'{\i}}guez and
Dante I. Tapia and
Paulo Novais},
title = {Optimizing OSGi Services on Gateways},
booktitle = {Ambient Intelligence - Software and Applications - 4th International
Symposium on Ambient Intelligence, ISAmI 2013, Salamanca, Spain, May
22-24, 2013},
series = {Advances in Intelligent Systems and Computing},
volume = {219},
pages = {155--162},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-319-00566-9\_20},
doi = {10.1007/978-3-319-00566-9\_20},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isami/SanchezSO13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lion/Hidalgo-BermudezRMGGF13,
author = {R. M. Hidalgo{-}Berm{\'{u}}dez and
M. S. Rodr{\'{\i}}guez{-}Domingo and
Antonio Miguel Mora and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Antonio Jos{\'{e}} Fern{\'{a}}ndez Leiva},
editor = {Giuseppe Nicosia and
Panos M. Pardalos},
title = {Evolutionary FSM-Based Agents for Playing Super Mario Game},
booktitle = {Learning and Intelligent Optimization - 7th International Conference,
{LION} 7, Catania, Italy, January 7-11, 2013, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {7997},
pages = {357--363},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-44973-4\_39},
doi = {10.1007/978-3-642-44973-4\_39},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lion/Hidalgo-BermudezRMGGF13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nsdi/SanchezOBCBKW13,
author = {Mario A. S{\'{a}}nchez and
John S. Otto and
Zachary S. Bischof and
David R. Choffnes and
Fabi{\'{a}}n E. Bustamante and
Balachander Krishnamurthy and
Walter Willinger},
editor = {Nick Feamster and
Jeffrey C. Mogul},
title = {Dasu: Pushing Experiments to the Internet's Edge},
booktitle = {Proceedings of the 10th {USENIX} Symposium on Networked Systems Design
and Implementation, {NSDI} 2013, Lombard, IL, USA, April 2-5, 2013},
pages = {487--499},
publisher = {{USENIX} Association},
year = {2013},
url = {https://www.usenix.org/conference/nsdi13/technical-sessions/presentation/sanchez},
timestamp = {Tue, 02 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nsdi/SanchezOBCBKW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pam/SanchezOBB13,
author = {Mario A. S{\'{a}}nchez and
John S. Otto and
Zachary S. Bischof and
Fabi{\'{a}}n E. Bustamante},
editor = {Matthew Roughan and
Rocky K. C. Chang},
title = {Trying Broadband Characterization at Home},
booktitle = {Passive and Active Measurement - 14th International Conference, {PAM}
2013, Hong Kong, China, March 18-19, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7799},
pages = {198--207},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-36516-4\_20},
doi = {10.1007/978-3-642-36516-4\_20},
timestamp = {Tue, 14 May 2019 10:00:52 +0200},
biburl = {https://dblp.org/rec/conf/pam/SanchezOBB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcsc/Ornelas-TellezGSA13,
author = {Fernando Ornelas{-}Tellez and
Mario Graff and
Edgar N. S{\'{a}}nchez and
Alma Y. Alanis},
editor = {Mo M. Jamshidi and
Vladik Kreinovich and
Janusz Kacprzyk},
title = {{PSO} Optimal Tracking Control for State-Dependent Coefficient Nonlinear
Systems},
booktitle = {Advance Trends in Soft Computing - Proceedings of {WCSC} 2013, December
16-18, San Antonio, Texas, {USA}},
series = {Studies in Fuzziness and Soft Computing},
volume = {312},
pages = {403--410},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-319-03674-8\_38},
doi = {10.1007/978-3-319-03674-8\_38},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wcsc/Ornelas-TellezGSA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/AartsenA13,
author = {Mark G. Aartsen and
Rasha U. Abbasi and
Markus Ackermann and
Jenni Adams and
Juan Antonio Aguilar S{\'{a}}nchez and
Markus Ahlers and
David Altmann and
Carlos A. Arg{\"{u}}elles Delgado and
Jan Auffenberg and
Xinhua Bai and
Michael F. Baker and
Steven W. Barwick and
Volker Baum and
Ryan Bay and
James J. Beatty and
Julia K. Becker Tjus and
Karl{-}Heinz Becker and
Segev BenZvi and
Patrick Berghaus and
David Berley and
Elisa Bernardini and
Anna Bernhard and
David Z. Besson and
G. Binder and
Daniel Bindig and
Martin Bissok and
Erik Blaufuss and
Jan Blumenthal and
David J. Boersma and
Christian Bohm and
Debanjan Bose and
Sebastian B{\"{o}}ser and
Olga Botner and
Lionel Brayeur and
Hans{-}Peter Bretz and
Anthony M. Brown and
Ronald Bruijn and
James Casey and
Martin Casier and
Dmitry Chirkin and
Asen Christov and
Brian John Christy and
Ken Clark and
Lew Classen and
Fabian Clevermann and
Stefan Coenders and
Shirit Cohen and
Doug F. Cowen and
Angel H. Cruz Silva and
Matthias Danninger and
Jacob Daughhetee and
James C. Davis and
Melanie Day and
Catherine De Clercq and
Sam De Ridder and
Paolo Desiati and
Krijn D. de Vries and
Meike de With and
Tyce DeYoung and
Juan Carlos D{\'{\i}}az{-}V{\'{e}}lez and
Matthew Dunkman and
Ryan Eagan and
Benjamin Eberhardt and
Bj{\"{o}}rn Eichmann and
Jonathan Eisch and
Sebastian Euler and
Paul A. Evenson and
Oladipo O. Fadiran and
Ali R. Fazely and
Anatoli Fedynitch and
Jacob Feintzeig and
Tom Feusels and
Kirill Filimonov and
Chad Finley and
Tobias Fischer{-}Wasels and
Samuel Flis and
Anna Franckowiak and
Katharina Frantzen and
Tomasz Fuchs and
Thomas K. Gaisser and
Joseph S. Gallagher and
Lisa Marie Gerhardt and
Laura E. Gladstone and
Thorsten Gl{\"{u}}senkamp and
Azriel Goldschmidt and
Geraldina Golup and
Javier G. Gonz{\'{a}}lez and
Jordan A. Goodman and
Dariusz G{\'{o}}ra and
Dylan T. Grandmont and
Darren Grant and
Pavel Gretskov and
John C. Groh and
Andreas Gro{\ss} and
Chang Hyon Ha and
Abd Al Karim Haj Ismail and
Patrick Hallen and
Allan Hallgren and
Francis Halzen and
Kael D. Hanson and
Dustin Hebecker and
David Heereman and
Dirk Heinen and
Klaus Helbing and
Robert Eugene Hellauer III and
Stephanie Virginia Hickford and
Gary C. Hill and
Kara D. Hoffman and
Ruth Hoffmann and
Andreas Homeier and
Kotoyo Hoshina and
Feifei Huang and
Warren Huelsnitz and
Per Olof Hulth and
Klas Hultqvist and
Shahid Hussain and
Aya Ishihara and
Emanuel Jacobi and
John E. Jacobsen and
Kai Jagielski and
George S. Japaridze and
Kyle Jero and
Ola Jlelati and
Basho Kaminsky and
Alexander Kappes and
Timo Karg and
Albrecht Karle and
Matthew Kauer and
John Lawrence Kelley and
Joanna Kiryluk and
J. Kl{\"{a}}s and
Spencer R. Klein and
Jan{-}Hendrik K{\"{o}}hne and
Georges Kohnen and
Hermann Kolanoski and
Lutz K{\"{o}}pke and
Claudio Kopper and
Sandro Kopper and
D. Jason Koskinen and
Marek Kowalski and
Mark Krasberg and
Anna Kriesten and
Kai Michael Krings and
G{\"{o}}sta Kroll and
Jan Kunnen and
Naoko Kurahashi and
Takao Kuwabara and
Mathieu L. M. Labare and
Hagar Landsman and
Michael James Larson and
Mariola Lesiak{-}Bzdak and
Martin Leuermann and
Julia Leute and
Jan L{\"{u}}nemann and
Oscar A. Mac{\'{\i}}as{-}Ram{\'{\i}}rez and
James Madsen and
Giuliano Maggi and
Reina Maruyama and
Keiichi Mase and
Howard S. Matis and
Frank McNally and
Kevin James Meagher and
Martin Merck and
Gonzalo Merino Ar{\'{e}}valo and
Thomas Meures and
Sandra Miarecki and
Eike Middell and
Natalie Milke and
John Lester Miller and
Lars Mohrmann and
Teresa Montaruli and
Robert M. Morse and
Rolf Nahnhauer and
Uwe Naumann and
Hans Niederhausen and
Sarah C. Nowicki and
David R. Nygren and
Anna Obertacke and
Sirin Odrowski and
Alex Olivas and
Ahmad Omairat and
Aongus Starbuck {\'{O}} Murchadha and
Larissa Paul and
Joshua A. Pepper and
Carlos P{\'{e}}rez de los Heros and
Carl Pfendner and
Damian Pieloth and
Elisa Pinat and
Jonas Posselt and
P. Buford Price and
Gerald T. Przybylski and
Melissa Quinnan and
Leif R{\"{a}}del and
Ian Rae and
Mohamed Rameez and
Katherine Rawlins and
Peter Christian Redl and
Ren{\'{e}} Reimann and
Elisa Resconi and
Wolfgang Rhode and
Mathieu Ribordy and
Michael Richman and
Benedikt Riedel and
J. P. Rodrigues and
Carsten Rott and
Tim Ruhe and
Bakhtiyar Ruzybayev and
Dirk Ryckbosch and
Sabine M. Saba and
Heinz{-}Georg Sander and
Juan Marcos Santander and
Subir Sarkar and
Kai Schatto and
Florian Scheriau and
Torsten Schmidt and
Martin Schmitz and
Sebastian Schoenen and
Sebastian Sch{\"{o}}neberg and
Arne Sch{\"{o}}nwald and
Anne Schukraft and
Lukas Schulte and
David Schultz and
Olaf Schulz and
David Seckel and
Yolanda Sestayo de la Cerra and
Surujhdeo Seunarine and
Rezo Shanidze and
Chris Sheremata and
Miles W. E. Smith and
Dennis Soldin and
Glenn M. Spiczak and
Christian Spiering and
Michael Stamatikos and
Todor Stanev and
Nick A. Stanisha and
Alexander Stasik and
Thorsten Stezelberger and
Robert G. Stokstad and
Achim St{\"{o}}{\ss}l and
Erik A. Strahler and
Rickard Str{\"{o}}m and
Nora Linn Strotjohann and
Gregory W. Sullivan and
Henric Taavola and
Ignacio J. Taboada and
Alessio Tamburro and
Andreas Tepe and
Samvel Ter{-}Antonyan and
Gordana Tesic and
Serap Tilav and
Patrick A. Toale and
Moriah Natasha Tobin and
Simona Toscano and
Maria Tselengidou and
Elisabeth Unger and
Marcel Usner and
Sofia Vallecorsa and
Nick van Eijndhoven and
Arne Van Overloop and
Jakob van Santen and
Markus Vehring and
Markus Voge and
Matthias Vraeghe and
Christian Walck and
Tilo Waldenmaier and
Marius Wallraff and
Christopher N. Weaver and
Mark T. Wellons and
Christopher H. Wendt and
Stefan Westerhoff and
Nathan Whitehorn and
Klaus Wiebe and
Christopher Wiebusch and
Dawn R. Williams and
Henrike Wissing and
Martin Wolf and
Terri R. Wood and
Kurt Woschnagg and
Donglian Xu and
Xianwu Xu and
Juan Pablo Y{\'{a}}{\~{n}}ez Garza and
Gaurang B. Yodh and
Shigeru Yoshida and
Pavel Zarzhitsky and
Jan Ziemann and
Simon Zierke and
Marcel Zoll},
title = {The IceProd Framework: Distributed Data Processing for the IceCube
Neutrino Observatory},
journal = {CoRR},
volume = {abs/1311.5904},
year = {2013},
url = {http://arxiv.org/abs/1311.5904},
eprinttype = {arXiv},
eprint = {1311.5904},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/AartsenA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aeog/Rodriguez-GalianoPSCC12,
author = {Victor F. Rodriguez{-}Galiano and
Eulogio Pardo{-}Ig{\'{u}}zquiza and
M. Sanchez{-}Castillo and
Mario Chica{-}Olmo and
Mario Chica{-}Rivas},
title = {Downscaling Landsat 7 {ETM+} thermal imagery using land surface temperature
and {NDVI} images},
journal = {Int. J. Appl. Earth Obs. Geoinformation},
volume = {18},
pages = {515--527},
year = {2012},
url = {https://doi.org/10.1016/j.jag.2011.10.002},
doi = {10.1016/J.JAG.2011.10.002},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aeog/Rodriguez-GalianoPSCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbpim/SanchezPV12,
author = {Mario E. S{\'{a}}nchez and
Diana Puentes and
Jorge Villalobos},
title = {Building a modular {YAWL} engine with Cumbia},
journal = {Int. J. Bus. Process. Integr. Manag.},
volume = {6},
number = {1},
pages = {41--51},
year = {2012},
url = {https://doi.org/10.1504/IJBPIM.2012.047912},
doi = {10.1504/IJBPIM.2012.047912},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbpim/SanchezPV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsita/DonateGC12,
author = {Mario Javier Donate and
F{\'{a}}tima Guadamillas and
Jes{\'{u}}s David S{\'{a}}nchez de Pablo Gonz{\'{a}}lez del Campo},
title = {Knowledge Management for Strategic Alliances: {A} Case Study},
journal = {Int. J. Strateg. Inf. Technol. Appl.},
volume = {3},
number = {3},
pages = {1--19},
year = {2012},
url = {https://doi.org/10.4018/jsita.2012070101},
doi = {10.4018/JSITA.2012070101},
timestamp = {Fri, 03 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijsita/DonateGC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jei/Sanchez-CruzR12,
author = {Hermilo S{\'{a}}nchez{-}Cruz and
Mario A. Rodr{\'{\i}}guez{-}D{\'{\i}}az},
title = {Binary document image compression using a three-symbol grouped code
dictionary},
journal = {J. Electronic Imaging},
volume = {21},
number = {2},
pages = {023013},
year = {2012},
url = {https://doi.org/10.1117/1.JEI.21.2.023013},
doi = {10.1117/1.JEI.21.2.023013},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jei/Sanchez-CruzR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/DiezPAMDBLHL12,
author = {Isabel de la Torre D{\'{\i}}ez and
Francisco Javier D{\'{\i}}az Pernas and
M{\'{\i}}riam Ant{\'{o}}n{-}Rodr{\'{\i}}guez and
Mario Mart{\'{\i}}nez{-}Zarzuela and
Jos{\'{e}} Fernando D{\'{\i}}ez Higuera and
Daniel Boto{-}Giralda and
Miguel Maldonado L{\'{o}}pez and
Roberto Hornero and
Mar{\'{\i}}a Isabel L{\'{o}}pez},
title = {Performance Evaluation of a Web-Based System to Exchange Electronic
Health Records Using Queueing Model {(M/M/1)}},
journal = {J. Medical Syst.},
volume = {36},
number = {2},
pages = {915--924},
year = {2012},
url = {https://doi.org/10.1007/s10916-010-9555-3},
doi = {10.1007/S10916-010-9555-3},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jms/DiezPAMDBLHL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pnc/PuypeMCSPMD12,
author = {Bart Puype and
Eva Mar{\'{\i}}n{-}Tordera and
Didier Colle and
Sergio S{\'{a}}nchez{-}L{\'{o}}pez and
Mario Pickavet and
Xavier Masip{-}Bruin and
Piet Demeester},
title = {Prediction-based routing as {RWA} in multilayer traffic engineering},
journal = {Photonic Netw. Commun.},
volume = {23},
number = {2},
pages = {172--182},
year = {2012},
url = {https://doi.org/10.1007/s11107-011-0348-5},
doi = {10.1007/S11107-011-0348-5},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pnc/PuypeMCSPMD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/Anton-CanalisHS12,
author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
Mario Hern{\'{a}}ndez{-}Tejera and
Elena S{\'{a}}nchez{-}Nielsen},
title = {Distance maps from unthresholded magnitudes},
journal = {Pattern Recognit.},
volume = {45},
number = {9},
pages = {3125--3130},
year = {2012},
url = {https://doi.org/10.1016/j.patcog.2012.02.010},
doi = {10.1016/J.PATCOG.2012.02.010},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pr/Anton-CanalisHS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/ManzurSSV12,
author = {Laura Manzur and
John Santa and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Marko Bajec and
Johann Eder},
title = {Experimentation in Executable Enterprise Architecture Models},
booktitle = {Advanced Information Systems Engineering Workshops - CAiSE 2012 International
Workshops, Gda{\'{n}}sk, Poland, June 25-26, 2012. Proceedings},
series = {Lecture Notes in Business Information Processing},
volume = {112},
pages = {455--469},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-31069-0\_36},
doi = {10.1007/978-3-642-31069-0\_36},
timestamp = {Sun, 23 Dec 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/caise/ManzurSSV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cescit/FernandezPSMSP12,
author = {J. Javier Fernandez and
Mario Prats and
Juan Carlos Garc{\'{\i}}a S{\'{a}}nchez and
Ra{\'{u}}l Mar{\'{\i}}n and
Pedro J. Sanz and
Antonio Pe{\~{n}}alver Benavent},
editor = {Klaus Schilling and
Florian Leutert},
title = {Manipulation in the Seabed: {A} New Underwater Manipulation System
for Shallow Water Intervention},
booktitle = {1st Conference on Embedded Systems, Computational Intelligence and
Telematics in Control, {CESCIT} 2012, W{\"{u}}rzburg, Germany,
April 03-05, 2012},
pages = {314--319},
publisher = {International Federation of Automatic Control},
year = {2012},
url = {https://doi.org/10.3182/20120403-3-DE-3010.00029},
doi = {10.3182/20120403-3-DE-3010.00029},
timestamp = {Fri, 24 Jul 2020 14:08:14 +0200},
biburl = {https://dblp.org/rec/conf/cescit/FernandezPSMSP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cgames/SalazarMOS12,
author = {Mario Gonzalez Salazar and
Hugo A. Mitre{-}Hern{\'{a}}ndez and
Cuauht{\'{e}}moc Lemus Olalde and
Jos{\'{e}} Luis Gonz{\'{a}}lez S{\'{a}}nchez},
editor = {Quasim H. Mehdi and
Adel Elmaghraby and
Ian Marshall and
Robert Moreton and
Rammohan K. Ragade and
Bego{\~{n}}a Garc{\'{\i}}a Zapirain and
Julia Chariker and
Mostafa M. El{-}Said and
Roman V. Yampolskiy and
Nickola Li Zhigiang},
title = {Proposal of Game Design Document from software engineering requirements
perspective},
booktitle = {17th International Conference on Computer Games, {CGAMES} 2012, Louisville,
KY, USA, July 30 - Aug. 1, 2012},
pages = {81--85},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/CGames.2012.6314556},
doi = {10.1109/CGAMES.2012.6314556},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cgames/SalazarMOS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conielecomp/Trujillo-CaballeroPSMST12,
author = {Mario Arturo Trujillo{-}Caballero and
Rub{\'{e}}n Posada{-}G{\'{o}}mez and
Oscar Osvaldo Sandoval{-}Gonzalez and
Albino Mart{\'{\i}}nez{-}Sibaja and
Blanca E. Gonz{\'{a}}lez S{\'{a}}nchez and
Juan Carlos Trujillo{-}Caballero},
editor = {Pedro Ba{\~{n}}uelos S{\'{a}}nchez and
Roberto Rosas{-}Romero and
Mauricio Javier Osorio Galindo},
title = {A remote monitoring system for a mechanotherapy device in neuromuscular
rehabilitation},
booktitle = {22nd International Conference on Electrical Communications and Computers,
{CONIELECOMP} 2012, Cholula, Puebla, Mexico, February 27-29, 2012},
pages = {55--58},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/CONIELECOMP.2012.6189881},
doi = {10.1109/CONIELECOMP.2012.6189881},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/conielecomp/Trujillo-CaballeroPSMST12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/NaranjoSV12,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Visual Analysis of Enterprise Models},
booktitle = {16th {IEEE} International Enterprise Distributed Object Computing
Conference Workshops, {EDOC} Workshops, Beijing, China, September
10-14, 2012},
pages = {19--28},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/EDOCW.2012.13},
doi = {10.1109/EDOCW.2012.13},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/edoc/NaranjoSV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/GomezMPP0H12,
author = {Carlos G{\'{o}}mez and
Mario Mart{\'{\i}}nez{-}Zarzuela and
Jes{\'{u}}s Poza and
Francisco Javier D{\'{\i}}az Pernas and
Alberto Fern{\'{a}}ndez and
Roberto Hornero},
title = {Synchrony analysis of spontaneous {MEG} activity in Alzheimer's disease
patients},
booktitle = {Annual International Conference of the {IEEE} Engineering in Medicine
and Biology Society, {EMBC} 2012, San Diego, CA, USA, August 28 -
September 1, 2012},
pages = {6188--6191},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/EMBC.2012.6347407},
doi = {10.1109/EMBC.2012.6347407},
timestamp = {Sat, 04 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/embc/GomezMPP0H12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/europar/LoddeFA12,
author = {Mario Lodde and
Jos{\'{e}} Flich and
Manuel E. Acacio},
editor = {Christos Kaklamanis and
Theodore S. Papatheodorou and
Paul G. Spirakis},
title = {Dynamic Last-Level Cache Allocation to Reduce Area and Power Overhead
in Directory Coherence Protocols},
booktitle = {Euro-Par 2012 Parallel Processing - 18th International Conference,
Euro-Par 2012, Rhodes Island, Greece, August 27-31, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7484},
pages = {206--218},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-32820-6\_22},
doi = {10.1007/978-3-642-32820-6\_22},
timestamp = {Mon, 18 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/europar/LoddeFA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-berlin/SanchezSO12,
author = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and
Daniel D{\'{\i}}az S{\'{a}}nchez and
Mario Mu{\~{n}}oz Organero},
title = {Flex-box: {A} flexible software architecture for {IPTV} set-top boxes},
booktitle = {{IEEE} Second International Conference on Consumer Electronics - Berlin,
ICCE-Berlin 2012, Berlin, Germany, September 3-5, 2012},
pages = {121--125},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICCE-Berlin.2012.6336480},
doi = {10.1109/ICCE-BERLIN.2012.6336480},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icce-berlin/SanchezSO12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccel/SanchezSO12,
author = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and
Daniel D{\'{\i}}az S{\'{a}}nchez and
Mario Mu{\~{n}}oz Organero},
title = {Optimizing resources on gateways using OSGi},
booktitle = {{IEEE} International Conference on Consumer Electronics, {ICCE} 2012,
Las Vegas, NV, USA, January 13-16, 2012},
pages = {526--527},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICCE.2012.6161957},
doi = {10.1109/ICCE.2012.6161957},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccel/SanchezSO12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/Sanchez-EscobedoC12,
author = {Dalila S{\'{a}}nchez{-}Escobedo and
Mario Castel{\'{a}}n},
title = {Face synthesis from a frontal pose image using partial least squares
and b-splines},
booktitle = {19th {IEEE} International Conference on Image Processing, {ICIP} 2012,
Lake Buena Vista, Orlando, FL, USA, September 30 - October 3, 2012},
pages = {1801--1804},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICIP.2012.6467231},
doi = {10.1109/ICIP.2012.6467231},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icip/Sanchez-EscobedoC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/RizoRRBL12,
author = {Mario Rizo and
Ana Rodr{\'{\i}}guez and
Francisco J. Rodr{\'{\i}}guez and
Emilio Bueno and
Marco Liserre},
title = {Different approaches of stationary reference frames saturators},
booktitle = {38th Annual Conference on {IEEE} Industrial Electronics Society, {IECON}
2012, Montreal, QC, Canada, October 25-28, 2012},
pages = {2245--2250},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/IECON.2012.6388887},
doi = {10.1109/IECON.2012.6388887},
timestamp = {Mon, 09 Aug 2021 14:54:01 +0200},
biburl = {https://dblp.org/rec/conf/iecon/RizoRRBL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieeehpcs/PeceroHBPLB12,
author = {Johnatan E. Pecero and
H{\'{e}}ctor Joaqu{\'{\i}}n {Fraire Huacuja} and
Pascal Bouvry and
Alejandro {Santiago Pineda} and
Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
Juan Javier Gonz{\'{a}}lez Barbosa},
editor = {Waleed W. Smari and
Vesna Zeljkovic},
title = {On the energy optimization for precedence constrained applications
using local search algorithms},
booktitle = {2012 International Conference on High Performance Computing {\&}
Simulation, {HPCS} 2012, Madrid, Spain, July 2-6, 2012},
pages = {133--139},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/HPCSim.2012.6266902},
doi = {10.1109/HPCSIM.2012.6266902},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ieeehpcs/PeceroHBPLB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/RankineSSV12,
author = {Cassidy Rankine and
G. Arturo Sanchez{-}Azofeifa and
Mario Marcos do Espirito Santo and
Marco Tulio S. Viera},
title = {Optical wireless sensor networks observe leaf phenology and photosynthetic
radiation interception in a Brazilian tropical dry forest},
booktitle = {2012 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2012, Munich, Germany, July 22-27, 2012},
pages = {6914--6915},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/IGARSS.2012.6352573},
doi = {10.1109/IGARSS.2012.6352573},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/RankineSSV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/imc/OttoSRB12,
author = {John S. Otto and
Mario A. S{\'{a}}nchez and
John P. Rula and
Fabi{\'{a}}n E. Bustamante},
editor = {John W. Byers and
Jim Kurose and
Ratul Mahajan and
Alex C. Snoeren},
title = {Content delivery and the natural evolution of {DNS:} remote dns trends,
performance issues and alternative solutions},
booktitle = {Proceedings of the 12th {ACM} {SIGCOMM} Internet Measurement Conference,
{IMC} '12, Boston, MA, USA, November 14-16, 2012},
pages = {523--536},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2398776.2398831},
doi = {10.1145/2398776.2398831},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/imc/OttoSRB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iolts/Sanchez-ClementeEGL12,
author = {Antonio Sanchez{-}Clemente and
Luis Entrena and
Mario Garc{\'{\i}}a{-}Valderas and
Celia L{\'{o}}pez{-}Ongil},
title = {Logic masking for {SET} Mitigation Using Approximate Logic Circuits},
booktitle = {18th {IEEE} International On-Line Testing Symposium, {IOLTS} 2012,
Sitges, Spain, June 27-29, 2012},
pages = {176--181},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/IOLTS.2012.6313868},
doi = {10.1109/IOLTS.2012.6313868},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iolts/Sanchez-ClementeEGL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/its/KarlovcecCP12,
author = {Mario Karlovcec and
Mariheida Cordova{-}Sanchez and
Zachary A. Pardos},
editor = {Stefano A. Cerri and
William J. Clancey and
Giorgos Papadourakis and
Kitty Panourgia},
title = {Knowledge Component Suggestion for Untagged Content in an Intelligent
Tutoring System},
booktitle = {Intelligent Tutoring Systems - 11th International Conference, {ITS}
2012, Chania, Crete, Greece, June 14-18, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7315},
pages = {195--200},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-30950-2\_25},
doi = {10.1007/978-3-642-30950-2\_25},
timestamp = {Sun, 02 Oct 2022 16:10:26 +0200},
biburl = {https://dblp.org/rec/conf/its/KarlovcecCP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/models/FlorezSVV12,
author = {Hector Florez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos and
Germ{\'{a}}n Vega},
title = {Coevolution assistance for enterprise architecture models},
booktitle = {Proceedings of the 6th International Workshop on Models and Evolution,
ME@MoDELS 2012, Innsbruck, Austria, October 1-5, 2012},
pages = {27--32},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2523599.2523605},
doi = {10.1145/2523599.2523605},
timestamp = {Tue, 06 Nov 2018 16:57:17 +0100},
biburl = {https://dblp.org/rec/conf/models/FlorezSVV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/models/GomezSFV12,
author = {Paola G{\'{o}}mez and
Mario E. S{\'{a}}nchez and
Hector Florez and
Jorge Villalobos},
editor = {Davide Di Ruscio and
Alfonso Pierantonio and
Juan de Lara},
title = {Co-creation of models and metamodels for enterprise architecture projects},
booktitle = {Proceedings of the 2012 Extreme Modeling Workshop, {XM} '12, Innsbruck,
Austria, October 1, 2012},
pages = {21--26},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2467307.2467312},
doi = {10.1145/2467307.2467312},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/models/GomezSFV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nocs/LoddeFA12,
author = {Mario Lodde and
Jos{\'{e}} Flich and
Manuel E. Acacio},
title = {Heterogeneous NoC Design for Efficient Broadcast-based Coherence Protocol
Support},
booktitle = {2012 Sixth {IEEE/ACM} International Symposium on Networks-on-Chip
(NoCS), Copenhagen, Denmark, 9-11 May, 2012},
pages = {59--66},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/NOCS.2012.14},
doi = {10.1109/NOCS.2012.14},
timestamp = {Mon, 18 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nocs/LoddeFA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/OttoSRSB12,
author = {John S. Otto and
Mario A. S{\'{a}}nchez and
John P. Rula and
Ted Stein and
Fabi{\'{a}}n E. Bustamante},
editor = {Lars Eggert and
J{\"{o}}rg Ott and
Venkata N. Padmanabhan and
George Varghese},
title = {namehelp: intelligent client-side {DNS} resolution},
booktitle = {{ACM} {SIGCOMM} 2012 Conference, {SIGCOMM} '12, Helsinki, Finland
- August 13 - 17, 2012},
pages = {287--288},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2342356.2342413},
doi = {10.1145/2342356.2342413},
timestamp = {Mon, 22 Mar 2021 16:55:03 +0100},
biburl = {https://dblp.org/rec/conf/sigcomm/OttoSRSB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/SanchezJV11,
author = {Mario E. S{\'{a}}nchez and
Camilo Jim{\'{e}}nez and
Jorge Villalobos},
title = {Model Based Testing for Workflow Enabled Applications},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {14},
number = {4},
year = {2011},
url = {http://cys.cic.ipn.mx/ojs/index.php/CyS/article/view/1280},
timestamp = {Thu, 11 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cys/SanchezJV11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/GonzalezDS11,
author = {Mario Gonz{\'{a}}lez and
David Dominguez and
{\'{A}}ngel S{\'{a}}nchez},
title = {Learning sequences of sparse correlated patterns using small-world
attractor neural networks: An application to traffic videos},
journal = {Neurocomputing},
volume = {74},
number = {14-15},
pages = {2361--2367},
year = {2011},
url = {https://doi.org/10.1016/j.neucom.2011.03.014},
doi = {10.1016/J.NEUCOM.2011.03.014},
timestamp = {Sat, 01 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/GonzalezDS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jvcir/Sanchez-NielsenH11,
author = {Elena S{\'{a}}nchez{-}Nielsen and
Mario Hern{\'{a}}ndez{-}Tejera},
title = {Heuristic algorithm for visual tracking of deformable objects},
journal = {J. Vis. Commun. Image Represent.},
volume = {22},
number = {6},
pages = {465--478},
year = {2011},
url = {https://doi.org/10.1016/j.jvcir.2011.05.005},
doi = {10.1016/J.JVCIR.2011.05.005},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jvcir/Sanchez-NielsenH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pdln/CavalieriFFPGS11,
author = {Daniel Cruz Cavalieri and
Teodiano Freire Bastos Filho and
M{\'{a}}rio Sarcinelli Filho and
Sira E. Palazuelos{-}Cagigas and
Javier Mac{\'{\i}}as Guarasa and
Jos{\'{e}} Luis Mart{\'{\i}}n S{\'{a}}nchez},
title = {A Part-of-Speech Tag Clustering for a Word Prediction System in Portuguese
Language},
journal = {Proces. del Leng. Natural},
volume = {47},
pages = {197--205},
year = {2011},
url = {http://journal.sepln.org/sepln/ojs/ojs/index.php/pln/article/view/984},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pdln/CavalieriFFPGS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/PastorelloSN11,
author = {Gilberto Zonta Pastorello Jr. and
G. Arturo Sanchez{-}Azofeifa and
Mario A. Nascimento},
title = {Enviro-Net: From Networks of Ground-Based Sensor Systems to a Web
Platform for Sensor Data Management},
journal = {Sensors},
volume = {11},
number = {6},
pages = {6454--6479},
year = {2011},
url = {https://doi.org/10.3390/s110606454},
doi = {10.3390/S110606454},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/PastorelloSN11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bpm/SanchezPV11,
author = {Mario E. S{\'{a}}nchez and
Diana Puentes and
Jorge Villalobos},
editor = {Florian Daniel and
Kamel Barkaoui and
Schahram Dustdar},
title = {A Modular Approach to Build Workflow Engines},
booktitle = {Business Process Management Workshops - {BPM} 2011 International Workshops,
Clermont-Ferrand, France, August 29, 2011, Revised Selected Papers,
Part {II}},
series = {Lecture Notes in Business Information Processing},
volume = {100},
pages = {289--300},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-28115-0\_28},
doi = {10.1007/978-3-642-28115-0\_28},
timestamp = {Sun, 02 Jun 2019 21:21:25 +0200},
biburl = {https://dblp.org/rec/conf/bpm/SanchezPV11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eScience/Sanchez-AzofeifaRSFG11,
author = {G. Arturo Sanchez{-}Azofeifa and
Cassidy Rankine and
Mario Marcos do Espirito Santo and
Rob Fatland and
Milton Garcia},
title = {Wireless Sensing Networks for Environmental Monitoring: Two Case Studies
from Tropical Forests},
booktitle = {{IEEE} 7th International Conference on E-Science, e-Science 2011,
Stockholm, Sweden, December 5-8, 2011},
pages = {70--76},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/eScience.2011.18},
doi = {10.1109/ESCIENCE.2011.18},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eScience/Sanchez-AzofeifaRSFG11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/enase/Sanchez-Gonzalez11,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
Francisco Ruiz and
F{\'{e}}lix Garc{\'{\i}}a and
Mario Piattini},
editor = {Leszek A. Maciaszek and
Kang Zhang},
title = {Improving Quality of Business Process Models},
booktitle = {Evaluation of Novel Approaches to Software Engineering - 6th International
Conference, {ENASE} 2011, Beijing, China, June 8-11, 2011. Revised
Selected Papers},
series = {Communications in Computer and Information Science},
volume = {275},
pages = {130--144},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-32341-6\_9},
doi = {10.1007/978-3-642-32341-6\_9},
timestamp = {Mon, 08 Jan 2024 21:46:47 +0100},
biburl = {https://dblp.org/rec/conf/enase/Sanchez-Gonzalez11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/enase/Sanchez-GonzalezRGP11,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
Francisco Ruiz and
F{\'{e}}lix Garc{\'{\i}}a and
Mario Piattini},
editor = {Leszek A. Maciaszek and
Kang Zhang},
title = {Business Process Model Improvement based on Measurement Activities},
booktitle = {{ENASE} 2011 - Proceedings of the 6th International Conference on
Evaluation of Novel Approaches to Software Engineering, Beijing, China,
8-11 June, 2011},
pages = {104--113},
publisher = {SciTePress},
year = {2011},
timestamp = {Sun, 05 Nov 2017 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/enase/Sanchez-GonzalezRGP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esem/Perez-CastilloSPGG11,
author = {Ricardo P{\'{e}}rez{-}Castillo and
Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
Mario Piattini and
F{\'{e}}lix Garc{\'{\i}}a and
Ignacio Garc{\'{\i}}a Rodr{\'{\i}}guez de Guzm{\'{a}}n},
title = {Obtaining Thresholds for the Effectiveness of Business Process Mining},
booktitle = {Proceedings of the 5th International Symposium on Empirical Software
Engineering and Measurement, {ESEM} 2011, Banff, AB, Canada, September
22-23, 2011},
pages = {453--462},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ESEM.2011.64},
doi = {10.1109/ESEM.2011.64},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esem/Perez-CastilloSPGG11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/GrajalOSGL11,
author = {Jes{\'{u}}s Grajal and
Omar A. Yeste Ojeda and
Miguel Angel S{\'{a}}nchez and
Mario Garrido and
Marisa L{\'{o}}pez{-}Vallejo},
title = {Real time {FPGA} implementation of an automatic modulation classifier
for electronic warfare applications},
booktitle = {Proceedings of the 19th European Signal Processing Conference, {EUSIPCO}
2011, Barcelona, Spain, August 29 - Sept. 2, 2011},
pages = {1514--1518},
publisher = {{IEEE}},
year = {2011},
url = {https://ieeexplore.ieee.org/document/7074233/},
timestamp = {Mon, 09 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eusipco/GrajalOSGL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ibpria/Anton-CanalisHS11,
author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
Mario Hern{\'{a}}ndez{-}Tejera and
Elena S{\'{a}}nchez{-}Nielsen},
editor = {Jordi Vitri{\`{a}} and
Jo{\~{a}}o Miguel Raposo Sanches and
Mario Hern{\'{a}}ndez},
title = {Distance Maps from Unthresholded Magnitudes},
booktitle = {Pattern Recognition and Image Analysis - 5th Iberian Conference, IbPRIA
2011, Las Palmas de Gran Canaria, Spain, June 8-10, 2011. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6669},
pages = {92--99},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-21257-4\_12},
doi = {10.1007/978-3-642-21257-4\_12},
timestamp = {Sun, 02 Oct 2022 16:02:57 +0200},
biburl = {https://dblp.org/rec/conf/ibpria/Anton-CanalisHS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/RodriguezSV11,
author = {Carlos Rodr{\'{\i}}guez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {William C. Chu and
W. Eric Wong and
Mathew J. Palakal and
Chih{-}Cheng Hung},
title = {Executable model composition: a multilevel approach},
booktitle = {Proceedings of the 2011 {ACM} Symposium on Applied Computing (SAC),
TaiChung, Taiwan, March 21 - 24, 2011},
pages = {877--884},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/1982185.1982376},
doi = {10.1145/1982185.1982376},
timestamp = {Tue, 06 Nov 2018 11:06:49 +0100},
biburl = {https://dblp.org/rec/conf/sac/RodriguezSV11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/BischofOSRCB11,
author = {Zachary S. Bischof and
John S. Otto and
Mario A. S{\'{a}}nchez and
John P. Rula and
David R. Choffnes and
Fabi{\'{a}}n E. Bustamante},
editor = {Nina Taft and
David Wetherall},
title = {Crowdsourcing {ISP} characterization to the network edge},
booktitle = {Proceedings of the first {ACM} {SIGCOMM} workshop on Measurements
up the stack, W-MUST@SIGCOMM 2011, Toronto, Ontario, Canada, August
19, 2011},
pages = {61--66},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2018602.2018617},
doi = {10.1145/2018602.2018617},
timestamp = {Tue, 06 Nov 2018 11:07:11 +0100},
biburl = {https://dblp.org/rec/conf/sigcomm/BischofOSRCB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/OttoSCBS11,
author = {John S. Otto and
Mario A. S{\'{a}}nchez and
David R. Choffnes and
Fabi{\'{a}}n E. Bustamante and
Georgos Siganos},
editor = {Srinivasan Keshav and
J{\"{o}}rg Liebeherr and
John W. Byers and
Jeffrey C. Mogul},
title = {On blind mice and the elephant: understanding the network impact of
a large distributed system},
booktitle = {Proceedings of the {ACM} {SIGCOMM} 2011 Conference on Applications,
Technologies, Architectures, and Protocols for Computer Communications,
Toronto, ON, Canada, August 15-19, 2011},
pages = {110--121},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2018436.2018450},
doi = {10.1145/2018436.2018450},
timestamp = {Fri, 12 Mar 2021 14:14:34 +0100},
biburl = {https://dblp.org/rec/conf/sigcomm/OttoSCBS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/SanchezOBB11,
author = {Mario A. S{\'{a}}nchez and
John S. Otto and
Zachary S. Bischof and
Fabi{\'{a}}n E. Bustamante},
editor = {Srinivasan Keshav and
J{\"{o}}rg Liebeherr and
John W. Byers and
Jeffrey C. Mogul},
title = {Dasu - {ISP} characterization from the edge: a BitTorrent implementation},
booktitle = {Proceedings of the {ACM} {SIGCOMM} 2011 Conference on Applications,
Technologies, Architectures, and Protocols for Computer Communications,
Toronto, ON, Canada, August 15-19, 2011},
pages = {454--455},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2018436.2018517},
doi = {10.1145/2018436.2018517},
timestamp = {Fri, 12 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigcomm/SanchezOBB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sis/ParraSFP11,
author = {Antonio Santos{-}Olmo and
Luis Enrique S{\'{a}}nchez and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
editor = {David Garcia Rosado and
Luis Enrique S{\'{a}}nchez and
Jan J{\"{u}}rjens},
title = {Desirable Characteristics for an {ISMS} oriented to SMEs},
booktitle = {{WOSIS} 2011 - Proceedings of the 8th International Workshop on Security
in Information Systems, In conjunction with {ICEIS} 2011, Beijing,
China, 8-9 June, 2011},
pages = {151--158},
publisher = {SciTePress},
year = {2011},
timestamp = {Mon, 29 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sis/ParraSFP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tools/RodriguezSV11,
author = {Carlos Rodr{\'{\i}}guez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Judith Bishop and
Antonio Vallecillo},
title = {Metamodel Dependencies for Executable Models},
booktitle = {Objects, Models, Components, Patterns - 49th International Conference,
{TOOLS} 2011, Zurich, Switzerland, June 28-30, 2011. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6705},
pages = {83--98},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-21952-8\_8},
doi = {10.1007/978-3-642-21952-8\_8},
timestamp = {Tue, 14 May 2019 10:00:45 +0200},
biburl = {https://dblp.org/rec/conf/tools/RodriguezSV11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1106-5489,
author = {Gilberto Zonta Pastorello Jr. and
G. Arturo Sanchez{-}Azofeifa and
Mario A. Nascimento},
title = {A Review of the Enviro-Net Project},
journal = {CoRR},
volume = {abs/1106.5489},
year = {2011},
url = {http://arxiv.org/abs/1106.5489},
eprinttype = {arXiv},
eprint = {1106.5489},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1106-5489.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/Segura-BedmarCPM10,
author = {Isabel Segura{-}Bedmar and
Mario Crespo and
C{\'{e}}sar de Pablo{-}S{\'{a}}nchez and
Paloma Mart{\'{\i}}nez},
title = {Resolving anaphoras for the extraction of drug-drug interactions in
pharmacological documents},
journal = {{BMC} Bioinform.},
volume = {11},
number = {{S-2}},
pages = {1},
year = {2010},
url = {https://doi.org/10.1186/1471-2105-11-S2-S1},
doi = {10.1186/1471-2105-11-S2-S1},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/Segura-BedmarCPM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bpmj/Sanchez-GonzalezGRV10,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
F{\'{e}}lix Garc{\'{\i}}a and
Francisco Ruiz and
Mario Piattini Velthuis},
title = {Measurement in business processes: a systematic review},
journal = {Bus. Process. Manag. J.},
volume = {16},
number = {1},
pages = {114--134},
year = {2010},
url = {https://doi.org/10.1108/14637151011017976},
doi = {10.1108/14637151011017976},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bpmj/Sanchez-GonzalezGRV10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dam/BilbaoO10,
author = {Jes{\'{u}}s Mario Bilbao and
Manuel Ord{\'{o}}{\~{n}}ez},
title = {The core and the Weber set of games on augmenting systems},
journal = {Discret. Appl. Math.},
volume = {158},
number = {3},
pages = {180--188},
year = {2010},
url = {https://doi.org/10.1016/j.dam.2009.09.016},
doi = {10.1016/J.DAM.2009.09.016},
timestamp = {Thu, 11 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dam/BilbaoO10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/NevesSBCRR10,
author = {Francisco A. S. Neves and
Helber E. P. de Souza and
Fabr{\'{\i}}cio Bradaschia and
Marcelo Cabral Cavalcanti and
Mario Rizo and
Francisco J. Rodr{\'{\i}}guez},
title = {A Space-Vector Discrete Fourier Transform for Unbalanced and Distorted
Three-Phase Signals},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {57},
number = {8},
pages = {2858--2867},
year = {2010},
url = {https://doi.org/10.1109/TIE.2009.2036646},
doi = {10.1109/TIE.2009.2036646},
timestamp = {Fri, 10 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tie/NevesSBCRR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/SanchezVHRPJ10,
author = {Ren{\'{e}} Osorio Sanchez and
Nimrod V{\'{a}}zquez and
Claudia Hern{\'{a}}ndez and
Elias Rodr{\'{\i}}guez and
Sergio Pinto and
Mario A. Ju{\'{a}}rez},
title = {Electric Dynamic Modeling of {HID} Lamps for Electronic Ballast Design},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {57},
number = {5},
pages = {1655--1662},
year = {2010},
url = {https://doi.org/10.1109/TIE.2009.2033095},
doi = {10.1109/TIE.2009.2033095},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/SanchezVHRPJ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEares/SanchezRFP10,
author = {Luis Enrique S{\'{a}}nchez and
Carlos Ruiz and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
title = {Managing the Asset Risk of SMEs},
booktitle = {{ARES} 2010, Fifth International Conference on Availability, Reliability
and Security, 15-18 February 2010, Krakow, Poland},
pages = {422--429},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/ARES.2010.52},
doi = {10.1109/ARES.2010.52},
timestamp = {Sat, 27 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/IEEEares/SanchezRFP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/centeris/SanchezPFP10,
author = {Luis Enrique S{\'{a}}nchez and
Antonio Santos{-}Olmo and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
editor = {Jo{\~{a}}o Eduardo Quintela Varaj{\~{a}}o and
Maria Manuela Cruz{-}Cunha and
Goran D. Putnik and
Ant{\'{o}}nio Trigo},
title = {Security Culture in Small and Medium-Size Enterprise},
booktitle = {ENTERprise Information Systems - International Conference, {CENTERIS}
2010, Viana do Castelo, Portugal, October 20-22, 2010, Proceedings,
Part {II}},
series = {Communications in Computer and Information Science},
volume = {110},
pages = {315--324},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-16419-4\_32},
doi = {10.1007/978-3-642-16419-4\_32},
timestamp = {Mon, 29 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/centeris/SanchezPFP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cibse/Sanchez-Gonzalez10,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
F{\'{e}}lix Garc{\'{\i}}a and
Francisco Ruiz and
Mario Piattini},
editor = {Xavier Franch and
Itana Maria de Souza Gimenes and
Juan Pablo Carvallo},
title = {{BILMA:} Entorno para la Mejora Continua de Procesos de Negocio guiada
por la Medici{\'{o}}n},
booktitle = {Proceedings of the 13th Iberoamerican Conference on Software Engineering,
CIbSE 2010, Cuenca, Ecuador, April 12-16, 2010},
pages = {293--298},
year = {2010},
timestamp = {Tue, 09 Feb 2021 15:58:30 +0100},
biburl = {https://dblp.org/rec/conf/cibse/Sanchez-Gonzalez10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conielecomp/Anzures-GarciaS10,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Elizabeth L{\'{o}}pez{-}Mel{\'{e}}ndez and
Gilberto Andrade{-}Andrade and
Ricardo Rivera{-}Morales},
title = {Platform to supports learning based on Social Network, Web Intelligence
and {CSCL}},
booktitle = {20th International Conference on Electronics, Communications and Computer,
{CONIELECOMP} 2010, Cholula, Puebla, Mexico, February 22-24, 2010},
pages = {201--205},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/CONIELECOMP.2010.5440769},
doi = {10.1109/CONIELECOMP.2010.5440769},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/conielecomp/Anzures-GarciaS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/er/Sanchez-GonzalezGMRP10,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
F{\'{e}}lix Garc{\'{\i}}a and
Jan Mendling and
Francisco Ruiz and
Mario Piattini},
editor = {Jeffrey Parsons and
Motoshi Saeki and
Peretz Shoval and
Carson C. Woo and
Yair Wand},
title = {Prediction of Business Process Model Quality Based on Structural Metrics},
booktitle = {Conceptual Modeling - {ER} 2010, 29th International Conference on
Conceptual Modeling, Vancouver, BC, Canada, November 1-4, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6412},
pages = {458--463},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-16373-9\_35},
doi = {10.1007/978-3-642-16373-9\_35},
timestamp = {Sun, 02 Jun 2019 21:20:31 +0200},
biburl = {https://dblp.org/rec/conf/er/Sanchez-GonzalezGMRP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/ChoffnesSB10,
author = {David R. Choffnes and
Mario A. S{\'{a}}nchez and
Fabian E. Bustamante},
title = {Network Positioning from the Edge - An Empirical Study of the Effectiveness
of Network Positioning in {P2P} Systems},
booktitle = {{INFOCOM} 2010. 29th {IEEE} International Conference on Computer Communications,
Joint Conference of the {IEEE} Computer and Communications Societies,
15-19 March 2010, San Diego, CA, {USA}},
pages = {291--295},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/INFCOM.2010.5462225},
doi = {10.1109/INFCOM.2010.5462225},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/infocom/ChoffnesSB10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jisbd/Sanchez-GonzalezGRP10,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
F{\'{e}}lix Garc{\'{\i}}a and
Francisco Ruiz and
Mario Piattini},
editor = {Ernest Teniente and
Silvia Abrah{\~{a}}o},
title = {Validaci{\'{o}}n Global de Medidas para Modelos Conceptuales
de Procesos de Negocio mediante Meta-An{\'{a}}lisis},
booktitle = {{XV} Jornadas de Ingenier{\'{\i}}a del Software y Bases de Datos
{(JISBD} 2010), Valencia, Spain, September 7-10, 2010. Actas},
pages = {293--298},
publisher = {{IBERGARCETA} Pub. {S.L.}},
year = {2010},
timestamp = {Sun, 05 Nov 2017 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/jisbd/Sanchez-GonzalezGRP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/paams/CrespoSFAL10,
author = {Mario Crespo and
Daniel S{\'{a}}nchez and
Luis Felipe Crespo Foix and
Sonia Astorga Moreno and
Antonio Le{\'{o}}n},
editor = {Yves Demazeau and
Frank Dignum and
Juan M. Corchado and
Javier Bajo},
title = {Collaborative Dialogue Agent for {COPD} Self-management in {AMICA:}
{A} First Insight},
booktitle = {Advances in Practical Applications of Agents and Multiagent Systems,
8th International Conference on Practical Applications of Agents and
Multiagent Systems, {PAAMS} 2010, Salamanca, Spain, 26-28 April 2010},
series = {Advances in Intelligent and Soft Computing},
volume = {70},
pages = {75--80},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-12384-9\_10},
doi = {10.1007/978-3-642-12384-9\_10},
timestamp = {Mon, 17 Jul 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/paams/CrespoSFAL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trustbus/SanchezPFP10,
author = {Luis Enrique S{\'{a}}nchez and
Antonio Santos{-}Olmo and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
editor = {Sokratis K. Katsikas and
Javier L{\'{o}}pez and
Miguel Soriano},
title = {Building {ISMS} through the Reuse of Knowledge},
booktitle = {Trust, Privacy and Security in Digital Business, 7th International
Conference, TrustBus 2010, Bilbao, Spain, August 30-31, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6264},
pages = {190--201},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-15152-1\_17},
doi = {10.1007/978-3-642-15152-1\_17},
timestamp = {Mon, 29 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/trustbus/SanchezPFP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eor/BilbaoO09,
author = {Jes{\'{u}}s Mario Bilbao and
Manuel Ord{\'{o}}{\~{n}}ez},
title = {Axiomatizations of the Shapley value for games on augmenting systems},
journal = {Eur. J. Oper. Res.},
volume = {196},
number = {3},
pages = {1008--1014},
year = {2009},
url = {https://doi.org/10.1016/j.ejor.2008.04.028},
doi = {10.1016/J.EJOR.2008.04.028},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eor/BilbaoO09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jikm/Perez-SolteroBS09,
author = {Alonso Perez{-}Soltero and
Mario Barcelo{-}Valenzuela and
Gerardo Sanchez{-}Schmitz},
title = {Design of an Ontology as a Support to the Knowledge Audit Process
in Organisations},
journal = {J. Inf. Knowl. Manag.},
volume = {8},
number = {2},
pages = {147--158},
year = {2009},
url = {https://doi.org/10.1142/S0219649209002257},
doi = {10.1142/S0219649209002257},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jikm/Perez-SolteroBS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jucs/SanchezPRP09,
author = {Luis Enrique S{\'{a}}nchez and
Antonio Santos{-}Olmo and
David Garcia Rosado and
Mario Piattini},
title = {Managing Security and its Maturity in Small and Medium-sized Enterprises},
journal = {J. Univers. Comput. Sci.},
volume = {15},
number = {15},
pages = {3038--3058},
year = {2009},
url = {https://doi.org/10.3217/jucs-015-15-3038},
doi = {10.3217/JUCS-015-15-3038},
timestamp = {Mon, 29 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jucs/SanchezPRP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rasi/SanchezV009,
author = {Mario E. S{\'{a}}nchez and
Jorge Villalobos and
Daniel Romero},
title = {Un mecanismo de coordinaci{\'{o}}n basado en m{\'{a}}quinas
de estado, empleado en las aplicaciones que usan workflows},
journal = {Rev. Avances en Sistemas Inform{\'{a}}tica},
volume = {6},
number = {1},
pages = {35--44},
year = {2009},
url = {http://www.minas.medellin.unal.edu.co/index.php?option=com\_docman\&task=doc\_view\&gid=551\&tmpl=component\&format=raw\&Itemid=285},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rasi/SanchezV009.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biostec/FerreiraFFSGQ09,
author = {Andr{\'{e}} Ferreira and
Teodiano Freire Bastos Filho and
M{\'{a}}rio Sarcinelli Filho and
Jos{\'{e}} Luis Mart{\'{\i}}n S{\'{a}}nchez and
Juan Carlos Garc{\'{\i}}a Garc{\'{\i}}a and
Manuel Mazo Quintas},
editor = {Teodiano Freire Bastos Filho and
Hugo Gamboa},
title = {Evaluation of {PSD} Components and {AAR} Parameters as Input Features
for a {SVM} Classifier Applied to a Robotic Wheelchair},
booktitle = {{BIODEVICES} 2009 - Proceedings of the International Conference on
Biomedical Electronics and Devices, Porto, Portugal, January 14-17,
2009},
pages = {7--12},
publisher = {{INSTICC} Press},
year = {2009},
timestamp = {Thu, 21 May 2009 18:31:39 +0200},
biburl = {https://dblp.org/rec/conf/biostec/FerreiraFFSGQ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biostec/FerreiraFFSGQ09a,
author = {Andr{\'{e}} Ferreira and
Teodiano Freire Bastos Filho and
M{\'{a}}rio Sarcinelli Filho and
Jos{\'{e}} Luis Mart{\'{\i}}n S{\'{a}}nchez and
Juan Carlos Garc{\'{\i}}a Garc{\'{\i}}a and
Manuel Mazo Quintas},
editor = {Ana L. N. Fred and
Joaquim Filipe and
Hugo Gamboa},
title = {Improvements of a Brain-Computer Interface Applied to a Robotic Wheelchair},
booktitle = {Biomedical Engineering Systems and Technologies - International Joint
Conference, {BIOSTEC} 2009 Porto, Portugal, January 14-17, 2009, Revised
Selected Papers},
series = {Communications in Computer and Information Science},
volume = {52},
pages = {64--73},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-11721-3\_4},
doi = {10.1007/978-3-642-11721-3\_4},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/biostec/FerreiraFFSGQ09a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ciarp/Sanchez-CruzR09,
author = {Hermilo S{\'{a}}nchez{-}Cruz and
Mario A. Rodr{\'{\i}}guez{-}D{\'{\i}}az},
editor = {Eduardo Bayro{-}Corrochano and
Jan{-}Olof Eklundh},
title = {Coding Long Contour Shapes of Binary Objects},
booktitle = {Progress in Pattern Recognition, Image Analysis, Computer Vision,
and Applications, 14th Iberoamerican Conference on Pattern Recognition,
{CIARP} 2009, Guadalajara, Jalisco, Mexico, November 15-18, 2009.
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5856},
pages = {45--52},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-10268-4\_5},
doi = {10.1007/978-3-642-10268-4\_5},
timestamp = {Tue, 14 May 2019 10:00:40 +0200},
biburl = {https://dblp.org/rec/conf/ciarp/Sanchez-CruzR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/Segura-BedmarCPM09,
author = {Isabel Segura{-}Bedmar and
Mario Crespo and
C{\'{e}}sar de Pablo{-}S{\'{a}}nchez and
Paloma Mart{\'{\i}}nez},
editor = {Doheon Lee and
Russ B. Altman and
Min Song and
Jun Huan},
title = {DrugNerAR: linguistic rule-based anaphora resolver for drug-drug interaction
extraction in pharmacological documents},
booktitle = {Proceeding of the 3rd International Workshop on Data and Text Mining
in Bioinformatics, {DTMBIO} 2009, Hong Kong, China, November 6, 2009},
pages = {19--26},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1651318.1651324},
doi = {10.1145/1651318.1651324},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/Segura-BedmarCPM09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/enc/Anzures-GarciaSHP09,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Miguel J. Hornos and
Patricia Paderewski},
editor = {Alejandro P. Buchmann},
title = {Service-Based Layered Architectural Model for Building Collaborative
Applications in Heterogeneous Environments},
booktitle = {2009 Mexican International Conference on Computer Science, {ENC} 2009,
Mexico City, Mexico, September 21-25, 2009},
pages = {252--263},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ENC.2009.37},
doi = {10.1109/ENC.2009.37},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/enc/Anzures-GarciaSHP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micai/ColungaSM09,
author = {Mario Chirinos Colunga and
Oscar S{\'{a}}nchez Siordia and
Stephen J. Maybank},
editor = {Arturo Hern{\'{a}}ndez Aguirre and
Ra{\'{u}}l Monroy Borja and
Carlos A. Reyes Garc{\'{\i}}a},
title = {Leukocyte Recognition Using EM-Algorithm},
booktitle = {{MICAI} 2009: Advances in Artificial Intelligence, 8th Mexican International
Conference on Artificial Intelligence, Guanajuato, Mexico, November
9-13, 2009. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5845},
pages = {545--555},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-05258-3\_48},
doi = {10.1007/978-3-642-05258-3\_48},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/micai/ColungaSM09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nldb/Segura-BedmarCP09,
author = {Isabel Segura{-}Bedmar and
Mario Crespo and
C{\'{e}}sar de Pablo{-}S{\'{a}}nchez},
editor = {Helmut Horacek and
Elisabeth M{\'{e}}tais and
Rafael Mu{\~{n}}oz and
Magdalena Wolska},
title = {Score-Based Approach for Anaphora Resolution in Drug-Drug Interactions
Documents},
booktitle = {Natural Language Processing and Information Systems, 14th International
Conference on Applications of Natural Language to Information Systems,
{NLDB} 2009, Saarbr{\"{u}}cken, Germany, June 24-26, 2009. Revised
Papers},
series = {Lecture Notes in Computer Science},
volume = {5723},
pages = {91--102},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-12550-8\_8},
doi = {10.1007/978-3-642-12550-8\_8},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nldb/Segura-BedmarCP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sis/SanchezPFP09,
author = {Luis Enrique S{\'{a}}nchez and
Antonio Santos{-}Olmo and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
editor = {Alfonso Rodr{\'{\i}}guez and
Mariemma Inmaculada Yag{\"{u}}e del Valle and
Eduardo Fern{\'{a}}ndez{-}Medina},
title = {{MMSM-SME:} Methodology for the Management of Security and its Maturity
in {SME}},
booktitle = {Security in Information Systems, Proceedings of the 7th International
Workshop on Security in Information Systems, {WOSIS} 2009, In conjunction
with {ICEIS} 2009, Milan, Italy, May 2009},
pages = {67--78},
publisher = {{INSTICC} Press},
year = {2009},
timestamp = {Mon, 29 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sis/SanchezPFP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sws/LischkaEC09,
author = {Mario Lischka and
Yukiko Endo and
Manuel S{\'{a}}nchez Cuenca},
editor = {Ernesto Damiani and
Seth Proctor and
Anoop Singhal},
title = {Deductive policies with {XACML}},
booktitle = {Proceedings of the 6th {ACM} Workshop On Secure Web Services, {SWS}
2009, Chicago, Illinois, USA, November 13, 2009},
pages = {37--44},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1655121.1655130},
doi = {10.1145/1655121.1655130},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sws/LischkaEC09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tools/SanchezJVD09,
author = {Mario E. S{\'{a}}nchez and
Camilo Jim{\'{e}}nez and
Jorge Villalobos and
Dirk Deridder},
editor = {Manuel Oriol and
Bertrand Meyer},
title = {Extensibility in Model-Based Business Process Engines},
booktitle = {Objects, Components, Models and Patterns, 47th International Conference,
{TOOLS} {EUROPE} 2009, Zurich, Switzerland, June 29-July 3, 2009.
Proceedings},
series = {Lecture Notes in Business Information Processing},
volume = {33},
pages = {157--174},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-02571-6\_10},
doi = {10.1007/978-3-642-02571-6\_10},
timestamp = {Mon, 30 Oct 2017 11:35:08 +0100},
biburl = {https://dblp.org/rec/conf/tools/SanchezJVD09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wecwis/AguilarSCRPCV09,
author = {Elvira Rol{\'{o}}n Aguilar and
Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
F{\'{e}}lix Garc{\'{\i}}a and
Francisco Ruiz and
Mario Piattini and
Danilo Caivano and
Giuseppe Visaggio},
editor = {Birgit Hofreiter and
Hannes Werthner},
title = {Prediction Models for {BPMN} Usability and Maintainability},
booktitle = {2009 {IEEE} Conference on Commerce and Enterprise Computing, {CEC}
2009, Vienna, Austria, July 20-23, 2009},
pages = {383--390},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/CEC.2009.53},
doi = {10.1109/CEC.2009.53},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wecwis/AguilarSCRPCV09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/igi/09/Sanchez-GonzalezD00P09,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
Andrea Delgado and
Francisco Ruiz and
F{\'{e}}lix Garc{\'{\i}}a and
Mario Piattini},
editor = {Jorge Cardoso and
Wil M. P. van der Aalst},
title = {Measurement and Maturity of Business Processes},
booktitle = {Handbook of Research on Business Process Modeling},
pages = {532--556},
publisher = {{IGI} Global},
year = {2009},
url = {https://doi.org/10.4018/978-1-60566-288-6.ch024},
doi = {10.4018/978-1-60566-288-6.CH024},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/igi/09/Sanchez-GonzalezD00P09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/SalvadorRMRCSFCGMM08,
author = {Carlos Hern{\'{a}}ndez Salvador and
Antonio Ruiz{-}Sanchez and
M. A. Gonz{\'{a}}lez de Mingo and
Montserrat Carmona Rodriguez and
Mario Pascual Carrasco and
Pilar G. Sagredo and
Juan A. Fragua and
Fernando Caballero{-}Martinez and
Fernando Garcia{-}Lopez and
J. M{\'{a}}rquez Montes and
Jose Luis Monteagudo},
title = {Evaluation of a Telemedicine-Based Service for the Follow-Up and Monitoring
of Patients Treated With Oral Anticoagulant Therapy},
journal = {{IEEE} Trans. Inf. Technol. Biomed.},
volume = {12},
number = {6},
pages = {696--706},
year = {2008},
url = {https://doi.org/10.1109/TITB.2008.910750},
doi = {10.1109/TITB.2008.910750},
timestamp = {Wed, 13 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/titb/SalvadorRMRCSFCGMM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEares/Anzures-GarciaS08,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez},
title = {Policy-based Group Organizational Structure Management using an Ontological
Approach},
booktitle = {Proceedings of the The Third International Conference on Availability,
Reliability and Security, {ARES} 2008, March 4-7, 2008, Technical
University of Catalonia, Barcelona , Spain},
pages = {807--812},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ARES.2008.186},
doi = {10.1109/ARES.2008.186},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/IEEEares/Anzures-GarciaS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aosd/SanchezV08,
author = {Mario E. S{\'{a}}nchez and
Jorge Villalobos},
editor = {Omar Aldawud and
Walter Cazzola and
Tzilla Elrad and
Jeff Gray and
J{\"{o}}rg Kienzle and
Dominik Stein},
title = {A flexible architecture to build workflows using aspect-oriented concepts},
booktitle = {Proceedings of the 2008 {AOSD} Workshop on Aspect-Oriented Modeling,
{AOM} '08, Brussels, Belgium, April 1, 2008},
pages = {25--30},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1404920.1404925},
doi = {10.1145/1404920.1404925},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aosd/SanchezV08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cisis/Anzures-GarciaS08,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez},
editor = {Fatos Xhafa and
Leonard Barolli},
title = {Group Organizational Structure Adaptation for Groupware Applications},
booktitle = {Second International Conference on Complex, Intelligent and Software
Intensive Systems (CISIS-2008), March 4th-7th, 2008, Technical University
of Catalonia, Barcelona, Spain},
pages = {435--440},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/CISIS.2008.149},
doi = {10.1109/CISIS.2008.149},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cisis/Anzures-GarciaS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/secrypt/SanchezVFP08,
author = {Luis Enrique S{\'{a}}nchez and
Daniel Villafranca and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
editor = {Eduardo Fern{\'{a}}ndez{-}Medina and
Manu Malek and
Javier Hernando},
title = {Practical Application of a Security Management Maturity Model for
SMEs based on Predefined Schemas},
booktitle = {{SECRYPT} 2008, Proceedings of the International Conference on Security
and Cryptography, Porto, Portugal, July 26-29, 2008, {SECRYPT} is
part of {ICETE} - The International Joint Conference on e-Business
and Telecommunications},
pages = {391--398},
publisher = {{INSTICC} Press},
year = {2008},
timestamp = {Mon, 08 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/secrypt/SanchezVFP08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/his/2008,
editor = {Fatos Xhafa and
Francisco Herrera and
Ajith Abraham and
Mario K{\"{o}}ppen and
Jos{\'{e}} Manuel Ben{\'{\i}}tez},
title = {8th International Conference on Hybrid Intelligent Systems {(HIS}
2008), September 10-12, 2008, Barcelona, Spain},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://ieeexplore.ieee.org/xpl/conhome/4626579/proceeding},
isbn = {978-0-7695-3326-1},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/his/2008.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/Martinez-BazanMGNSL07,
author = {Norbert Mart{\'{\i}}nez{-}Bazan and
Victor Munt{\'{e}}s{-}Mulero and
Sergio G{\'{o}}mez{-}Villamor and
Jordi Nin and
Mario{-}A. S{\'{a}}nchez{-}Mart{\'{\i}}nez and
Josep Llu{\'{\i}}s Larriba{-}Pey},
editor = {M{\'{a}}rio J. Silva and
Alberto H. F. Laender and
Ricardo A. Baeza{-}Yates and
Deborah L. McGuinness and
Bj{\o}rn Olstad and
{\O}ystein Haug Olsen and
Andr{\'{e}} O. Falc{\~{a}}o},
title = {Dex: high-performance exploration on large graphs for information
retrieval},
booktitle = {Proceedings of the Sixteenth {ACM} Conference on Information and Knowledge
Management, {CIKM} 2007, Lisbon, Portugal, November 6-10, 2007},
pages = {573--582},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1321440.1321521},
doi = {10.1145/1321440.1321521},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cikm/Martinez-BazanMGNSL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eurocast/Anzures-GarciaSHP07,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Miguel J. Hornos and
Patricia Paderewski{-}Rodr{\'{\i}}guez},
editor = {Roberto Moreno{-}D{\'{\i}}az and
Franz Pichler and
Alexis Quesada{-}Arencibia},
title = {Ontology-Based Modelling of Session Management Policies for Groupware
Applications},
booktitle = {Computer Aided Systems Theory - {EUROCAST} 2007, 11th International
Conference on Computer Aided Systems Theory, Las Palmas de Gran Canaria,
Spain, February 12-16, 2007, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {4739},
pages = {57--64},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-75867-9\_8},
doi = {10.1007/978-3-540-75867-9\_8},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eurocast/Anzures-GarciaSHP07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iasam/AzcondoOMDBRPDC07,
author = {Francisco J. Azcondo and
Alfredo Ortiz and
Mario Ma{\~{n}}ana and
F. Javier D{\'{\i}}az and
Christian Bra{\~{n}}as and
Carlos Renedo and
Severiano P{\'{e}}rez and
Fernando Delgado and
Rosario Casanueva},
title = {Effects of Flicker on Different Types of 150-W High-Pressure Sodium
Lamps and Ballasts},
booktitle = {Conference Record of the 2007 {IEEE} Industry Applications Conference
Forty-Second {IAS} Annual Meeting, New Orleans, LA, USA, September
23-27, 2007},
pages = {833--838},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/07IAS.2007.131},
doi = {10.1109/07IAS.2007.131},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iasam/AzcondoOMDBRPDC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ibpria/Anton-CanalisHS07,
author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
Mario Hern{\'{a}}ndez{-}Tejera and
Elena S{\'{a}}nchez{-}Nielsen},
editor = {Joan Mart{\'{\i}} and
Jos{\'{e}}{-}Miguel Bened{\'{\i}} and
Ana Maria Mendon{\c{c}}a and
Joan Serrat},
title = {Analysis of Relevant Maxima in Distance Transform. An Application
to Fast Coarse Image Segmentation},
booktitle = {Pattern Recognition and Image Analysis, Third Iberian Conference,
IbPRIA 2007, Girona, Spain, June 6-8, 2007, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {4477},
pages = {97--104},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-72847-4\_14},
doi = {10.1007/978-3-540-72847-4\_14},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ibpria/Anton-CanalisHS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsoft/SanchezVFP07,
author = {Luis Enrique S{\'{a}}nchez and
Daniel Villafranca and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
editor = {Joaquim Filipe and
Boris Shishkov and
Markus Helfert},
title = {Scmm-Tool - Tool for Computer Automation of the Information Security
Management Systems},
booktitle = {{ICSOFT} 2007, Proceedings of the Second International Conference
on Software and Data Technologies, Volume SE, Barcelona, Spain, July
22-25, 2007},
pages = {311--318},
publisher = {{INSTICC} Press},
year = {2007},
timestamp = {Mon, 08 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icsoft/SanchezVFP07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/secrypt/SanchezVFP07,
author = {Luis Enrique S{\'{a}}nchez and
Daniel Villafranca and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
editor = {Javier Hernando and
Eduardo Fern{\'{a}}ndez{-}Medina and
Manu Malek},
title = {Developing a Model and a Tool to Manage the Information Security in
Small and Medium Enterprises},
booktitle = {{SECRYPT} 2007, Proceedings of the International Conference on Security
and Cryptography, Barcelona, Spain, July 28-13, 2007, {SECRYPT} is
part of {ICETE} - The International Joint Conference on e-Business
and Telecommunications},
pages = {355--362},
publisher = {{INSTICC} Press},
year = {2007},
timestamp = {Mon, 08 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/secrypt/SanchezVFP07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sis/SachezVP07,
author = {Lu{\'{\i}}s Enrique Sanchez and
Daniel Villafranca and
Mario Piattini},
editor = {Mariemma Inmaculada Yag{\"{u}}e del Valle and
Eduardo Fern{\'{a}}ndez{-}Medina},
title = {{MMISS-SME} Practical Development: Maturity Model for Information
Systems Security Management in SMEs},
booktitle = {Security in Information Systems, Proceedings of the 5th International
Workshop on Security in Information Systems, {WOSIS} 2007, In conjunction
with {ICEIS} 2007, Funchal, Madeira, Portugal, June 2007},
pages = {233--244},
publisher = {{INSTICC} Press},
year = {2007},
timestamp = {Mon, 11 Aug 2008 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sis/SachezVP07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0712-2684,
author = {Ricardo L{\'{o}}pez{-}Ruiz and
J. Gonzalez{-}Estevez and
Mario G. Cosenza and
J. R. S{\'{a}}nchez},
title = {An Economic Model of Coupled Exponential Maps},
journal = {CoRR},
volume = {abs/0712.2684},
year = {2007},
url = {http://arxiv.org/abs/0712.2684},
eprinttype = {arXiv},
eprint = {0712.2684},
timestamp = {Wed, 11 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-0712-2684.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rasi/RodriguezSC06,
author = {Elkin Rodr{\'{\i}}guez and
Andr{\'{e}}s Felipe S{\'{a}}nchez and
Jorge Mario Chaverra},
title = {Desarrollo de una Herramienta para la Minimizaci{\'{o}}n de Tardanza
Total en Ambientes Job Shop Apoyada en B{\'{u}}squeda Tab{\'{u}}},
journal = {Rev. Avances en Sistemas Inform{\'{a}}tica},
volume = {3},
number = {1},
pages = {75--78},
year = {2006},
url = {http://pisis.unalmed.edu.co/avances/archivos/ediciones/2006/rodriguez\_etal06.pdf},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rasi/RodriguezSC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmod/VelaFMP06,
author = {Bel{\'{e}}n Vela and
Eduardo Fern{\'{a}}ndez{-}Medina and
Esperanza Marcos and
Mario Piattini},
title = {Model driven development of secure {XML} databases},
journal = {{SIGMOD} Rec.},
volume = {35},
number = {3},
pages = {22--27},
year = {2006},
url = {https://doi.org/10.1145/1168092.1168095},
doi = {10.1145/1168092.1168095},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigmod/VelaFMP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEares/SanchezVFP06,
author = {Luis Enrique S{\'{a}}nchez and
Daniel Villafranca and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
title = {Practical Approach of a Secure Management System based on {ISO/IEC}
17799},
booktitle = {Proceedings of the The First International Conference on Availability,
Reliability and Security, {ARES} 2006, The International Dependability
Conference - Bridging Theory and Practice, April 20-22 2006, Vienna
University of Technology, Austria},
pages = {585--592},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ARES.2006.94},
doi = {10.1109/ARES.2006.94},
timestamp = {Sat, 27 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/IEEEares/SanchezVFP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acivs/Anton-CanalisHS06,
author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
Mario Hern{\'{a}}ndez{-}Tejera and
Elena S{\'{a}}nchez{-}Nielsen},
editor = {Jacques Blanc{-}Talon and
Wilfried Philips and
Dan C. Popescu and
Paul Scheunders},
title = {AddCanny: Edge Detector for Video Processing},
booktitle = {Advanced Concepts for Intelligent Vision Systems, 8th International
Conference, {ACIVS} 2006, Antwerp, Belgium, September 18-21, 2006,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4179},
pages = {501--512},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11864349\_46},
doi = {10.1007/11864349\_46},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acivs/Anton-CanalisHS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/SznaierPP06,
author = {Mario Sznaier and
Ricardo Salvador S{\'{a}}nchez Pe{\~{n}}a and
Vicen{\c{c}} Puig},
title = {Set-Membership Identification of Parametric Systems},
booktitle = {45th {IEEE} Conference on Decision and Control, {CDC} 2006, San Diego,
CA, USA, December 13-15, 2006},
pages = {151--156},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/CDC.2006.377561},
doi = {10.1109/CDC.2006.377561},
timestamp = {Fri, 04 Mar 2022 13:26:30 +0100},
biburl = {https://dblp.org/rec/conf/cdc/SznaierPP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cibse/VelaFMP06,
author = {Bel{\'{e}}n Vela and
Eduardo Fern{\'{a}}ndez{-}Medina and
Esperanza Marcos and
Mario Piattini},
editor = {Jaelson Castro and
Luca Cernuzzi and
Silvia E. Gordillo},
title = {Una Aproximaci{\'{o}}n Dirigida por Modelos para el Dise{\~{n}}o
de Bases de Datos {XML} Seguras},
booktitle = {Memorias de la {IX} Conferenci a Iberoamericana de Software Engineering
(CIbSE 2006), La Plata, Argentina, Abril 24-28, 2006},
pages = {229--242},
year = {2006},
timestamp = {Tue, 21 Dec 2010 15:32:51 +0100},
biburl = {https://dblp.org/rec/conf/cibse/VelaFMP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fpt/MarcosGLL06,
author = {Miguel A. S{\'{a}}nchez Marcos and
Mario Garrido and
Marisa L{\'{o}}pez{-}Vallejo and
Carlos A. L{\'{o}}pez{-}Barrio},
editor = {George A. Constantinides and
Wai{-}Kei Mak and
Phaophak Sirisuk and
Theerayod Wiangtong},
title = {Automated design space exploration of FPGA-based {FFT} architectures
based on area and power estimation},
booktitle = {2006 {IEEE} International Conference on Field Programmable Technology,
{FPT} 2006, Bangkok, Thailand, December 13-15, 2006},
pages = {127--134},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/FPT.2006.270303},
doi = {10.1109/FPT.2006.270303},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fpt/MarcosGLL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/glvlsi/GargSGJGK06,
author = {Rajesh Garg and
Mario S{\'{a}}nchez and
Kanupriya Gulati and
Nikhil Jayakumar and
Anshul Gupta and
Sunil P. Khatri},
editor = {Gang Qu and
Yehea I. Ismail and
Narayanan Vijaykrishnan and
Hai Zhou},
title = {A design flow to optimize circuit delay by using standard cells and
PLAs},
booktitle = {Proceedings of the 16th {ACM} Great Lakes Symposium on {VLSI} 2006,
Philadelphia, PA, USA, April 30 - May 1, 2006},
pages = {217--222},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1127908.1127960},
doi = {10.1145/1127908.1127960},
timestamp = {Wed, 16 Aug 2023 21:16:32 +0200},
biburl = {https://dblp.org/rec/conf/glvlsi/GargSGJGK06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isda/Anton-CanalisHS06,
author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
Mario Hern{\'{a}}ndez{-}Tejera and
Elena S{\'{a}}nchez{-}Nielsen},
title = {Particle Swarms as Video Sequence Inhabitants For Object Tracking
in Computer Vision},
booktitle = {Proceedings of the Sixth International Conference on Intelligent Systems
Design and Applications {(ISDA} 2006), October 16-18, 2006, Jinan,
China},
pages = {604--609},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ISDA.2006.253905},
doi = {10.1109/ISDA.2006.253905},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isda/Anton-CanalisHS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sis/SanchezVFP06,
author = {Luis Enrique S{\'{a}}nchez and
Daniel Villafranca and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
editor = {Eduardo Fern{\'{a}}ndez{-}Medina and
Mariemma Inmaculada Yag{\"{u}}e del Valle},
title = {Developing a Maturity Model for Information System Security Management
within Small and Medium Size Enterprises},
booktitle = {Security in Information Systems, Proceedings of the 4th International
Workshop on Security in Information Systems, {WOSIS} 2006, In conjunction
with {ICEIS} 2006, Paphos, Cyprus, May 2006},
pages = {256--266},
publisher = {{INSTICC} Press},
year = {2006},
timestamp = {Mon, 08 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sis/SanchezVFP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sis/VelaFMP06,
author = {Bel{\'{e}}n Vela and
Eduardo Fern{\'{a}}ndez{-}Medina and
Esperanza Marcos and
Mario Piattini},
editor = {Eduardo Fern{\'{a}}ndez{-}Medina and
Mariemma Inmaculada Yag{\"{u}}e del Valle},
title = {A Model Driven Approach for Secure {XML} Database Development},
booktitle = {Security in Information Systems, Proceedings of the 4th International
Workshop on Security in Information Systems, {WOSIS} 2006, In conjunction
with {ICEIS} 2006, Paphos, Cyprus, May 2006},
pages = {33--46},
publisher = {{INSTICC} Press},
year = {2006},
timestamp = {Tue, 19 Sep 2006 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sis/VelaFMP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wises/IbanezSMS06,
author = {Mario Ib{\'{a}}{\~{n}}ez and
Juan Jes{\'{u}}s S{\'{a}}nchez S{\'{a}}nchez and
Natividad Mart{\'{\i}}nez Madrid and
Ralf Seepold},
editor = {Wilfried Elmenreich and
Gregor Novak and
Ralf Seepold},
title = {Portable Profiles for Residential Gateways},
booktitle = {4th International Workshop on Intelligent Solutions in Embedded Systems,
{WISES} 2006, Vienna, Austria, June 30, 2006},
pages = {189--200},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/WISES.2006.329129},
doi = {10.1109/WISES.2006.329129},
timestamp = {Fri, 27 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wises/IbanezSMS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acivs/Sanchez-NielsenH05,
author = {Elena S{\'{a}}nchez{-}Nielsen and
Mario Hern{\'{a}}ndez{-}Tejera},
editor = {Jacques Blanc{-}Talon and
Wilfried Philips and
Dan C. Popescu and
Paul Scheunders},
title = {Heuristic Algorithm for Computing Fast Template Motion in Video Streams},
booktitle = {Advanced Concepts for Intelligent Vision Systems, 7th International
Conference, {ACIVS} 2005, Antwerp, Belgium, September 20-23, 2005,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3708},
pages = {547--554},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11558484\_69},
doi = {10.1007/11558484\_69},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acivs/Sanchez-NielsenH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bvai/Sanchez-NielsenH05,
author = {Elena S{\'{a}}nchez{-}Nielsen and
Mario Hern{\'{a}}ndez{-}Tejera},
editor = {Massimo De Gregorio and
Vito Di Maio and
Maria Frucci and
Carlo Musio},
title = {Heuristic Algorithms for Fast and Accurate Tracking of Moving Objects
in Unrestricted Environments},
booktitle = {Brain, Vision, and Artificial Intelligence, First International Symposium,
{BVAI} 2005, Naples, Italy, October 19-21, 2005, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3704},
pages = {507--516},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11565123\_49},
doi = {10.1007/11565123\_49},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bvai/Sanchez-NielsenH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/OsorioOPPJKG05,
author = {Ren{\'{e}} Osorio and
Marco Antonio Oliver{-}Salazar and
Mario Ponce{-}Silva and
Sergio Pinto and
Mario A. Ju{\'{a}}rez and
Reza Katebi and
M. J. Grimble},
title = {Analysis and Design of Discrete-Sliding-Mode Control for a Square-Waveform-Ballast},
booktitle = {44th {IEEE} {IEEE} Conference on Decision and Control and 8th European
Control Conference Control, {CDC/ECC} 2005, Seville, Spain, 12-15
December, 2005},
pages = {584--589},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/CDC.2005.1582219},
doi = {10.1109/CDC.2005.1582219},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cdc/OsorioOPPJKG05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/PenaSP05,
author = {Ricardo S. S{\'{a}}nchez Pe{\~{n}}a and
Mario Sznaier and
Vicen{\c{c}} Puig},
title = {Robust Interpolation using Interval Structures},
booktitle = {44th {IEEE} {IEEE} Conference on Decision and Control and 8th European
Control Conference Control, {CDC/ECC} 2005, Seville, Spain, 12-15
December, 2005},
pages = {4983--4987},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/CDC.2005.1582951},
doi = {10.1109/CDC.2005.1582951},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cdc/PenaSP05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/egc/GomesDMBGHKMMRDCSGSFLNLOWBNPWFFCFTXDACHSKRG05,
author = {Jorge A. T. Gomes and
M{\'{a}}rio David and
J. Martins and
Lu{\'{\i}}s Bernardo and
Ariel Garc{\'{\i}}a and
Markus Hardt and
Harald Kornmayer and
J. Marco and
R. Marco and
D. Rodr{\'{\i}}guez and
Iv{\'{a}}n D{\'{\i}}az and
D. Cano and
Jos{\'{e}} Salt and
S. Gonzalez and
Javier S{\'{a}}nchez and
Farida Fassi and
V. Lara and
P. Nyczyk and
Patryk Lason and
Andrzej Ozieblo and
Pawel Wolniewicz and
Michal Bluj and
Krzysztof Nawrocki and
Adam Padee and
Wojciech Wislicki and
C. Fern{\'{a}}ndez and
J. Font{\'{a}}n and
Yannis Cotronis and
Evangelos Floros and
George Tsouloupas and
Wei Xing and
Marios D. Dikaiakos and
J{\'{a}}n Astalos and
Brian A. Coghlan and
Elisa Heymann and
Miquel A. Senar and
C. Kanellopoulos and
A. Ramos and
Derek Groen},
editor = {Peter M. A. Sloot and
Alfons G. Hoekstra and
Thierry Priol and
Alexander Reinefeld and
Marian Bubak},
title = {Experience with the International Testbed in the CrossGrid Project},
booktitle = {Advances in Grid Computing - {EGC} 2005, European Grid Conference,
Amsterdam, The Netherlands, February 14-16, 2005, Revised Selected
Papers},
series = {Lecture Notes in Computer Science},
volume = {3470},
pages = {98--110},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11508380\_12},
doi = {10.1007/11508380\_12},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/egc/GomesDMBGHKMMRDCSGSFLNLOWBNPWFFCFTXDACHSKRG05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/Sanchez-NielsenH05,
author = {Elena S{\'{a}}nchez{-}Nielsen and
Mario Hern{\'{a}}ndez{-}Tejera},
editor = {Leslie Pack Kaelbling and
Alessandro Saffiotti},
title = {An Heuristic Search based Approach for Moving Objects Tracking},
booktitle = {IJCAI-05, Proceedings of the Nineteenth International Joint Conference
on Artificial Intelligence, Edinburgh, Scotland, UK, July 30 - August
5, 2005},
pages = {1736--1737},
publisher = {Professional Book Center},
year = {2005},
url = {http://ijcai.org/Proceedings/05/Papers/post-0184.pdf},
timestamp = {Tue, 20 Aug 2019 16:16:29 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/Sanchez-NielsenH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/idea/encyclopedia2005/BarcaMVM05,
author = {Jos{\'{e}} Mar{\'{\i}}a Cavero Barca and
Esperanza Marcos Mart{\'{\i}}nez and
Mario Piattini and
Adolfo Sanchez de Miguel},
editor = {Mehdi Khosrow{-}Pour},
title = {Data Warehouse Development},
booktitle = {Encyclopedia of Information Science and Technology {(5} Volumes)},
pages = {729--733},
publisher = {Idea Group},
year = {2005},
url = {http://www.igi-global.com/Bookstore/Chapter.aspx?TitleId=14326},
timestamp = {Sun, 09 Jul 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/idea/encyclopedia2005/BarcaMVM05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcsc/EchavarriaSPCC04,
author = {Rodolfo Echavarr{\'{\i}}a and
Victor M. Sanchez and
Mario Ponce and
Maria Cotorogea and
Abraham Claudio},
title = {Analysis And Design Of {A} Quasi-Resonant Fast On-Load Tap Changing
Regulator},
journal = {J. Circuits Syst. Comput.},
volume = {13},
number = {4},
pages = {877--899},
year = {2004},
url = {https://doi.org/10.1142/S0218126604001738},
doi = {10.1142/S0218126604001738},
timestamp = {Tue, 28 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcsc/EchavarriaSPCC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsp/FernandezPAP04,
author = {Matilde S{\'{a}}nchez Fern{\'{a}}ndez and
Mario de Prado{-}Cumplido and
Jer{\'{o}}nimo Arenas{-}Garc{\'{\i}}a and
Fernando P{\'{e}}rez{-}Cruz},
title = {{SVM} multiregression for nonlinear channel estimation in multiple-input
multiple-output systems},
journal = {{IEEE} Trans. Signal Process.},
volume = {52},
number = {8},
pages = {2298--2307},
year = {2004},
url = {https://doi.org/10.1109/TSP.2004.831028},
doi = {10.1109/TSP.2004.831028},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tsp/FernandezPAP04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wscg/Sanchez-NielsenAH04,
author = {Elena S{\'{a}}nchez{-}Nielsen and
Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
Mario Hern{\'{a}}ndez{-}Tejera},
title = {Hand Gesture Recognition for Human-Machine Interaction},
booktitle = {The 12-th International Conference in Central Europe on Computer Graphics,
Visualization and Computer Vision'2004, {WSCG} 2004, University of
West Bohemia, Campus Bory, Plzen-Bory, Czech Republic, February 2-6,
2004},
pages = {395--402},
year = {2004},
timestamp = {Wed, 24 Jul 2013 17:32:33 +0200},
biburl = {https://dblp.org/rec/conf/wscg/Sanchez-NielsenAH04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cs-PL-0404050,
author = {Puri Arenas{-}S{\'{a}}nchez and
Mario Rodr{\'{\i}}guez{-}Artalejo},
title = {A General Framework For Lazy Functional Logic Programming With Algebraic
Polymorphic Types},
journal = {CoRR},
volume = {cs.PL/0404050},
year = {2004},
url = {http://arxiv.org/abs/cs/0404050},
timestamp = {Fri, 10 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/cs-PL-0404050.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcmc/ClimentMOSSTV03,
author = {Salvador Climent and
Joaquim Mor{\'{e}} and
Antoni Oliver and
M{\'{\i}}riam Salvatierra and
Imma S{\`{a}}nchez and
Mariona Taul{\'{e}} and
Llu{\"{\i}}sa Vallmanya},
title = {Bilingual Newsgroups in Catalonia: {A} Challenge for Machine Translation},
journal = {J. Comput. Mediat. Commun.},
volume = {9},
number = {1},
pages = {0},
year = {2003},
url = {https://doi.org/10.1111/j.1083-6101.2003.tb00360.x},
doi = {10.1111/J.1083-6101.2003.TB00360.X},
timestamp = {Thu, 01 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcmc/ClimentMOSSTV03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pdln/AdurizAAABCCIFGHMMMMMMMNOPPPRSSSST03,
author = {Itziar Aduriz and
Alicia Ageno and
Bertol Arrieta and
Jose Maria Arriola and
Empar Bisbal and
N{\'{u}}ria Castell and
Montserrat Civit and
Arantza D{\'{\i}}az de Ilarraza and
Bel{\'{e}}n Fern{\'{a}}ndez and
Koldo Gojenola and
Reda Halkoum and
Raquel Marcos and
Llu{\'{\i}}s M{\`{a}}rquez and
Maria Ant{\`{o}}nia Mart{\'{\i}} and
Patricio Mart{\'{\i}}nez{-}Barco and
Antonio Molina and
Paloma Moreda and
Lidia Moreno and
Borja Navarro and
Maite Oronoz and
Llu{\'{\i}}s Padr{\'{o}} and
Manuel Palomar and
Ferran Pla and
Horacio Rodr{\'{\i}}guez and
Maximiliano Saiz{-}Noeda and
Emilio Sanchis and
Kepa Sarasola and
Armando Su{\'{a}}rez and
Mariona Taul{\'{e}}},
title = {3LB: Construcci{\'{o}}n de una base de datos de {\'{a}}rboles
sint{\'{a}}ctico sem{\'{a}}nticos},
journal = {Proces. del Leng. Natural},
volume = {31},
year = {2003},
url = {http://journal.sepln.org/sepln/ojs/ojs/index.php/pln/article/view/3179/1670},
timestamp = {Thu, 09 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pdln/AdurizAAABCCIFGHMMMMMMMNOPPPRSSSST03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eagc/GomesDMBMMRSGSFHGNOWBNPWFFGLCFTXDACHSMKA03,
author = {Jorge A. T. Gomes and
M{\'{a}}rio David and
J. Martins and
Lu{\'{\i}}s Bernardo and
J. Marco and
R. Marco and
D. Rodr{\'{\i}}guez and
Jos{\'{e}} Salt and
S. Gonzalez and
Javier S{\'{a}}nchez and
A. Fuentes and
Markus Hardt and
Ariel Garc{\'{\i}}a and
P. Nyczyk and
Andrzej Ozieblo and
Pawel Wolniewicz and
Michal Bluj and
Krzysztof Nawrocki and
Adam Padee and
Wojciech Wislicki and
C. Fern{\'{a}}ndez and
J. Font{\'{a}}n and
A. G{\'{o}}mez and
I. L{\'{o}}pez and
Yannis Cotronis and
Evangelos Floros and
George Tsouloupas and
Wei Xing and
Marios D. Dikaiakos and
J{\'{a}}n Astalos and
Brian A. Coghlan and
Elisa Heymann and
Miquel A. Senar and
Gonzalo Merino and
C. Kanellopoulos and
G. Dick van Albada},
editor = {Francisco Fernandez Rivera and
Marian Bubak and
Andr{\'{e}}s G{\'{o}}mez{-}Tato and
Ramon Doallo},
title = {First Prototype of the CrossGrid Testbed},
booktitle = {Grid Computing, First European Across Grids Conference, Santiago de
Compostela, Spain, February 13-14, 2003, Revised Papers},
series = {Lecture Notes in Computer Science},
volume = {2970},
pages = {67--77},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/978-3-540-24689-3\_9},
doi = {10.1007/978-3-540-24689-3\_9},
timestamp = {Sun, 12 Nov 2023 02:12:58 +0100},
biburl = {https://dblp.org/rec/conf/eagc/GomesDMBMMRSGSFHGNOWBNPWFFGLCFTXDACHSMKA03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/EchavarriaSPCC02,
author = {Rodolfo Echavarr{\'{\i}}a and
Victor M. Sanchez and
Mario Ponce and
Maria Cotorogea and
Abraham Claudio},
title = {Analysis of a power topology for a quasi-resonant fast on-load tap
changing regulator},
booktitle = {Proceedings of the 2002 International Symposium on Circuits and Systems,
{ISCAS} 2002, Scottsdale, Arizona, USA, May 26-29, 2002},
pages = {837--840},
publisher = {{IEEE}},
year = {2002},
url = {https://doi.org/10.1109/ISCAS.2002.1010834},
doi = {10.1109/ISCAS.2002.1010834},
timestamp = {Tue, 28 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iscas/EchavarriaSPCC02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcst/InancSPP01,
author = {Tamer Inanc and
Mario Sznaier and
Pablo A. Parrilo and
Ricardo S. S{\'{a}}nchez Pe{\~{n}}a},
title = {Robust identification with mixed parametric/nonparametric models and
time/frequency-domain experiments: theory and an application},
journal = {{IEEE} Trans. Control. Syst. Technol.},
volume = {9},
number = {4},
pages = {608--617},
year = {2001},
url = {https://doi.org/10.1109/87.930971},
doi = {10.1109/87.930971},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcst/InancSPP01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tplp/Arenas-SanchezR01,
author = {Puri Arenas{-}S{\'{a}}nchez and
Mario Rodr{\'{\i}}guez{-}Artalejo},
title = {A General Framework for Lazy Functional Logic, Programming with Algebraic
Polymorphic Types},
journal = {Theory Pract. Log. Program.},
volume = {1},
number = {2},
pages = {185--245},
year = {2001},
url = {http://journals.cambridge.org/action/displayAbstract?aid=74981},
timestamp = {Thu, 13 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tplp/Arenas-SanchezR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iciap/NielsenLH01,
author = {Elena S{\'{a}}nchez{-}Nielsen and
Javier Lorenzo{-}Navarro and
Mario Hern{\'{a}}ndez{-}Tejera},
title = {Increasing Efficiency of Hausdorff Approach for Tracking Real Scenes
with Complex Environments},
booktitle = {11th International Conference on Image Analysis and Processing {(ICIAP}
2001), 26-28 September 2001, Palermo, Italy},
pages = {131--136},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/ICIAP.2001.956997},
doi = {10.1109/ICIAP.2001.956997},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iciap/NielsenLH01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tac/ParriloPS99,
author = {Pablo A. Parrilo and
Ricardo S. S{\'{a}}nchez Pe{\~{n}}a and
Mario Sznaier},
title = {A parametric extension of mixed time/frequency robust identification},
journal = {{IEEE} Trans. Autom. Control.},
volume = {44},
number = {2},
pages = {364--369},
year = {1999},
url = {https://doi.org/10.1109/9.746267},
doi = {10.1109/9.746267},
timestamp = {Wed, 20 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tac/ParriloPS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/PazosSG99,
author = {Carlos M. D. Pazos and
Juan C. Sanchez{-}Agrelo and
Mario Gerla},
title = {Using Back-Pressure to Improve {TCP} Performance with Many Flows},
booktitle = {Proceedings {IEEE} {INFOCOM} '99, The Conference on Computer Communications,
Eighteenth Annual Joint Conference of the {IEEE} Computer and Communications
Societies, The Future Is Now, New York, NY, USA, March 21-25, 1999},
pages = {431--438},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/INFCOM.1999.751375},
doi = {10.1109/INFCOM.1999.751375},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/infocom/PazosSG99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/TeschPBS99,
author = {Bruce J. Tesch and
Philip M. Pratt and
Kanti Bacrania and
Mario Sanchez},
title = {A 14-b, 125 {MSPS} digital-to-analog converter and bandgap voltage
reference in 0.5 um {CMOS}},
booktitle = {Proceedings of the 1999 International Symposium on Circuits and Systems,
{ISCAS} 1999, Orlando, Florida, USA, May 30 - June 2, 1999},
pages = {452--455},
publisher = {{IEEE}},
year = {1999},
url = {https://doi.org/10.1109/ISCAS.1999.780765},
doi = {10.1109/ISCAS.1999.780765},
timestamp = {Wed, 03 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iscas/TeschPBS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ppdp/Arenas-SanchezLR99,
author = {Puri Arenas{-}S{\'{a}}nchez and
Francisco Javier L{\'{o}}pez{-}Fraguas and
Mario Rodr{\'{u}}guez{-}Arteljo},
editor = {Gopalan Nadathur},
title = {Functional Plus Logic Programming with Built-In and Symbolic Constraints},
booktitle = {Principles and Practice of Declarative Programming, International
Conference PPDP'99, Paris, France, September 29 - October 1, 1999,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1702},
pages = {152--169},
publisher = {Springer},
year = {1999},
url = {https://doi.org/10.1007/10704567\_9},
doi = {10.1007/10704567\_9},
timestamp = {Tue, 14 May 2019 10:00:46 +0200},
biburl = {https://dblp.org/rec/conf/ppdp/Arenas-SanchezLR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/automatica/ParriloSPI98,
author = {Pablo A. Parrilo and
Mario Sznaier and
Ricardo S. S{\'{a}}nchez Pe{\~{n}}a and
Tamer Inanc},
title = {Mixed Time/Frequency-Domain Based Robust Identification},
journal = {Autom.},
volume = {34},
number = {11},
pages = {1375--1389},
year = {1998},
url = {https://doi.org/10.1016/S0005-1098(98)00083-1},
doi = {10.1016/S0005-1098(98)00083-1},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/automatica/ParriloSPI98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/plilp/Arenas-SanchezLR98,
author = {Puri Arenas{-}S{\'{a}}nchez and
Francisco Javier L{\'{o}}pez{-}Fraguas and
Mario Rodr{\'{u}}guez{-}Arteljo},
editor = {Catuscia Palamidessi and
Hugh Glaser and
Karl Meinke},
title = {Embedding Multiset Constraints into a Lazy Functional Logic Language},
booktitle = {Principles of Declarative Programming, 10th International Symposium,
PLILP'98 Held Jointly with the 7th International Conference, ALP'98,
Pisa, Italy, September 16-18, 1998, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1490},
pages = {429--444},
publisher = {Springer},
year = {1998},
url = {https://doi.org/10.1007/BFb0056631},
doi = {10.1007/BFB0056631},
timestamp = {Tue, 14 May 2019 10:00:35 +0200},
biburl = {https://dblp.org/rec/conf/plilp/Arenas-SanchezLR98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/slp/Arenas-SanchezR97,
author = {Puri Arenas{-}S{\'{a}}nchez and
Mario Rodr{\'{\i}}guez{-}Artalejo},
editor = {Jan Maluszynski},
title = {A Lazy Narrowing Calculus for Functional Logic Programming with Algebraic
Polymorphic Types},
booktitle = {Logic Programming, Proceedings of the 1997 International Symposium,
Port Jefferson, Long Island, NY, USA, October 13-16, 1997},
pages = {53--67},
publisher = {{MIT} Press},
year = {1997},
timestamp = {Fri, 10 Jul 2015 12:20:33 +0200},
biburl = {https://dblp.org/rec/conf/slp/Arenas-SanchezR97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tapsoft/Arenas-SanchezR97,
author = {Puri Arenas{-}S{\'{a}}nchez and
Mario Rodr{\'{\i}}guez{-}Artalejo},
editor = {Michel Bidoit and
Max Dauchet},
title = {A Semantic Framework for Functional Logic Programming with Algebraic
Polymorphic Types},
booktitle = {TAPSOFT'97: Theory and Practice of Software Development, 7th International
Joint Conference CAAP/FASE, Lille, France, April 14-18, 1997, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1214},
pages = {453--464},
publisher = {Springer},
year = {1997},
url = {https://doi.org/10.1007/BFb0030618},
doi = {10.1007/BFB0030618},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/tapsoft/Arenas-SanchezR97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/time/SanchezS96,
author = {Mario R. S{\'{a}}nchez and
Anil M. Shende},
editor = {Luca Chittaro and
Scott D. Goodwin and
Howard J. Hamilton and
Angelo Montanari},
title = {Time Accountability for Lattice Computers},
booktitle = {Proceedings of the Third International Workshop on Temporal Representation
and Reasoning, TIME-96, Key West, Florida, USA, May 19-20, 1996},
pages = {211--216},
publisher = {{IEEE} Computer Society},
year = {1996},
url = {https://doi.org/10.1109/TIME.1996.555702},
doi = {10.1109/TIME.1996.555702},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/time/SanchezS96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmod/RisheSBDOALOSS95,
author = {Naphtali Rishe and
Wei Sun and
David Barton and
Yi Deng and
Cyril U. Orji and
Michael Alexopoulos and
Leonard Loureiro and
Carlos Ordonez and
Mario R. S{\'{a}}nchez and
Artyom Shaposhnikov},
title = {Florida International University High Performance Database Research
Center},
journal = {{SIGMOD} Rec.},
volume = {24},
number = {3},
pages = {71--76},
year = {1995},
url = {https://doi.org/10.1145/211990.212019},
doi = {10.1145/211990.212019},
timestamp = {Thu, 20 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigmod/RisheSBDOALOSS95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-06-22 11:45 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
