Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Mario Sanchez"
download as .bib file
@article{DBLP:journals/access/VilarAndreuGGAG24,
author = {Mario Vilar{-}Andreu and
Laura Garc{\'{\i}}a and
Antonio{-}Javier Garc{\'{\i}}a{-}S{\'{a}}nchez and
Rafael Asorey{-}Cacheda and
Joan Garc{\'{\i}}a{-}Haro},
title = {Enhancing Precision Agriculture Pest Control: {A} Generalized Deep
Learning Approach With YOLOv8-Based Insect Detection},
journal = {{IEEE} Access},
volume = {12},
pages = {84420--84434},
year = {2024}
}
@article{DBLP:journals/access/VilchezMembrillaPPSS24,
author = {Jos{\'{e}} Antonio Vilchez{-}Membrilla and
Mario Fern{\'{a}}ndez Pantoja and
Ana Pilar Valerga Puerta and
Victor Hugo Oliveira e Souza and
Clemente Cobos S{\'{a}}nchez},
title = {Design of Transcranial Magnetic Stimulation Coils With Optimized Stimulation
Depth},
journal = {{IEEE} Access},
volume = {12},
pages = {1330--1340},
year = {2024}
}
@article{DBLP:journals/computers/AndresSanchezOSG24,
author = {Jorge de Andr{\'{e}}s{-}S{\'{a}}nchez and
Mario Arias Oliva and
Mar Souto{-}Romero and
Jaume Gen{\'{e}}{-}Albesa},
title = {Assessing the Acceptance of Cyborg Technology with a Hedonic Technology
Acceptance Model},
journal = {Comput.},
volume = {13},
number = {3},
pages = {82},
year = {2024}
}
@article{DBLP:journals/dcg/KolesnikS24,
author = {Brett Kolesnik and
Mario Sanchez},
title = {The Geometry of Random Tournaments},
journal = {Discret. Comput. Geom.},
volume = {71},
number = {4},
pages = {1343--1351},
year = {2024}
}
@article{DBLP:journals/fi/GuerraMACSS24,
author = {Erik Ortiz Guerra and
Mario Mart{\'{\i}}nez Morfa and
Carlos Manuel Garc{\'{\i}}a Algora and
Hector Cruz{-}Enriquez and
Kris Steenhaut and
Samuel Montejo Sanchez},
title = {Enhanced Beacons Dynamic Transmission over {TSCH}},
journal = {Future Internet},
volume = {16},
number = {6},
pages = {187},
year = {2024}
}
@article{DBLP:journals/nn/VillaizanValleladoSCS24,
author = {Mario Villaiz{\'{a}}n{-}Vallelado and
Matteo Salvatori and
Bel{\'{e}}n Carro and
Antonio Javier S{\'{a}}nchez{-}Esguevillas},
title = {Graph Neural Network contextual embedding for Deep Learning on tabular
data},
journal = {Neural Networks},
volume = {173},
pages = {106180},
year = {2024}
}
@article{DBLP:journals/software/LorenzoLopezMJPHP24,
author = {Alvaro Lorenzo{-}Lopez and
Ashley Morris and
Owain Jones and
Alexander B. Phillips and
Mario Hern{\'{a}}ndez{-}Tejera and
Adri{\'{a}}n Pe{\~{n}}ate S{\'{a}}nchez},
title = {Developing a Reconfigurable Architecture for the Remote Operation
of Marine Autonomous Systems},
journal = {{IEEE} Softw.},
volume = {41},
number = {4},
pages = {160--170},
year = {2024}
}
@article{DBLP:journals/tim/MateosRuizPHAMMC24,
author = {Pablo Mateos{-}Ruiz and
Mario Perez{-}Escribano and
Alberto Hern{\'{a}}ndez{-}Escobar and
Elena Abdo{-}S{\'{a}}nchez and
Enrique Marquez{-}Segura and
Teresa M. Mart{\'{\i}}n{-}Guerrero and
Carlos Camacho{-}Pe{\~{n}}alosa},
title = {Time-Domain Characterization of Nematic Liquid Crystals Using Additive
Manufacturing Microstrip Lines},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {73},
pages = {1--8},
year = {2024}
}
@article{DBLP:journals/access/EntrenaSGPGLS23,
author = {Luis Entrena and
Antonio J. Sanchez{-}Clemente and
Luis {\'{A}}ngel Garc{\'{\i}}a{-}Astudillo and
Marta Portela{-}Garc{\'{\i}}a and
Mario Garc{\'{\i}}a{-}Valderas and
Almudena Lindoso and
Roberto Sarmiento},
title = {Formal Verification of Fault-Tolerant Hardware Designs},
journal = {{IEEE} Access},
volume = {11},
pages = {116127--116140},
year = {2023}
}
@article{DBLP:journals/access/OrtizTorresMSMR23,
author = {Gerardo Ortiz{-}Torres and
Jesse Yoe Rumbo Morales and
Ren{\'{e}} Osorio S{\'{a}}nchez and
Mario Mart{\'{\i}}nez{-}Garc{\'{\i}}a and
Marco Antonio Rodr{\'{\i}}guez{-}Blanco},
title = {Fault Tolerant Control via Input-Output Linearization Method for LED-Driver
Using a Boost Converter},
journal = {{IEEE} Access},
volume = {11},
pages = {10390--10397},
year = {2023}
}
@article{DBLP:journals/amcs/OrdazASO23,
author = {Patricio Ordaz and
Hussain Alazki and
Bonifacio Sanchez and
Mario Ordaz{-}Oliver},
title = {On the finite time stabilization via robust control for uncertain
disturbed systems},
journal = {Int. J. Appl. Math. Comput. Sci.},
volume = {33},
number = {1},
year = {2023}
}
@article{DBLP:journals/bspc/MadrugaCP23,
author = {Mario Madruga and
Yolanda Campos{-}Roca and
Carlos J. P{\'{e}}rez},
title = {Addressing smartphone mismatch in Parkinson's disease detection aid
systems based on speech},
journal = {Biomed. Signal Process. Control.},
volume = {80},
number = {Part},
pages = {104281},
year = {2023}
}
@article{DBLP:journals/complexity/RoldanCaballeroPHSPRVMGM23,
author = {Alfredo Rold{\'{a}}n{-}Caballero and
Jose Humberto P{\'{e}}rez{-}Cruz and
Eduardo Hern{\'{a}}ndez{-}M{\'{a}}rquez and
Jos{\'{e}} Rafael Garc{\'{\i}}a S{\'{a}}nchez and
Mario Ponce{-}Silva and
Jos{\'{e}} de Jes{\'{u}}s Rubio and
Miguel Gabriel Villarreal{-}Cervantes and
Jes{\'{u}}s Mart{\'{\i}}nez{-}Mart{\'{\i}}nez and
Enrique Garc{\'{\i}}a{-}Trinidad and
Alejandro Mendoza{-}Chegue},
title = {Synchronization of a New Chaotic System Using Adaptive Control: Design
and Experimental Implementation},
journal = {Complex.},
volume = {2023},
pages = {2881192:1--2881192:22},
year = {2023}
}
@article{DBLP:journals/comsur/BeltranPSBBPPC23,
author = {Enrique Tom{\'{a}}s Mart{\'{\i}}nez Beltr{\'{a}}n and
Mario Quiles P{\'{e}}rez and
Pedro Miguel S{\'{a}}nchez S{\'{a}}nchez and
Sergio L{\'{o}}pez Bernal and
G{\'{e}}r{\^{o}}me Bovet and
Manuel Gil P{\'{e}}rez and
Gregorio Mart{\'{\i}}nez P{\'{e}}rez and
Alberto Huertas Celdr{\'{a}}n},
title = {Decentralized Federated Learning: Fundamentals, State of the Art,
Frameworks, Trends, and Challenges},
journal = {{IEEE} Commun. Surv. Tutorials},
volume = {25},
number = {4},
pages = {2983--3013},
year = {2023}
}
@article{DBLP:journals/cys/VillarFEMP23,
author = {Erika Yolanda Aguilar del Villar and
Mario Alberto S{\'{a}}nchez Flores and
Jes{\'{u}}s Jaime Moreno Escobar and
Oswaldo Morales Matamoros and
Ricardo Tejeida Padilla},
title = {Power Spectral Analysis of Bioacoustic Signals Emitted by a Bottlenose
Dolphin when Performing Assisted Therapy},
journal = {Computaci{\'{o}}n y Sistemas (CyS)},
volume = {27},
number = {1},
year = {2023}
}
@article{DBLP:journals/eait/RojasSanchezPF23,
author = {Mario A. Rojas{-}S{\'{a}}nchez and
Pedro R. Palos{-}Sanchez and
Jos{\'{e}} A. Folgado{-}Fern{\'{a}}ndez},
title = {Systematic literature review and bibliometric analysis on virtual
reality and education},
journal = {Educ. Inf. Technol.},
volume = {28},
number = {1},
pages = {155--192},
year = {2023}
}
@article{DBLP:journals/esi/CabreraQCSGSL23,
author = {Diego Cabrera and
Mar{\'{\i}}a J. Quinteros and
Mariela Cerrada and
Ren{\'{e}}{-}Vinicio S{\'{a}}nchez and
Mario Guallpa and
Fernando Sancho and
Chuan Li},
title = {Rainfall Forecasting using a Bayesian framework and Long Short-Term
Memory Multi-model Estimation based on an hourly meteorological monitoring
network. Case of study: Andean Ecuadorian Tropical City},
journal = {Earth Sci. Informatics},
volume = {16},
number = {2},
pages = {1373--1388},
year = {2023}
}
@article{DBLP:journals/fgcs/SanchezZasVVLMB23,
author = {Carmen S{\'{a}}nchez{-}Zas and
V{\'{\i}}ctor A. Villagr{\'{a}} and
Mario Vega{-}Barbas and
Xavier Larriva{-}Novo and
Jos{\'{e}} Ignacio Moreno and
Julio Berrocal},
title = {Ontology-based approach to real-time risk management and cyber-situational
awareness},
journal = {Future Gener. Comput. Syst.},
volume = {141},
pages = {462--472},
year = {2023}
}
@article{DBLP:journals/finr/HaraldsenHMRMAAAAABBBBCCCCDBDDGGGG23,
author = {Ira R. J. Hebold Haraldsen and
Christoffer Hatlestad{-}Hall and
Camillo Marra and
Hanna Renvall and
Fernando Maest{\'{u}} and
Jorge Acosta{-}Hern{\'{a}}ndez and
Soraya Alfonsin and
Vebj{\o}rn Andersson and
Abhilash Anand and
Victor Ayll{\'{o}}n and
Aleksandar Babic and
Asma Belhadi and
Cindy Birck and
Ricardo Bru{\~{n}}a and
Naike Caraglia and
Claudia Carrarini and
Erik Christensen and
Americo Cicchetti and
Signe Daugbjerg and
Rossella Di Bidino and
Ana Diaz{-}Ponce and
Ainar Drews and
Guido Maria Giuffr{\`{e}} and
Jean Georges and
Pedro Gil{-}Gregorio and
Dianne Gove and
Tim M. Govers and
Harry Hallock and
Marja Hietanen and
Lone Holmen and
Jaakko Hotta and
Samuel Kaski and
Rabindra Khadka and
Antti S. Kinnunen and
Anne M. Koivisto and
Shrikanth Kulashekhar and
Denis Larsen and
Mia Liljestr{\"{o}}m and
Pedro G. Lind and
Alberto Marcos Dolado and
Serena Elizabeth Marshall and
Susanne Merz and
Francesca Miraglia and
Juha Montonen and
Ville M{\"{a}}ntynen and
Anne Rita {\O}kseng{\aa}rd and
Javier Olazar{\'{a}}n and
Teemu Paajanen and
Jos{\'{e}} M. Pe{\~{n}}a and
Lu{\'{\i}}s Pe{\~{n}}a and
Daniel lrabien Peniche and
Ana S. P{\'{e}}rez and
Mohamed Radwan and
Federico Ram{\'{\i}}rez{-}Tora{\~{n}}o and
Andrea Rodr{\'{\i}}guez{-}Pedrero and
Timo Saarinen and
Mario Salas{-}Carrillo and
Riitta Salmelin and
Sonia Sousa and
Abdillah Suyuthi and
Mathias Toft and
Pablo Toharia and
Thomas Tveitst{\o}l and
Mats Tveter and
Ramesh Upreti and
Robin J. Vermeulen and
Fabrizio Vecchio and
Anis Yazidi and
Paolo Maria Rossini},
title = {Intelligent digital tools for screening of brain connectivity and
dementia risk estimation in people affected by mild cognitive impairment:
the AI-Mind clinical study protocol},
journal = {Frontiers Neurorobotics},
volume = {17},
year = {2023}
}
@article{DBLP:journals/jcise/PenaCMCS23,
author = {Mario Pe{\~{n}}a and
Mariela Cerrada and
Rub{\'{e}}n Medina and
Diego Cabrera and
Ren{\'{e}}{-}Vinicio S{\'{a}}nchez},
title = {Poincar{\'{e}} Plot Features and Statistical Features From Current
and Vibration Signals for Fault Severity Classification of Helical
Gear Tooth Breaks},
journal = {J. Comput. Inf. Sci. Eng.},
volume = {23},
number = {2},
year = {2023}
}
@article{DBLP:journals/jirs/SanchezSanchezHGRFFF23,
author = {A. G. Sanchez{-}Sanchez and
Eduardo Gamaliel Hern{\'{a}}ndez{-}Mart{\'{\i}}nez and
Jaime Gonz{\'{a}}lez{-}Sierra and
Mario Ramirez{-}Neria and
Jos{\'{e}}{-}Job Flores{-}Godoy and
Enrique D. Ferreira and
Guillermo Fern{\'{a}}ndez{-}Anaya},
title = {Leader-Follower Power-based Formation Control Applied to Differential-drive
Mobile Robots},
journal = {J. Intell. Robotic Syst.},
volume = {107},
number = {1},
pages = {6},
year = {2023}
}
@article{DBLP:journals/kybernetes/BuitragoFlorezSRHH23,
author = {Francisco Buitrago{-}Florez and
Mario Sanchez and
Vanessa Perez Romanello and
Carola Hernandez and
Marcela Hern{\'{a}}ndez Hoyos},
title = {A systematic approach for curriculum redesign of introductory courses
in engineering: a programming course case study},
journal = {Kybernetes},
volume = {52},
number = {10},
pages = {3904--3917},
year = {2023}
}
@article{DBLP:journals/mta/OlivaONREMN23,
author = {Diego Oliva and
No{\'{e}} Ortega{-}S{\'{a}}nchez and
Mario A. Navarro and
Alfonso Ramos{-}Michel and
Mohammed El{-}Abd and
Seyed Jalaleddin Mousavirad and
Mohammad H. Nadimi{-}Shahraki},
title = {Segmentation of thermographies from electronic systems by using the
global-best brain storm optimization algorithm},
journal = {Multim. Tools Appl.},
volume = {82},
number = {29},
pages = {44911--44941},
year = {2023}
}
@article{DBLP:journals/neuroimage/GirardRTAANPBABGOBPBSDSCBPFS23,
author = {Gabriel Girard and
Jonathan Rafael{-}Patino and
Rapha{\"{e}}l Truffet and
Dogu Baran Aydogan and
Nagesh Adluru and
Veena A. Nair and
Vivek Prabhakaran and
Barbara B. Bendlin and
Andrew L. Alexander and
Sara Bosticardo and
Ilaria Gabusi and
Mario Ocampo{-}Pineda and
Matteo Battocchio and
Zuzana Piskorova and
Pietro Bontempi and
Simona Schiavi and
Alessandro Daducci and
Aleksandra Stafiej and
Dominika Ciupek and
Fabian Bogusz and
Tomasz Pieciak and
Matteo Frigo and
Sara Sedlar and
Samuel Deslauriers{-}Gauthier and
Ivana Kojcic and
Mauro Zucchelli and
Hiba Laghrissi and
Yang Ji and
Rachid Deriche and
Kurt G. Schilling and
Bennett A. Landman and
Alberto Cacciola and
Gianpaolo Antonio Basile and
Salvatore Bertino and
Nancy Newlin and
Praitayini Kanakaraj and
Francois Rheault and
Patryk Filipiak and
Timothy M. Shepherd and
Ying{-}Chia Lin and
Dimitris G. Placantonakis and
Fernando E. Boada and
Steven H. Baete and
Erick Hernandez{-}Gutierrez and
Alonso Ramirez{-}Manzanares and
Ricardo Coronado{-}Leija and
Pablo Stack{-}S{\'{a}}nchez and
Luis Concha and
Maxime Descoteaux and
Sina Mansour L and
Caio Seguin and
Andrew Zalesky and
Kenji Marshall and
Erick Jorge Canales{-}Rodr{\'{\i}}guez and
Ye Wu and
Sahar Ahmad and
Pew{-}Thian Yap and
Antoine Th{\'{e}}berge and
Florence Gagnon and
Fr{\'{e}}d{\'{e}}ric Massi and
Elda Fischi Gomez and
Remy Gardier and
Juan Luis Villarreal{-}Haro and
Marco Pizzolato and
Emmanuel Caruyer and
Jean{-}Philippe Thiran},
title = {Tractography passes the test: Results from the diffusion-simulated
connectivity (disco) challenge},
journal = {NeuroImage},
volume = {277},
pages = {120231},
year = {2023}
}
@article{DBLP:journals/remotesensing/HerreraCoyCHBCDSF23,
author = {Mar{\'{\i}}a Camila Herrera{-}Coy and
Laura Paola Calder{\'{o}}n and
Iv{\'{a}}n Leonardo Herrera{-}P{\'{e}}rez and
Paul Esteban Bravo{-}L{\'{o}}pez and
Christian Conoscenti and
Jorge Delgado and
Mario S{\'{a}}nchez{-}G{\'{o}}mez and
Tom{\'{a}}s Fern{\'{a}}ndez},
title = {Landslide Susceptibility Analysis on the Vicinity of Bogot{\'{a}}-Villavicencio
Road (Eastern Cordillera of the Colombian Andes)},
journal = {Remote. Sens.},
volume = {15},
number = {15},
pages = {3870},
year = {2023}
}
@article{DBLP:journals/sensors/Fernandez-Gorgojo23,
author = {Mario Fern{\'{a}}ndez{-}Gorgojo and
Diana Salas{-}G{\'{o}}mez and
Pascual S{\'{a}}nchez{-}Juan and
Esther Laguna{-}Bercero and
Mar{\'{\i}}a Isabel P{\'{e}}rez{-}N{\'{u}}{\~{n}}ez},
title = {Analysis of Dynamic Plantar Pressure and Influence of Clinical-Functional
Measures on Their Performance in Subjects with Bimalleolar Ankle Fracture
at 6 and 12 Months Post-Surgery},
journal = {Sensors},
volume = {23},
number = {8},
pages = {3975},
year = {2023}
}
@article{DBLP:journals/sensors/GraciaOCISDA23,
author = {Desir{\'{e}}e I. Gracia and
Mario Ort{\'{\i}}z and
Tatiana Candela and
Eduardo I{\'{a}}{\~{n}}ez and
Rosa M. S{\'{a}}nchez and
Carmina D{\'{\i}}az and
Jos{\'{e}} Mar{\'{\i}}a Azor{\'{\i}}n},
title = {Design and Evaluation of a Potential Non-Invasive Neurostimulation
Strategy for Treating Persistent Anosmia in Post-COVID-19 Patients},
journal = {Sensors},
volume = {23},
number = {13},
pages = {5880},
year = {2023}
}
@article{DBLP:journals/sensors/MartinezAPMBABL23,
author = {Raquel Martinez and
Alberto Arroyo and
Alberto Pigazo and
Mario Manana and
Eduardo Bayona and
Francisco J. Azcondo and
Sergio Bustamante and
Alberto Laso},
title = {Acoustic Noise-Based Detection of Ferroresonance Events in Isolated
Neutral Power Systems with Inductive Voltage Transformers},
journal = {Sensors},
volume = {23},
number = {1},
pages = {195},
year = {2023}
}
@article{DBLP:journals/sensors/Sanchez-Fernandez23,
author = {Luis Pastor S{\'{a}}nchez{-}Fern{\'{a}}ndez and
Luis Alejandro S{\'{a}}nchez{-}P{\'{e}}rez and
Jos{\'{e}} Juan Carbajal Hern{\'{a}}ndez and
Mario Alberto Hern{\'{a}}ndez{-}Guerrero and
Lucrecia P{\'{e}}rez{-}Echazabal},
title = {Buildings' Biaxial Tilt Assessment Using Inertial Wireless Sensors
and a Parallel Training Model},
journal = {Sensors},
volume = {23},
number = {11},
pages = {5352},
year = {2023}
}
@inproceedings{DBLP:conf/clihc/Sanchez-RinzaSL23,
author = {B{\'{a}}rbara Emma S{\'{a}}nchez{-}Rinza and
Carlos Ignacio Robledo S{\'{a}}nchez and
Mario Rossainz L{\'{o}}pez},
title = {Usability in a Mixed Cryptography and Hardware Security System},
booktitle = {{CLIHC}},
pages = {10:1--10:5},
publisher = {{ACM}},
year = {2023}
}
@inproceedings{DBLP:conf/edoc/VelandiaHBSV23,
author = {Paula Velandia and
Andrea Herrera and
L. Mar{\'{\i}}a Jos{\'{e}} Bonilla and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Driving Innovation in Industry 4.0 Through Business Model Simulation},
booktitle = {{EDOC} Workshops},
series = {Lecture Notes in Business Information Processing},
volume = {498},
pages = {23--38},
publisher = {Springer},
year = {2023}
}
@inproceedings{DBLP:conf/icaisc/SanchezMQ23,
author = {Sergio Sanchez and
Javier Machacuay and
Mario Quinde},
title = {Federated Learning for Human Activity Recognition on the MHealth Dataset},
booktitle = {{ICAISC} {(1)}},
series = {Lecture Notes in Computer Science},
volume = {14125},
pages = {215--225},
publisher = {Springer},
year = {2023}
}
@inproceedings{DBLP:conf/iceee/BravoMPRM23,
author = {J. Juan Avil{\'{e}}s Bravo and
Alfredo Morales{-}S{\'{a}}nchez and
Liliana Palacios{-}Huerta and
J. Federico Ramirez Rios and
Mario Moreno},
title = {Improved Photoluminescence Intensity of Silicon Rich Oxide Film by
Surface Etching},
booktitle = {{CCE}},
pages = {1--6},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/igarss/CazcarraBesBLDDSC23,
author = {Victor Cazcarra{-}Bes and
Mario Busquier and
Juan M. Lopez{-}Sanchez and
Michael Duersch and
Shaunak De and
Craig Stringham and
Davide Castelleti},
title = {Assessment of Multi-Temporal Capella {SAR} Data for Change Detection
and Crop Monitoring},
booktitle = {{IGARSS}},
pages = {3410--3413},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/igarss/VillarroyaCarpioBLE23,
author = {Arturo Villarroya{-}Carpio and
Mario Busquier and
Juan M. Lopez{-}Sanchez and
Marcus E. Engdahl},
title = {{C-} and X-Band Repeat-Pass Coherence for Crop-Type Mapping and Monitoring},
booktitle = {{IGARSS}},
pages = {425--428},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/vts/AhmadilivaniBBBDTGJRRST23,
author = {Mohammad Hasan Ahmadilivani and
Mario Barbareschi and
Salvatore Barone and
Alberto Bosio and
Masoud Daneshtalab and
Salvatore Della Torca and
Gabriele Gavarini and
Maksim Jenihhin and
Jaan Raik and
Annachiara Ruospo and
Ernesto S{\'{a}}nchez and
Mahdi Taheri},
title = {Special Session: Approximation and Fault Resiliency of {DNN} Accelerators},
booktitle = {{VTS}},
pages = {1--10},
publisher = {{IEEE}},
year = {2023}
}
@incollection{DBLP:books/sp/23/SavaglioSFACMRRB23,
author = {Claudio Savaglio and
Giandomenico Spezzano and
Giancarlo Fortino and
Mario Alejandro Paguay Alvarado and
Fabio Capparelli and
Gianmarco Marcello and
Luigi Rachiele and
Francesco Raco and
Samantha Genoveva Sanchez Basantes},
title = {Edge Intelligence Against {COVID-19:} {A} Smart University Campus
Case Study},
booktitle = {IoT Edge Solutions for Cognitive Buildings},
pages = {221--243},
publisher = {Springer},
year = {2023}
}
@article{DBLP:journals/corr/abs-2303-06455,
author = {Mario Villaiz{\'{a}}n{-}Vallelado and
Matteo Salvatori and
Bel{\'{e}}n Carro Mart{\'{\i}}nez and
Antonio Javier S{\'{a}}nchez{-}Esguevillas},
title = {Graph Neural Network contextual embedding for Deep Learning on Tabular
Data},
journal = {CoRR},
volume = {abs/2303.06455},
year = {2023}
}
@article{DBLP:journals/corr/abs-2306-04645,
author = {Mohammad Hasan Ahmadilivani and
Mario Barbareschi and
Salvatore Barone and
Alberto Bosio and
Masoud Daneshtalab and
Salvatore Della Torca and
Gabriele Gavarini and
Maksim Jenihhin and
Jaan Raik and
Annachiara Ruospo and
Ernesto S{\'{a}}nchez and
Mahdi Taheri},
title = {Special Session: Approximation and Fault Resiliency of {DNN} Accelerators},
journal = {CoRR},
volume = {abs/2306.04645},
year = {2023}
}
@article{DBLP:journals/access/Calderon-Ramirez22,
author = {Mario Calder{\'{o}}n{-}Ram{\'{\i}}rez and
Jes{\'{u}}s A. G{\'{o}}mez{-}N{\'{a}}fate and
Ramiro Rico{-}Mart{\'{\i}}nez and
Ram{\'{o}}n Rodr{\'{\i}}guez{-}Castro and
Micael{-}G. Bravo{-}S{\'{a}}nchez and
Luis A. Alcaraz{-}Caracheo},
title = {Improvement of Ohmic Pasteurization in Mango Pulp Through {CFD} and
{RSM}},
journal = {{IEEE} Access},
volume = {10},
pages = {81380--81389},
year = {2022}
}
@article{DBLP:journals/access/Garza-FabreSAB22,
author = {Mario Garza{-}Fabre and
Aar{\'{o}}n Leonardo S{\'{a}}nchez{-}Mart{\'{\i}}nez and
Edwin Aldana{-}Bobadilla and
Ricardo Landa Becerra},
title = {Decision Making in Evolutionary Multiobjective Clustering: {A} Machine
Learning Challenge},
journal = {{IEEE} Access},
volume = {10},
pages = {117281--117303},
year = {2022}
}
@article{DBLP:journals/access/Maya-RodriguezL22,
author = {Mario C. Maya{-}Rodriguez and
Mario A. L{\'{o}}pez{-}Pacheco and
Yair Lozano{-}Hern{\'{a}}ndez and
Victor G. S{\'{a}}nchez{-}Meza and
Luis A. Cantera Cantera and
Ren{\'{e}} Tolentino{-}Eslava},
title = {Integration of {CNN} in a Dynamic Model-Based Controller for Control
of a 2DOF Helicopter With Tail Rotor Perturbations},
journal = {{IEEE} Access},
volume = {10},
pages = {73474--73483},
year = {2022}
}
@article{DBLP:journals/bioinformatics/SanchezAMCO22,
author = {Daniel Jim{\'{e}}nez S{\'{a}}nchez and
Mikel Ariz and
Jos{\'{e}} M{\'{a}}rio Morgado and
Iv{\'{a}}n Cort{\'{e}}s{-}Dom{\'{\i}}nguez and
Carlos Ortiz{-}de{-}Sol{\'{o}}rzano},
title = {Corrigendum to: {NMF-RI:} blind spectral unmixing of highly mixed
multispectral flow and image cytometry data},
journal = {Bioinform.},
volume = {38},
number = {6},
pages = {1779},
year = {2022}
}
@article{DBLP:journals/cys/GalvezGGA22,
author = {Alba Maribel S{\'{a}}nchez G{\'{a}}lvez and
Ricardo {\'{A}}lvarez{-}Gonz{\'{a}}lez and
Sully S{\'{a}}nchez G{\'{a}}lvez and
Mario Anzures{-}Garc{\'{\i}}a},
title = {Model to Predict the Result of a Soccer Match Based on the Number
of Goals Scored by a Single Team},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {26},
number = {1},
year = {2022}
}
@article{DBLP:journals/ec/SanchezG22,
author = {Claudia N. S{\'{a}}nchez and
Mario Graff},
title = {Selection Heuristics on Semantic Genetic Programming for Classification
Problems},
journal = {Evol. Comput.},
volume = {30},
number = {2},
pages = {253--289},
year = {2022}
}
@article{DBLP:journals/esi/Gonzalez-Herrera22,
author = {Roger Gonzalez{-}Herrera and
Mario Cortazar{-}Cepeda and
Ismael S{\'{a}}nchez{-}Pinto and
Javier Canto{-}Rios},
title = {A homogeneous approach in modeling a coastal karst aquifer},
journal = {Earth Sci. Informatics},
volume = {15},
number = {3},
pages = {1825--1840},
year = {2022}
}
@article{DBLP:journals/eswa/GomezCSCV22,
author = {Manuel J. Gomez and
Mario Calder{\'{o}}n and
Victor S{\'{a}}nchez and
F{\'{e}}lix J. Garc{\'{\i}}a Clemente and
Jos{\'{e}} A. Ruip{\'{e}}rez{-}Valiente},
title = {Large scale analysis of open {MOOC} reviews to support learners' course
selection},
journal = {Expert Syst. Appl.},
volume = {210},
pages = {118400},
year = {2022}
}
@article{DBLP:journals/fgcs/DivanRG22,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso and
Silvio Miguel Gonnet},
title = {Measurement project interoperability for real-time data gathering
systems},
journal = {Future Gener. Comput. Syst.},
volume = {129},
pages = {298--314},
year = {2022}
}
@article{DBLP:journals/ieee-rita/JiSPNJ22,
author = {Yi Peng Ji and
Ra{\'{u}}l Marticorena S{\'{a}}nchez and
Carlos Pardo{-}Aguilar and
Carlos L{\'{o}}pez Nozal and
Mario Juez{-}Gil},
title = {Activity and Dropout Tracking in Moodle Using UBUMonitor Application},
journal = {Rev. Iberoam. de Tecnol. del Aprendiz.},
volume = {17},
number = {3},
pages = {307--317},
year = {2022}
}
@article{DBLP:journals/infsof/CrespoNSTP22,
author = {Yania Crespo and
Carlos L{\'{o}}pez Nozal and
Ra{\'{u}}l Marticorena S{\'{a}}nchez and
Margarita Gonzalo Tasis and
Mario Piattini},
title = {The role of awareness and gamification on technical debt management},
journal = {Inf. Softw. Technol.},
volume = {150},
pages = {106946},
year = {2022}
}
@article{DBLP:journals/js/Mendez-MonroyMT22,
author = {Paul E. Mendez{-}Monroy and
E. Cruz May and
Mario Jim{\'{e}}nez Torres and
J. L. G{\'{o}}mez Hern{\'{a}}ndez and
M. Canto Romero and
Israel Sanchez Dominguez and
Oscar May{-}Tzuc and
Ali Bassam},
title = {IoT System for the Continuous Electrical and Environmental Monitoring
into Mexican Social Housing Evaluated under Tropical Climate Conditions},
journal = {J. Sensors},
volume = {2022},
pages = {1--20},
year = {2022}
}
@article{DBLP:journals/lgrs/Romero-PuigLB22,
author = {Noelia Romero{-}Puig and
Juan M. Lopez{-}Sanchez and
Mario Busquier},
title = {Evaluation of PolInSAR Observables for Crop-Type Mapping Using Bistatic
TanDEM-X Data},
journal = {{IEEE} Geosci. Remote. Sens. Lett.},
volume = {19},
pages = {1--5},
year = {2022}
}
@article{DBLP:journals/npjdm/BiffiSDHSAABCDF22,
author = {Carlo Biffi and
Pietro Salvagnini and
Nhan Ngo Dinh and
Cesare Hassan and
Prateek Sharma and
Giulio Antonelli and
Halim Awadie and
Sebastian Bernhofer and
Sabela Carballal and
M{\'{a}}rio Dinis{-}Ribeiro and
Agn{\`{e}}s Fern{\'{a}}ndez{-}Clotet and
Gloria Fern{\'{a}}ndez{-}Esparrach and
Ian Gralnek and
Yuta Higasa and
Taku Hirabayashi and
Tatsuki Hirai and
Mineo Iwatate and
Miki Kawano and
Markus Mader and
Andreas Maieron and
Sebastian Mattes and
Tastuya Nakai and
Ingrid Ordas and
Raquel Ortig{\~{a}}o and
Oswaldo Ortiz Z{\'{u}}{\~{n}}iga and
Maria Pellis{\'{e}} and
Cl{\'{a}}udia Pinto and
Florian Riedl and
Ariadna S{\'{a}}nchez and
Emanuel Steiner and
Yukari Tanaka and
Andrea Cherubini},
title = {A novel {AI} device for real-time optical characterization of colorectal
polyps},
journal = {npj Digit. Medicine},
volume = {5},
year = {2022}
}
@article{DBLP:journals/npjdm/BiffiSDHSAABCDF22a,
author = {Carlo Biffi and
Pietro Salvagnini and
Nhan Ngo Dinh and
Cesare Hassan and
Prateek Sharma and
Giulio Antonelli and
Halim Awadie and
Sebastian Bernhofer and
Sabela Carballal and
M{\'{a}}rio Dinis{-}Ribeiro and
Agn{\`{e}}s Fern{\'{a}}ndez{-}Clotet and
Gloria Fern{\'{a}}ndez{-}Esparrach and
Ian Gralnek and
Yuta Higasa and
Taku Hirabayashi and
Tatsuki Hirai and
Mineo Iwatate and
Miki Kawano and
Markus Mader and
Andreas Maieron and
Sebastian Mattes and
Tastuya Nakai and
Ingrid Ordas and
Raquel Ortig{\~{a}}o and
Oswaldo Ortiz Z{\'{u}}{\~{n}}iga and
Maria Pellis{\'{e}} and
Cl{\'{a}}udia Pinto and
Florian Riedl and
Ariadna S{\'{a}}nchez and
Emanuel Steiner and
Yukari Tanaka and
Andrea Cherubini},
title = {Author Correction: {A} novel {AI} device for real-time optical characterization
of colorectal polyps},
journal = {npj Digit. Medicine},
volume = {5},
year = {2022}
}
@article{DBLP:journals/remotesensing/Rio-BarralSGA22,
author = {Pablo del R{\'{\i}}o{-}Barral and
Mario Soil{\'{a}}n and
Silvia Mar{\'{\i}}a Gonz{\'{a}}lez{-}Collazo and
Pedro Arias},
title = {Pavement Crack Detection and Clustering via Region-Growing Algorithm
from 3D {MLS} Point Clouds},
journal = {Remote. Sens.},
volume = {14},
number = {22},
pages = {5866},
year = {2022}
}
@article{DBLP:journals/sensors/Almanza-OjedaRC22,
author = {Dora Luz Almanza{-}Ojeda and
Daniela Rodriguez{-}Sotelo and
Rogelio Castro{-}Sanchez and
Rene Martinez{-}Celorio and
Mario Alberto Ibarra{-}Manzano},
title = {Stokes Dynamic Polarimeter for Non-Organic and Organic Samples Characterization},
journal = {Sensors},
volume = {22},
number = {6},
pages = {2155},
year = {2022}
}
@article{DBLP:journals/sensors/Contreras-Hernandez22,
author = {Jose L. Contreras{-}Hernandez and
Dora Luz Almanza{-}Ojeda and
Sergio Ledesma and
Arturo Garcia{-}Perez and
Rogelio Castro{-}Sanchez and
Miguel A. Gomez{-}Martinez and
Mario Alberto Ibarra{-}Manzano},
title = {Geometric Analysis of Signals for Inference of Multiple Faults in
Induction Motors},
journal = {Sensors},
volume = {22},
number = {7},
pages = {2622},
year = {2022}
}
@article{DBLP:journals/sensors/Fernandez-Gorgojo22,
author = {Mario Fern{\'{a}}ndez{-}Gorgojo and
Diana Salas{-}G{\'{o}}mez and
Pascual S{\'{a}}nchez{-}Juan and
David Barbado and
Esther Laguna{-}Bercero and
Mar{\'{\i}}a Isabel P{\'{e}}rez{-}N{\'{u}}{\~{n}}ez},
title = {Clinical-Functional Evaluation and Test-Retest Reliability of the
{G-WALK} Sensor in Subjects with Bimalleolar Ankle Fractures 6 Months
after Surgery},
journal = {Sensors},
volume = {22},
number = {8},
pages = {3050},
year = {2022}
}
@article{DBLP:journals/staeors/BusquierLTF22,
author = {Mario Busquier and
Juan M. Lopez{-}Sanchez and
Francesca Ticconi and
Nicolas Floury},
title = {Combination of Time Series of L-, C-, and X-Band {SAR} Images for
Land Cover and Crop Classification},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {15},
pages = {8266--8286},
year = {2022}
}
@article{DBLP:journals/tcsv/SaldanhaSMA22,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Configurable Fast Block Partitioning for {VVC} Intra Coding Using
Light Gradient Boosting Machine},
journal = {{IEEE} Trans. Circuits Syst. Video Technol.},
volume = {32},
number = {6},
pages = {3947--3960},
year = {2022}
}
@article{DBLP:journals/tim/Vilchez-Membrilla22,
author = {Jos{\'{e}} Antonio Vilchez{-}Membrilla and
Ignacio Mateos and
{\'{A}}ngel Quir{\'{o}}s{-}Oloz{\'{a}}bal and
Mario Fern{\'{a}}ndez Pantoja and
Clemente Cobos S{\'{a}}nchez},
title = {{PCB} Transducer Coil Design for a Low-Noise Magnetic Measurement
System in Space Missions},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {71},
pages = {1--9},
year = {2022}
}
@article{DBLP:journals/tnsm/RaghuramuCSSKCL22,
author = {Arun Raghuramu and
Lianjie Cao and
Puneet Sharma and
Mario S{\'{a}}nchez and
Joon{-}Myung Kang and
Chen{-}Nee Chuah and
David Lee and
Vinay Saxena},
title = {Metered Boot: Trusted Framework for Application Usage Rights Management
in Virtualized Ecosystems},
journal = {{IEEE} Trans. Netw. Serv. Manag.},
volume = {19},
number = {3},
pages = {2238--2250},
year = {2022}
}
@inproceedings{DBLP:conf/embc/Vilchez-Membrilla22,
author = {Jos{\'{e}} Antonio Vilchez{-}Membrilla and
Clemente Cobos S{\'{a}}nchez and
Carmen Torres Montijano and
Ana Pilar Valerga Puerta and
Mario Fern{\'{a}}ndez Pantoja},
title = {Design of Optimal Coils for Deep Transcranial Magnetic Stimulation},
booktitle = {{EMBC}},
pages = {3447--3450},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/iscas/SaldanhaSMA22,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Fast Transform Decision Scheme for {VVC} Intra-Frame Prediction Using
Decision Trees},
booktitle = {{ISCAS}},
pages = {1948--1952},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/micai/Sanchez-Martinez22,
author = {Aar{\'{o}}n Leonardo S{\'{a}}nchez{-}Mart{\'{\i}}nez and
Mario Garza{-}Fabre and
Ricardo Landa Becerra and
Edwin Aldana{-}Bobadilla},
title = {Machine Learning-Based Decision Making in Evolutionary Multiobjective
Clustering},
booktitle = {{MICAI} {(1)}},
series = {Lecture Notes in Computer Science},
volume = {13612},
pages = {123--137},
publisher = {Springer},
year = {2022}
}
@inproceedings{DBLP:conf/riiforum/SanchezGMG22,
author = {Mar{\'{\i}}a de los {\'{A}}ngeles T{\'{a}}rraga S{\'{a}}nchez and
Mar{\'{\i}}a del Mar Ballesteros Garc{\'{\i}}a and
H{\'{e}}ctor Migall{\'{o}}n and
Otoniel L{\'{o}}pez Granado},
title = {Reinforcement Learning Through Gamification and Open Online Resources
in Elementary School},
booktitle = {{RIIFORUM}},
series = {Springer Proceedings in Complexity},
pages = {455--463},
publisher = {Springer},
year = {2022}
}
@inproceedings{DBLP:conf/sigcomm/AhujaDPSGSYNRSZ22,
author = {Satyajeet Singh Ahuja and
Vinayak Dangui and
Kirtesh Patil and
Manikandan Somasundaram and
Varun Gupta and
Mario A. S{\'{a}}nchez and
Guanqing Yan and
Max Noormohammadpour and
Alaleh Razmjoo and
Grace Smith and
Hao Zhong and
Abhinav Triguna and
Soshant Bali and
Yuxiang Xiang and
Yilun Chen and
Prabhakaran Ganesan and
Mikel Jimenez Fernandez and
Petr Lapukhov and
Guyue Liu and
Ying Zhang},
title = {Network entitlement: contract-based network sharing with agility and
{SLO} guarantees},
booktitle = {{SIGCOMM}},
pages = {250--263},
publisher = {{ACM}},
year = {2022}
}
@proceedings{DBLP:conf/sepln/2022iberlef,
editor = {Manuel Montes{-}y{-}G{\'{o}}mez and
Julio Gonzalo and
Francisco Rangel and
Marco Casavantes and
Miguel {\'{A}}ngel {\'{A}}lvare Carmona and
Gemma Bel{-}Enguix and
Hugo Jair Escalante and
Larissa A. de Freitas and
Antonio Miranda{-}Escalada and
Francisco J. Rodr{\'{\i}}guez{-}Sanchez and
Aiala Ros{\'{a}} and
Marco Antonio Sobrevilla Cabezudo and
Mariona Taul{\'{e}} and
Rafael Valencia{-}Garc{\'{\i}}a},
title = {Proceedings of the Iberian Languages Evaluation Forum (IberLEF 2022)
co-located with the Conference of the Spanish Society for Natural
Language Processing {(SEPLN} 2022), {A} Coru{\~{n}}a, Spain, September
20, 2022},
series = {{CEUR} Workshop Proceedings},
volume = {3202},
publisher = {CEUR-WS.org},
year = {2022}
}
@article{DBLP:journals/corr/abs-2201-06967,
author = {Manuel J. Gomez and
Mario Calder{\'{o}}n and
Victor S{\'{a}}nchez and
F{\'{e}}lix J. Garc{\'{\i}}a Clemente and
Jos{\'{e}} A. Ruip{\'{e}}rez{-}Valiente},
title = {Large Scale Analysis of Open {MOOC} Reviews to Support Learners' Course
Selection},
journal = {CoRR},
volume = {abs/2201.06967},
year = {2022}
}
@article{DBLP:journals/corr/abs-2211-08413,
author = {Enrique Tom{\'{a}}s Mart{\'{\i}}nez Beltr{\'{a}}n and
Mario Quiles P{\'{e}}rez and
Pedro Miguel S{\'{a}}nchez S{\'{a}}nchez and
Sergio L{\'{o}}pez Bernal and
G{\'{e}}r{\^{o}}me Bovet and
Manuel Gil P{\'{e}}rez and
Gregorio Mart{\'{\i}}nez P{\'{e}}rez and
Alberto Huertas Celdr{\'{a}}n},
title = {Decentralized Federated Learning: Fundamentals, State-of-the-art,
Frameworks, Trends, and Challenges},
journal = {CoRR},
volume = {abs/2211.08413},
year = {2022}
}
@article{DBLP:journals/access/MadrugaCP21,
author = {Mario Madruga and
Yolanda Campos{-}Roca and
C. J. P{\'{e}}rez},
title = {Multicondition Training for Noise-Robust Detection of Benign Vocal
Fold Lesions From Recorded Speech},
journal = {{IEEE} Access},
volume = {9},
pages = {1707--1722},
year = {2021}
}
@article{DBLP:journals/access/SanchezCOA21,
author = {Melissa S{\'{a}}nchez and
Jorge M. Cruz{-}Duarte and
Jos{\'{e}} Carlos Ortiz{-}Bayliss and
Iv{\'{a}}n Amaya},
title = {Sequence-Based Selection Hyper-Heuristic Model via MAP-Elites},
journal = {{IEEE} Access},
volume = {9},
pages = {116500--116527},
year = {2021}
}
@article{DBLP:journals/access/SanchezPANL21,
author = {H{\'{e}}ctor Corrales S{\'{a}}nchez and
Noelia Hern{\'{a}}ndez Parra and
Ignacio Parra Alonso and
Eduardo M. Nebot and
David Fern{\'{a}}ndez Llorca},
title = {Are We Ready for Accurate and Unbiased Fine-Grained Vehicle Classification
in Realistic Environments?},
journal = {{IEEE} Access},
volume = {9},
pages = {116338--116355},
year = {2021}
}
@article{DBLP:journals/artmed/NaranjoPCM21,
author = {Lizbeth Naranjo and
Carlos J. P{\'{e}}rez and
Yolanda Campos{-}Roca and
Mario Madruga},
title = {Replication-based regularization approaches to diagnose Reinke's edema
by using voice recordings},
journal = {Artif. Intell. Medicine},
volume = {120},
pages = {102162},
year = {2021}
}
@article{DBLP:journals/bdr/LealCCGGDSSKGXL21,
author = {F{\'{a}}tima Leal and
Adriana E. Chis and
Simon Caton and
Horacio Gonz{\'{a}}lez{-}V{\'{e}}lez and
Juan M. Garc{\'{\i}}a{-}G{\'{o}}mez and
Marta Dur{\'{a}} and
Angel S{\'{a}}nchez{-}Garc{\'{\i}}a and
Carlos S{\'{a}}ez and
Anthony Karageorgos and
Vassilis C. Gerogiannis and
Apostolos Xenakis and
Efthymios N. Lallas and
Theodoros Ntounas and
Eleni Vasileiou and
Georgios Mountzouris and
Barbara Otti and
Penelope Pucci and
Rossano Papini and
David Cerrai and
Mariola Mier},
title = {Smart Pharmaceutical Manufacturing: Ensuring End-to-End Traceability
and Data Integrity in Medicine Production},
journal = {Big Data Res.},
volume = {24},
pages = {100172},
year = {2021}
}
@article{DBLP:journals/ijgi/LuacesFFOBDL21,
author = {Miguel R. Luaces and
Jes{\'{u}}s A. Fisteus and
Luis S{\'{a}}nchez Fern{\'{a}}ndez and
Mario Mu{\~{n}}oz Organero and
Jes{\'{u}}s Balado and
Luc{\'{\i}}a D{\'{\i}}az{-}Vilari{\~{n}}o and
Henrique Lorenzo},
title = {Accessible Routes Integrating Data from Multiple Sources},
journal = {{ISPRS} Int. J. Geo Inf.},
volume = {10},
number = {1},
pages = {7},
year = {2021}
}
@article{DBLP:journals/ijon/GonzalezSDR21,
author = {Mario Gonz{\'{a}}lez and
{\'{A}}ngel S{\'{a}}nchez and
David Dominguez and
Francisco B. Rodr{\'{\i}}guez},
title = {Ensemble of diluted attractor networks with optimized topology for
fingerprint retrieval},
journal = {Neurocomputing},
volume = {442},
pages = {269--280},
year = {2021}
}
@article{DBLP:journals/ijris/DivanR21,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
title = {Strategies based on IoT for supporting the decision-making in agriculture:
a systematic literature mapping},
journal = {Int. J. Reason. based Intell. Syst.},
volume = {13},
number = {3},
pages = {155--171},
year = {2021}
}
@article{DBLP:journals/iotj/DivanRPM21,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso and
Juan Esteban Panebianco and
Mariano J. M{\'{e}}ndez},
title = {IoT-Based Approaches for Monitoring the Particulate Matter and Its
Impact on Health},
journal = {{IEEE} Internet Things J.},
volume = {8},
number = {15},
pages = {11983--12003},
year = {2021}
}
@article{DBLP:journals/isci/RiveraFGPS21,
author = {Gilberto Rivera and
Rogelio Florencia and
Mario Guerrero and
Ra{\'{u}}l Porras and
Julia Patricia S{\'{a}}nchez{-}Sol{\'{\i}}s},
title = {Online multi-criteria portfolio analysis through compromise programming
models built on the underlying principles of fuzzy outranking},
journal = {Inf. Sci.},
volume = {580},
pages = {734--755},
year = {2021}
}
@article{DBLP:journals/iwc/Bustos-LopezASP21,
author = {Maritza Bustos{-}L{\'{o}}pez and
Giner Alor{-}Hern{\'{a}}ndez and
Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
Mario Andr{\'{e}}s Paredes{-}Valverde and
Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate},
title = {EduRecomSys: An Educational Resource Recommender System Based on Collaborative
Filtering and Emotion Detection},
journal = {Interact. Comput.},
volume = {32},
number = {4},
pages = {407--432},
year = {2021}
}
@article{DBLP:journals/jei/SaldanhaSMA21,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Fast block partitioning scheme for chrominance intra prediction of
versatile video coding standard},
journal = {J. Electronic Imaging},
volume = {30},
number = {5},
year = {2021}
}
@article{DBLP:journals/jis/Sanchez-Cervantes21,
author = {Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
Giner Alor{-}Hern{\'{a}}ndez and
Mario Andr{\'{e}}s Paredes{-}Valverde and
Lisbeth Rodr{\'{\i}}guez{-}Mazahua and
Rafael Valencia{-}Garc{\'{\i}}a},
title = {NaLa-Search: {A} multimodal, interaction-based architecture for faceted
search on linked open data},
journal = {J. Inf. Sci.},
volume = {47},
number = {6},
year = {2021}
}
@article{DBLP:journals/jvcir/SaldanhaSMA21,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Performance analysis of {VVC} intra coding},
journal = {J. Vis. Commun. Image Represent.},
volume = {79},
pages = {103202},
year = {2021}
}
@article{DBLP:journals/kbs/DivanR21,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
title = {Metadata-based measurements transmission verified by a Merkle Tree},
journal = {Knowl. Based Syst.},
volume = {219},
pages = {106871},
year = {2021}
}
@article{DBLP:journals/paa/RodriguezOM21,
author = {Mario Rodr{\'{\i}}guez and
Carlos Orrite and
Carlos Medrano},
title = {Space-time flexible kernel for recognizing activities from wearable
cameras},
journal = {Pattern Anal. Appl.},
volume = {24},
number = {2},
pages = {843--852},
year = {2021}
}
@article{DBLP:journals/ploscb/Rubio-TevesDPSP21,
author = {Mario Rubio{-}Teves and
Sergio Diez{-}Hermano and
C{\'{e}}sar Porrero and
Abel Sanchez{-}Jimenez and
Luc{\'{\i}}a Prensa and
Francisco Clasc{\'{a}} and
Mar{\'{\i}}a Garc{\'{\i}}a{-}Amado and
Jos{\'{e}} Antonio Villacorta{-}Atienza},
title = {Benchmarking of tools for axon length measurement in individually-labeled
projection neurons},
journal = {PLoS Comput. Biol.},
volume = {17},
number = {12},
year = {2021}
}
@article{DBLP:journals/remotesensing/BusquierVLPSA21,
author = {Mario Busquier and
Rub{\'{e}}n Valcarce{-}Di{\~{n}}eiro and
Juan M. Lopez{-}Sanchez and
Javier Plaza and
Nilda S{\'{a}}nchez and
Benjam{\'{\i}}n Arias{-}P{\'{e}}rez},
title = {Fusion of Multi-Temporal {PAZ} and Sentinel-1 Data for Crop Classification},
journal = {Remote. Sens.},
volume = {13},
number = {19},
pages = {3915},
year = {2021}
}
@article{DBLP:journals/tkde/GatziouraVJS21,
author = {Anna Gatzioura and
Jo{\~{a}}o Vinagre and
Al{\'{\i}}pio M{\'{a}}rio Jorge and
Miquel S{\`{a}}nchez{-}Marr{\`{e}}},
title = {A Hybrid Recommender System for Improving Automatic Playlist Continuation},
journal = {{IEEE} Trans. Knowl. Data Eng.},
volume = {33},
number = {5},
pages = {1819--1830},
year = {2021}
}
@inproceedings{DBLP:conf/bmsd/NaranjoS21,
author = {David Naranjo and
Mario E. S{\'{a}}nchez},
title = {View and Viewpoint Reconstruction for Assisting the Preparation of
Participatory Modeling Sessions},
booktitle = {{BMSD}},
series = {Lecture Notes in Business Information Processing},
volume = {422},
pages = {306--316},
publisher = {Springer},
year = {2021}
}
@inproceedings{DBLP:conf/caip/TapiaGEJPCL21,
author = {Luis Sanchez Tapia and
Antonio Gomez and
Mario Esparza and
Venkatesh Jatla and
Marios Pattichis and
Sylvia Celed{\'{o}}n{-}Pattichis and
Carlos L{\'{o}}pez Leiva},
title = {Bilingual Speech Recognition by Estimating Speaker Geometry from Video
Data},
booktitle = {{CAIP} {(1)}},
series = {Lecture Notes in Computer Science},
volume = {13052},
pages = {79--89},
publisher = {Springer},
year = {2021}
}
@inproceedings{DBLP:conf/cbms/GonzalezRVHPPST21,
author = {Ruben Vasallo Gonz{\'{a}}lez and
Antonio Robles{-}G{\'{o}}mez and
Rafael Pastor Vargas and
Juan Mario Haut and
Nicol{\'{a}}s A. Passadore and
Mercedes Eugenia Paoletti and
Carlos Luis S{\'{a}}nchez{-}Bocanegra and
Llanos Tobarra and
Karla A. Chac{\'{o}}n{-}Vargas and
Roberto Hern{\'{a}}ndez Berlinches and
Francesc Saig{\'{\i}} Rubi{\'{o}}},
title = {A Recommendation System for Electronic Health Records in the Context
of the {HOPE} Project},
booktitle = {{CBMS}},
pages = {603--608},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/fie/IzuLMS21,
author = {Cruz Izu and
Violetta Lonati and
Anna Morpurgo and
Mario S{\'{a}}nchez},
title = {An Inventory of Goals from {CS1} Programs Processing a Data Series},
booktitle = {{FIE}},
pages = {1--8},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/icai2/MachadoSV21,
author = {Paola Lara Machado and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Enterprise Modeling: {A} Multi-perspective Tool-Supported Approach},
booktitle = {{ICAI}},
series = {Communications in Computer and Information Science},
volume = {1455},
pages = {465--480},
publisher = {Springer},
year = {2021}
}
@inproceedings{DBLP:conf/iceee/Lopez-TapiaSRAF21,
author = {Andrea L{\'{o}}pez{-}Tapia and
Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
Mario Alfredo Reyes{-}Barranca and
Griselda Stephany Abarca{-}Jimenez and
Luis Mart{\'{\i}}n Flores{-}Nava},
title = {Micromotors unit based on {CMOS-MEMS} technology integrated on a single
chip},
booktitle = {{CCE}},
pages = {1--6},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/iwann/GonzalezSDR21,
author = {Mario Gonz{\'{a}}lez and
{\'{A}}ngel S{\'{a}}nchez and
David Dominguez and
Francisco B. Rodr{\'{\i}}guez},
title = {Fine-Tuning of Patterns Assignment to Subnetworks Increases the Capacity
of an Attractor Network Ensemble},
booktitle = {{IWANN} {(2)}},
series = {Lecture Notes in Computer Science},
volume = {12862},
pages = {236--247},
publisher = {Springer},
year = {2021}
}
@inproceedings{DBLP:conf/micai/Suarez-RamirezD21,
author = {Cuauhtemoc Daniel Suarez{-}Ramirez and
Mario Alberto Duran{-}Vega and
H{\'{e}}ctor M. S{\'{a}}nchez C. and
Miguel Gonz{\'{a}}lez{-}Mendoza and
Leonardo Chang and
John M. Marshall},
title = {Deep Learning Architectures Applied to Mosquito Count Regressions
in {US} Datasets},
booktitle = {{MICAI} {(1)}},
series = {Lecture Notes in Computer Science},
volume = {13067},
pages = {199--212},
publisher = {Springer},
year = {2021}
}
@inproceedings{DBLP:conf/ondm/UrenaGSGNGG21,
author = {Mario Ure{\~{n}}a and
Rub{\'{e}}n Guillem and
Sabahat Shaheen and
Sergi Garc{\'{\i}}a and
Elham Nazemosadat and
Itandehui Gris{-}S{\'{a}}nchez and
Ivana Gasulla},
title = {Specialty fibers exploiting spatial multiplexing for signal processing
in radio access networks},
booktitle = {{ONDM}},
pages = {1--3},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/vcip/SaldanhaSMA21,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Analysis of {VVC} Intra Prediction Block Partitioning Structure},
booktitle = {{VCIP}},
pages = {1--5},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/vcip/SaldanhaSMA21a,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Learning-Based Complexity Reduction Scheme for {VVC} Intra-Frame Prediction},
booktitle = {{VCIP}},
pages = {1--5},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/worldcist/MoralesMTAM21,
author = {C. Santiago Morales and
Mario Raul Morales{-}Morales and
Glenda Toala S{\'{a}}nchez and
B. Alicia Andrade and
Milton Giovanny Moncayo},
title = {Business Decision Making Based on Social Media Analysis},
booktitle = {WorldCIST {(2)}},
series = {Advances in Intelligent Systems and Computing},
volume = {1366},
pages = {203--213},
publisher = {Springer},
year = {2021}
}
@article{DBLP:journals/corr/abs-2106-02009,
author = {Eric Sadit Tellez and
Sabino Miranda{-}Jim{\'{e}}nez and
Mario Graff and
Daniela Moctezuma and
Oscar S. Siordia and
Elio{-}Aten{\'{o}}genes Villase{\~{n}}or},
title = {A Case Study of Spanish Text Transformations for Twitter Sentiment
Analysis},
journal = {CoRR},
volume = {abs/2106.02009},
year = {2021}
}
@article{DBLP:journals/corr/abs-2112-13463,
author = {Luis Sanchez Tapia and
Antonio Gomez and
Mario Esparza and
Venkatesh Jatla and
Marios Pattichis and
Sylvia Celed{\'{o}}n{-}Pattichis and
Carlos LopezLeiva},
title = {Bilingual Speech Recognition by Estimating Speaker Geometry from Video
Data},
journal = {CoRR},
volume = {abs/2112.13463},
year = {2021}
}
@article{DBLP:journals/aada/DivanR20,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
title = {Optimizing Data Transmission from IoT Devices Through Weighted Online
Data Changing Detectors},
journal = {Adv. Data Sci. Adapt. Anal.},
volume = {12},
number = {2},
pages = {2041001:1--2041001:33},
year = {2020}
}
@article{DBLP:journals/access/Sanchez-AvilaMF20,
author = {Mario S{\'{a}}nchez{-}{\'{A}}vila and
Marcos Antonio Mouri{\~{n}}o{-}Garc{\'{\i}}a and
Jes{\'{u}}s A. Fisteus and
Luis S{\'{a}}nchez Fern{\'{a}}ndez},
title = {Detection of Barriers to Mobility in the Smart City Using Twitter},
journal = {{IEEE} Access},
volume = {8},
pages = {168429--168438},
year = {2020}
}
@article{DBLP:journals/access/SanchezCOCTA20,
author = {Melissa S{\'{a}}nchez and
Jorge M. Cruz{-}Duarte and
Jos{\'{e}} Carlos Ortiz{-}Bayliss and
Hector G. Ceballos and
Hugo Terashima{-}Mar{\'{\i}}n and
Iv{\'{a}}n Amaya},
title = {A Systematic Review of Hyper-Heuristics on Combinatorial Optimization
Problems},
journal = {{IEEE} Access},
volume = {8},
pages = {128068--128095},
year = {2020}
}
@article{DBLP:journals/caee/Jimenez-Ramirez20,
author = {Omar Jim{\'{e}}nez{-}Ram{\'{\i}}rez and
Jos{\'{e}} A. C{\'{a}}rdenas{-}Valderrama and
Alejandro A. Ordo{\~{n}}ez{-}S{\'{a}}nchez and
Mario Alan Quiroz{-}Ju{\'{a}}rez and
Rub{\'{e}}n V{\'{a}}zquez{-}Medina},
title = {Digital proportional-derivative controller implemented in low-resource
microcontrollers},
journal = {Comput. Appl. Eng. Educ.},
volume = {28},
number = {6},
pages = {1671--1682},
year = {2020}
}
@article{DBLP:journals/ci/Paredes-Valverde20,
author = {Mario Andr{\'{e}}s Paredes{-}Valverde and
Giner Alor{-}Hern{\'{a}}ndez and
Jorge Luis Garc{\'{\i}}a{-}Alcaraz and
Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and
Luis Omar Colombo{-}Mendoza and
Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes},
title = {IntelliHome: An internet of things-based system for electrical energy
saving in smart home environment},
journal = {Comput. Intell.},
volume = {36},
number = {1},
pages = {203--224},
year = {2020}
}
@article{DBLP:journals/cleiej/DivanR20,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
title = {A Real-Time Entity Monitoring based on States and Scenarios},
journal = {{CLEI} Electron. J.},
volume = {23},
number = {1},
year = {2020}
}
@article{DBLP:journals/computer/Gonzalez-Briceno20,
author = {Gaspar Gonz{\'{a}}lez{-}Brice{\~{n}}o and
Abraham S{\'{a}}nchez and
Susana Ortega{-}Cisneros and
Mario Salvador Garcia Contreras and
German Alonso Pinedo Diaz and
Eduardo Ulises Moya{-}S{\'{a}}nchez},
title = {Artificial Intelligence-Based Referral System for Patients With Diabetic
Retinopathy},
journal = {Computer},
volume = {53},
number = {10},
pages = {77--87},
year = {2020}
}
@article{DBLP:journals/cys/Sanchez-GalvezA20,
author = {Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Mario Anzures{-}Garc{\'{\i}}a and
{\'{A}}lvaro Campos Gregorio},
title = {Weighted Bidirectional Graph-based Academic Curricula Model to Support
the Tutorial Competence},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {24},
number = {2},
year = {2020}
}
@article{DBLP:journals/digearth/SoilanRFA20,
author = {Mario Soil{\'{a}}n and
Bel{\'{e}}n Riveiro and
Jes{\'{u}}s Balado and
Pedro Arias},
title = {Comparison of heuristic and deep learning-based methods for ground
classification from aerial point clouds},
journal = {Int. J. Digit. Earth},
volume = {13},
number = {10},
pages = {1115--1134},
year = {2020}
}
@article{DBLP:journals/ijgi/FernandezPGCCSD20,
author = {Tom{\'{a}}s Fern{\'{a}}ndez and
Jos{\'{e}} Luis P{\'{e}}rez{-}Garc{\'{\i}}a and
Jos{\'{e}} Miguel G{\'{o}}mez{-}L{\'{o}}pez and
Javier Cardenal and
Julio Calero and
Mario S{\'{a}}nchez{-}G{\'{o}}mez and
Jorge Delgado and
Joaqu{\'{\i}}n Tovar{-}Pescador},
title = {Multitemporal Analysis of Gully Erosion in Olive Groves by Means of
Digital Elevation Models Obtained with Aerial Photogrammetric and
LiDAR Data},
journal = {{ISPRS} Int. J. Geo Inf.},
volume = {9},
number = {4},
pages = {260},
year = {2020}
}
@article{DBLP:journals/jbi/NaveiraSCGGPCMC20,
author = {Miguel Ramos Naveira and
Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
Jes{\'{u}}s Barros Castro and
Lino Carrajo Garc{\'{\i}}a and
Guillermo V{\'{a}}zquez Gonz{\'{a}}lez and
Santiago P{\'{e}}rez and
Mario Pascual Carrasco and
Fernando Mart{\'{\i}}n{-}S{\'{a}}nchez and
Adolfo Mu{\~{n}}oz Carrero},
title = {An Archetype Query Language interpreter into MongoDB: Managing NoSQL
standardized Electronic Health Record extracts systems},
journal = {J. Biomed. Informatics},
volume = {101},
pages = {103339},
year = {2020}
}
@article{DBLP:journals/jifs/Anzures-GarciaS20,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez},
title = {{PROMISE:} PRoposing an Ontological Model for developing collaboratIve
SystEms},
journal = {J. Intell. Fuzzy Syst.},
volume = {39},
number = {2},
pages = {2545--2557},
year = {2020}
}
@article{DBLP:journals/jiii/LaraSV20,
author = {Paola Lara and
Mario S{\'{a}}nchez and
Jorge Villalobos},
title = {Enterprise modeling and operational technologies {(OT)} application
in the oil and gas industry},
journal = {J. Ind. Inf. Integr.},
volume = {19},
pages = {100160},
year = {2020}
}
@article{DBLP:journals/kais/Salas-ZarateASP20,
author = {Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and
Giner Alor{-}Hern{\'{a}}ndez and
Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
Mario Andr{\'{e}}s Paredes{-}Valverde and
Jorge Luis Garc{\'{\i}}a{-}Alcaraz and
Rafael Valencia{-}Garc{\'{\i}}a},
title = {Review of English literature on figurative language applied to social
networks},
journal = {Knowl. Inf. Syst.},
volume = {62},
number = {6},
pages = {2105--2137},
year = {2020}
}
@article{DBLP:journals/lgrs/BusquierLB20,
author = {Mario Busquier and
Juan M. Lopez{-}Sanchez and
Damian Bargiel},
title = {Added Value of Coherent Copolar Polarimetry at X-Band for Crop-Type
Mapping},
journal = {{IEEE} Geosci. Remote. Sens. Lett.},
volume = {17},
number = {5},
pages = {819--823},
year = {2020}
}
@article{DBLP:journals/nca/Alvarez-Arenald20,
author = {Angel {\'{A}}lvarez{-}Arenal and
H{\'{e}}ctor deLlanos{-}Lanchares and
Elena Mart{\'{\i}}n Fern{\'{a}}ndez and
Mario Mauvezin{-}Quevedo and
Mar{\'{\i}}a Luisa S{\'{a}}nchez Rodr{\'{\i}}guez and
Francisco Javier de Cos Juez},
title = {An artificial neural network model for the prediction of bruxism by
means of occlusal variables},
journal = {Neural Comput. Appl.},
volume = {32},
number = {5},
pages = {1259--1267},
year = {2020}
}
@article{DBLP:journals/rcs/Anzures-GarciaS20,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez},
title = {Enfoque sem{\'{a}}ntico de pol{\'{\i}}ticas para gestionar
la conciencia de grupo en Groupware},
journal = {Res. Comput. Sci.},
volume = {149},
number = {8},
pages = {1117--1132},
year = {2020}
}
@article{DBLP:journals/rcs/BricenoSMODCC20,
author = {Gaspar Gonz{\'{a}}lez{-}Brice{\~{n}}o and
Abraham S{\'{a}}nchez and
Eduardo Ulises Moya{-}S{\'{a}}nchez and
Susana Ortega{-}Cisneros and
German Alonso Pinedo Diaz and
Mario Salvador Garcia Contreras and
Beatriz Alvarado Castillo},
title = {Automatic Cropping of Retinal Fundus Photographs using Convolutional
Neural Networks},
journal = {Res. Comput. Sci.},
volume = {149},
number = {5},
pages = {161--167},
year = {2020}
}
@article{DBLP:journals/rcs/EnriquezGLSPRG20,
author = {Karen Andrea Guerrero Enr{\'{\i}}quez and
Octavio Jim{\'{e}}nez Gonz{\'{a}}lez and
Roberto Pacheco L{\'{o}}pez and
Javier Medrano S{\'{a}}nchez and
Mario Murguia Perez and
Ang{\'{e}}lica Hern{\'{a}}ndez Rayas and
Martha Alicia Hern{\'{a}}ndez Gonz{\'{a}}lez},
title = {An{\'{a}}lisis y caracterizaci{\'{o}}n de espectros Raman
de tejido neopl{\'{a}}sico e hiperpl{\'{a}}sico de pr{\'{o}}stata},
journal = {Res. Comput. Sci.},
volume = {149},
number = {2},
pages = {87--94},
year = {2020}
}
@article{DBLP:journals/rcs/EstrellaTM20,
author = {Guillermo Fern{\'{a}}ndez Estrella and
Joel Antonio Trejo{-}S{\'{a}}nchez and
Mario Ren{\'{a}}n Moreno{-}Sabido},
title = {Sistema multi-agente para el control de tr{\'{a}}fico urbano
para veh{\'{\i}}culos de prioridad},
journal = {Res. Comput. Sci.},
volume = {149},
number = {8},
pages = {713--723},
year = {2020}
}
@article{DBLP:journals/remotesensing/BusquierLMNGM20,
author = {Mario Busquier and
Juan M. Lopez{-}Sanchez and
Alejandro Mestre{-}Quereda and
Elena Navarro and
Maria P. Gonz{\'{a}}lez{-}Dugo and
Luciano Mateos},
title = {Exploring TanDEM-X Interferometric Products for Crop-Type Mapping},
journal = {Remote. Sens.},
volume = {12},
number = {11},
pages = {1774},
year = {2020}
}
@article{DBLP:journals/remotesensing/SoilanJSR20,
author = {Mario Soil{\'{a}}n and
Andr{\'{e}}s Justo and
Ana S{\'{a}}nchez{-}Rodr{\'{\i}}guez and
Bel{\'{e}}n Riveiro},
title = {3D Point Cloud to {BIM:} Semi-Automated Framework to Define {IFC}
Alignment Entities from MLS-Acquired LiDAR Data of Highway Roads},
journal = {Remote. Sens.},
volume = {12},
number = {14},
pages = {2301},
year = {2020}
}
@article{DBLP:journals/ress/LozanoZS20,
author = {Jorge{-}Mario Lozano and
Santiago Zuluaga and
Mauricio S{\'{a}}nchez{-}Silva},
title = {Developing flexible management strategies in infrastructure: The sequential
expansion problem for infrastructure analysis {(SEPIA)}},
journal = {Reliab. Eng. Syst. Saf.},
volume = {200},
pages = {106951},
year = {2020}
}
@article{DBLP:journals/sensors/Guerra-SerranoS20,
author = {Juan Guerra{-}Serrano and
Angel S{\'{a}}nchez{-}Roca and
Guillermo Gonz{\'{a}}lez{-}Yero and
Mario C. S{\'{a}}nchez{-}Orozco and
Mercedes P{\'{e}}rez de la Parte and
Emilio Jim{\'{e}}nez Mac{\'{\i}}as and
Julio Blanco{-}Fern{\'{a}}ndez},
title = {New Arc Stability Index for Industrial {AC} Three-Phase Electric Arc
Furnaces Based on Acoustic Signals},
journal = {Sensors},
volume = {20},
number = {23},
pages = {6840},
year = {2020}
}
@article{DBLP:journals/sensors/SanchezTSGMRPHM20,
author = {Jos{\'{e}} Rafael Garc{\'{\i}}a S{\'{a}}nchez and
Salvador Tavera{-}Mosqueda and
Ram{\'{o}}n Silva{-}Ortigoza and
V{\'{\i}}ctor Manuel Hern{\'{a}}ndez Guzm{\'{a}}n and
Magdalena Marciano{-}Melchor and
Jos{\'{e}} de Jes{\'{u}}s Rubio and
Mario Ponce{-}Silva and
Miguel Hern{\'{a}}ndez{-}Bola{\~{n}}os and
Jes{\'{u}}s Mart{\'{\i}}nez{-}Mart{\'{\i}}nez},
title = {A Novel Dynamic Three-Level Tracking Controller for Mobile Robots
Considering Actuators and Power Stage Subsystems: Experimental Assessment},
journal = {Sensors},
volume = {20},
number = {17},
pages = {4959},
year = {2020}
}
@article{DBLP:journals/tcas/SaldanhaSMA20,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Tile Adaptation for Workload Balancing of 3D-HEVC Encoder in Homogeneous
Multicore Systems},
journal = {{IEEE} Trans. Circuits Syst. {I} Fundam. Theory Appl.},
volume = {67-I},
number = {5},
pages = {1704--1714},
year = {2020}
}
@article{DBLP:journals/tcas/SanchezSFCAM20,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Ramon Fernandes and
Rodrigo Cataldo and
Luciano Agostini and
C{\'{e}}sar A. M. Marcon},
title = {3D-HEVC Bipartition Modes Encoder and Decoder Design Targeting High-Resolution
Videos},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {67-I},
number = {2},
pages = {415--427},
year = {2020}
}
@article{DBLP:journals/tce/SanchezSO20,
author = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and
Daniel D{\'{\i}}az S{\'{a}}nchez and
Mario Mu{\~{n}}oz Organero},
title = {Specification and Unattended Deployment of Home Networks at the Edge
of the Network},
journal = {{IEEE} Trans. Consumer Electron.},
volume = {66},
number = {4},
pages = {279--288},
year = {2020}
}
@article{DBLP:journals/tcsv/SaldanhaSMA20,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Fast 3D-HEVC Depth Map Encoding Using Machine Learning},
journal = {{IEEE} Trans. Circuits Syst. Video Technol.},
volume = {30},
number = {3},
pages = {850--861},
year = {2020}
}
@article{DBLP:journals/tii/SantAnaHSSAN20,
author = {Jean Michel de Souza Sant'Ana and
Arliones Hoeller and
Richard Demo Souza and
Samuel Montejo Sanchez and
Hirley Alves and
Mario de Noronha{-}Neto},
title = {Hybrid Coded Replication in LoRa Networks},
journal = {{IEEE} Trans. Ind. Informatics},
volume = {16},
number = {8},
pages = {5577--5585},
year = {2020}
}
@inproceedings{DBLP:conf/ahfe/Sanchez-MatuteZ20,
author = {Mario Raul Sanchez{-}Matute and
Carolina Zayas{-}M{\'{a}}rquez and
Mar{\'{\i}}a Marcela Sol{\'{\i}}s{-}Quinteros and
Luis Alfredo {\'{A}}vila{-}L{\'{o}}pez},
title = {Improvement of Efficiency in the Productivity of an Aerospace, Maritime
and Military Company in Tijuana, Baja California; Mexico},
booktitle = {{AHFE} {(15)}},
series = {Advances in Intelligent Systems and Computing},
volume = {1215},
pages = {421--436},
publisher = {Springer},
year = {2020}
}
@inproceedings{DBLP:conf/cec/SanchezOACCT20,
author = {Xavier S{\'{a}}nchez and
Jos{\'{e}} Carlos Ortiz{-}Bayliss and
Iv{\'{a}}n Amaya and
Jorge M. Cruz{-}Duarte and
Santiago Enrique Conant{-}Pablos and
Hugo Terashima{-}Mar{\'{\i}}n},
title = {A Preliminary Study on Feature-independent Hyper-heuristics for the
0/1 Knapsack Problem},
booktitle = {{CEC}},
pages = {1--8},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/cosecivi/RomeroSSMP20,
author = {Diego Romero and
Mario S{\'{a}}nchez and
Jos{\'{e}} M. Sierra and
Maximiliano Miranda and
Federico Peinado},
title = {Developing an automated planning tool for non-player character behavior},
booktitle = {CoSECivi},
series = {{CEUR} Workshop Proceedings},
volume = {2719},
pages = {69--77},
publisher = {CEUR-WS.org},
year = {2020}
}
@inproceedings{DBLP:conf/icassp/MadrugaCP20,
author = {Mario Madruga and
Yolanda Campos{-}Roca and
Carlos J. P{\'{e}}rez},
title = {Robustness Assessment of Automatic Reinke's Edema Diagnosis Systems},
booktitle = {{ICASSP}},
pages = {891--895},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/icecsys/MouraSSMPA20,
author = {Christopher Moura and
M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Marcelo Schiavon Porto and
Luciano Agostini},
title = {Fast Intra Mode Decision for 3D-HEVC Depth Map Coding using Decision
Trees},
booktitle = {{ICECS}},
pages = {1--4},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/iceee/Lopez-TapiaRASF20,
author = {Andrea L{\'{o}}pez{-}Tapia and
Mario Alfredo Reyes{-}Barranca and
Griselda Stephany Abarca{-}Jimenez and
Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
Luis Mart{\'{\i}}n Flores{-}Nava},
title = {Design of position sensor of a linear micromotor based on {CMOS-MEMS}
technology},
booktitle = {{CCE}},
pages = {1--6},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/iceee/MenesesMSM20,
author = {Maricela Meneses and
Mario Moreno and
Alfredo Morales{-}S{\'{a}}nchez and
J. C{\'{e}}sar Mendoza},
title = {Effect of the thermal treatments on the emission of a-Si1-xCx: {H}
films},
booktitle = {{CCE}},
pages = {1--5},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/iceee/Sanchez-Marquez20,
author = {Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
Mario Alfredo Reyes{-}Barranca and
Griselda Stephany Abarca{-}Jimenez and
Andrea L{\'{o}}pez{-}Tapia and
Luis Mart{\'{\i}}n Flores{-}Nava},
title = {Proposal for a rotary micromotor structure based on {CMOS-MEMS} technology},
booktitle = {{CCE}},
pages = {1--6},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/icict2/Barcelo-Valenzuela20,
author = {Mario Barcelo{-}Valenzuela and
Carlos Maximiliano Leal{-}Pompa and
Gerardo Sanchez{-}Schmitz},
title = {An {IT} Service Management Methodology for an Electoral Public Institution},
booktitle = {{ICICT}},
pages = {219--223},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/icip/SaldanhaSMA20,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Complexity Analysis Of {VVC} Intra Coding},
booktitle = {{ICIP}},
pages = {3119--3123},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/iscas/SaldanhaSMA20,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {Fast Partitioning Decision Scheme for Versatile Video Coding Intra-Frame
Prediction},
booktitle = {{ISCAS}},
pages = {1--5},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/iticse/SanchezS20,
author = {Mario S{\'{a}}nchez and
Pedro Salazar},
title = {A feedback-oriented platform for deliberate programming practice},
booktitle = {ITiCSE},
pages = {531--532},
publisher = {{ACM}},
year = {2020}
}
@inproceedings{DBLP:conf/micai/Lara-CardenasSA20,
author = {Erick Lara{-}C{\'{a}}rdenas and
Xavier S{\'{a}}nchez{-}D{\'{\i}}az and
Iv{\'{a}}n Amaya and
Jorge M. Cruz{-}Duarte and
Jos{\'{e}} Carlos Ortiz{-}Bayliss},
title = {A Genetic Programming Framework for Heuristic Generation for the Job-Shop
Scheduling Problem},
booktitle = {{MICAI} {(1)}},
series = {Lecture Notes in Computer Science},
volume = {12468},
pages = {284--295},
publisher = {Springer},
year = {2020}
}
@inproceedings{DBLP:conf/ssci/Silva-GalvezOLO20,
author = {Arturo Silva{-}G{\'{a}}lvez and
Jorge Orozco{-}Sanchez and
Erick Lara{-}C{\'{a}}rdenas and
Jos{\'{e}} Carlos Ortiz{-}Bayliss and
Iv{\'{a}}n Amaya and
Jorge M. Cruz{-}Duarte and
Hugo Terashima{-}Mar{\'{\i}}n},
title = {Discovering Action Regions for Solving the Bin Packing Problem through
Hyper-heuristics},
booktitle = {{SSCI}},
pages = {822--828},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/ssiai/TapiaPCL20,
author = {Luis Sanchez Tapia and
Marios S. Pattichis and
Sylvia Celed{\'{o}}n{-}Pattichis and
Carlos L{\'{o}}pez Leiva},
title = {The Importance of the Instantaneous Phase for Face Detection using
Simple Convolutional Neural Networks},
booktitle = {{SSIAI}},
pages = {1--4},
publisher = {{IEEE}},
year = {2020}
}
@article{DBLP:journals/corr/abs-2001-08168,
author = {Jean Michel de Souza Sant'Ana and
Arliones Hoeller and
Richard Demo Souza and
Samuel Montejo S{\'{a}}nchez and
Hirley Alves and
Mario de Noronha{-}Neto},
title = {Hybrid Coded Replication in LoRa Networks},
journal = {CoRR},
volume = {abs/2001.08168},
year = {2020}
}
@article{DBLP:journals/access/Perez-MedinaGPV19,
author = {Jorge Luis P{\'{e}}rez{-}Medina and
Mario Gonz{\'{a}}lez and
Hennry Mauricio Pilco and
Karina Beatriz Jimenes Vargas and
Patricia Acosta{-}Vargas and
Sandra Sanchez{-}Gordon and
Tania Calle{-}Jimenez and
Danilo Esparza and
Yves Rybarczyk},
title = {Usability Study of a Web-Based Platform for Home Motor Rehabilitation},
journal = {{IEEE} Access},
volume = {7},
pages = {7932--7947},
year = {2019}
}
@article{DBLP:journals/access/Sanchez-Martinez19,
author = {Juan Jose Sanchez{-}Martinez and
Mario Perez{-}Escribano and
Enrique Marquez{-}Segura},
title = {Synthesis of Dual-Band Bandpass Filters With Short-Circuited Multiconductor
Transmission Lines and Shunt Open Stubs},
journal = {{IEEE} Access},
volume = {7},
pages = {24071--24081},
year = {2019}
}
@article{DBLP:journals/ascom/SanchezDLBCGQAC19,
author = {Bruno S{\'{a}}nchez and
Mariano Dom{\'{\i}}nguez and
Marcelo Lares and
Martin Beroiz and
Juan B. Cabral and
Sebasti{\'{a}}n Gurovich and
Cecilia Qui{\~{n}}ones and
Rodolfo A. Artola and
Carlos A. Colazo and
Mat{\'{\i}}as E. Schneiter and
Carla Girardini and
Marina Tornatore and
Jos Luis Nilo Castell{\'{o}}n and
Diego Garc{\'{\i}}a Lambas and
Mario C. D{\'{\i}}az},
title = {Machine learning on difference image analysis: {A} comparison of methods
for transient detection},
journal = {Astron. Comput.},
volume = {28},
pages = {100284},
year = {2019}
}
@article{DBLP:journals/bise/LaraSV19,
author = {Paola Lara and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {{OT} Modeling: The Enterprise Beyond {IT}},
journal = {Bus. Inf. Syst. Eng.},
volume = {61},
number = {4},
pages = {399--411},
year = {2019}
}
@article{DBLP:journals/jcisd/Perez-CastilloS19,
author = {Yunierkis P{\'{e}}rez{-}Castillo and
Stellamaris Sotomayor{-}Burneo and
Karina Beatriz Jimenes Vargas and
Mario Salvador Gonz{\'{a}}lez{-}Rodr{\'{\i}}guez and
Maykel Cruz{-}Monteagudo and
Vinicio Armijos{-}Jaramillo and
M. Nat{\'{a}}lia Dias Soeiro Cordeiro and
Fernanda Borges and
Aminael S{\'{a}}nchez{-}Rodr{\'{\i}}guez and
Eduardo Tejera},
title = {CompScore: Boosting Structure-Based Virtual Screening Performance
by Incorporating Docking Scoring Function Components into Consensus
Scoring},
journal = {J. Chem. Inf. Model.},
volume = {59},
number = {9},
pages = {3655--3666},
year = {2019}
}
@article{DBLP:journals/jd/MuhlbergerSTOBB19,
author = {G{\"{u}}nter M{\"{u}}hlberger and
Louise Seaward and
Melissa Terras and
Sofia Ares Oliveira and
Vicente Bosch and
Maximilian Bryan and
Sebastian Colutto and
Herv{\'{e}} D{\'{e}}jean and
Markus Diem and
Stefan Fiel and
Basilis Gatos and
Albert Greinoecker and
Tobias Gr{\"{u}}ning and
G{\"{u}}nter Hackl and
Vili Haukkovaara and
Gerhard Heyer and
Lauri Hirvonen and
Tobias Hodel and
Matti Jokinen and
Philip Kahle and
Mario Kallio and
Fr{\'{e}}d{\'{e}}ric Kaplan and
Florian Kleber and
Roger Labahn and
Eva Maria Lang and
S{\"{o}}ren Laube and
Gundram Leifert and
Georgios Louloudis and
Rory McNicholl and
Jean{-}Luc Meunier and
Johannes Michael and
Elena M{\"{u}}hlbauer and
Nathanael Philipp and
Ioannis Pratikakis and
Joan Puigcerver P{\'{e}}rez and
Hannelore Putz and
George Retsinas and
Ver{\'{o}}nica Romero and
Robert Sablatnig and
Joan{-}Andreu S{\'{a}}nchez and
Philip Schofield and
Giorgos Sfikas and
Christian Sieber and
Nikolaos Stamatopoulos and
Tobias Strau{\ss} and
Tamara Terbul and
Alejandro H. Toselli and
Berthold Ulreich and
Mauricio Villegas and
Enrique Vidal and
Johanna Walcher and
Max Weidemann and
Herbert Wurster and
Konstantinos Zagoris},
title = {Transforming scholarship in the archives through handwritten text
recognition},
journal = {J. Documentation},
volume = {75},
number = {5},
pages = {954--976},
year = {2019}
}
@article{DBLP:journals/jocs/PrimsCAMLSCD19,
author = {Oriol Tint{\'{o}} Prims and
Miguel Castrillo and
Mario C. Acosta and
Oriol Mula{-}Valls and
Alicia Sanchez Lorente and
Kim Serradell and
Ana Cort{\'{e}}s and
Francisco J. Doblas{-}Reyes},
title = {Finding, analysing and solving {MPI} communication bottlenecks in
Earth System models},
journal = {J. Comput. Sci.},
volume = {36},
year = {2019}
}
@article{DBLP:journals/neuroimage/PremiCDGCAAPGSG19,
author = {Enrico Premi and
Vince D. Calhoun and
Matteo Diano and
Stefano Gazzina and
Maura Cosseddu and
Antonella Alberici and
Silvana Archetti and
Donata Paternic{\`{o}} and
Roberto Gasparotti and
John van Swieten and
Daniela Galimberti and
Raquel S{\'{a}}nchez{-}Valle and
Robert Laforce Jr. and
Fermin Moreno and
Matthis Synofzik and
Caroline Graff and
Mario Masellis and
Maria Carmela Tartaglia and
Miren Zulaica},
title = {The inner fluctuations of the brain in presymptomatic Frontotemporal
Dementia: The chronnectome fingerprint},
journal = {NeuroImage},
volume = {189},
pages = {645--654},
year = {2019}
}
@article{DBLP:journals/pdln/AraujoMDLSCC19,
author = {Lourdes Araujo and
Juan Mart{\'{\i}}nez{-}Romo and
Andr{\'{e}}s Duque and
Fernando L{\'{o}}pez{-}Ostenero and
Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
Adolfo Mu{\~{n}}oz Carrero and
Mario Pascual Carrasco},
title = {{EXTRAE:} EXTRacci{\'{o}}n de Asociaciones entre Enfermedades
y otros conceptos m{\'{e}}dicos},
journal = {Proces. del Leng. Natural},
volume = {63},
pages = {171--174},
year = {2019}
}
@article{DBLP:journals/ploscb/BendallMILPOJMR19,
author = {Matthew L. Bendall and
Miguel de Mulder and
Luis Pedro I{\~{n}}iguez and
Aar{\'{o}}n Lecanda{-}S{\'{a}}nchez and
Marcos P{\'{e}}rez{-}Losada and
Mario A. Ostrowski and
R. Brad Jones and
Lubbertus C. F. Mulder and
Gustavo Reyes{-}Ter{\'{a}}n and
Keith A. Crandall and
Christopher E. Ormsby and
Douglas F. Nixon},
title = {Telescope: Characterization of the retrotranscriptome by accurate
estimation of transposable element expression},
journal = {PLoS Comput. Biol.},
volume = {15},
number = {9},
year = {2019}
}
@article{DBLP:journals/rcs/SernaLALG19,
author = {Mario Serna and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Mart{\'{\i}}n Estrada Analco and
Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Elberfeld E. P{\'{e}}rez G.},
title = {Navegaci{\'{o}}n de robots m{\'{o}}viles utilizando algoritmos
Bugs extendidos},
journal = {Res. Comput. Sci.},
volume = {148},
number = {8},
pages = {159--171},
year = {2019}
}
@article{DBLP:journals/remotesensing/Mate-GonzalezSB19,
author = {Miguel {\'{A}}ngel Mat{\'{e}}{-}Gonz{\'{a}}lez and
Luis Javier S{\'{a}}nchez{-}Aparicio and
Cristina S{\'{a}}ez Bl{\'{a}}zquez and
Pedro Carrasco Garc{\'{\i}}a and
David {\'{A}}lvarez{-}Alonso and
Mar{\'{\i}}a de Andr{\'{e}}s{-}Herrero and
Juan Carlos Garc{\'{\i}}a{-}Davalillo and
Diego Gonz{\'{a}}lez{-}Aguilera and
Mario Hern{\'{a}}ndez Ruiz and
Luis Jord{\'{a}} Bordehore and
Carlos L{\'{o}}pez Carnicero and
Roc{\'{\i}}o Mora},
title = {On the Combination of Remote Sensing and Geophysical Methods for the
Digitalization of the San L{\'{a}}zaro Middle Paleolithic Rock
Shelter (Segovia, Central Iberia, Spain)},
journal = {Remote. Sens.},
volume = {11},
number = {17},
pages = {2035},
year = {2019}
}
@article{DBLP:journals/remotesensing/QSS19,
author = {J. Antonio Guzm{\'{a}}n Q. and
G. Arturo Sanchez{-}Azofeifa and
Mario Marcos do Espirito Santo},
title = {{MODIS} and {PROBA-V} {NDVI} Products Differ when Compared with Observations
from Phenological Towers at Four Tropical Dry Forests in the Americas},
journal = {Remote. Sens.},
volume = {11},
number = {19},
pages = {2316},
year = {2019}
}
@article{DBLP:journals/remotesensing/Sanchez-Rodriguez19,
author = {Ana S{\'{a}}nchez{-}Rodr{\'{\i}}guez and
Mario Soil{\'{a}}n and
Manuel Cabaleiro and
Pedro Arias},
title = {Automated Inspection of Railway Tunnels' Power Line Using LiDAR Point
Clouds},
journal = {Remote. Sens.},
volume = {11},
number = {21},
pages = {2567},
year = {2019}
}
@article{DBLP:journals/remotesensing/TomasPNCPRCCBML19,
author = {Roberto Tom{\'{a}}s and
Jos{\'{e}} Ignacio Pag{\'{a}}n and
Jos{\'{e}} A. Navarro and
Miguel Cano and
Jos{\'{e}} Luis Pastor and
Adri{\'{a}}n J. Riquelme and
Mar{\'{\i}}a Cuevas{-}Gonz{\'{a}}lez and
Michele Crosetto and
Anna Barra and
Oriol Monserrat and
Juan M. Lopez{-}Sanchez and
Alfredo Ram{\'{o}}n and
Salvador Ivorra and
Matteo Del Soldato and
Lorenzo Solari and
Silvia Bianchini and
Federico Raspini and
Fabrizio Novali and
Alessandro Ferretti and
Mario Costantini and
Francesco Trillo and
Gerardo Herrera and
Nicola Casagli},
title = {Semi-Automatic Identification and Pre-Screening of Geological-Geotechnical
Deformational Processes Using Persistent Scatterer Interferometry
Datasets},
journal = {Remote. Sens.},
volume = {11},
number = {14},
pages = {1675},
year = {2019}
}
@article{DBLP:journals/sivp/SanchezSAM19,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Luciano Agostini and
C{\'{e}}sar A. M. Marcon},
title = {Analysis of parallel encoding using tiles in 3D High Efficiency Video
Coding},
journal = {Signal Image Video Process.},
volume = {13},
number = {6},
pages = {1079--1086},
year = {2019}
}
@article{DBLP:journals/soco/PenaBLTPSMGC19,
author = {Alejandro Pe{\~{n}}a and
Isis Bonet and
Christian Lochmuller and
Marta S. Tabares and
Carlos C. Piedrahita and
Carmen C. S{\'{a}}nchez and
Lillyana Mar{\'{\i}}a Giraldo Mar{\'{\i}}n and
Mario Gongora and
Francisco Chiclana},
title = {A fuzzy {ELECTRE} structure methodology to assess big data maturity
in healthcare SMEs},
journal = {Soft Comput.},
volume = {23},
number = {20},
pages = {10537--10550},
year = {2019}
}
@article{DBLP:journals/tim/WuMS19,
author = {Chenchen Wu and
Mario E. Maga{\~{n}}a and
Eduardo Cotilla Sanchez},
title = {Dynamic Frequency and Amplitude Estimation for Three-Phase Unbalanced
Power Systems Using the Unscented Kalman Filter},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {68},
number = {9},
pages = {3387--3395},
year = {2019}
}
@inproceedings{DBLP:conf/caise/LaraSHVV19,
author = {Paola Lara and
Mario E. S{\'{a}}nchez and
Andrea Herrera and
Karol Valdivieso and
Jorge Villalobos},
title = {Modeling Reverse Logistics Networks: {A} Case Study for {\unicode{8232}}E-Waste
Management Policy},
booktitle = {CAiSE Forum},
series = {Lecture Notes in Business Information Processing},
volume = {350},
pages = {158--169},
publisher = {Springer},
year = {2019}
}
@inproceedings{DBLP:conf/cisis-spain/SanchezMDE19,
author = {Mar{\'{\i}}a Jes{\'{u}}s Santos S{\'{a}}nchez and
Mario Miguel and
Araceli Queiruga Dios and
Ascensi{\'{o}}n Hern{\'{a}}ndez Encinas},
title = {Looking for the Antidote for Contaminated Water: Learning Through
an Escape Game},
booktitle = {{CISIS-ICEUTE}},
series = {Advances in Intelligent Systems and Computing},
volume = {951},
pages = {217--226},
publisher = {Springer},
year = {2019}
}
@inproceedings{DBLP:conf/citi/Machorro-CanoPA19,
author = {Isaac Machorro{-}Cano and
Mario Andr{\'{e}}s Paredes{-}Valverde and
Giner Alor{-}Hern{\'{a}}ndez and
Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and
M{\'{o}}nica Guadalupe Segura Ozuna and
Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes},
title = {PESSHIoT: Smart Platform for Monitoring and Controlling Smart Home
Devices and Sensors},
booktitle = {{CITI}},
series = {Communications in Computer and Information Science},
volume = {1124},
pages = {137--150},
publisher = {Springer},
year = {2019}
}
@inproceedings{DBLP:conf/clei/DivanR19,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
title = {Incorporating Scenarios and States Definitions on Real-Time Entity
Monitoring in PAbMM},
booktitle = {{CLEI}},
pages = {1--10},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/conielecomp/Ordonez-Sanchez19,
author = {Alejandro A. Ordo{\~{n}}ez{-}S{\'{a}}nchez and
Omar Jim{\'{e}}nez{-}Ram{\'{\i}}rez and
Jos{\'{e}} A. C{\'{a}}rdenas{-}Valderrama and
Mario Alan Quiroz{-}Ju{\'{a}}rez and
Leonardo Palacios{-}Luengas and
Rub{\'{e}}n V{\'{a}}zquez{-}Medina},
title = {Generator of Synthetic Dopaminergic Signals},
booktitle = {{CONIELECOMP}},
pages = {31--35},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/hci-collab/LopezGAMCS19,
author = {Mario Rossainz L{\'{o}}pez and
Carmen Cer{\'{o}}n Garnica and
Etelvina Archundia{-}Sierra and
Ana Patricia Cervantes M{\'{a}}rquez and
David Carrasco{-}Lim{\'{o}}n and
B{\'{a}}rbara S{\'{a}}nchez{-}Rinza},
title = {Parallel Simulation of Digital Logic Circuits Using Message Passing
via {CSP} as an Educational Tool},
booktitle = {{HCI-COLLAB}},
series = {Communications in Computer and Information Science},
volume = {1114},
pages = {284--298},
publisher = {Springer},
year = {2019}
}
@inproceedings{DBLP:conf/hci-collab/Sanchez-GalvezL19,
author = {Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Juan Manuel Fern{\'{a}}ndez Luna and
Mario Anzures{-}Garc{\'{\i}}a},
title = {A Groupware Usability-Oriented Evaluation Methodology Based on a Fuzzy
Linguistic Approach},
booktitle = {{HCI-COLLAB}},
series = {Communications in Computer and Information Science},
volume = {1114},
pages = {1--16},
publisher = {Springer},
year = {2019}
}
@inproceedings{DBLP:conf/iceee/Lopez-TapiaRASF19,
author = {Andrea L{\'{o}}pez{-}Tapia and
Mario Alfredo Reyes{-}Barranca and
Griselda Stephany Abarca{-}Jimenez and
Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
Luis Mart{\'{\i}}n Flores{-}Nava and
Oliverio Arellano{-}C{\'{a}}rdenas},
title = {Design and analysis of the mechanical structure of a linear micromotor
based on {CMOS-MEMS} technology},
booktitle = {{CCE}},
pages = {1--6},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/iceee/Sanchez-Marquez19,
author = {Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
Mario Alfredo Reyes{-}Barranca and
Griselda Stephany Abarca{-}Jimenez and
Andrea L{\'{o}}pez{-}Tapia and
Luis Mart{\'{\i}}n Flores{-}Nava and
Oliverio Arellano{-}C{\'{a}}rdenas},
title = {Proposal of a speed sensor based on {FGMOS} for a {MEMS} rotatory
micromotor},
booktitle = {{CCE}},
pages = {1--6},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/igarss/BernabeGFPHPP19,
author = {Sergio Bernab{\'{e}} and
Carlos Garc{\'{\i}}a and
Rub{\'{e}}n Fern{\'{a}}ndez{-}Beltran and
Mercedes Eugenia Paoletti and
Juan Mario Haut and
Javier Plaza and
Antonio Plaza},
title = {Open Multi-Processing Acceleration for Unsupervised Land Cover Categorization
Using Probabilistic Latent Semantic Analysis},
booktitle = {{IGARSS}},
pages = {9835--9838},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/iscas/SaldanhaSZMA19,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
Bruno Zatt and
C{\'{e}}sar A. M. Marcon and
Luciano Agostini},
title = {{TITAN:} Tile Timing-Aware Balancing Algorithm for Speeding Up the
3D-HEVC Intra Coding},
booktitle = {{ISCAS}},
pages = {1--5},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/iwann/DavilaGPDSR19,
author = {Carlos D{\'{a}}vila and
Mario Gonz{\'{a}}lez and
Jorge Luis P{\'{e}}rez{-}Medina and
David Dominguez and
{\'{A}}ngel S{\'{a}}nchez and
Francisco B. Rodr{\'{\i}}guez},
title = {Ensemble of Attractor Networks for 2D Gesture Retrieval},
booktitle = {{IWANN} {(2)}},
series = {Lecture Notes in Computer Science},
volume = {11507},
pages = {488--499},
publisher = {Springer},
year = {2019}
}
@inproceedings{DBLP:conf/iwann/GonzalezDDSR19,
author = {Mario Gonz{\'{a}}lez and
Carlos D{\'{a}}vila and
David Dominguez and
{\'{A}}ngel S{\'{a}}nchez and
Francisco B. Rodr{\'{\i}}guez},
title = {Fingerprint Retrieval Using a Specialized Ensemble of Attractor Networks},
booktitle = {{IWANN} {(2)}},
series = {Lecture Notes in Computer Science},
volume = {11507},
pages = {709--719},
publisher = {Springer},
year = {2019}
}
@inproceedings{DBLP:conf/iwann/Nimo-JarquezRRY19,
author = {Dami{\'{a}}n Nimo{-}J{\'{a}}rquez and
Magaly Margarita Narvaez{-}Rios and
Mario Rivas{-}S{\'{a}}nchez and
Andr{\'{e}}s Y{\'{a}}{\~{n}}ez and
Guillermo B{\'{a}}rcena{-}Gonz{\'{a}}lez and
Maria De La Paz Guerrero{-}Lebrero and
Elisa Guerrero and
Pedro L. Galindo},
title = {{AL4LA:} Active Learning for Text Labeling Based on Paragraph Vectors},
booktitle = {{IWANN} {(1)}},
series = {Lecture Notes in Computer Science},
volume = {11506},
pages = {679--687},
publisher = {Springer},
year = {2019}
}
@incollection{DBLP:books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19,
author = {Ziawasch Abedjan and
Nozha Boujemaa and
Stuart Campbell and
Patricia Casla and
Supriyo Chatterjea and
Sergio Consoli and
Crist{\'{o}}bal Costa Soria and
Paul Czech and
Marija Despenic and
Chiara Garattini and
Dirk Hamelinck and
Adrienne Heinrich and
Wessel Kraaij and
Jacek Kustra and
Aizea Lojo and
Marga Martin Sanchez and
Miguel Angel Mayer and
Matteo Melideo and
Ernestina Menasalvas and
Frank M{\o}ller Aarestrup and
Elvira Narro Artigot and
Milan Petkovic and
Diego Reforgiato Recupero and
Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
Gisele Roesems Kerremans and
Roland Roller and
M{\'{a}}rio Rom{\~{a}}o and
Stefan R{\"{u}}ping and
Felix Sasaki and
Wouter Spek and
Nenad Stojanovic and
Jack Thoms and
Andrejs Vasiljevs and
Wilfried Verachtert and
Roel Wuyts},
title = {Data Science in Healthcare: Benefits, Challenges and Opportunities},
booktitle = {Data Science for Healthcare},
pages = {3--38},
publisher = {Springer},
year = {2019}
}
@proceedings{DBLP:conf/igisc/2019,
editor = {Oscar S. Siordia and
Jos{\'{e}} Luis Silv{\'{a}}n{-}C{\'{a}}rdenas and
Alejandro Molina{-}Villegas and
Gandhi Hern{\'{a}}ndez{-}Chan and
Pablo L{\'{o}}pez{-}Ram{\'{\i}}rez and
Rodrigo Tapia{-}McClung and
Karime Gonz{\'{a}}lez Zuccolotto and
Mario Chirinos Colunga},
title = {Proceedings of the 1st International Conference on Geospatial Information
Sciences, iGISc 2019, M{\'{e}}rida, Yucat{\'{a}}n, M{\'{e}}xico,
October 23-25, 2019},
series = {Kalpa Publications in Computing},
volume = {13},
publisher = {EasyChair},
year = {2019}
}
@article{DBLP:journals/corr/abs-1907-07066,
author = {Claudia N. S{\'{a}}nchez and
Mario Graff},
title = {Selection Heuristics on Semantic Genetic Programming for Classification
Problems},
journal = {CoRR},
volume = {abs/1907.07066},
year = {2019}
}
@article{DBLP:journals/candc/ModicaSPOMC18,
author = {Maria Vittoria Modica and
Jonathan Reinoso S{\'{a}}nchez and
Andrea Pasquadibisceglie and
Marco Oliverio and
Paolo Mariottini and
Manuela Cervelli},
title = {Anti-haemostatic compounds from the vampire snail \emph{Cumia reticulata}:
Molecular cloning and \emph{in-silico} structure-function analysis},
journal = {Comput. Biol. Chem.},
volume = {75},
pages = {168--177},
year = {2018}
}
@article{DBLP:journals/comcom/Sanchez-GarciaG18,
author = {Jes{\'{u}}s S{\'{a}}nchez{-}Garc{\'{\i}}a and
Jos{\'{e}} M. Garc{\'{\i}}a{-}Campos and
Mario Arzamendia and
Daniel Guti{\'{e}}rrez{-}Reina and
Sergio L. Toral Mar{\'{\i}}n and
Derlis Gregor},
title = {A survey on unmanned aerial and aquatic vehicle multi-hop networks:
Wireless communications, evaluation tools and applications},
journal = {Comput. Commun.},
volume = {119},
pages = {43--65},
year = {2018}
}
@article{DBLP:journals/cys/Anzures-GarciaS18,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Miguel J. Hornos and
Patricia Paderewski{-}Rodr{\'{\i}}guez},
title = {A Workflow Ontology to support Knowledge Management in a Group's organizational
structure},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {22},
number = {1},
year = {2018}
}
@article{DBLP:journals/cys/GonzalezSDA18,
author = {Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
Jorge Cerezo S{\'{a}}nchez and
Mario Bustillo D{\'{\i}}az and
Apolonio Ata{-}P{\'{e}}rez},
title = {Recognition and Classification of Sign Language for Spanish},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {22},
number = {1},
year = {2018}
}
@article{DBLP:journals/cys/Saldana-Gonzalez18,
author = {Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
Jorge Cerezo S{\'{a}}nchez and
Mario Bustillo D{\'{\i}}az and
Apolonio Ata{-}P{\'{e}}rez},
title = {Vision System for the Navigation of a Mobile Robot},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {22},
number = {1},
year = {2018}
}
@article{DBLP:journals/cys/Sanchez-ReyesRT18,
author = {Sergio S{\'{a}}nchez{-}Reyes and
Mario E. Rivero{-}Angeles and
No{\'{e}} Torres{-}Cruz},
title = {Teletraffic Analysis for VoIP Services in {WLAN} Systems with Handoff
Capabilities},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {22},
number = {3},
year = {2018}
}
@article{DBLP:journals/fini/Ruiz-GomezGPMTC18,
author = {Sa{\'{u}}l J. Ruiz{-}G{\'{o}}mez and
Carlos G{\'{o}}mez and
Jes{\'{u}}s Poza and
Mario Mart{\'{\i}}nez{-}Zarzuela and
Miguel {\'{A}}ngel Tola{-}Arribas and
M{\'{o}}nica Cano and
Roberto Hornero},
title = {Measuring Alterations of Spontaneous {EEG} Neural Coupling in Alzheimer's
Disease and Mild Cognitive Impairment by Means of Cross-Entropy Metrics},
journal = {Frontiers Neuroinformatics},
volume = {12},
pages = {76},
year = {2018}
}
@article{DBLP:journals/iet-spr/MunozMS18,
author = {Juan Pablo Mu{\~{n}}oz and
Mario E. Maga{\~{n}}a and
Eduardo Cotilla Sanchez},
title = {Adaptive master-slave unscented Kalman filter for grid voltage frequency
estimation},
journal = {{IET} Signal Process.},
volume = {12},
number = {4},
pages = {496--505},
year = {2018}
}
@article{DBLP:journals/jifs/PenaCAJLMGS18,
author = {Mario Pe{\~{n}}a and
Mariela Cerrada and
Ximena Alvarez and
Diana Jad{\'{a}}n and
Pablo Lucero and
Barrag{\'{a}}n Milton and
Rodrigo Guam{\'{a}}n and
Ren{\'{e}}{-}Vinicio S{\'{a}}nchez},
title = {Feature engineering based on ANOVA, cluster validity assessment and
{KNN} for fault diagnosis in bearings},
journal = {J. Intell. Fuzzy Syst.},
volume = {34},
number = {6},
pages = {3451--3462},
year = {2018}
}
@article{DBLP:journals/jucs/Bustos-LopezASS18,
author = {Maritza Bustos{-}L{\'{o}}pez and
Giner Alor{-}Hern{\'{a}}ndez and
Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and
Mario Andr{\'{e}}s Paredes{-}Valverde},
title = {EduRP: an Educational Resources Platform based on Opinion Mining and
Semantic Web},
journal = {J. Univers. Comput. Sci.},
volume = {24},
number = {11},
pages = {1515--1535},
year = {2018}
}
@article{DBLP:journals/rcs/DiazLSVL18,
author = {Enrique D{\'{\i}}az and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Mario Serna and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca}},
title = {Planificaci{\'{o}}n reactiva de movimientos en tiempo real para
robots m{\'{o}}viles},
journal = {Res. Comput. Sci.},
volume = {147},
number = {7},
pages = {115--128},
year = {2018}
}
@article{DBLP:journals/rcs/Lopez-RamirezMS18,
author = {Pablo L{\'{o}}pez{-}Ram{\'{\i}}rez and
Alejandro Molina{-}Villegas and
Oscar S{\'{a}}nchez Siordia and
Mario Chirinos Colunga and
Gandhi Hern{\'{a}}ndez{-}Chan},
title = {Regular Activity Patterns in Spatio-Temporal Events Databases: Multi-Scale
Extraction of Geolocated Tweets},
journal = {Res. Comput. Sci.},
volume = {147},
number = {12},
pages = {137--150},
year = {2018}
}
@article{DBLP:journals/tgrs/Nieto-HidalgoGG18,
author = {Mario Nieto{-}Hidalgo and
Antonio Javier Gallego and
Pablo Gil and
Antonio Pertusa},
title = {Two-Stage Convolutional Neural Network for Ship and Spill Detection
Using {SLAR} Images},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {56},
number = {9},
pages = {5217--5230},
year = {2018}
}
@article{DBLP:journals/tie/MorianoRBMR18,
author = {Javier Moriano and
Mario Rizo and
Emilio Jos{\'{e}} Bueno and
Rocio Martin and
Francisco J. Rodr{\'{\i}}guez},
title = {A Novel Multifrequency Current Reference Calculation to Mitigate Active
Power Fluctuations},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {65},
number = {1},
pages = {810--818},
year = {2018}
}
@article{DBLP:journals/tie/OsorioAVPSMB18,
author = {Ren{\'{e}} Osorio and
J. Marcos Alonso and
Nimrod V{\'{a}}zquez and
Sergio Pinto and
Felipe De Jesus Sorcia{-}Vazquez and
Mario Mart{\'{\i}}nez{-}Garc{\'{\i}}a and
Luis Manuel Barrera},
title = {Fuzzy Logic Control With an Improved Algorithm for Integrated {LED}
Drivers},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {65},
number = {9},
pages = {6994--7003},
year = {2018}
}
@article{DBLP:journals/urban/OrganeroRF18,
author = {Mario Mu{\~{n}}oz Organero and
Ramona Ruiz{-}Blazquez and
Luis S{\'{a}}nchez Fern{\'{a}}ndez},
title = {Automatic detection of traffic lights, street crossings and urban
roundabouts combining outlier detection and deep learning classification
techniques based on {GPS} traces while driving},
journal = {Comput. Environ. Urban Syst.},
volume = {68},
pages = {1--8},
year = {2018}
}
@inproceedings{DBLP:conf/amcis/RomeroSV18,
author = {Mar{\'{\i}}a Camila Romero and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Executable Business Model Blueprints},
booktitle = {{AMCIS}},
publisher = {Association for Information Systems},
year = {2018}
}
@inproceedings{DBLP:conf/appis/Barcena-Gonzalez18,
author = {Guillermo B{\'{a}}rcena{-}Gonz{\'{a}}lez and
Maria De La Paz Guerrero{-}Lebrero and
Elisa Guerrero and
D. F. Reyes and
B. Nu{\~{n}}ez{-}Moraleda and
Mario Rivas{-}S{\'{a}}nchez and
Andr{\'{e}}s Y{\'{a}}{\~{n}}ez and
David Gonz{\'{a}}lez and
Pedro L. Galindo},
title = {Application of Super-Resolution Techniques to Transmission Electron
Microscopy Images},
booktitle = {{APPIS}},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {310},
pages = {42--49},
publisher = {{IOS} Press},
year = {2018}
}
@inproceedings{DBLP:conf/ccia/GatziouraSJ18,
author = {Anna Gatzioura and
Miquel S{\`{a}}nchez{-}Marr{\`{e}} and
Al{\'{\i}}pio M{\'{a}}rio Jorge},
title = {A Study on Contextual Influences on Automatic Playlist Continuation},
booktitle = {{CCIA}},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {308},
pages = {156--165},
publisher = {{IOS} Press},
year = {2018}
}
@inproceedings{DBLP:conf/citi/Ochoa-Hernandez18,
author = {Jos{\'{e}} Luis Ochoa{-}Hern{\'{a}}ndez and
Mario Barcelo{-}Valenzuela and
Gerardo Sanchez{-}Schmitz and
Raquel Torres Peralta},
title = {Concept Identification from Single-Documents},
booktitle = {{CITI}},
series = {Communications in Computer and Information Science},
volume = {883},
pages = {158--173},
publisher = {Springer},
year = {2018}
}
@inproceedings{DBLP:conf/clef/AlmagroMIP18,
author = {Mario Almagro and
Soto Montalvo and
Arantza D{\'{\i}}az de Ilarraza and
Alicia P{\'{e}}rez},
title = {{MAMTRA-MED} at {CLEF} eHealth 2018: {A} Combination of Information
Retrieval Techniques and Neural Networks for {ICD-10} Coding of Death
Certificates},
booktitle = {{CLEF} (Working Notes)},
series = {{CEUR} Workshop Proceedings},
volume = {2125},
publisher = {CEUR-WS.org},
year = {2018}
}
@inproceedings{DBLP:conf/eccv/KristanLMFPZVBL18,
author = {Matej Kristan and
Ales Leonardis and
Jiri Matas and
Michael Felsberg and
Roman P. Pflugfelder and
Luka Cehovin Zajc and
Tom{\'{a}}s Voj{\'{\i}}r and
Goutam Bhat and
Alan Lukezic and
Abdelrahman Eldesokey and
Gustavo Fern{\'{a}}ndez and
{\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and
{\'{A}}lvaro Iglesias{-}Arias and
A. Aydin Alatan and
Abel Gonz{\'{a}}lez{-}Garc{\'{\i}}a and
Alfredo Petrosino and
Alireza Memarmoghadam and
Andrea Vedaldi and
Andrej Muhic and
Anfeng He and
Arnold W. M. Smeulders and
Asanka G. Perera and
Bo Li and
Boyu Chen and
Changick Kim and
Changsheng Xu and
Changzhen Xiong and
Cheng Tian and
Chong Luo and
Chong Sun and
Cong Hao and
Daijin Kim and
Deepak Mishra and
Deming Chen and
Dong Wang and
Dongyoon Wee and
Efstratios Gavves and
Erhan Gundogdu and
Erik Velasco{-}Salido and
Fahad Shahbaz Khan and
Fan Yang and
Fei Zhao and
Feng Li and
Francesco Battistone and
George De Ath and
Gorthi R. K. Sai Subrahmanyam and
Guilherme Sousa Bastos and
Haibin Ling and
Hamed Kiani Galoogahi and
Hankyeol Lee and
Haojie Li and
Haojie Zhao and
Heng Fan and
Honggang Zhang and
Horst Possegger and
Houqiang Li and
Huchuan Lu and
Hui Zhi and
Huiyun Li and
Hyemin Lee and
Hyung Jin Chang and
Isabela Drummond and
Jack Valmadre and
Jaime Spencer Martin and
Javaan Singh Chahl and
Jin Young Choi and
Jing Li and
Jinqiao Wang and
Jinqing Qi and
Jinyoung Sung and
Joakim Johnander and
Jo{\~{a}}o F. Henriques and
Jongwon Choi and
Joost van de Weijer and
Jorge Rodr{\'{\i}}guez Herranz and
Jos{\'{e}} M. Mart{\'{\i}}nez and
Josef Kittler and
Junfei Zhuang and
Junyu Gao and
Klemen Grm and
Lichao Zhang and
Lijun Wang and
Lingxiao Yang and
Litu Rout and
Liu Si and
Luca Bertinetto and
Lutao Chu and
Manqiang Che and
Mario Edoardo Maresca and
Martin Danelljan and
Ming{-}Hsuan Yang and
Mohamed H. Abdelpakey and
Mohamed S. Shehata and
Myunggu Kang and
Namhoon Lee and
Ning Wang and
Ondrej Miksik and
Payman Moallem and
Pablo Vicente{-}Mo{\~{n}}ivar and
Pedro Senna and
Peixia Li and
Philip H. S. Torr and
Priya Mariam Raju and
Ruihe Qian and
Qiang Wang and
Qin Zhou and
Qing Guo and
Rafael Martin Nieto and
Rama Krishna Sai Subrahmanyam Gorthi and
Ran Tao and
Richard Bowden and
Richard M. Everson and
Runling Wang and
Sangdoo Yun and
Seokeon Choi and
Sergio Vivas and
Shuai Bai and
Shuangping Huang and
Sihang Wu and
Simon Hadfield and
Siwen Wang and
Stuart Golodetz and
Ming Tang and
Tianyang Xu and
Tianzhu Zhang and
Tobias Fischer and
Vincenzo Santopietro and
Vitomir Struc and
Wei Wang and
Wangmeng Zuo and
Wei Feng and
Wei Wu and
Wei Zou and
Weiming Hu and
Wengang Zhou and
Wenjun Zeng and
Xiaofan Zhang and
Xiaohe Wu and
Xiao{-}Jun Wu and
Xinmei Tian and
Yan Li and
Yan Lu and
Yee Wei Law and
Yi Wu and
Yiannis Demiris and
Yicai Yang and
Yifan Jiao and
Yuhong Li and
Yunhua Zhang and
Yuxuan Sun and
Zheng Zhang and
Zheng Zhu and
Zhen{-}Hua Feng and
Zhihui Wang and
Zhiqun He},
title = {The Sixth Visual Object Tracking {VOT2018} Challenge Results},
booktitle = {{ECCV} Workshops {(1)}},
series = {Lecture Notes in Computer Science},
volume = {11129},
pages = {3--53},
publisher = {Springer},
year = {2018}
}
@inproceedings{DBLP:conf/icassp/SaldanhaSMA18,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
C{\'{e}}sar A. M. Marcon and
Luciano Volcan Agostini},
title = {Fast 3D-Hevc Depth Maps Intra-Frame Prediction Using Data Mining},
booktitle = {{ICASSP}},
pages = {1738--1742},
publisher = {{IEEE}},
year = {2018}
}
@inproceedings{DBLP:conf/ipmu/ValdezGLG18,
author = {Mario Garc{\'{\i}}a Valdez and
Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Lucero Lara and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez},
title = {Increasing Performance via Gamification in a Volunteer-Based Evolutionary
Computation System},
booktitle = {{IPMU} {(3)}},
series = {Communications in Computer and Information Science},
volume = {855},
pages = {342--353},
publisher = {Springer},
year = {2018}
}
@inproceedings{DBLP:conf/ni/GarciaMFNMS18,
author = {Jessica Juarez Garc{\'{\i}}a and
Adriana Jord{\'{a}}n Morales and
Lizbeth Garc{\'{\i}}a Fern{\'{a}}ndez and
Reyna Rosas Negrete and
Mario Enrique Rend{\'{o}}n Macias and
Sylvia Claudine Ram{\'{\i}}rez S{\'{a}}nchez},
title = {Use of Distraction to Reduce Pain in Venipunture when a Venoclysis
Is Placed},
booktitle = {Nursing Informatics},
series = {Studies in Health Technology and Informatics},
volume = {250},
pages = {24--25},
publisher = {{IOS} Press},
year = {2018}
}
@inproceedings{DBLP:conf/rice/SanchezGSG18,
author = {Claudia N. S{\'{a}}nchez and
Sebasti{\'{a}}n Guti{\'{e}}rrez and
Julieta Dom{\'{\i}}nguez{-}Soberanes and
Mario Graff},
title = {Landscape images distance using kullback leibler divergence},
booktitle = {{RICE}},
pages = {1--5},
publisher = {{IEEE}},
year = {2018}
}
@inproceedings{DBLP:conf/sbcci/SanchezSAM18,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Luciano Volcan Agostini and
C{\'{e}}sar A. M. Marcon},
title = {Hardware-Oriented Wedgelet Evaluation Skip for {DMM-1} in 3D-HEVC},
booktitle = {{SBCCI}},
pages = {1--5},
publisher = {{IEEE}},
year = {2018}
}
@inproceedings{DBLP:conf/sepln/GraffMTMSOS18,
author = {Mario Graff and
Sabino Miranda{-}Jim{\'{e}}nez and
Eric Sadit Tellez and
Daniela Moctezuma and
Vladimir Salgado and
Jos{\'{e}} Ortiz{-}Bejar and
Claudia N. S{\'{a}}nchez},
title = {{INGEOTEC} at {MEX-A3T:} Author Profiling and Aggressiveness Analysis
in Twitter Using {\(\mu\)}TC and EvoMSA},
booktitle = {IberEval@SEPLN},
series = {{CEUR} Workshop Proceedings},
volume = {2150},
pages = {128--133},
publisher = {CEUR-WS.org},
year = {2018}
}
@article{DBLP:journals/cbm/NaranjoSMBG17,
author = {Claudia Carricarte Naranjo and
Lazaro M. Sanchez{-}Rodriguez and
Marta Brown Mart{\'{\i}}nez and
Mario Est{\'{e}}vez B{\'{a}}ez and
Andr{\'{e}}s Machado Garc{\'{\i}}a},
title = {Permutation entropy analysis of heart rate variability for the assessment
of cardiovascular autonomic neuropathy in type 1 diabetes mellitus},
journal = {Comput. Biol. Medicine},
volume = {86},
pages = {90--97},
year = {2017}
}
@article{DBLP:journals/eswa/GonzalezDSR17,
author = {Mario Gonz{\'{a}}lez and
David Dominguez and
{\'{A}}ngel S{\'{a}}nchez and
Francisco B. Rodr{\'{\i}}guez},
title = {Increase attractor capacity using an ensembled neural network},
journal = {Expert Syst. Appl.},
volume = {71},
pages = {206--215},
year = {2017}
}
@article{DBLP:journals/eswa/TellezMGMSV17,
author = {Eric Sadit Tellez and
Sabino Miranda{-}Jim{\'{e}}nez and
Mario Graff and
Daniela Moctezuma and
Oscar S. Siordia and
Elio{-}Aten{\'{o}}genes Villase{\~{n}}or},
title = {A case study of Spanish text transformations for twitter sentiment
analysis},
journal = {Expert Syst. Appl.},
volume = {81},
pages = {457--471},
year = {2017}
}
@article{DBLP:journals/ett/ContrerasCT17,
author = {David Contreras and
Mario Castro and
David S{\'{a}}nchez de la Torre},
title = {Performance evaluation of bluetooth low energy in indoor positioning
systems},
journal = {Trans. Emerg. Telecommun. Technol.},
volume = {28},
number = {1},
year = {2017}
}
@article{DBLP:journals/ijcopi/LorancaAVLSD17,
author = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Mart{\'{\i}}n Estrada Analco and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Jorge Cerezo S{\'{a}}nchez and
Mario Bustillo D{\'{\i}}az},
title = {Quadratic Assignation Problem: {A} solution approach with parallel
{GRASP}},
journal = {Int. J. Comb. Optim. Probl. Informatics},
volume = {8},
number = {3},
pages = {33--38},
year = {2017}
}
@article{DBLP:journals/ijcta/OsorioAPMVPM17,
author = {Ren{\'{e}} Osorio and
Jos{\'{e}} Marcos Alonso and
Sergio Pinto and
Gilberto Mart{\'{\i}}nez and
Nimrod V{\'{a}}zquez and
Mario Ponce{-}Silva and
A. J. Martinez},
title = {Simplified electrical modelling of power LEDs for {DC-DC} converter
analysis and simulation},
journal = {Int. J. Circuit Theory Appl.},
volume = {45},
number = {11},
pages = {1760--1772},
year = {2017}
}
@article{DBLP:journals/jaihc/PastorMSNC17,
author = {Francisco Javier Ferr{\'{a}}ndez Pastor and
Higinio Mora Mora and
Jos{\'{e}}{-}Luis S{\'{a}}nchez{-}Romero and
Mario Nieto{-}Hidalgo and
Juan Manuel Garc{\'{\i}}a Chamizo},
title = {Interpreting human activity from electrical consumption data using
reconfigurable hardware and hidden Markov models},
journal = {J. Ambient Intell. Humaniz. Comput.},
volume = {8},
number = {4},
pages = {469--483},
year = {2017}
}
@article{DBLP:journals/jrtip/SaldanhaSZPA17,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini},
title = {Energy-aware scheme for the 3D-HEVC depth maps prediction},
journal = {J. Real Time Image Process.},
volume = {13},
number = {1},
pages = {55--69},
year = {2017}
}
@article{DBLP:journals/midm/Sanchez-de-Madariaga17,
author = {Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
Adolfo Mu{\~{n}}oz and
Raimundo Lozano{-}Rub{\'{\i}} and
Pablo Serrano{-}Balazote and
Antonio L. Castro and
Oscar Moreno and
Mario Pascual Carrasco},
title = {Examining database persistence of {ISO/EN} 13606 standardized electronic
health record extracts: relational vs. NoSQL approaches},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {17},
number = {1},
pages = {123:1--123:14},
year = {2017}
}
@article{DBLP:journals/nature/DudasCBTBFPLAAB17,
author = {Gytis Dudas and
Luiz Max Carvalho and
Trevor Bedford and
Andrew J. Tatem and
Guy Baele and
Nuno R. Faria and
Daniel J. Park and
Jason T. Ladner and
Armando Arias and
Danny Asogun and
Filip Bielejec and
Sarah L. Caddy and
Matthew Cotten and
Jonathan D'Ambrozio and
Simon Dellicour and
Antonino Di Caro and
Joseph W. Diclaro and
Sophie Duraffour and
Michael J. Elmore and
Lawrence S. Fakoli and
Ousmane Faye and
Merle L. Gilbert and
Sahr M. Gevao and
Stephen Gire and
Adrianne Gladden{-}Young and
Andreas Gnirke and
Augustine Goba and
Donald S. Grant and
Bart L. Haagmans and
Julian A. Hiscox and
Umaru Jah and
Jeffrey R. Kugelman and
Di Liu and
Jia Lu and
Christine M. Malboeuf and
Suzanne Mate and
David A. Matthews and
Christian B. Matranga and
Luke W. Meredith and
James Qu and
Joshua Quick and
Suzan D. Pas and
My V. T. Phan and
Georgios Pollakis and
Chantal B. Reusken and
Mariano Sanchez{-}Lockhart and
Stephen F. Schaffner and
John S. Schieffelin and
Rachel S. G. Sealfon and
Etienne Simon{-}Loriere and
Saskia L. Smits and
Kilian Stoecker and
Lucy Thorne and
Ekaete Alice Tobin and
Mohamed A. Vandi and
Simon J. Watson and
Kendra West and
Shannon Whitmer and
Michael R. Wiley and
Sarah M. Winnicki and
Shirlee Wohl and
Roman W{\"{o}}lfel and
Nathan L. Yozwiak and
Kristian G. Andersen and
Sylvia O. Blyden and
Fatorma Bolay and
Miles W. Carroll and
Bernice Dahn and
Boubacar Diallo and
Pierre Formenty and
Christophe Fraser and
George F. Gao and
Robert F. Garry and
Ian Goodfellow and
Stephan G{\"{u}}nther and
Christian T. Happi and
Edward C. Holmes and
Brima Kargbo and
Sakoba Ke{\"{\i}}ta and
Paul Kellam and
Marion Koopmans and
Jens H. Kuhn and
Nicholas J. Loman and
N'Faly Magassouba and
Dhamari Naidoo and
Stuart T. Nichol and
Tolbert Nyenswah and
Gustavo F. Palacios and
Oliver G. Pybus and
Pardis C. Sabeti and
Amadou Sall and
Ute Str{\"{o}}her and
Isatta Wurie and
Marc A. Suchard and
Philippe Lemey and
Andrew Rambaut},
title = {Virus genomes reveal factors that spread and sustained the Ebola epidemic},
journal = {Nat.},
volume = {544},
number = {7650},
pages = {309--315},
year = {2017}
}
@article{DBLP:journals/pdln/SanchezPVAA17,
author = {Francisco Garc{\'{\i}}a{-}S{\'{a}}nchez and
Mario Andr{\'{e}}s Paredes{-}Valverde and
Rafael Valencia{-}Garc{\'{\i}}a and
Gema Alcaraz{-}M{\'{a}}rmol and
{\'{A}}ngela Almela},
title = {{KBS4FIA:} Leveraging advanced knowledge-based systems for financial
information analysis},
journal = {Proces. del Leng. Natural},
volume = {59},
pages = {145--148},
year = {2017}
}
@article{DBLP:journals/prl/TellezMGMSS17,
author = {Eric Sadit Tellez and
Sabino Miranda{-}Jim{\'{e}}nez and
Mario Graff and
Daniela Moctezuma and
Ranyart Rodrigo Su{\'{a}}rez and
Oscar S{\'{a}}nchez Siordia},
title = {A simple approach to multilingual polarity classification in Twitter},
journal = {Pattern Recognit. Lett.},
volume = {94},
pages = {68--74},
year = {2017}
}
@article{DBLP:journals/sosym/Sanchez-Gonzalez17,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
F{\'{e}}lix Garc{\'{\i}}a and
Francisco Ruiz and
Mario Piattini},
title = {A case study about the improvement of business process models driven
by indicators},
journal = {Softw. Syst. Model.},
volume = {16},
number = {3},
pages = {759--788},
year = {2017}
}
@article{DBLP:journals/tcas/ReyesSPH17,
author = {Benjam{\'{\i}}n T. Reyes and
Raul M. Sanchez and
Ariel L. Pola and
Mario R. Hueda},
title = {Design and Experimental Evaluation of a Time-Interleaved {ADC} Calibration
Algorithm for Application in High-Speed Communication Systems},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {64-I},
number = {5},
pages = {1019--1030},
year = {2017}
}
@article{DBLP:journals/tcyb/RodriguezOMM17,
author = {Mario Rodr{\'{\i}}guez and
Carlos Orrite and
Carlos Medrano and
Dimitrios Makris},
title = {One-Shot Learning of Human Activity With an {MAP} Adapted {GMM} and
Simplex-HMM},
journal = {{IEEE} Trans. Cybern.},
volume = {47},
number = {7},
pages = {1769--1780},
year = {2017}
}
@article{DBLP:journals/tvlsi/GarridoSVG17,
author = {Mario Garrido and
Miguel Angel S{\'{a}}nchez and
Mar{\'{\i}}a Luisa L{\'{o}}pez Vallejo and
Jes{\'{u}}s Grajal},
title = {A 4096-Point Radix-4 Memory-Based {FFT} Using {DSP} Slices},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {25},
number = {1},
pages = {375--379},
year = {2017}
}
@inproceedings{DBLP:conf/bis/SaenzCSV17,
author = {Juan Pablo S{\'{a}}enz and
Steve C{\'{a}}rdenas and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Semi-automated Model-Based Generation of Enterprise Architecture Deliverables},
booktitle = {{BIS}},
series = {Lecture Notes in Business Information Processing},
volume = {288},
pages = {59--73},
publisher = {Springer},
year = {2017}
}
@inproceedings{DBLP:conf/clihc/GomezSLR17,
author = {Nancy Lizbeth Cruz G{\'{o}}mez and
{\'{A}}ngel Quintero S{\'{a}}nchez and
Eneas Kevin Garc{\'{\i}}a L{\'{o}}pez and
Mario Alberto Moreno Rocha},
title = {{SBK:} Smart Braille Keyboard for Learning Braille Literacy in Blind
or Visually Impaired People},
booktitle = {{CLIHC}},
pages = {26:1--26:4},
publisher = {{ACM}},
year = {2017}
}
@inproceedings{DBLP:conf/clihc/HerreraGSC17,
author = {Andres E. Acevedo Herrera and
Garc{\'{\i}}a Gonz{\'{a}}lez Gabriel and
Luis {\'{A}}ngel Ort{\'{\i}}z S{\'{a}}nchez and
Mario David May Cuevas},
title = {Light Cane: An Augmented Blind Cane to Help Users to Cross the Street},
booktitle = {{CLIHC}},
pages = {13:1--13:4},
publisher = {{ACM}},
year = {2017}
}
@inproceedings{DBLP:conf/clihc/RochaSLG17,
author = {Mario Alberto Moreno Rocha and
{\'{A}}ngel Quintero S{\'{a}}nchez and
Eneas Kevin Garc{\'{\i}}a L{\'{o}}pez and
Nancy Lizbeth Cruz G{\'{o}}mez},
title = {Incorporating Technology into Braille Learning Through a User-Centered
Methodology},
booktitle = {{CLIHC}},
pages = {15:1--15:4},
publisher = {{ACM}},
year = {2017}
}
@inproceedings{DBLP:conf/conf-irm/GiraldoHSV17,
author = {David Giraldo and
Andrea Herrera and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Analysis of {ICT} services by observing "fit for use" attributes},
booktitle = {{CONF-IRM}},
pages = {3},
year = {2017}
}
@inproceedings{DBLP:conf/csedu/CasasSV17,
author = {Lina Casas and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Using an {IT} Laboratory for Training {IT} Architects},
booktitle = {{CSEDU} {(1)}},
pages = {108--119},
publisher = {SciTePress},
year = {2017}
}
@inproceedings{DBLP:conf/cvpr/RodriguezOMM17,
author = {Mario Rodr{\'{\i}}guez and
Carlos Orrite and
Carlos Medrano and
Dimitrios Makris},
title = {Fast Simplex-HMM for One-Shot Learning Activity Recognition},
booktitle = {{CVPR} Workshops},
pages = {1259--1266},
publisher = {{IEEE} Computer Society},
year = {2017}
}
@inproceedings{DBLP:conf/edoc/NaranjoSV17,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Visualizing the Bias of Enterprise Metamodels towards Nuanced Concepts},
booktitle = {{EDOC}},
pages = {30--39},
publisher = {{IEEE} Computer Society},
year = {2017}
}
@inproceedings{DBLP:conf/emoocs/RivoMCCMGAAA17,
author = {Manuel Sanjurjo Rivo and
Mario Merino and
Filippo Cichocki and
Xin Chen and
David Morante and
Daniel P{\'{e}}rez Grande and
Gonzalo S{\'{a}}nchez Arriaga and
Manuel Soler Arnedo and
Eduardo Ahedo},
title = {The Conquest of Space: un Curso {MOOC} y {SPOC} en Ingenier{\'{\i}}a
Aeroespacial},
booktitle = {EMOOCs-ES},
series = {{CEUR} Workshop Proceedings},
volume = {1836},
pages = {91--97},
publisher = {CEUR-WS.org},
year = {2017}
}
@inproceedings{DBLP:conf/eusipco/SanchezSAM17,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Luciano Volcan Agostini and
C{\'{e}}sar A. M. Marcon},
title = {Depth modeling modes complexity control system for the 3D-HEVC video
encoder},
booktitle = {{EUSIPCO}},
pages = {1021--1025},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/eusipco/SanchezSZPAM17,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini and
C{\'{e}}sar A. M. Marcon},
title = {Edge-aware depth motion estimation - {A} complexity reduction scheme
for 3D-HEVC},
booktitle = {{EUSIPCO}},
pages = {1524--1528},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/evoW/GuervosBCRGRVHR17,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Israel Blancas{-}Alvarez and
Pedro A. Castillo and
Gustavo Romero and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
V{\'{\i}}ctor M. Rivas and
Mario Garc{\'{\i}}a Valdez and
Amaury Hern{\'{a}}ndez{-}{\'{A}}guila and
Mario Rom{\'{a}}n},
title = {Ranking Programming Languages for Evolutionary Algorithm Operations},
booktitle = {EvoApplications {(1)}},
series = {Lecture Notes in Computer Science},
volume = {10199},
pages = {689--704},
year = {2017}
}
@inproceedings{DBLP:conf/evoW/MereloCGV17,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Paloma de las Cuevas and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Mario Garc{\'{\i}}a Valdez},
title = {A Performance Assessment of Evolutionary Algorithms in Volunteer Computing
Environments: The Importance of Entropy},
booktitle = {EvoApplications {(1)}},
series = {Lecture Notes in Computer Science},
volume = {10199},
pages = {806--821},
year = {2017}
}
@inproceedings{DBLP:conf/ibpria/RodriguezOM17,
author = {Mario Rodr{\'{\i}}guez and
Carlos Orrite and
Carlos Medrano},
title = {Space-Time Flexible Kernel for Recognizing Activities from Wearable
Cameras},
booktitle = {IbPRIA},
series = {Lecture Notes in Computer Science},
volume = {10255},
pages = {511--518},
publisher = {Springer},
year = {2017}
}
@inproceedings{DBLP:conf/icar/SanchezR17,
author = {O. Nelson Andres Sanchez and
Mario Fernando De la Rosa Rosero},
title = {Path planning and following using genetic algorithms to solve the
multi-travel salesman problem in dynamic scenarios},
booktitle = {{ICAR}},
pages = {204--209},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/iccS/TintoACCSSD17,
author = {Oriol Tint{\'{o}} and
Mario C. Acosta and
Miguel Castrillo and
Ana Cort{\'{e}}s and
Alicia Sanchez Lorente and
Kim Serradell and
Francisco J. Doblas{-}Reyes},
title = {Optimizing domain decomposition in an ocean model: the case of {NEMO}},
booktitle = {{ICCS}},
series = {Procedia Computer Science},
volume = {108},
pages = {776--785},
publisher = {Elsevier},
year = {2017}
}
@inproceedings{DBLP:conf/iceis/RomeroSV17,
author = {Mar{\'{\i}}a Camila Romero and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Business Model Pattern Execution - {A} System Dynamics Application},
booktitle = {{ICEIS} {(3)}},
pages = {440--447},
publisher = {SciTePress},
year = {2017}
}
@inproceedings{DBLP:conf/ict4ageingwell/OCaoimhMFVCNVWJ17,
author = {R{\'{o}}n{\'{a}}n O'Caoimh and
D. William Molloy and
Carol Fitzgerald and
Lex van Velsen and
Miriam Cabrita and
Mohammad Hossein Nassabi and
Frederiek de Vette and
Marit Dekker{-}van Weering and
Stephanie Jansen{-}Kosterink and
Wander Kenter and
Sanne Frazer and
Am{\'{e}}lia P. Rauter and
Maria Ant{\'{o}}nia Amaral Turkman and
Mar{\'{\i}}lia Antunes and
Feridun Turkman and
Marta Sousa Silva and
Alice Martins and
Helena S. Costa and
T{\^{a}}nia Gon{\c{c}}alves Albuquerque and
Ant{\'{o}}nio E. N. Ferreira and
Mario Scherillo and
Vincenzo De Luca and
Maddalena Illario and
Alejandro Garc{\'{\i}}a{-}Rudolph and
Rocio Sanchez{-}Carrion and
Javier Solana S{\'{a}}nchez and
Enrique J. G{\'{o}}mez Aguilera and
Hermie Hermens and
Miriam M. R. Vollenbroek{-}Hutten},
title = {Healthcare Recommendations from the Personalised {ICT} Supported Service
for Independent Living and Active Ageing {(PERSSILAA)} Study},
booktitle = {ICT4AgeingWell},
pages = {91--103},
publisher = {{SCITEPRESS}},
year = {2017}
}
@inproceedings{DBLP:conf/ict4ageingwell/OCaoimhMFVCNVWJ17a,
author = {R{\'{o}}n{\'{a}}n O'Caoimh and
D. William Molloy and
Carol Fitzgerald and
Lex van Velsen and
Miriam Cabrita and
Mohammad Hossein Nassabi and
Frederiek de Vette and
Marit Dekker{-}van Weering and
Stephanie Jansen{-}Kosterink and
Wander Kenter and
Sanne Frazer and
Am{\'{e}}lia P. Rauter and
Maria Ant{\'{o}}nia Amaral Turkman and
Mar{\'{\i}}lia Antunes and
Feridun Turkman and
Marta Sousa Silva and
Alice Martins and
Helena S. Costa and
T{\^{a}}nia Gon{\c{c}}alves Albuquerque and
Ant{\'{o}}nio E. N. Ferreira and
Mario Scherillo and
Vincenzo De Luca and
Pasquale Abete and
Annamaria Colao and
Alejandro Garc{\'{\i}}a{-}Rudolph and
Rocio Sanchez{-}Carrion and
Javier Solana S{\'{a}}nchez and
Enrique J. G{\'{o}}mez Aguilera and
Maddalena Illario and
Hermie Hermens and
Miriam M. R. Vollenbroek{-}Hutten},
title = {ICT-Supported Interventions Targeting Pre-frailty: Healthcare Recommendations
from the Personalised {ICT} Supported Service for Independent Living
and Active Ageing {(PERSSILAA)} Study},
booktitle = {ICT4AgeingWell (Selected Papers)},
series = {Communications in Computer and Information Science},
volume = {869},
pages = {69--92},
publisher = {Springer},
year = {2017}
}
@inproceedings{DBLP:conf/infocom/ZhangWBKS17,
author = {Ying Zhang and
Wenfei Wu and
Sujata Banerjee and
Joon{-}Myung Kang and
Mario A. S{\'{a}}nchez},
title = {SLA-verifier: Stateful and quantitative verification for service chaining},
booktitle = {{INFOCOM}},
pages = {1--9},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/iwann/GonzalezDSR17,
author = {Mario Gonz{\'{a}}lez and
David Dominguez and
{\'{A}}ngel S{\'{a}}nchez and
Francisco B. Rodr{\'{\i}}guez},
title = {Capacity and Retrieval of a Modular Set of Diluted Attractor Networks
with Respect to the Global Number of Neurons},
booktitle = {{IWANN} {(1)}},
series = {Lecture Notes in Computer Science},
volume = {10305},
pages = {497--506},
publisher = {Springer},
year = {2017}
}
@inproceedings{DBLP:conf/iwann/Rivas-SanchezGV17,
author = {Mario Rivas{-}S{\'{a}}nchez and
Maria De La Paz Guerrero{-}Lebrero and
Elisa Guerrero V{\'{a}}zquez and
Guillermo B{\'{a}}rcena{-}Gonzalez and
Jaime Martel and
Pedro L. Galindo},
title = {Using Deep Learning for Image Similarity in Product Matching},
booktitle = {{IWANN} {(1)}},
series = {Lecture Notes in Computer Science},
volume = {10305},
pages = {281--290},
publisher = {Springer},
year = {2017}
}
@inproceedings{DBLP:conf/lascas/GonzalezSVCRZPS17,
author = {S. A. Gonzalez and
Enrique Mario Spinelli and
Alejandro L. Veiga and
D. F. Coral and
M. B. Fernandez van Raap and
P. Mendoza Zelis and
G. A. Pasquevich and
F. H. Sanchez},
title = {Portable electromagnetic field applicator for magnetic hyperthermia
experiments},
booktitle = {{LASCAS}},
pages = {1--4},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/somet/Sotelo-GarridoN17,
author = {Mario Sotelo{-}Garrido and
Mariko Nakano{-}Miyatake and
Gabriel Sanchez{-}Perez and
Manuel Cedillo{-}Hernandez and
H{\'{e}}ctor P{\'{e}}rez{-}Meana},
title = {Software Protection Against Illegal Copy Using Software Watermarking},
booktitle = {SoMeT},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {297},
pages = {503--511},
publisher = {{IOS} Press},
year = {2017}
}
@inproceedings{DBLP:conf/ucami/Garcia-SanchezT17,
author = {Mario Garc{\'{\i}}a{-}S{\'{a}}nchez and
Miguel A. Teruel and
Elena Navarro and
Pascual Gonz{\'{a}}lez and
Antonio Fern{\'{a}}ndez{-}Caballero},
title = {A Distributed Tool to Perform Dynamic Therapies for Social Cognitive
Deficit Through Avatars},
booktitle = {UCAmI},
series = {Lecture Notes in Computer Science},
volume = {10586},
pages = {731--741},
publisher = {Springer},
year = {2017}
}
@incollection{DBLP:series/sci/HuacujaLCPR17,
author = {H{\'{e}}ctor Joaqu{\'{\i}}n {Fraire Huacuja} and
Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
Norberto Castillo{-}Garc{\'{\i}}a and
Johnatan E. Pecero and
Rodolfo A. Pazos Rangel},
title = {Solving the Cut Width Optimization Problem with a Genetic Algorithm
Approach},
booktitle = {Nature-Inspired Design of Hybrid Intelligent Systems},
series = {Studies in Computational Intelligence},
volume = {667},
pages = {729--738},
publisher = {Springer},
year = {2017}
}
@article{DBLP:journals/corr/Arias-FisteusFM17,
author = {Jes{\'{u}}s Arias{-}Fisteus and
Luis S{\'{a}}nchez Fern{\'{a}}ndez and
V{\'{\i}}ctor Corcoba Maga{\~{n}}a and
Mario Mu{\~{n}}oz Organero and
Jorge Yago Fern{\'{a}}ndez Rodr{\'{\i}}guez and
Juan Antonio {\'{A}}lvarez{-}Garc{\'{\i}}a},
title = {A Scalable Data Streaming Infrastructure for Smart Cities},
journal = {CoRR},
volume = {abs/1703.02755},
year = {2017}
}
@article{DBLP:journals/amcs/LocesMPHBB16,
author = {Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
Jedrzej Musial and
Johnatan E. Pecero and
H{\'{e}}ctor Joaqu{\'{\i}}n {Fraire Huacuja} and
Jacek Blazewicz and
Pascal Bouvry},
title = {Exact and heuristic approaches to solve the Internet shopping optimization
problem with delivery costs},
journal = {Int. J. Appl. Math. Comput. Sci.},
volume = {26},
number = {2},
pages = {391--406},
year = {2016}
}
@article{DBLP:journals/crossroads/Sanchez16,
author = {Daniel L{\'{o}}pez S{\'{a}}nchez},
title = {"ANN" helps Mario rescue Princess Toadstool},
journal = {{XRDS}},
volume = {23},
number = {1},
pages = {18--19},
year = {2016}
}
@article{DBLP:journals/cviu/Sanchez-Escobedo16,
author = {Dalila S{\'{a}}nchez{-}Escobedo and
Mario Castel{\'{a}}n and
William A. P. Smith},
title = {Statistical 3D face shape estimation from occluding contours},
journal = {Comput. Vis. Image Underst.},
volume = {142},
pages = {111--124},
year = {2016}
}
@article{DBLP:journals/fi/ParraSRFP16,
author = {Antonio Santos{-}Olmo and
Luis Enrique S{\'{a}}nchez and
David Garcia Rosado and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
title = {Applying the Action-Research Method to Develop a Methodology to Reduce
the Installation and Maintenance Times of Information Security Management
Systems},
journal = {Future Internet},
volume = {8},
number = {3},
pages = {36},
year = {2016}
}
@article{DBLP:journals/ijhis/LorancaRVALZGD16,
author = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Jorge A. Ruiz{-}Vanoye and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
Mart{\'{\i}}n Estrada Analco and
Abraham S{\'{a}}nchez L{\'{o}}pez and
Alberto Ochoa{-}Zezzatti and
Gerardo {Mart{\'{\i}}nez Guzman} and
Mario Bustillo D{\'{\i}}az},
title = {An approximation method for the P-median problem: {A} bioinspired
tabu search and variable neighborhood search partitioning approach},
journal = {Int. J. Hybrid Intell. Syst.},
volume = {13},
number = {2},
pages = {87--98},
year = {2016}
}
@article{DBLP:journals/infsof/Barcelo-Valenzuela16,
author = {Mario Barcelo{-}Valenzuela and
Patricia Shihemy Carrillo{-}Villafa{\~{n}}a and
Alonso Perez{-}Soltero and
Gerardo Sanchez{-}Schmitz},
title = {A framework to acquire explicit knowledge stored on different versions
of software},
journal = {Inf. Softw. Technol.},
volume = {70},
pages = {40--48},
year = {2016}
}
@article{DBLP:journals/ivc/RodriguezOMM16,
author = {Mario Rodr{\'{\i}}guez and
Carlos Orrite and
Carlos Medrano and
Dimitrios Makris},
title = {A Time Flexible Kernel framework for video-based activity recognition},
journal = {Image Vis. Comput.},
volume = {48-49},
pages = {26--36},
year = {2016}
}
@article{DBLP:journals/jvis/VictoriaRRPO16,
author = {{\'{A}}yax Hernando Torres Victoria and
Mario S{\'{a}}nchez Rosas and
Fernando Arag{\'{o}}n Rivera and
Salom{\'{o}}n Peralta and
Abraham Medina Ovando},
title = {Visualization of isotherms around a heated horizontal cylinder embedded
in a porous medium},
journal = {J. Vis.},
volume = {19},
number = {4},
pages = {631--641},
year = {2016}
}
@article{DBLP:journals/midm/Lozano-LozanoMG16,
author = {Mario Lozano{-}Lozano and
Lydia Mart{\'{\i}}n{-}Mart{\'{\i}}n and
Noelia Galiano{-}Castillo and
Francisco {\'{A}}lvarez{-}Salvago and
Irene Cantarero{-}Villanueva and
Carolina Fern{\'{a}}ndez{-}Lao and
Carmen S{\'{a}}nchez{-}Salado and
Manuel Arroyo Morales},
title = {Integral strategy to supportive care in breast cancer survivors through
occupational therapy and a m-health system: design of a randomized
clinical trial},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {16},
pages = {150:1--150:10},
year = {2016}
}
@article{DBLP:journals/rcs/Anzures-GarciaS16,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Miguel J. Hornos and
Patricia Paderewski{-}Rodr{\'{\i}}guez},
title = {Semantic Formalism for Modelling the Group Interaction},
journal = {Res. Comput. Sci.},
volume = {118},
pages = {137--147},
year = {2016}
}
@article{DBLP:journals/rcs/Anzures-GarciaS16a,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Miguel J. Hornos and
Patricia Paderewski{-}Rodr{\'{\i}}guez},
title = {Knowledge-based Workflow Ontology for Group Organizational Structure},
journal = {Res. Comput. Sci.},
volume = {123},
pages = {79--90},
year = {2016}
}
@article{DBLP:journals/rcs/DominguezHPHC16,
author = {Mario Hernandez Dominguez and
Jos{\'{e}}{-}Isidro Hern{\'{a}}ndez{-}Vega and
Dolores{-}Gabriela Palomares{-}Gorham and
Carlos Hern{\'{a}}ndez{-}Santos and
Jonam L. S{\'{a}}nchez Cuevas},
title = {A {BDI} Agent System for the Collaboration of the Unmanned Aerial
Vehicle},
journal = {Res. Comput. Sci.},
volume = {121},
pages = {113--124},
year = {2016}
}
@article{DBLP:journals/rcs/LopezCPML16,
author = {Abraham S{\'{a}}nchez L{\'{o}}pez and
Viridiana Cruz{-}Guti{\'{e}}rrez and
Mario Alberto Posada{-}Zamora and
M. Teresa Torrijos M. and
Mar{\'{\i}}a Auxilio Osorio Lama},
title = {Estudio del an{\'{a}}lisis de componentes principales en bases
de datos de calidad del aire},
journal = {Res. Comput. Sci.},
volume = {120},
pages = {9--19},
year = {2016}
}
@article{DBLP:journals/rcs/LorancaVDASSL16,
author = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
Mario Bustillo D{\'{\i}}az and
Mart{\'{\i}}n Estrada Analco and
Jorge Cerezo S{\'{a}}nchez and
Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
Abraham S{\'{a}}nchez L{\'{o}}pez},
title = {Methodology for Location-Allocation Problem},
journal = {Res. Comput. Sci.},
volume = {123},
pages = {91--98},
year = {2016}
}
@article{DBLP:journals/rcs/Saldana-Gonzalez16,
author = {Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
Jorge Cerezo S{\'{a}}nchez and
Mario Bustillo D{\'{\i}}az and
Apolonio Ata P{\'{e}}rez and
Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Gerardo {Mart{\'{\i}}nez Guzman} and
Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez},
title = {Dise{\~{n}}o de un robot m{\'{o}}vil controlado por un agente
reactivo en tiempo real},
journal = {Res. Comput. Sci.},
volume = {125},
pages = {17--26},
year = {2016}
}
@article{DBLP:journals/rcs/SanchezSDA16,
author = {Jorge Cerezo S{\'{a}}nchez and
Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
Mario Bustillo D{\'{\i}}az and
Apolonio Ata{-}P{\'{e}}rez},
title = {Sistema de planificaci{\'{o}}n de trayectorias utilizando visi{\'{o}}n
artificial},
journal = {Res. Comput. Sci.},
volume = {128},
pages = {141--148},
year = {2016}
}
@article{DBLP:journals/rcs/SanchezSDPFLG16,
author = {Jorge Cerezo S{\'{a}}nchez and
Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
Mario Mauricio Bustillo D{\'{\i}}az and
Apolonio Ata P{\'{e}}rez and
Jos{\'{e}} Andr{\'{e}}s V{\'{a}}zquez Flores and
Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
Gerardo {Mart{\'{\i}}nez Guzman}},
title = {Sistema de reconocimiento y clasificaci{\'{o}}n de se{\~{n}}as
para el lenguaje espa{\~{n}}ol},
journal = {Res. Comput. Sci.},
volume = {124},
pages = {73--80},
year = {2016}
}
@article{DBLP:journals/staeors/RiveiroDCSA16,
author = {Bel{\'{e}}n Riveiro and
Luc{\'{\i}}a D{\'{\i}}az{-}Vilari{\~{n}}o and
Borja Conde{-}Carnero and
Mario Soil{\'{a}}n and
Pedro Arias},
title = {Automatic Segmentation and Shape-Based Classification of Retro-Reflective
Traffic Signs from Mobile LiDAR Data},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {9},
number = {1},
pages = {295--303},
year = {2016}
}
@article{DBLP:journals/tetc/BarrioOS16,
author = {Cesar Morillas Barrio and
Mario Mu{\~{n}}oz Organero and
Joaqu{\'{\i}}n S{\'{a}}nchez{-}Soriano},
title = {Can Gamification Improve the Benefits of Student Response Systems
in Learning? An Experimental Study},
journal = {{IEEE} Trans. Emerg. Top. Comput.},
volume = {4},
number = {3},
pages = {429--438},
year = {2016}
}
@inproceedings{DBLP:conf/alife/Garcia-ValdezGC16,
author = {Mario Garc{\'{\i}}a{-}Valdez and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Paloma de las Cuevas and
Juan Juli{\'{a}}n Merelo},
title = {The human in the loop: volunteer-based metacomputers as a socio-technical
system},
booktitle = {{ALIFE}},
pages = {648--655},
publisher = {{MIT} Press},
year = {2016}
}
@inproceedings{DBLP:conf/caise/FlorezSV16,
author = {Hector Florez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Analysis of Imprecise Enterprise Models},
booktitle = {{BMMDS/EMMSAD}},
series = {Lecture Notes in Business Information Processing},
volume = {248},
pages = {349--364},
publisher = {Springer},
year = {2016}
}
@inproceedings{DBLP:conf/eccv/FelsbergKMLPHBE16,
author = {Michael Felsberg and
Matej Kristan and
Jiri Matas and
Ales Leonardis and
Roman P. Pflugfelder and
Gustav H{\"{a}}ger and
Amanda Berg and
Abdelrahman Eldesokey and
J{\"{o}}rgen Ahlberg and
Luka Cehovin and
Tom{\'{a}}s Voj{\'{\i}}r and
Alan Lukezic and
Gustavo Fern{\'{a}}ndez and
Alfredo Petrosino and
{\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and
Andr{\'{e}}s Sol{\'{\i}}s Montero and
Anton Varfolomieiev and
Aykut Erdem and
Bohyung Han and
Chang{-}Ming Chang and
Dawei Du and
Erkut Erdem and
Fahad Shahbaz Khan and
Fatih Porikli and
Fei Zhao and
Filiz Bunyak and
Francesco Battistone and
Gao Zhu and
Guna Seetharaman and
Hongdong Li and
Honggang Qi and
Horst Bischof and
Horst Possegger and
Hyeonseob Nam and
Jack Valmadre and
Jianke Zhu and
Jiayi Feng and
Jochen Lang and
Jos{\'{e}} M. Mart{\'{\i}}nez and
Kannappan Palaniappan and
Karel Lebeda and
Ke Gao and
Krystian Mikolajczyk and
Longyin Wen and
Luca Bertinetto and
Mahdieh Poostchi and
Mario Edoardo Maresca and
Martin Danelljan and
Michael Arens and
Ming Tang and
Mooyeol Baek and
Nana Fan and
Noor Al{-}Shakarji and
Ondrej Miksik and
Osman Akin and
Philip H. S. Torr and
Qingming Huang and
Rafael Martin Nieto and
Rengarajan Pelapur and
Richard Bowden and
Robert Lagani{\`{e}}re and
Sebastian Bernd Krah and
Shengkun Li and
Shizeng Yao and
Simon Hadfield and
Siwei Lyu and
Stefan Becker and
Stuart Golodetz and
Tao Hu and
Thomas Mauthner and
Vincenzo Santopietro and
Wenbo Li and
Wolfgang H{\"{u}}bner and
Xin Li and
Yang Li and
Zhan Xu and
Zhenyu He},
title = {The Thermal Infrared Visual Object Tracking {VOT-TIR2016} Challenge
Results},
booktitle = {{ECCV} Workshops {(2)}},
series = {Lecture Notes in Computer Science},
volume = {9914},
pages = {824--849},
year = {2016}
}
@inproceedings{DBLP:conf/eccv/KristanLMFPCVHL16,
author = {Matej Kristan and
Ales Leonardis and
Jiri Matas and
Michael Felsberg and
Roman P. Pflugfelder and
Luka Cehovin and
Tom{\'{a}}s Voj{\'{\i}}r and
Gustav H{\"{a}}ger and
Alan Lukezic and
Gustavo Fern{\'{a}}ndez and
Abhinav Gupta and
Alfredo Petrosino and
Alireza Memarmoghadam and
{\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and
Andr{\'{e}}s Sol{\'{\i}}s Montero and
Andrea Vedaldi and
Andreas Robinson and
Andy Jinhua Ma and
Anton Varfolomieiev and
A. Aydin Alatan and
Aykut Erdem and
Bernard Ghanem and
Bin Liu and
Bohyung Han and
Brais Mart{\'{\i}}nez and
Chang{-}Ming Chang and
Changsheng Xu and
Chong Sun and
Daijin Kim and
Dapeng Chen and
Dawei Du and
Deepak Mishra and
Dit{-}Yan Yeung and
Erhan Gundogdu and
Erkut Erdem and
Fahad Shahbaz Khan and
Fatih Porikli and
Fei Zhao and
Filiz Bunyak and
Francesco Battistone and
Gao Zhu and
Giorgio Roffo and
Gorthi R. K. Sai Subrahmanyam and
Guilherme Sousa Bastos and
Guna Seetharaman and
Henry Medeiros and
Hongdong Li and
Honggang Qi and
Horst Bischof and
Horst Possegger and
Huchuan Lu and
Hyemin Lee and
Hyeonseob Nam and
Hyung Jin Chang and
Isabela Drummond and
Jack Valmadre and
Jae{-}chan Jeong and
Jaeil Cho and
Jae{-}Yeong Lee and
Jianke Zhu and
Jiayi Feng and
Jin Gao and
Jin Young Choi and
Jingjing Xiao and
Ji{-}Wan Kim and
Jiyeoup Jeong and
Jo{\~{a}}o F. Henriques and
Jochen Lang and
Jongwon Choi and
Jos{\'{e}} M. Mart{\'{\i}}nez and
Junliang Xing and
Junyu Gao and
Kannappan Palaniappan and
Karel Lebeda and
Ke Gao and
Krystian Mikolajczyk and
Lei Qin and
Lijun Wang and
Longyin Wen and
Luca Bertinetto and
Madan Kumar Rapuru and
Mahdieh Poostchi and
Mario Edoardo Maresca and
Martin Danelljan and
Matthias Mueller and
Mengdan Zhang and
Michael Arens and
Michel F. Valstar and
Ming Tang and
Mooyeol Baek and
Muhammad Haris Khan and
Naiyan Wang and
Nana Fan and
Noor Al{-}Shakarji and
Ondrej Miksik and
Osman Akin and
Payman Moallem and
Pedro Senna and
Philip H. S. Torr and
Pong C. Yuen and
Qingming Huang and
Rafael Martin Nieto and
Rengarajan Pelapur and
Richard Bowden and
Robert Lagani{\`{e}}re and
Rustam Stolkin and
Ryan Walsh and
Sebastian Bernd Krah and
Shengkun Li and
Shengping Zhang and
Shizeng Yao and
Simon Hadfield and
Simone Melzi and
Siwei Lyu and
Siyi Li and
Stefan Becker and
Stuart Golodetz and
Sumithra Kakanuru and
Sunglok Choi and
Tao Hu and
Thomas Mauthner and
Tianzhu Zhang and
Tony P. Pridmore and
Vincenzo Santopietro and
Weiming Hu and
Wenbo Li and
Wolfgang H{\"{u}}bner and
Xiangyuan Lan and
Xiaomeng Wang and
Xin Li and
Yang Li and
Yiannis Demiris and
Yifan Wang and
Yuankai Qi and
Zejian Yuan and
Zexiong Cai and
Zhan Xu and
Zhenyu He and
Zhizhen Chi},
title = {The Visual Object Tracking {VOT2016} Challenge Results},
booktitle = {{ECCV} Workshops {(2)}},
series = {Lecture Notes in Computer Science},
volume = {9914},
pages = {777--823},
year = {2016}
}
@inproceedings{DBLP:conf/er/LaraSV16,
author = {Paola Lara and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Bridging the {IT} and {OT} Worlds Using an Extensible Modeling Language},
booktitle = {{ER}},
series = {Lecture Notes in Computer Science},
volume = {9974},
pages = {122--129},
year = {2016}
}
@inproceedings{DBLP:conf/evoW/MereloCBRGFRV16,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Pedro A. Castillo and
Israel Blancas and
Gustavo Romero and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Antonio Fern{\'{a}}ndez{-}Ares and
V{\'{\i}}ctor M. Rivas and
Mario Garc{\'{\i}}a Valdez},
title = {Benchmarking Languages for Evolutionary Algorithms},
booktitle = {EvoApplications {(2)}},
series = {Lecture Notes in Computer Science},
volume = {9598},
pages = {27--41},
publisher = {Springer},
year = {2016}
}
@inproceedings{DBLP:conf/gecco/MereloCGCRV16,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Pedro A. Castillo and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Paloma de las Cuevas and
Nuria Rico and
Mario Garc{\'{\i}}a Valdez},
title = {Performance for the Masses: Experiments with {A} Web Based Architecture
to Harness Volunteer Resources for Low Cost Distributed Evolutionary
Computation},
booktitle = {{GECCO}},
pages = {837--844},
publisher = {{ACM}},
year = {2016}
}
@inproceedings{DBLP:conf/gecco/MereloCGCV16,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Pedro A. Castillo and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Paloma de las Cuevas and
Mario Garc{\'{\i}}a Valdez},
title = {NodIO: {A} Framework and Architecture for Pool-based Evolutionary
Computation},
booktitle = {{GECCO} (Companion)},
pages = {1323--1330},
publisher = {{ACM}},
year = {2016}
}
@inproceedings{DBLP:conf/icecsys/SanchezSPZAM16,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Marcelo Schiavon Porto and
Bruno Zatt and
Luciano Volcan Agostini and
C{\'{e}}sar A. M. Marcon},
title = {Real-time simplified edge detector architecture for 3D-HEVC depth
maps coding},
booktitle = {{ICECS}},
pages = {352--355},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/iceee/Dominguez-Sanchez16,
author = {S. Dominguez{-}Sanchez and
Salvador Mendoza{-}Acevedo and
Mario Alfredo Reyes{-}Barranca and
Luis M. Flores{-}Nava and
Jose A. Moreno{-}Cadenas},
title = {Assessment of the possibility to couple a photo sensor to a Floating-gate
{MOS} transistor},
booktitle = {{CCE}},
pages = {1--5},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/iceis/RomeroSV16,
author = {Mar{\'{\i}}a Camila Romero and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Weaving Business Model Patterns - Understanding Business Models},
booktitle = {{ICEIS} {(2)}},
pages = {496--505},
publisher = {SciTePress},
year = {2016}
}
@inproceedings{DBLP:conf/iceis/RomeroSV16a,
author = {Mar{\'{\i}}a Camila Romero and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Business Model Loom: {A} Pattern-Based Approach Towards the Definition
of Business Models},
booktitle = {{ICEIS} (Revised Selected Papers)},
series = {Lecture Notes in Business Information Processing},
volume = {291},
pages = {463--487},
publisher = {Springer},
year = {2016}
}
@inproceedings{DBLP:conf/icpr/OrriteRM16,
author = {Carlos Orrite and
Mario Rodr{\'{\i}}guez and
Carlos Medrano},
title = {One-shot learning of temporal sequences using a distance dependent
Chinese Restaurant Process},
booktitle = {{ICPR}},
pages = {2694--2699},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/iecon/MorianoBMRR16,
author = {Javier Moriano and
Emilio Bueno and
Rocio Martin and
Francisco Javier Rodr{\'{\i}}guez and
Mario Rizo},
title = {Multi-frequency stationary frame grid synchronization using multiple
reduced order generalized integrators},
booktitle = {{IECON}},
pages = {2349--2354},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/ijcci/GuervosBCRGSVHR16,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Israel Blancas{-}Alvarez and
Pedro A. Castillo and
Gustavo Romero and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
V{\'{\i}}ctor Manuel Rivas Santos and
Mario Garc{\'{\i}}a Valdez and
Amaury Hern{\'{a}}ndez{-}{\'{A}}guila and
Mario Rom{\'{a}}n},
title = {Ranking the Performance of Compiled and Interpreted Languages in Genetic
Algorithms},
booktitle = {{IJCCI} {(ECTA)}},
pages = {164--170},
publisher = {SciTePress},
year = {2016}
}
@inproceedings{DBLP:conf/lascas/SaldanhaZPAS16,
author = {M{\'{a}}rio Saldanha and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini and
Gustavo Sanchez},
title = {Solutions for {DMM-1} complexity reduction in 3D-HEVC based on gradient
calculation},
booktitle = {{LASCAS}},
pages = {211--214},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/lascas/SanchezRPH16,
author = {Raul M. Sanchez and
Benjam{\'{\i}}n T. Reyes and
Ariel L. Pola and
Mario Rafael Hueda},
title = {An FPGA-based emulation platform for evaluation of time-interleaved
{ADC} calibration systems},
booktitle = {{LASCAS}},
pages = {187--190},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/micai/Cruz-GutierrezP16,
author = {Viridiana Cruz{-}Guti{\'{e}}rrez and
Mario Alberto Posada{-}Zamora and
Abraham S{\'{a}}nchez L{\'{o}}pez},
title = {An Efficient Expert System for Diabetes with a Bayesian Inference
Engine},
booktitle = {{MICAI} {(2)}},
series = {Lecture Notes in Computer Science},
volume = {10062},
pages = {54--64},
publisher = {Springer},
year = {2016}
}
@article{DBLP:journals/corr/GuervosVCGCR16,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Mario Garc{\'{\i}}a Valdez and
Pedro {\'{A}}ngel Castillo Valdivieso and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Paloma de las Cuevas and
Nuria Rico},
title = {NodIO, a JavaScript framework for volunteer-based evolutionary algorithms
: first results},
journal = {CoRR},
volume = {abs/1601.01607},
year = {2016}
}
@article{DBLP:journals/corr/Poncela-Casasnovas16,
author = {Julia Poncela{-}Casasnovas and
Mario Guti{\'{e}}rrez{-}Roig and
Carlos Gracia{-}L{\'{a}}zaro and
Juli{\'{a}}n Vicens and
Jes{\'{u}}s G{\'{o}}mez{-}Garde{\~{n}}es and
Josep Perello and
Yamir Moreno and
Jordi Duch and
{\'{A}}ngel S{\'{a}}nchez},
title = {Humans display a reduced set of consistent behavioral phenotypes in
dyadic games},
journal = {CoRR},
volume = {abs/1608.02015},
year = {2016}
}
@article{DBLP:journals/corr/TellezMGMSS16,
author = {Eric Sadit Tellez and
Sabino Miranda{-}Jim{\'{e}}nez and
Mario Graff and
Daniela Moctezuma and
Ranyart Rodrigo Su{\'{a}}rez and
Oscar S{\'{a}}nchez Siordia},
title = {A Simple Approach to Multilingual Polarity Classification in Twitter},
journal = {CoRR},
volume = {abs/1612.05270},
year = {2016}
}
@article{DBLP:journals/jam/Filobello-NinoV15,
author = {Uriel Filobello{-}Ni{\~{n}}o and
H{\'{e}}ctor V{\'{a}}zquez{-}Leal and
Karem Boubaker and
Arturo Sarmiento{-}Reyes and
Agustin Perez{-}Sesma and
Alejandro D{\'{\i}}az{-}S{\'{a}}nchez and
V{\'{\i}}ctor Manuel Jimenez{-}Fernandez and
Juan Cervantes{-}Perez and
Jesus Sanchez{-}Orea and
Jesus Huerta{-}Chua and
Luis J. Morales{-}Mendoza and
Mario Gonzalez{-}Lee and
Carlos Hern{\'{a}}ndez{-}Mej{\'{\i}}a and
Francisco Javier Gonzalez{-}Martinez},
title = {Nonlinearities Distribution Homotopy Perturbation Method Applied to
Solve Nonlinear Problems: Thomas-Fermi Equation as a Case Study},
journal = {J. Appl. Math.},
volume = {2015},
pages = {405108:1--405108:9},
year = {2015}
}
@article{DBLP:journals/jei/SanchezSBZPA15,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Gabriel Balota and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini},
title = {DMMFast: a complexity reduction scheme for three-dimensional high-efficiency
video coding intraframe depth map coding},
journal = {J. Electronic Imaging},
volume = {24},
number = {2},
pages = {023011},
year = {2015}
}
@article{DBLP:journals/jot/NaranjoSV15,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Evaluating the capabilities of Enterprise Architecture modeling tools
for Visual Analysis},
journal = {J. Object Technol.},
volume = {14},
number = {1},
pages = {3:1--32},
year = {2015}
}
@article{DBLP:journals/jpdc/Aartsen15,
author = {Mark G. Aartsen and
Rasha U. Abbasi and
Markus Ackermann and
Jenni Adams and
Juan Antonio Aguilar S{\'{a}}nchez and
Markus Ahlers and
David Altmann and
Carlos A. Arg{\"{u}}elles Delgado and
Jan Auffenberg and
Xinhua Bai and
Michael F. Baker and
Steven W. Barwick and
Volker Baum and
Ryan Bay and
James J. Beatty and
Julia K. Becker Tjus and
Karl{-}Heinz Becker and
Segev BenZvi and
Patrick Berghaus and
David Berley and
Elisa Bernardini and
Anna Bernhard and
David Z. Besson and
G. Binder and
Daniel Bindig and
Martin Bissok and
Erik Blaufuss and
Jan Blumenthal and
David J. Boersma and
Christian Bohm and
Debanjan Bose and
Sebastian B{\"{o}}ser and
Olga Botner and
Lionel Brayeur and
Hans{-}Peter Bretz and
Anthony M. Brown and
Ronald Bruijn and
James Casey and
Martin Casier and
Dmitry Chirkin and
Asen Christov and
Brian John Christy and
Ken Clark and
Lew Classen and
Fabian Clevermann and
Stefan Coenders and
Shirit Cohen and
Doug F. Cowen and
Angel H. Cruz Silva and
Matthias Danninger and
Jacob Daughhetee and
James C. Davis and
Melanie Day and
Catherine De Clercq and
Sam De Ridder and
Paolo Desiati and
Krijn D. de Vries and
Meike de With and
Tyce DeYoung and
Juan Carlos D{\'{\i}}az{-}V{\'{e}}lez and
Matthew Dunkman and
Ryan Eagan and
Benjamin Eberhardt and
Bj{\"{o}}rn Eichmann and
Jonathan Eisch and
Sebastian Euler and
Paul A. Evenson and
Oladipo O. Fadiran and
Ali R. Fazely and
Anatoli Fedynitch and
Jacob Feintzeig and
Tom Feusels and
Kirill Filimonov and
Chad Finley and
Tobias Fischer{-}Wasels and
Samuel Flis and
Anna Franckowiak and
Katharina Frantzen and
Tomasz Fuchs and
Thomas K. Gaisser and
Joseph S. Gallagher and
Lisa Marie Gerhardt and
Laura E. Gladstone and
Thorsten Gl{\"{u}}senkamp and
Azriel Goldschmidt and
Geraldina Golup and
Javier G. Gonz{\'{a}}lez and
Jordan A. Goodman and
Dariusz G{\'{o}}ra and
Dylan T. Grandmont and
Darren Grant and
Pavel Gretskov and
John C. Groh and
Andreas Gro{\ss} and
Chang Hyon Ha and
Abd Al Karim Haj Ismail and
Patrick Hallen and
Allan Hallgren and
Francis Halzen and
Kael D. Hanson and
Dustin Hebecker and
David Heereman and
Dirk Heinen and
Klaus Helbing and
Robert Eugene Hellauer III and
Stephanie Virginia Hickford and
Gary C. Hill and
Kara D. Hoffman and
Ruth Hoffmann and
Andreas Homeier and
Kotoyo Hoshina and
Feifei Huang and
Warren Huelsnitz and
Per Olof Hulth and
Klas Hultqvist and
Shahid Hussain and
Aya Ishihara and
Emanuel Jacobi and
John E. Jacobsen and
Kai Jagielski and
George S. Japaridze and
Kyle Jero and
Ola Jlelati and
Basho Kaminsky and
Alexander Kappes and
Timo Karg and
Albrecht Karle and
Matthew Kauer and
John Lawrence Kelley and
Joanna Kiryluk and
J. Kl{\"{a}}s and
Spencer R. Klein and
Jan{-}Hendrik K{\"{o}}hne and
Georges Kohnen and
Hermann Kolanoski and
Lutz K{\"{o}}pke and
Claudio Kopper and
Sandro Kopper and
D. Jason Koskinen and
Marek Kowalski and
Mark Krasberg and
Anna Kriesten and
Kai Michael Krings and
G{\"{o}}sta Kroll and
Jan Kunnen and
Naoko Kurahashi and
Takao Kuwabara and
Mathieu L. M. Labare and
Hagar Landsman and
Michael James Larson and
Mariola Lesiak{-}Bzdak and
Martin Leuermann and
Julia Leute and
Jan L{\"{u}}nemann and
Oscar A. Mac{\'{\i}}as{-}Ram{\'{\i}}rez and
James Madsen and
Giuliano Maggi and
Reina Maruyama and
Keiichi Mase and
Howard S. Matis and
Frank McNally and
Kevin James Meagher and
Martin Merck and
Gonzalo Merino Ar{\'{e}}valo and
Thomas Meures and
Sandra Miarecki and
Eike Middell and
Natalie Milke and
John Lester Miller and
Lars Mohrmann and
Teresa Montaruli and
Robert M. Morse and
Rolf Nahnhauer and
Uwe Naumann and
Hans Niederhausen and
Sarah C. Nowicki and
David R. Nygren and
Anna Obertacke and
Sirin Odrowski and
Alex Olivas and
Ahmad Omairat and
Aongus Starbuck {\'{O}} Murchadha and
Larissa Paul and
Joshua A. Pepper and
Carlos P{\'{e}}rez de los Heros and
Carl Pfendner and
Damian Pieloth and
Elisa Pinat and
Jonas Posselt and
P. Buford Price and
Gerald T. Przybylski and
Melissa Quinnan and
Leif R{\"{a}}del and
Ian Rae and
Mohamed Rameez and
Katherine Rawlins and
Peter Christian Redl and
Ren{\'{e}} Reimann and
Elisa Resconi and
Wolfgang Rhode and
Mathieu Ribordy and
Michael Richman and
Benedikt Riedel and
J. P. Rodrigues and
Carsten Rott and
Tim Ruhe and
Bakhtiyar Ruzybayev and
Dirk Ryckbosch and
Sabine M. Saba and
Heinz{-}Georg Sander and
Juan Marcos Santander and
Subir Sarkar and
Kai Schatto and
Florian Scheriau and
Torsten Schmidt and
Martin Schmitz and
Sebastian Schoenen and
Sebastian Sch{\"{o}}neberg and
Arne Sch{\"{o}}nwald and
Anne Schukraft and
Lukas Schulte and
David Schultz and
Olaf Schulz and
David Seckel and
Yolanda Sestayo de la Cerra and
Surujhdeo Seunarine and
Rezo Shanidze and
Chris Sheremata and
Miles W. E. Smith and
Dennis Soldin and
Glenn M. Spiczak and
Christian Spiering and
Michael Stamatikos and
Todor Stanev and
Nick A. Stanisha and
Alexander Stasik and
Thorsten Stezelberger and
Robert G. Stokstad and
Achim St{\"{o}}{\ss}l and
Erik A. Strahler and
Rickard Str{\"{o}}m and
Nora Linn Strotjohann and
Gregory W. Sullivan and
Henric Taavola and
Ignacio J. Taboada and
Alessio Tamburro and
Andreas Tepe and
Samvel Ter{-}Antonyan and
Gordana Tesic and
Serap Tilav and
Patrick A. Toale and
Moriah Natasha Tobin and
Simona Toscano and
Maria Tselengidou and
Elisabeth Unger and
Marcel Usner and
Sofia Vallecorsa and
Nick van Eijndhoven and
Arne Van Overloop and
Jakob van Santen and
Markus Vehring and
Markus Voge and
Matthias Vraeghe and
Christian Walck and
Tilo Waldenmaier and
Marius Wallraff and
Christopher N. Weaver and
Mark T. Wellons and
Christopher H. Wendt and
Stefan Westerhoff and
Nathan Whitehorn and
Klaus Wiebe and
Christopher Wiebusch and
Dawn R. Williams and
Henrike Wissing and
Martin Wolf and
Terri R. Wood and
Kurt Woschnagg and
Donglian Xu and
Xianwu Xu and
Juan Pablo Y{\'{a}}{\~{n}}ez Garza and
Gaurang B. Yodh and
Shigeru Yoshida and
Pavel Zarzhitsky and
Jan Ziemann and
Simon Zierke and
Marcel Zoll},
title = {The IceProd framework: Distributed data processing for the IceCube
neutrino observatory},
journal = {J. Parallel Distributed Comput.},
volume = {75},
pages = {198--211},
year = {2015}
}
@article{DBLP:journals/jsce/Amezquita-Brooks15,
author = {Luis Antonio Amezquita{-}Brooks and
Diana Hernandez{-}Alcantara and
Mario Francisco Gonz{\'{a}}lez{-}S{\'{a}}nchez and
Juan Carlos Tud{\'{o}}n{-}Mart{\'{\i}}nez},
title = {Linear programming predictive control with actuator saturation: Experimental
robustness and performance results},
journal = {J. Syst. Control. Eng.},
volume = {229},
number = {8},
pages = {700--710},
year = {2015}
}
@article{DBLP:journals/rcs/Anzures-GarciaS15,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Miguel J. Hornos and
Patricia Paderewski{-}Rodr{\'{\i}}guez},
title = {A Software Architecture for Defining a Methodologic Approach to Develop
Collaborative Applications},
journal = {Res. Comput. Sci.},
volume = {105},
pages = {9--20},
year = {2015}
}
@article{DBLP:journals/rcs/Cruz-GutierrezP15,
author = {Viridiana Cruz{-}Guti{\'{e}}rrez and
Mario Alberto Posada{-}Zamora and
Maya Carrillo and
Luis Enrique Colmenares Guill{\'{e}}n and
Abraham S{\'{a}}nchez L{\'{o}}pez},
title = {Preprocesamiento de un corpus empleando correcci{\'{o}}n probabil{\'{\i}}stica
para precisar el vocabulario},
journal = {Res. Comput. Sci.},
volume = {99},
pages = {43--54},
year = {2015}
}
@article{DBLP:journals/simulation/ManzurUSV15,
author = {Laura Manzur and
Jorge Mario Ulloa and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {xArchiMate: Enterprise Architecture simulation, experimentation and
analysis},
journal = {Simul.},
volume = {91},
number = {3},
pages = {276--301},
year = {2015}
}
@article{DBLP:journals/tii/RizoLBRG15,
author = {Mario Rizo and
Marco Liserre and
Emilio Jos{\'{e}} Bueno and
Francisco J. Rodr{\'{\i}}guez and
Carlos Giron},
title = {Voltage Control Architectures for the Universal Operation of {DPGS}},
journal = {{IEEE} Trans. Ind. Informatics},
volume = {11},
number = {2},
pages = {313--321},
year = {2015}
}
@article{DBLP:journals/titb/SomolinosCHPTSF15,
author = {Roberto Somolinos and
Adolfo Mu{\~{n}}oz Carrero and
M. Elena Hernando and
Mario Pascual Carrasco and
Jes{\'{u}}s C{\'{a}}ceres Tello and
Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
Juan A. Fragua and
Pablo Serrano and
Carlos Hern{\'{a}}ndez Salvador},
title = {Service for the Pseudonymization of Electronic Healthcare Records
Based on {ISO/EN} 13606 for the Secondary Use of Information},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {19},
number = {6},
pages = {1937--1944},
year = {2015}
}
@article{DBLP:journals/ton/SanchezOBCBKW15,
author = {Mario A. S{\'{a}}nchez and
John S. Otto and
Zachary S. Bischof and
David R. Choffnes and
Fabian E. Bustamante and
Balachander Krishnamurthy and
Walter Willinger},
title = {A Measurement Experimentation Platform at the Internet's Edge},
journal = {{IEEE/ACM} Trans. Netw.},
volume = {23},
number = {6},
pages = {1944--1958},
year = {2015}
}
@inproceedings{DBLP:conf/approx/BrodyS15,
author = {Joshua Brody and
Mario S{\'{a}}nchez},
title = {Dependent Random Graphs and Multi-Party Pointer Jumping},
booktitle = {{APPROX-RANDOM}},
series = {LIPIcs},
volume = {40},
pages = {606--624},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2015}
}
@inproceedings{DBLP:conf/caise/NaranjoSV15,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {The Devil in the Details: Fine-Grained Enterprise Model Weaving},
booktitle = {CAiSE Workshops},
series = {Lecture Notes in Business Information Processing},
volume = {215},
pages = {233--244},
publisher = {Springer},
year = {2015}
}
@inproceedings{DBLP:conf/caise/RamosSSV15,
author = {Andr{\'{e}}s Ramos and
Juan Pablo S{\'{a}}enz and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {On the Support of Automated Analysis Chains on Enterprise Models},
booktitle = {{BMMDS/EMMSAD}},
series = {Lecture Notes in Business Information Processing},
volume = {214},
pages = {345--359},
publisher = {Springer},
year = {2015}
}
@inproceedings{DBLP:conf/fskd/Sanchez-Camacho15,
author = {Mario Garcia{-}Munoz Sanchez{-}Camacho and
Hongying Wu and
Carlos Alberto Nunes Cosenza and
Fabio Krykhtine and
F{\'{e}}lix Mora{-}Camino},
title = {Fuzzy setting of cost Index for improved flight management},
booktitle = {{FSKD}},
pages = {433--438},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/ibpria/RodriguezMHO15,
author = {Mario Rodr{\'{\i}}guez and
Carlos Medrano and
El{\'{\i}}as Herrero and
Carlos Orrite},
title = {Spectral Clustering Using Friendship Path Similarity},
booktitle = {IbPRIA},
series = {Lecture Notes in Computer Science},
volume = {9117},
pages = {319--326},
publisher = {Springer},
year = {2015}
}
@inproceedings{DBLP:conf/iscas/SaldanhaSZPA15,
author = {M{\'{a}}rio Saldanha and
Gustavo Sanchez and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini},
title = {Complexity reduction for the 3D-HEVC depth maps coding},
booktitle = {{ISCAS}},
pages = {621--624},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/iwbbio/SanchezFCAC15,
author = {Horacio P{\'{e}}rez S{\'{a}}nchez and
Afshin Fassihi and
Jos{\'{e}} M. Cecilia and
Hesham H. Ali and
Mario Cannataro},
title = {Applications of High Performance Computing in Bioinformatics, Computational
Biology and Computational Chemistry},
booktitle = {{IWBBIO} {(2)}},
series = {Lecture Notes in Computer Science},
volume = {9044},
pages = {527--541},
publisher = {Springer},
year = {2015}
}
@inproceedings{DBLP:conf/lascas/SanchezSZPA15,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini},
title = {{S-GMOF:} {A} gradient-based complexity reduction algorithm for depth-maps
intra prediction on 3D-HEVC},
booktitle = {{LASCAS}},
pages = {1--4},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/mie/MorenoGCLLSBGWC15,
author = {Pedro A. Moreno and
Jos{\'{e}} Luis Garcia{-}Pacheco and
Jim Charvill and
Ahmad Lotfi and
Caroline S. Langensiepen and
Alison Saunders and
Kris Berckmans and
Jozef Gaspersic and
Louise Walton and
Montserrat Carmona Rodriguez and
S. Perez de la Camara and
Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
J. Pozo and
Adolfo Mu{\~{n}}oz and
Mario Pascual Carrasco and
Enrique J. G{\'{o}}mez},
title = {iCarer: {AAL} for the Informal Carers of the Elderly},
booktitle = {{MIE}},
series = {Studies in Health Technology and Informatics},
volume = {210},
pages = {678--680},
publisher = {{IOS} Press},
year = {2015}
}
@inproceedings{DBLP:conf/mie/Sanchez-de-Madariaga15,
author = {Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
Adolfo Mu{\~{n}}oz Carrero and
Roberto Somolinos and
Antonio L. Castro and
Iker Vel{\'{a}}zquez and
Oscar Moreno and
Jos{\'{e}} L. Garc{\'{\i}}a{-}Pacheco and
Mario Pascual Carrasco and
Carlos Hern{\'{a}}ndez Salvador},
title = {Normalized medical information visualization},
booktitle = {{MIE}},
series = {Studies in Health Technology and Informatics},
volume = {210},
pages = {215--217},
publisher = {{IOS} Press},
year = {2015}
}
@inproceedings{DBLP:conf/mswim/Sanchez-Hernandez15,
author = {Jairo Javier Sanchez{-}Hernandez and
Rolando Menchaca{-}M{\'{e}}ndez and
Ricardo Menchaca{-}Mendez and
Jesus Garcia{-}Diaz and
Mario E. Rivero{-}Angeles and
Jose Joaquin Garcia{-}Luna{-}Aceves},
title = {A Bloom Filter-Based Algorithm for Routing in Intermittently Connected
Mobile Networks},
booktitle = {MSWiM},
pages = {319--326},
publisher = {{ACM}},
year = {2015}
}
@inproceedings{DBLP:conf/sepln/SiordiaMGMTV15,
author = {Oscar S. Siordia and
Daniela Moctezuma and
Mario Graff and
Sabino Miranda{-}Jim{\'{e}}nez and
Eric Sadit T{\'{e}}llez and
Elio{-}Aten{\'{o}}genes Villase{\~{n}}or},
title = {Sentiment Analysis for Twitter: {TASS} 2015},
booktitle = {TASS@SEPLN},
series = {{CEUR} Workshop Proceedings},
volume = {1397},
pages = {65--70},
publisher = {CEUR-WS.org},
year = {2015}
}
@inproceedings{DBLP:conf/sigcomm/SanchezBKW15,
author = {Mario A. S{\'{a}}nchez and
Fabi{\'{a}}n E. Bustamante and
Balachander Krishnamurthy and
Walter Willinger},
title = {Experiment Coordination for Large-scale Measurement Platforms},
booktitle = {C2B(I)D@SIGCOMM},
pages = {21--26},
publisher = {{ACM}},
year = {2015}
}
@inproceedings{DBLP:conf/ucami/Ferrandez-Pastor15,
author = {Francisco Javier Ferr{\'{a}}ndez Pastor and
Higinio Mora Mora and
Jos{\'{e}}{-}Luis S{\'{a}}nchez{-}Romero and
Mario Nieto{-}Hidalgo},
title = {Smart Sensor Design for Power Signal Processing},
booktitle = {UCAmI},
series = {Lecture Notes in Computer Science},
volume = {9454},
pages = {387--393},
publisher = {Springer},
year = {2015}
}
@incollection{DBLP:series/sci/LocesRPBH15,
author = {Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
Kavita Rege and
Johnatan E. Pecero and
Pascal Bouvry and
H{\'{e}}ctor J. {Fraire H.}},
title = {Trajectory Metaheuristics for the Internet Shopping Optimization Problem},
booktitle = {Design of Intelligent Systems Based on Fuzzy Logic, Neural Networks
and Nature-Inspired Optimization},
series = {Studies in Computational Intelligence},
volume = {601},
pages = {527--536},
publisher = {Springer},
year = {2015}
}
@article{DBLP:journals/corr/BrodyS15,
author = {Joshua Brody and
Mario S{\'{a}}nchez},
title = {Dependent Random Graphs and Multiparty Pointer Jumping},
journal = {CoRR},
volume = {abs/1506.01083},
year = {2015}
}
@article{DBLP:journals/corr/MereloGVB15,
author = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Mario Garc{\'{\i}}a Valdez and
Israel Blancas},
title = {There is no fast lunch: an examination of the running speed of evolutionary
algorithms in several languages},
journal = {CoRR},
volume = {abs/1511.01088},
year = {2015}
}
@article{DBLP:journals/eccc/BrodyS15,
author = {Joshua Brody and
Mario S{\'{a}}nchez},
title = {Dependent Random Graphs and Multiparty Pointer Jumping},
journal = {Electron. Colloquium Comput. Complex.},
volume = {{TR15-091}},
year = {2015}
}
@article{DBLP:journals/computing/GansnerKWBS14,
author = {Emden R. Gansner and
Balachander Krishnamurthy and
Walter Willinger and
Fabi{\'{a}}n E. Bustamante and
Mario A. S{\'{a}}nchez},
title = {Demo abstract: towards extracting semantics by visualizing large traceroute
datasets},
journal = {Computing},
volume = {96},
number = {1},
pages = {81--83},
year = {2014}
}
@article{DBLP:journals/dsp/Rodriguez-DiazS14,
author = {Mario A. Rodr{\'{\i}}guez{-}D{\'{\i}}az and
Hermilo S{\'{a}}nchez{-}Cruz},
title = {Refined fixed double pass binary object classification for document
image compression},
journal = {Digit. Signal Process.},
volume = {30},
pages = {114--130},
year = {2014}
}
@article{DBLP:journals/ejwcn/Cortes-SanchezVLRS14,
author = {Jorge Cort{\'{e}}s{-}S{\'{a}}nchez and
Andr{\'{e}}s Vel{\'{a}}zquez{-}Ram{\'{\i}}rez and
Andr{\'{e}}s Lucas{-}Bravo and
Mario E. Rivero{-}Angeles and
Victor A. Salinas{-}Reyes},
title = {On the use of electromagnetic waves as means of power supply in wireless
sensor networks},
journal = {{EURASIP} J. Wirel. Commun. Netw.},
volume = {2014},
pages = {36},
year = {2014}
}
@article{DBLP:journals/evi/MoraGGCRH14,
author = {Antonio Miguel Mora and
Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Pedro A. Castillo and
M. S. Rodr{\'{\i}}guez{-}Domingo and
R. M. Hidalgo{-}Berm{\'{u}}dez},
title = {Creating autonomous agents for playing Super Mario Bros game by means
of evolutionary finite state machines},
journal = {Evol. Intell.},
volume = {6},
number = {4},
pages = {205--218},
year = {2014}
}
@article{DBLP:journals/ijns/GonzalezDRS14,
author = {Mario Gonz{\'{a}}lez and
David Dominguez and
Francisco B. Rodr{\'{\i}}guez and
{\'{A}}ngel S{\'{a}}nchez},
title = {Retrieval of noisy Fingerprint Patterns using Metric Attractor Networks},
journal = {Int. J. Neural Syst.},
volume = {24},
number = {7},
year = {2014}
}
@article{DBLP:journals/jot/GomezSFV14,
author = {Paola G{\'{o}}mez and
Mario E. S{\'{a}}nchez and
Hector Florez and
Jorge Villalobos},
title = {An approach to the co-creation of models and metamodels in Enterprise
Architecture Projects},
journal = {J. Object Technol.},
volume = {13},
number = {3},
pages = {2: 1--29},
year = {2014}
}
@article{DBLP:journals/pnas/Gavalda-Miralles14,
author = {Arnau Gavald{\`{a}}{-}Miralles and
David R. Choffnes and
John S. Otto and
Mario A. S{\'{a}}nchez and
Fabi{\'{a}}n E. Bustamante and
Lu{\'{\i}}s A. Nunes Amaral and
Jordi Duch and
Roger Guimer{\`{a}}},
title = {Impact of heterogeneity and socioeconomic factors on individual behavior
in decentralized sharing ecosystems},
journal = {Proc. Natl. Acad. Sci. {USA}},
volume = {111},
number = {43},
pages = {15322--15327},
year = {2014}
}
@article{DBLP:journals/polibits/JaramilloSP14,
author = {Carlos Mario Zapata Jaramillo and
Rafael Esteban Arango Sanchez and
Leidy Diana Jim{\'{e}}nez Pinz{\'{o}}n},
title = {Mejoramiento de la consistencia entre la sintaxis textual y gr{\'{a}}fica
del lenguaje de Semat},
journal = {Polibits},
volume = {49},
pages = {83--89},
year = {2014}
}
@inproceedings{DBLP:conf/caise/RamosGSV14,
author = {Andr{\'{e}}s Ramos and
Paola G{\'{o}}mez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Automated Enterprise-Level Analysis of ArchiMate Models},
booktitle = {{BMMDS/EMMSAD}},
series = {Lecture Notes in Business Information Processing},
volume = {175},
pages = {439--453},
publisher = {Springer},
year = {2014}
}
@inproceedings{DBLP:conf/caise/SanchezRV14,
author = {Mario E. S{\'{a}}nchez and
Julio Cesar Reyes and
Jorge Villalobos},
title = {Extraction and Reconstruction of Enterprise Models},
booktitle = {EOMAS@CAiSE},
series = {Lecture Notes in Business Information Processing},
volume = {191},
pages = {3--20},
publisher = {Springer},
year = {2014}
}
@inproceedings{DBLP:conf/ccgrid/DiazPBSVC14,
author = {Cesar O. Diaz and
Johnatan E. Pecero and
Pascal Bouvry and
German Sotelo and
Mario Villamizar and
Harold E. Castro},
title = {Performance Evaluation of an IaaS Opportunistic Cloud Computing},
booktitle = {{CCGRID}},
pages = {546--547},
publisher = {{IEEE} Computer Society},
year = {2014}
}
@inproceedings{DBLP:conf/clei/DivanORCFM14,
author = {Mario Jos{\'{e}} Div{\'{a}}n and
Ana Oddone and
Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso and
Bruno Sebastian Cavallo and
Marcos Alejandro Fredes and
Alejandro Maximiliano Martinez},
title = {A data monitoring strategy based in snapshots for the score calculation
in the housing distribution},
booktitle = {{CLEI}},
pages = {1--12},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/edoc/FlorezSV14,
author = {Hector Florez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Extensible Model-Based Approach for Supporting Automatic Enterprise
Analysis},
booktitle = {{EDOC}},
pages = {32--41},
publisher = {{IEEE} Computer Society},
year = {2014}
}
@inproceedings{DBLP:conf/edoc/FlorezSV14a,
author = {Hector Florez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {iArchiMate: {A} Tool for Managing Imperfection in Enterprise Models},
booktitle = {{EDOC} Workshops},
pages = {201--210},
publisher = {{IEEE} Computer Society},
year = {2014}
}
@inproceedings{DBLP:conf/edoc/NaranjoSV14,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Towards a Unified and Modular Approach for Visual Analysis of Enterprise
Models},
booktitle = {{EDOC} Workshops},
pages = {77--86},
publisher = {{IEEE} Computer Society},
year = {2014}
}
@inproceedings{DBLP:conf/iceee/Dominguez-Sanchez14,
author = {S. Dominguez{-}Sanchez and
Mario Alfredo Reyes{-}Barranca and
G. S. Abarca{-}Jimenez and
Salvador Mendoza{-}Acevedo},
title = {A prototype design for an accelerometer using a multiple floating-gate
{MOSFET} as a transducer},
booktitle = {{CCE}},
pages = {1--6},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/iceis/NaranjoSV14,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {PRIMROSe - {A} Tool for Enterprise Architecture Analysis and Diagnosis},
booktitle = {{ICEIS} {(3)}},
pages = {201--213},
publisher = {SciTePress},
year = {2014}
}
@inproceedings{DBLP:conf/iceis/NaranjoSV14a,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {PRIMROSe: {A} Graph-Based Approach for Enterprise Architecture Analysis},
booktitle = {{ICEIS} (Revised Selected Papers)},
series = {Lecture Notes in Business Information Processing},
volume = {227},
pages = {434--452},
publisher = {Springer},
year = {2014}
}
@inproceedings{DBLP:conf/icete/MusialPLFBB14,
author = {Jedrzej Musial and
Johnatan E. Pecero and
Mario C. Lopez and
H{\'{e}}ctor J. {Fraire H.} and
Pascal Bouvry and
Jacek Blazewicz},
title = {How to Efficiently Solve Internet Shopping Optimization Problem with
Price Sensitive Discounts?},
booktitle = {{ICE-B}},
pages = {209--215},
publisher = {SciTePress},
year = {2014}
}
@inproceedings{DBLP:conf/icip/SanchezSBZPA14,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Gabriel Balota and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini},
title = {Complexity reduction for 3D-HEVC depth maps intra-frame prediction
using simplified edge detector algorithm},
booktitle = {{ICIP}},
pages = {3209--3213},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/icira/PrudencioSGL14,
author = {Alejandro Prudencio and
Eduardo Morales Sanchez and
Mario A. Garc{\'{\i}}a and
Alejandro Lozano},
title = {Anthropometric and Anthropomorphic Features Applied to a Mechanical
Finger},
booktitle = {{ICIRA} {(1)}},
series = {Lecture Notes in Computer Science},
volume = {8917},
pages = {254--265},
publisher = {Springer},
year = {2014}
}
@inproceedings{DBLP:conf/imc/SanchezBKWSE14,
author = {Mario A. S{\'{a}}nchez and
Fabi{\'{a}}n E. Bustamante and
Balachander Krishnamurthy and
Walter Willinger and
Georgios Smaragdakis and
Jeffrey Erman},
title = {Inter-Domain Traffic Estimation for the Outsider},
booktitle = {Internet Measurement Conference},
pages = {1--14},
publisher = {{ACM}},
year = {2014}
}
@inproceedings{DBLP:conf/iolts/Sanchez-ClementeEG14,
author = {Antonio Sanchez{-}Clemente and
Luis Entrena and
Mario Garc{\'{\i}}a{-}Valderas},
title = {Error masking with approximate logic circuits using dynamic probability
estimations},
booktitle = {{IOLTS}},
pages = {134--139},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/lanmr/Anzures-GarciaSHP14,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Miguel J. Hornos and
Patricia Paderewski},
title = {Knowledge Representation for Development of Collaborative Applications},
booktitle = {{LANMR}},
series = {{CEUR} Workshop Proceedings},
volume = {1287},
pages = {1--9},
publisher = {CEUR-WS.org},
year = {2014}
}
@inproceedings{DBLP:conf/lascas/BalotaSSZPA14,
author = {Gabriel Balota and
M{\'{a}}rio Saldanha and
Gustavo Sanchez and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini},
title = {Overview and quality analysis in 3D-HEVC emergent video coding standard},
booktitle = {{LASCAS}},
pages = {1--4},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/lascas/ReyesPTLSMH14,
author = {Benjam{\'{\i}}n T. Reyes and
German Paulina and
Lucas Tealdi and
Emanuel Labat and
Raul M. Sanchez and
Pablo Sergio Mandolesi and
Mario Rafael Hueda},
title = {A 1.6Gb/s {CMOS} {LVDS} transmitter with a programmable pre-emphasis
system},
booktitle = {{LASCAS}},
pages = {1--4},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/lascas/ReyesTPLSMH14,
author = {Benjam{\'{\i}}n T. Reyes and
Lucas Tealdi and
German Paulina and
Emanuel Labat and
Raul M. Sanchez and
Pablo Sergio Mandolesi and
Mario Rafael Hueda},
title = {A 6-bit 2GS/s {CMOS} time-interleaved {ADC} for analysis of mixed-signal
calibration techniques},
booktitle = {{LASCAS}},
pages = {1--4},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/vcip/SanchezSBZPA14,
author = {Gustavo Sanchez and
M{\'{a}}rio Saldanha and
Gabriel Balota and
Bruno Zatt and
Marcelo Schiavon Porto and
Luciano Volcan Agostini},
title = {A complexity reduction algorithm for depth maps intra prediction on
the 3D-HEVC},
booktitle = {{VCIP}},
pages = {137--140},
publisher = {{IEEE}},
year = {2014}
}
@incollection{DBLP:series/sci/LocesCHBPRBV14,
author = {Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
Norberto Castillo{-}Garc{\'{\i}}a and
H{\'{e}}ctor J. {Fraire H.} and
Pascal Bouvry and
Johnatan E. Pecero and
Rodolfo A. Pazos Rangel and
Juan Javier Gonz{\'{a}}lez Barbosa and
Fevrier Valdez},
title = {A New Integer Linear Programming Model for the Cutwidth Minimization
Problem of a Connected Undirected Graph},
booktitle = {Recent Advances on Hybrid Approaches for Designing Intelligent Systems},
series = {Studies in Computational Intelligence},
volume = {547},
pages = {509--517},
publisher = {Springer},
year = {2014}
}
@article{DBLP:journals/cluster/CastroVSDPB13,
author = {Harold E. Castro and
Mario Villamizar and
German Sotelo and
Cesar O. Diaz and
Johnatan E. Pecero and
Pascal Bouvry},
title = {Green flexible opportunistic computing with task consolidation and
virtualization},
journal = {Clust. Comput.},
volume = {16},
number = {3},
pages = {545--557},
year = {2013}
}
@article{DBLP:journals/cmpb/Martinez-ZarzuelaGPFH13,
author = {Mario Mart{\'{\i}}nez{-}Zarzuela and
Carlos G{\'{o}}mez and
Francisco Javier D{\'{\i}}az Pernas and
Alberto Fern{\'{a}}ndez and
Roberto Hornero},
title = {Cross-Approximate Entropy parallel computation on GPUs for biomedical
signal analysis. Application to {MEG} recordings},
journal = {Comput. Methods Programs Biomed.},
volume = {112},
number = {1},
pages = {189--199},
year = {2013}
}
@article{DBLP:journals/envsoft/RodriguezMDAHM13,
author = {Juan Pablo Rodr{\'{\i}}guez and
Neil Duncan McIntyre and
Mario D{\'{\i}}az{-}Granados and
Stefan Achleitner and
Martin Hochedlinger and
Cedo Maksimovic},
title = {Generating time-series of dry weather loads to sewers},
journal = {Environ. Model. Softw.},
volume = {43},
pages = {133--143},
year = {2013}
}
@article{DBLP:journals/ijcis/Sanchez-GonzalezGRP13,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
F{\'{e}}lix Garc{\'{\i}}a and
Francisco Ruiz and
Mario Piattini},
title = {Toward a Quality Framework for Business Process Models},
journal = {Int. J. Cooperative Inf. Syst.},
volume = {22},
number = {1},
year = {2013}
}
@article{DBLP:journals/jamia/Sanchez-de-MadariagaCTSPMSM13,
author = {Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
Adolfo Mu{\~{n}}oz Carrero and
Jes{\'{u}}s C{\'{a}}ceres Tello and
Roberto Somolinos and
Mario Pascual Carrasco and
Ignacio Mart{\'{\i}}nez and
Carlos Hern{\'{a}}ndez Salvador and
Jose Luis Monteagudo},
title = {ccML, a new mark-up language to improve {ISO/EN} 13606-based electronic
health record extracts practical edition},
journal = {J. Am. Medical Informatics Assoc.},
volume = {20},
number = {2},
pages = {298--304},
year = {2013}
}
@article{DBLP:journals/mcs/RizoLBRH13,
author = {Mario Rizo and
Marco Liserre and
Emilio Jos{\'{e}} Bueno and
Francisco J. Rodr{\'{\i}}guez and
Francisco Huerta},
title = {Universal wind turbine working in grid-connected and island operating
modes},
journal = {Math. Comput. Simul.},
volume = {91},
pages = {41--51},
year = {2013}
}
@article{DBLP:journals/prl/Sanchez-EscobedoC13,
author = {Dalila S{\'{a}}nchez{-}Escobedo and
Mario Castel{\'{a}}n},
title = {3D face shape prediction from a frontal image using cylindrical coordinates
and partial least squares},
journal = {Pattern Recognit. Lett.},
volume = {34},
number = {4},
pages = {389--399},
year = {2013}
}
@article{DBLP:journals/rcc/SanchezV13,
author = {Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {An Expanded and Refined Catalog of Time Patterns for Workflows},
journal = {Rev. Colomb. de Computaci{\'{o}}n},
volume = {14},
number = {2},
pages = {122--140},
year = {2013}
}
@article{DBLP:journals/tvlsi/GarridoGSG13,
author = {Mario Garrido and
Jes{\'{u}}s Grajal and
Miguel A. S{\'{a}}nchez Marcos and
Oscar Gustafsson},
title = {Pipelined Radix-2\({}^{\mbox{k}}\) Feedforward {FFT} Architectures},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {21},
number = {1},
pages = {23--32},
year = {2013}
}
@inproceedings{DBLP:conf/ccgrid/DiazCVPB13,
author = {Cesar O. Diaz and
Harold E. Castro and
Mario Villamizar and
Johnatan E. Pecero and
Pascal Bouvry},
title = {Energy-aware {VM} Allocation on an Opportunistic Cloud Infrastructure},
booktitle = {{CCGRID}},
pages = {663--670},
publisher = {{IEEE} Computer Society},
year = {2013}
}
@inproceedings{DBLP:conf/cdc/Gonzalez-SanchezALZ13,
author = {Mario Francisco Gonz{\'{a}}lez{-}S{\'{a}}nchez and
Luis Antonio Amezquita{-}Brooks and
Eduardo Lic{\'{e}}aga{-}Castro and
Patricia del C. Zambrano{-}Robledo},
title = {Simplifying quadrotor controllers by using simplified design models},
booktitle = {{CDC}},
pages = {4236--4241},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/ecoop/GomezSV13,
author = {Paola G{\'{o}}mez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {\emph{GraCoT}, a tool for co-creation of models and metamodels in
specific domains},
booktitle = {ACME@ECOOP},
pages = {5:1--5:10},
publisher = {{ACM}},
year = {2013}
}
@inproceedings{DBLP:conf/ecoop/MeloSV13,
author = {Ivan Melo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Composing graphical languages},
booktitle = {GlobalDSL@ECOOP},
pages = {12--17},
publisher = {{ACM}},
year = {2013}
}
@inproceedings{DBLP:conf/europar/LoddeFA13,
author = {Mario Lodde and
Jos{\'{e}} Flich and
Manuel E. Acacio},
title = {Towards Efficient Dynamic {LLC} Home Bank Mapping with NoC-Level Support},
booktitle = {Euro-Par},
series = {Lecture Notes in Computer Science},
volume = {8097},
pages = {178--190},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/hbu/RodriguezMHO13,
author = {Mario Rodr{\'{\i}}guez and
Carlos Medrano and
El{\'{\i}}as Herrero and
Carlos Orrite},
title = {Transfer Learning of Human Poses for Action Recognition},
booktitle = {{HBU}},
series = {Lecture Notes in Computer Science},
volume = {8212},
pages = {89--101},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/ica3pp/SoteloDVCPB13,
author = {German Sotelo and
Cesar O. Diaz and
Mario Villamizar and
Harold E. Castro and
Johnatan E. Pecero and
Pascal Bouvry},
title = {Building Platform as a Service for High Performance Computing over
an Opportunistic Cloud Computing},
booktitle = {{ICA3PP} {(1)}},
series = {Lecture Notes in Computer Science},
volume = {8285},
pages = {380--389},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/icsoc/PeceroDCVSB13,
author = {Johnatan E. Pecero and
Cesar O. Diaz and
Harold E. Castro and
Mario Villamizar and
German Sotelo and
Pascal Bouvry},
title = {Energy Savings on a Cloud-Based Opportunistic Infrastructure},
booktitle = {{ICSOC} Workshops},
series = {Lecture Notes in Computer Science},
volume = {8377},
pages = {366--378},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/ifip8-1/FlorezSV13,
author = {Hector Florez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Embracing Imperfection in Enterprise Architecture Models},
booktitle = {PoEM (Short Papers)},
series = {{CEUR} Workshop Proceedings},
volume = {1023},
pages = {8--17},
publisher = {CEUR-WS.org},
year = {2013}
}
@inproceedings{DBLP:conf/ifip8-1/NaranjoSV13,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Connecting the Dots: Examining Visualization Techniques for Enterprise
Architecture Model Analysis},
booktitle = {PoEM (Short Papers)},
series = {{CEUR} Workshop Proceedings},
volume = {1023},
pages = {29--38},
publisher = {CEUR-WS.org},
year = {2013}
}
@inproceedings{DBLP:conf/isami/SanchezSO13,
author = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and
Daniel D{\'{\i}}az S{\'{a}}nchez and
Mario Mu{\~{n}}oz Organero},
title = {Optimizing OSGi Services on Gateways},
booktitle = {ISAmI},
series = {Advances in Intelligent Systems and Computing},
volume = {219},
pages = {155--162},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/lion/Hidalgo-BermudezRMGGF13,
author = {R. M. Hidalgo{-}Berm{\'{u}}dez and
M. S. Rodr{\'{\i}}guez{-}Domingo and
Antonio Miguel Mora and
Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
Antonio Jos{\'{e}} Fern{\'{a}}ndez Leiva},
title = {Evolutionary FSM-Based Agents for Playing Super Mario Game},
booktitle = {{LION}},
series = {Lecture Notes in Computer Science},
volume = {7997},
pages = {357--363},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/nsdi/SanchezOBCBKW13,
author = {Mario A. S{\'{a}}nchez and
John S. Otto and
Zachary S. Bischof and
David R. Choffnes and
Fabi{\'{a}}n E. Bustamante and
Balachander Krishnamurthy and
Walter Willinger},
title = {Dasu: Pushing Experiments to the Internet's Edge},
booktitle = {{NSDI}},
pages = {487--499},
publisher = {{USENIX} Association},
year = {2013}
}
@inproceedings{DBLP:conf/pam/SanchezOBB13,
author = {Mario A. S{\'{a}}nchez and
John S. Otto and
Zachary S. Bischof and
Fabi{\'{a}}n E. Bustamante},
title = {Trying Broadband Characterization at Home},
booktitle = {{PAM}},
series = {Lecture Notes in Computer Science},
volume = {7799},
pages = {198--207},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/wcsc/Ornelas-TellezGSA13,
author = {Fernando Ornelas{-}Tellez and
Mario Graff and
Edgar N. S{\'{a}}nchez and
Alma Y. Alanis},
title = {{PSO} Optimal Tracking Control for State-Dependent Coefficient Nonlinear
Systems},
booktitle = {{WCSC}},
series = {Studies in Fuzziness and Soft Computing},
volume = {312},
pages = {403--410},
publisher = {Springer},
year = {2013}
}
@article{DBLP:journals/corr/AartsenA13,
author = {Mark G. Aartsen and
Rasha U. Abbasi and
Markus Ackermann and
Jenni Adams and
Juan Antonio Aguilar S{\'{a}}nchez and
Markus Ahlers and
David Altmann and
Carlos A. Arg{\"{u}}elles Delgado and
Jan Auffenberg and
Xinhua Bai and
Michael F. Baker and
Steven W. Barwick and
Volker Baum and
Ryan Bay and
James J. Beatty and
Julia K. Becker Tjus and
Karl{-}Heinz Becker and
Segev BenZvi and
Patrick Berghaus and
David Berley and
Elisa Bernardini and
Anna Bernhard and
David Z. Besson and
G. Binder and
Daniel Bindig and
Martin Bissok and
Erik Blaufuss and
Jan Blumenthal and
David J. Boersma and
Christian Bohm and
Debanjan Bose and
Sebastian B{\"{o}}ser and
Olga Botner and
Lionel Brayeur and
Hans{-}Peter Bretz and
Anthony M. Brown and
Ronald Bruijn and
James Casey and
Martin Casier and
Dmitry Chirkin and
Asen Christov and
Brian John Christy and
Ken Clark and
Lew Classen and
Fabian Clevermann and
Stefan Coenders and
Shirit Cohen and
Doug F. Cowen and
Angel H. Cruz Silva and
Matthias Danninger and
Jacob Daughhetee and
James C. Davis and
Melanie Day and
Catherine De Clercq and
Sam De Ridder and
Paolo Desiati and
Krijn D. de Vries and
Meike de With and
Tyce DeYoung and
Juan Carlos D{\'{\i}}az{-}V{\'{e}}lez and
Matthew Dunkman and
Ryan Eagan and
Benjamin Eberhardt and
Bj{\"{o}}rn Eichmann and
Jonathan Eisch and
Sebastian Euler and
Paul A. Evenson and
Oladipo O. Fadiran and
Ali R. Fazely and
Anatoli Fedynitch and
Jacob Feintzeig and
Tom Feusels and
Kirill Filimonov and
Chad Finley and
Tobias Fischer{-}Wasels and
Samuel Flis and
Anna Franckowiak and
Katharina Frantzen and
Tomasz Fuchs and
Thomas K. Gaisser and
Joseph S. Gallagher and
Lisa Marie Gerhardt and
Laura E. Gladstone and
Thorsten Gl{\"{u}}senkamp and
Azriel Goldschmidt and
Geraldina Golup and
Javier G. Gonz{\'{a}}lez and
Jordan A. Goodman and
Dariusz G{\'{o}}ra and
Dylan T. Grandmont and
Darren Grant and
Pavel Gretskov and
John C. Groh and
Andreas Gro{\ss} and
Chang Hyon Ha and
Abd Al Karim Haj Ismail and
Patrick Hallen and
Allan Hallgren and
Francis Halzen and
Kael D. Hanson and
Dustin Hebecker and
David Heereman and
Dirk Heinen and
Klaus Helbing and
Robert Eugene Hellauer III and
Stephanie Virginia Hickford and
Gary C. Hill and
Kara D. Hoffman and
Ruth Hoffmann and
Andreas Homeier and
Kotoyo Hoshina and
Feifei Huang and
Warren Huelsnitz and
Per Olof Hulth and
Klas Hultqvist and
Shahid Hussain and
Aya Ishihara and
Emanuel Jacobi and
John E. Jacobsen and
Kai Jagielski and
George S. Japaridze and
Kyle Jero and
Ola Jlelati and
Basho Kaminsky and
Alexander Kappes and
Timo Karg and
Albrecht Karle and
Matthew Kauer and
John Lawrence Kelley and
Joanna Kiryluk and
J. Kl{\"{a}}s and
Spencer R. Klein and
Jan{-}Hendrik K{\"{o}}hne and
Georges Kohnen and
Hermann Kolanoski and
Lutz K{\"{o}}pke and
Claudio Kopper and
Sandro Kopper and
D. Jason Koskinen and
Marek Kowalski and
Mark Krasberg and
Anna Kriesten and
Kai Michael Krings and
G{\"{o}}sta Kroll and
Jan Kunnen and
Naoko Kurahashi and
Takao Kuwabara and
Mathieu L. M. Labare and
Hagar Landsman and
Michael James Larson and
Mariola Lesiak{-}Bzdak and
Martin Leuermann and
Julia Leute and
Jan L{\"{u}}nemann and
Oscar A. Mac{\'{\i}}as{-}Ram{\'{\i}}rez and
James Madsen and
Giuliano Maggi and
Reina Maruyama and
Keiichi Mase and
Howard S. Matis and
Frank McNally and
Kevin James Meagher and
Martin Merck and
Gonzalo Merino Ar{\'{e}}valo and
Thomas Meures and
Sandra Miarecki and
Eike Middell and
Natalie Milke and
John Lester Miller and
Lars Mohrmann and
Teresa Montaruli and
Robert M. Morse and
Rolf Nahnhauer and
Uwe Naumann and
Hans Niederhausen and
Sarah C. Nowicki and
David R. Nygren and
Anna Obertacke and
Sirin Odrowski and
Alex Olivas and
Ahmad Omairat and
Aongus Starbuck {\'{O}} Murchadha and
Larissa Paul and
Joshua A. Pepper and
Carlos P{\'{e}}rez de los Heros and
Carl Pfendner and
Damian Pieloth and
Elisa Pinat and
Jonas Posselt and
P. Buford Price and
Gerald T. Przybylski and
Melissa Quinnan and
Leif R{\"{a}}del and
Ian Rae and
Mohamed Rameez and
Katherine Rawlins and
Peter Christian Redl and
Ren{\'{e}} Reimann and
Elisa Resconi and
Wolfgang Rhode and
Mathieu Ribordy and
Michael Richman and
Benedikt Riedel and
J. P. Rodrigues and
Carsten Rott and
Tim Ruhe and
Bakhtiyar Ruzybayev and
Dirk Ryckbosch and
Sabine M. Saba and
Heinz{-}Georg Sander and
Juan Marcos Santander and
Subir Sarkar and
Kai Schatto and
Florian Scheriau and
Torsten Schmidt and
Martin Schmitz and
Sebastian Schoenen and
Sebastian Sch{\"{o}}neberg and
Arne Sch{\"{o}}nwald and
Anne Schukraft and
Lukas Schulte and
David Schultz and
Olaf Schulz and
David Seckel and
Yolanda Sestayo de la Cerra and
Surujhdeo Seunarine and
Rezo Shanidze and
Chris Sheremata and
Miles W. E. Smith and
Dennis Soldin and
Glenn M. Spiczak and
Christian Spiering and
Michael Stamatikos and
Todor Stanev and
Nick A. Stanisha and
Alexander Stasik and
Thorsten Stezelberger and
Robert G. Stokstad and
Achim St{\"{o}}{\ss}l and
Erik A. Strahler and
Rickard Str{\"{o}}m and
Nora Linn Strotjohann and
Gregory W. Sullivan and
Henric Taavola and
Ignacio J. Taboada and
Alessio Tamburro and
Andreas Tepe and
Samvel Ter{-}Antonyan and
Gordana Tesic and
Serap Tilav and
Patrick A. Toale and
Moriah Natasha Tobin and
Simona Toscano and
Maria Tselengidou and
Elisabeth Unger and
Marcel Usner and
Sofia Vallecorsa and
Nick van Eijndhoven and
Arne Van Overloop and
Jakob van Santen and
Markus Vehring and
Markus Voge and
Matthias Vraeghe and
Christian Walck and
Tilo Waldenmaier and
Marius Wallraff and
Christopher N. Weaver and
Mark T. Wellons and
Christopher H. Wendt and
Stefan Westerhoff and
Nathan Whitehorn and
Klaus Wiebe and
Christopher Wiebusch and
Dawn R. Williams and
Henrike Wissing and
Martin Wolf and
Terri R. Wood and
Kurt Woschnagg and
Donglian Xu and
Xianwu Xu and
Juan Pablo Y{\'{a}}{\~{n}}ez Garza and
Gaurang B. Yodh and
Shigeru Yoshida and
Pavel Zarzhitsky and
Jan Ziemann and
Simon Zierke and
Marcel Zoll},
title = {The IceProd Framework: Distributed Data Processing for the IceCube
Neutrino Observatory},
journal = {CoRR},
volume = {abs/1311.5904},
year = {2013}
}
@article{DBLP:journals/aeog/Rodriguez-GalianoPSCC12,
author = {Victor F. Rodriguez{-}Galiano and
Eulogio Pardo{-}Ig{\'{u}}zquiza and
M. Sanchez{-}Castillo and
Mario Chica{-}Olmo and
Mario Chica{-}Rivas},
title = {Downscaling Landsat 7 {ETM+} thermal imagery using land surface temperature
and {NDVI} images},
journal = {Int. J. Appl. Earth Obs. Geoinformation},
volume = {18},
pages = {515--527},
year = {2012}
}
@article{DBLP:journals/ijbpim/SanchezPV12,
author = {Mario E. S{\'{a}}nchez and
Diana Puentes and
Jorge Villalobos},
title = {Building a modular {YAWL} engine with Cumbia},
journal = {Int. J. Bus. Process. Integr. Manag.},
volume = {6},
number = {1},
pages = {41--51},
year = {2012}
}
@article{DBLP:journals/ijsita/DonateGC12,
author = {Mario Javier Donate and
F{\'{a}}tima Guadamillas and
Jes{\'{u}}s David S{\'{a}}nchez de Pablo Gonz{\'{a}}lez del Campo},
title = {Knowledge Management for Strategic Alliances: {A} Case Study},
journal = {Int. J. Strateg. Inf. Technol. Appl.},
volume = {3},
number = {3},
pages = {1--19},
year = {2012}
}
@article{DBLP:journals/jei/Sanchez-CruzR12,
author = {Hermilo S{\'{a}}nchez{-}Cruz and
Mario A. Rodr{\'{\i}}guez{-}D{\'{\i}}az},
title = {Binary document image compression using a three-symbol grouped code
dictionary},
journal = {J. Electronic Imaging},
volume = {21},
number = {2},
pages = {023013},
year = {2012}
}
@article{DBLP:journals/jms/DiezPAMDBLHL12,
author = {Isabel de la Torre D{\'{\i}}ez and
Francisco Javier D{\'{\i}}az Pernas and
M{\'{\i}}riam Ant{\'{o}}n{-}Rodr{\'{\i}}guez and
Mario Mart{\'{\i}}nez{-}Zarzuela and
Jos{\'{e}} Fernando D{\'{\i}}ez Higuera and
Daniel Boto{-}Giralda and
Miguel Maldonado L{\'{o}}pez and
Roberto Hornero and
Mar{\'{\i}}a Isabel L{\'{o}}pez},
title = {Performance Evaluation of a Web-Based System to Exchange Electronic
Health Records Using Queueing Model {(M/M/1)}},
journal = {J. Medical Syst.},
volume = {36},
number = {2},
pages = {915--924},
year = {2012}
}
@article{DBLP:journals/pnc/PuypeMCSPMD12,
author = {Bart Puype and
Eva Mar{\'{\i}}n{-}Tordera and
Didier Colle and
Sergio S{\'{a}}nchez{-}L{\'{o}}pez and
Mario Pickavet and
Xavier Masip{-}Bruin and
Piet Demeester},
title = {Prediction-based routing as {RWA} in multilayer traffic engineering},
journal = {Photonic Netw. Commun.},
volume = {23},
number = {2},
pages = {172--182},
year = {2012}
}
@article{DBLP:journals/pr/Anton-CanalisHS12,
author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
Mario Hern{\'{a}}ndez{-}Tejera and
Elena S{\'{a}}nchez{-}Nielsen},
title = {Distance maps from unthresholded magnitudes},
journal = {Pattern Recognit.},
volume = {45},
number = {9},
pages = {3125--3130},
year = {2012}
}
@inproceedings{DBLP:conf/caise/ManzurSSV12,
author = {Laura Manzur and
John Santa and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Experimentation in Executable Enterprise Architecture Models},
booktitle = {CAiSE Workshops},
series = {Lecture Notes in Business Information Processing},
volume = {112},
pages = {455--469},
publisher = {Springer},
year = {2012}
}
@inproceedings{DBLP:conf/cescit/FernandezPSMSP12,
author = {J. Javier Fernandez and
Mario Prats and
Juan Carlos Garc{\'{\i}}a S{\'{a}}nchez and
Ra{\'{u}}l Mar{\'{\i}}n and
Pedro J. Sanz and
Antonio Pe{\~{n}}alver Benavent},
title = {Manipulation in the Seabed: {A} New Underwater Manipulation System
for Shallow Water Intervention},
booktitle = {{CESCIT}},
pages = {314--319},
publisher = {International Federation of Automatic Control},
year = {2012}
}
@inproceedings{DBLP:conf/cgames/SalazarMOS12,
author = {Mario Gonzalez Salazar and
Hugo A. Mitre{-}Hern{\'{a}}ndez and
Cuauht{\'{e}}moc Lemus Olalde and
Jos{\'{e}} Luis Gonz{\'{a}}lez S{\'{a}}nchez},
title = {Proposal of Game Design Document from software engineering requirements
perspective},
booktitle = {{CGAMES}},
pages = {81--85},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/conielecomp/Trujillo-CaballeroPSMST12,
author = {Mario Arturo Trujillo{-}Caballero and
Rub{\'{e}}n Posada{-}G{\'{o}}mez and
Oscar Osvaldo Sandoval{-}Gonzalez and
Albino Mart{\'{\i}}nez{-}Sibaja and
Blanca E. Gonz{\'{a}}lez S{\'{a}}nchez and
Juan Carlos Trujillo{-}Caballero},
title = {A remote monitoring system for a mechanotherapy device in neuromuscular
rehabilitation},
booktitle = {{CONIELECOMP}},
pages = {55--58},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/edoc/NaranjoSV12,
author = {David Naranjo and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Visual Analysis of Enterprise Models},
booktitle = {{EDOC} Workshops},
pages = {19--28},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/embc/GomezMPP0H12,
author = {Carlos G{\'{o}}mez and
Mario Mart{\'{\i}}nez{-}Zarzuela and
Jes{\'{u}}s Poza and
Francisco Javier D{\'{\i}}az Pernas and
Alberto Fern{\'{a}}ndez and
Roberto Hornero},
title = {Synchrony analysis of spontaneous {MEG} activity in Alzheimer's disease
patients},
booktitle = {{EMBC}},
pages = {6188--6191},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/europar/LoddeFA12,
author = {Mario Lodde and
Jos{\'{e}} Flich and
Manuel E. Acacio},
title = {Dynamic Last-Level Cache Allocation to Reduce Area and Power Overhead
in Directory Coherence Protocols},
booktitle = {Euro-Par},
series = {Lecture Notes in Computer Science},
volume = {7484},
pages = {206--218},
publisher = {Springer},
year = {2012}
}
@inproceedings{DBLP:conf/icce-berlin/SanchezSO12,
author = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and
Daniel D{\'{\i}}az S{\'{a}}nchez and
Mario Mu{\~{n}}oz Organero},
title = {Flex-box: {A} flexible software architecture for {IPTV} set-top boxes},
booktitle = {ICCE-Berlin},
pages = {121--125},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/iccel/SanchezSO12,
author = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and
Daniel D{\'{\i}}az S{\'{a}}nchez and
Mario Mu{\~{n}}oz Organero},
title = {Optimizing resources on gateways using OSGi},
booktitle = {{ICCE}},
pages = {526--527},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/icip/Sanchez-EscobedoC12,
author = {Dalila S{\'{a}}nchez{-}Escobedo and
Mario Castel{\'{a}}n},
title = {Face synthesis from a frontal pose image using partial least squares
and b-splines},
booktitle = {{ICIP}},
pages = {1801--1804},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/iecon/RizoRRBL12,
author = {Mario Rizo and
Ana Rodr{\'{\i}}guez and
Francisco J. Rodr{\'{\i}}guez and
Emilio Bueno and
Marco Liserre},
title = {Different approaches of stationary reference frames saturators},
booktitle = {{IECON}},
pages = {2245--2250},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/ieeehpcs/PeceroHBPLB12,
author = {Johnatan E. Pecero and
H{\'{e}}ctor Joaqu{\'{\i}}n {Fraire Huacuja} and
Pascal Bouvry and
Alejandro {Santiago Pineda} and
Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
Juan Javier Gonz{\'{a}}lez Barbosa},
title = {On the energy optimization for precedence constrained applications
using local search algorithms},
booktitle = {{HPCS}},
pages = {133--139},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/igarss/RankineSSV12,
author = {Cassidy Rankine and
G. Arturo Sanchez{-}Azofeifa and
Mario Marcos do Espirito Santo and
Marco Tulio S. Viera},
title = {Optical wireless sensor networks observe leaf phenology and photosynthetic
radiation interception in a Brazilian tropical dry forest},
booktitle = {{IGARSS}},
pages = {6914--6915},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/imc/OttoSRB12,
author = {John S. Otto and
Mario A. S{\'{a}}nchez and
John P. Rula and
Fabi{\'{a}}n E. Bustamante},
title = {Content delivery and the natural evolution of {DNS:} remote dns trends,
performance issues and alternative solutions},
booktitle = {Internet Measurement Conference},
pages = {523--536},
publisher = {{ACM}},
year = {2012}
}
@inproceedings{DBLP:conf/iolts/Sanchez-ClementeEGL12,
author = {Antonio Sanchez{-}Clemente and
Luis Entrena and
Mario Garc{\'{\i}}a{-}Valderas and
Celia L{\'{o}}pez{-}Ongil},
title = {Logic masking for {SET} Mitigation Using Approximate Logic Circuits},
booktitle = {{IOLTS}},
pages = {176--181},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/its/KarlovcecCP12,
author = {Mario Karlovcec and
Mariheida Cordova{-}Sanchez and
Zachary A. Pardos},
title = {Knowledge Component Suggestion for Untagged Content in an Intelligent
Tutoring System},
booktitle = {{ITS}},
series = {Lecture Notes in Computer Science},
volume = {7315},
pages = {195--200},
publisher = {Springer},
year = {2012}
}
@inproceedings{DBLP:conf/models/FlorezSVV12,
author = {Hector Florez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos and
Germ{\'{a}}n Vega},
title = {Coevolution assistance for enterprise architecture models},
booktitle = {ME@MoDELS},
pages = {27--32},
publisher = {{ACM}},
year = {2012}
}
@inproceedings{DBLP:conf/models/GomezSFV12,
author = {Paola G{\'{o}}mez and
Mario E. S{\'{a}}nchez and
Hector Florez and
Jorge Villalobos},
title = {Co-creation of models and metamodels for enterprise architecture projects},
booktitle = {XM@MoDELS},
pages = {21--26},
publisher = {{ACM}},
year = {2012}
}
@inproceedings{DBLP:conf/nocs/LoddeFA12,
author = {Mario Lodde and
Jos{\'{e}} Flich and
Manuel E. Acacio},
title = {Heterogeneous NoC Design for Efficient Broadcast-based Coherence Protocol
Support},
booktitle = {{NOCS}},
pages = {59--66},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/sigcomm/OttoSRSB12,
author = {John S. Otto and
Mario A. S{\'{a}}nchez and
John P. Rula and
Ted Stein and
Fabi{\'{a}}n E. Bustamante},
title = {namehelp: intelligent client-side {DNS} resolution},
booktitle = {{SIGCOMM}},
pages = {287--288},
publisher = {{ACM}},
year = {2012}
}
@article{DBLP:journals/cys/SanchezJV11,
author = {Mario E. S{\'{a}}nchez and
Camilo Jim{\'{e}}nez and
Jorge Villalobos},
title = {Model Based Testing for Workflow Enabled Applications},
journal = {Computaci{\'{o}}n y Sistemas},
volume = {14},
number = {4},
year = {2011}
}
@article{DBLP:journals/ijon/GonzalezDS11,
author = {Mario Gonz{\'{a}}lez and
David Dominguez and
{\'{A}}ngel S{\'{a}}nchez},
title = {Learning sequences of sparse correlated patterns using small-world
attractor neural networks: An application to traffic videos},
journal = {Neurocomputing},
volume = {74},
number = {14-15},
pages = {2361--2367},
year = {2011}
}
@article{DBLP:journals/jvcir/Sanchez-NielsenH11,
author = {Elena S{\'{a}}nchez{-}Nielsen and
Mario Hern{\'{a}}ndez{-}Tejera},
title = {Heuristic algorithm for visual tracking of deformable objects},
journal = {J. Vis. Commun. Image Represent.},
volume = {22},
number = {6},
pages = {465--478},
year = {2011}
}
@article{DBLP:journals/pdln/CavalieriFFPGS11,
author = {Daniel Cruz Cavalieri and
Teodiano Freire Bastos Filho and
M{\'{a}}rio Sarcinelli Filho and
Sira E. Palazuelos{-}Cagigas and
Javier Mac{\'{\i}}as Guarasa and
Jos{\'{e}} Luis Mart{\'{\i}}n S{\'{a}}nchez},
title = {A Part-of-Speech Tag Clustering for a Word Prediction System in Portuguese
Language},
journal = {Proces. del Leng. Natural},
volume = {47},
pages = {197--205},
year = {2011}
}
@article{DBLP:journals/sensors/PastorelloSN11,
author = {Gilberto Zonta Pastorello Jr. and
G. Arturo Sanchez{-}Azofeifa and
Mario A. Nascimento},
title = {Enviro-Net: From Networks of Ground-Based Sensor Systems to a Web
Platform for Sensor Data Management},
journal = {Sensors},
volume = {11},
number = {6},
pages = {6454--6479},
year = {2011}
}
@inproceedings{DBLP:conf/bpm/SanchezPV11,
author = {Mario E. S{\'{a}}nchez and
Diana Puentes and
Jorge Villalobos},
title = {A Modular Approach to Build Workflow Engines},
booktitle = {Business Process Management Workshops {(2)}},
series = {Lecture Notes in Business Information Processing},
volume = {100},
pages = {289--300},
publisher = {Springer},
year = {2011}
}
@inproceedings{DBLP:conf/eScience/Sanchez-AzofeifaRSFG11,
author = {G. Arturo Sanchez{-}Azofeifa and
Cassidy Rankine and
Mario Marcos do Espirito Santo and
Rob Fatland and
Milton Garcia},
title = {Wireless Sensing Networks for Environmental Monitoring: Two Case Studies
from Tropical Forests},
booktitle = {eScience},
pages = {70--76},
publisher = {{IEEE} Computer Society},
year = {2011}
}
@inproceedings{DBLP:conf/enase/Sanchez-Gonzalez11,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
Francisco Ruiz and
F{\'{e}}lix Garc{\'{\i}}a and
Mario Piattini},
title = {Improving Quality of Business Process Models},
booktitle = {{ENASE} (Selected Papers)},
series = {Communications in Computer and Information Science},
volume = {275},
pages = {130--144},
publisher = {Springer},
year = {2011}
}
@inproceedings{DBLP:conf/enase/Sanchez-GonzalezRGP11,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
Francisco Ruiz and
F{\'{e}}lix Garc{\'{\i}}a and
Mario Piattini},
title = {Business Process Model Improvement based on Measurement Activities},
booktitle = {{ENASE}},
pages = {104--113},
publisher = {SciTePress},
year = {2011}
}
@inproceedings{DBLP:conf/esem/Perez-CastilloSPGG11,
author = {Ricardo P{\'{e}}rez{-}Castillo and
Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
Mario Piattini and
F{\'{e}}lix Garc{\'{\i}}a and
Ignacio Garc{\'{\i}}a Rodr{\'{\i}}guez de Guzm{\'{a}}n},
title = {Obtaining Thresholds for the Effectiveness of Business Process Mining},
booktitle = {{ESEM}},
pages = {453--462},
publisher = {{IEEE} Computer Society},
year = {2011}
}
@inproceedings{DBLP:conf/eusipco/GrajalOSGL11,
author = {Jes{\'{u}}s Grajal and
Omar A. Yeste Ojeda and
Miguel Angel S{\'{a}}nchez and
Mario Garrido and
Marisa L{\'{o}}pez{-}Vallejo},
title = {Real time {FPGA} implementation of an automatic modulation classifier
for electronic warfare applications},
booktitle = {{EUSIPCO}},
pages = {1514--1518},
publisher = {{IEEE}},
year = {2011}
}
@inproceedings{DBLP:conf/ibpria/Anton-CanalisHS11,
author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
Mario Hern{\'{a}}ndez{-}Tejera and
Elena S{\'{a}}nchez{-}Nielsen},
title = {Distance Maps from Unthresholded Magnitudes},
booktitle = {IbPRIA},
series = {Lecture Notes in Computer Science},
volume = {6669},
pages = {92--99},
publisher = {Springer},
year = {2011}
}
@inproceedings{DBLP:conf/sac/RodriguezSV11,
author = {Carlos Rodr{\'{\i}}guez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Executable model composition: a multilevel approach},
booktitle = {{SAC}},
pages = {877--884},
publisher = {{ACM}},
year = {2011}
}
@inproceedings{DBLP:conf/sigcomm/BischofOSRCB11,
author = {Zachary S. Bischof and
John S. Otto and
Mario A. S{\'{a}}nchez and
John P. Rula and
David R. Choffnes and
Fabi{\'{a}}n E. Bustamante},
title = {Crowdsourcing {ISP} characterization to the network edge},
booktitle = {W-MUST@SIGCOMM},
pages = {61--66},
publisher = {{ACM}},
year = {2011}
}
@inproceedings{DBLP:conf/sigcomm/OttoSCBS11,
author = {John S. Otto and
Mario A. S{\'{a}}nchez and
David R. Choffnes and
Fabi{\'{a}}n E. Bustamante and
Georgos Siganos},
title = {On blind mice and the elephant: understanding the network impact of
a large distributed system},
booktitle = {{SIGCOMM}},
pages = {110--121},
publisher = {{ACM}},
year = {2011}
}
@inproceedings{DBLP:conf/sigcomm/SanchezOBB11,
author = {Mario A. S{\'{a}}nchez and
John S. Otto and
Zachary S. Bischof and
Fabi{\'{a}}n E. Bustamante},
title = {Dasu - {ISP} characterization from the edge: a BitTorrent implementation},
booktitle = {{SIGCOMM}},
pages = {454--455},
publisher = {{ACM}},
year = {2011}
}
@inproceedings{DBLP:conf/sis/ParraSFP11,
author = {Antonio Santos{-}Olmo and
Luis Enrique S{\'{a}}nchez and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
title = {Desirable Characteristics for an {ISMS} oriented to SMEs},
booktitle = {{WOSIS}},
pages = {151--158},
publisher = {SciTePress},
year = {2011}
}
@inproceedings{DBLP:conf/tools/RodriguezSV11,
author = {Carlos Rodr{\'{\i}}guez and
Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {Metamodel Dependencies for Executable Models},
booktitle = {{TOOLS} {(49)}},
series = {Lecture Notes in Computer Science},
volume = {6705},
pages = {83--98},
publisher = {Springer},
year = {2011}
}
@article{DBLP:journals/corr/abs-1106-5489,
author = {Gilberto Zonta Pastorello Jr. and
G. Arturo Sanchez{-}Azofeifa and
Mario A. Nascimento},
title = {A Review of the Enviro-Net Project},
journal = {CoRR},
volume = {abs/1106.5489},
year = {2011}
}
@article{DBLP:journals/bmcbi/Segura-BedmarCPM10,
author = {Isabel Segura{-}Bedmar and
Mario Crespo and
C{\'{e}}sar de Pablo{-}S{\'{a}}nchez and
Paloma Mart{\'{\i}}nez},
title = {Resolving anaphoras for the extraction of drug-drug interactions in
pharmacological documents},
journal = {{BMC} Bioinform.},
volume = {11},
number = {{S-2}},
pages = {1},
year = {2010}
}
@article{DBLP:journals/bpmj/Sanchez-GonzalezGRV10,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
F{\'{e}}lix Garc{\'{\i}}a and
Francisco Ruiz and
Mario Piattini Velthuis},
title = {Measurement in business processes: a systematic review},
journal = {Bus. Process. Manag. J.},
volume = {16},
number = {1},
pages = {114--134},
year = {2010}
}
@article{DBLP:journals/dam/BilbaoO10,
author = {Jes{\'{u}}s Mario Bilbao and
Manuel Ord{\'{o}}{\~{n}}ez},
title = {The core and the Weber set of games on augmenting systems},
journal = {Discret. Appl. Math.},
volume = {158},
number = {3},
pages = {180--188},
year = {2010}
}
@article{DBLP:journals/tie/NevesSBCRR10,
author = {Francisco A. S. Neves and
Helber E. P. de Souza and
Fabr{\'{\i}}cio Bradaschia and
Marcelo Cabral Cavalcanti and
Mario Rizo and
Francisco J. Rodr{\'{\i}}guez},
title = {A Space-Vector Discrete Fourier Transform for Unbalanced and Distorted
Three-Phase Signals},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {57},
number = {8},
pages = {2858--2867},
year = {2010}
}
@article{DBLP:journals/tie/SanchezVHRPJ10,
author = {Ren{\'{e}} Osorio Sanchez and
Nimrod V{\'{a}}zquez and
Claudia Hern{\'{a}}ndez and
Elias Rodr{\'{\i}}guez and
Sergio Pinto and
Mario A. Ju{\'{a}}rez},
title = {Electric Dynamic Modeling of {HID} Lamps for Electronic Ballast Design},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {57},
number = {5},
pages = {1655--1662},
year = {2010}
}
@inproceedings{DBLP:conf/IEEEares/SanchezRFP10,
author = {Luis Enrique S{\'{a}}nchez and
Carlos Ruiz and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
title = {Managing the Asset Risk of SMEs},
booktitle = {{ARES}},
pages = {422--429},
publisher = {{IEEE} Computer Society},
year = {2010}
}
@inproceedings{DBLP:conf/centeris/SanchezPFP10,
author = {Luis Enrique S{\'{a}}nchez and
Antonio Santos{-}Olmo and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
title = {Security Culture in Small and Medium-Size Enterprise},
booktitle = {{CENTERIS} {(2)}},
series = {Communications in Computer and Information Science},
volume = {110},
pages = {315--324},
publisher = {Springer},
year = {2010}
}
@inproceedings{DBLP:conf/cibse/Sanchez-Gonzalez10,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
F{\'{e}}lix Garc{\'{\i}}a and
Francisco Ruiz and
Mario Piattini},
title = {{BILMA:} Entorno para la Mejora Continua de Procesos de Negocio guiada
por la Medici{\'{o}}n},
booktitle = {CIbSE},
pages = {293--298},
year = {2010}
}
@inproceedings{DBLP:conf/conielecomp/Anzures-GarciaS10,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Elizabeth L{\'{o}}pez{-}Mel{\'{e}}ndez and
Gilberto Andrade{-}Andrade and
Ricardo Rivera{-}Morales},
title = {Platform to supports learning based on Social Network, Web Intelligence
and {CSCL}},
booktitle = {{CONIELECOMP}},
pages = {201--205},
publisher = {{IEEE}},
year = {2010}
}
@inproceedings{DBLP:conf/er/Sanchez-GonzalezGMRP10,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
F{\'{e}}lix Garc{\'{\i}}a and
Jan Mendling and
Francisco Ruiz and
Mario Piattini},
title = {Prediction of Business Process Model Quality Based on Structural Metrics},
booktitle = {{ER}},
series = {Lecture Notes in Computer Science},
volume = {6412},
pages = {458--463},
publisher = {Springer},
year = {2010}
}
@inproceedings{DBLP:conf/infocom/ChoffnesSB10,
author = {David R. Choffnes and
Mario A. S{\'{a}}nchez and
Fabian E. Bustamante},
title = {Network Positioning from the Edge - An Empirical Study of the Effectiveness
of Network Positioning in {P2P} Systems},
booktitle = {{INFOCOM}},
pages = {291--295},
publisher = {{IEEE}},
year = {2010}
}
@inproceedings{DBLP:conf/jisbd/Sanchez-GonzalezGRP10,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
F{\'{e}}lix Garc{\'{\i}}a and
Francisco Ruiz and
Mario Piattini},
title = {Validaci{\'{o}}n Global de Medidas para Modelos Conceptuales
de Procesos de Negocio mediante Meta-An{\'{a}}lisis},
booktitle = {{JISBD}},
pages = {293--298},
publisher = {{IBERGARCETA} Pub. {S.L.}},
year = {2010}
}
@inproceedings{DBLP:conf/paams/CrespoSFAL10,
author = {Mario Crespo and
Daniel S{\'{a}}nchez and
Luis Felipe Crespo Foix and
Sonia Astorga Moreno and
Antonio Le{\'{o}}n},
title = {Collaborative Dialogue Agent for {COPD} Self-management in {AMICA:}
{A} First Insight},
booktitle = {{PAAMS}},
series = {Advances in Intelligent and Soft Computing},
volume = {70},
pages = {75--80},
publisher = {Springer},
year = {2010}
}
@inproceedings{DBLP:conf/trustbus/SanchezPFP10,
author = {Luis Enrique S{\'{a}}nchez and
Antonio Santos{-}Olmo and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
title = {Building {ISMS} through the Reuse of Knowledge},
booktitle = {TrustBus},
series = {Lecture Notes in Computer Science},
volume = {6264},
pages = {190--201},
publisher = {Springer},
year = {2010}
}
@article{DBLP:journals/eor/BilbaoO09,
author = {Jes{\'{u}}s Mario Bilbao and
Manuel Ord{\'{o}}{\~{n}}ez},
title = {Axiomatizations of the Shapley value for games on augmenting systems},
journal = {Eur. J. Oper. Res.},
volume = {196},
number = {3},
pages = {1008--1014},
year = {2009}
}
@article{DBLP:journals/jikm/Perez-SolteroBS09,
author = {Alonso Perez{-}Soltero and
Mario Barcelo{-}Valenzuela and
Gerardo Sanchez{-}Schmitz},
title = {Design of an Ontology as a Support to the Knowledge Audit Process
in Organisations},
journal = {J. Inf. Knowl. Manag.},
volume = {8},
number = {2},
pages = {147--158},
year = {2009}
}
@article{DBLP:journals/jucs/SanchezPRP09,
author = {Luis Enrique S{\'{a}}nchez and
Antonio Santos{-}Olmo and
David Garcia Rosado and
Mario Piattini},
title = {Managing Security and its Maturity in Small and Medium-sized Enterprises},
journal = {J. Univers. Comput. Sci.},
volume = {15},
number = {15},
pages = {3038--3058},
year = {2009}
}
@article{DBLP:journals/rasi/SanchezV009,
author = {Mario E. S{\'{a}}nchez and
Jorge Villalobos and
Daniel Romero},
title = {Un mecanismo de coordinaci{\'{o}}n basado en m{\'{a}}quinas
de estado, empleado en las aplicaciones que usan workflows},
journal = {Rev. Avances en Sistemas Inform{\'{a}}tica},
volume = {6},
number = {1},
pages = {35--44},
year = {2009}
}
@inproceedings{DBLP:conf/biostec/FerreiraFFSGQ09,
author = {Andr{\'{e}} Ferreira and
Teodiano Freire Bastos Filho and
M{\'{a}}rio Sarcinelli Filho and
Jos{\'{e}} Luis Mart{\'{\i}}n S{\'{a}}nchez and
Juan Carlos Garc{\'{\i}}a Garc{\'{\i}}a and
Manuel Mazo Quintas},
title = {Evaluation of {PSD} Components and {AAR} Parameters as Input Features
for a {SVM} Classifier Applied to a Robotic Wheelchair},
booktitle = {{BIODEVICES}},
pages = {7--12},
publisher = {{INSTICC} Press},
year = {2009}
}
@inproceedings{DBLP:conf/biostec/FerreiraFFSGQ09a,
author = {Andr{\'{e}} Ferreira and
Teodiano Freire Bastos Filho and
M{\'{a}}rio Sarcinelli Filho and
Jos{\'{e}} Luis Mart{\'{\i}}n S{\'{a}}nchez and
Juan Carlos Garc{\'{\i}}a Garc{\'{\i}}a and
Manuel Mazo Quintas},
title = {Improvements of a Brain-Computer Interface Applied to a Robotic Wheelchair},
booktitle = {{BIOSTEC} (Selected Papers)},
series = {Communications in Computer and Information Science},
volume = {52},
pages = {64--73},
year = {2009}
}
@inproceedings{DBLP:conf/ciarp/Sanchez-CruzR09,
author = {Hermilo S{\'{a}}nchez{-}Cruz and
Mario A. Rodr{\'{\i}}guez{-}D{\'{\i}}az},
title = {Coding Long Contour Shapes of Binary Objects},
booktitle = {{CIARP}},
series = {Lecture Notes in Computer Science},
volume = {5856},
pages = {45--52},
publisher = {Springer},
year = {2009}
}
@inproceedings{DBLP:conf/cikm/Segura-BedmarCPM09,
author = {Isabel Segura{-}Bedmar and
Mario Crespo and
C{\'{e}}sar de Pablo{-}S{\'{a}}nchez and
Paloma Mart{\'{\i}}nez},
title = {DrugNerAR: linguistic rule-based anaphora resolver for drug-drug interaction
extraction in pharmacological documents},
booktitle = {{DTMBIO}},
pages = {19--26},
publisher = {{ACM}},
year = {2009}
}
@inproceedings{DBLP:conf/enc/Anzures-GarciaSHP09,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Miguel J. Hornos and
Patricia Paderewski},
title = {Service-Based Layered Architectural Model for Building Collaborative
Applications in Heterogeneous Environments},
booktitle = {{ENC}},
pages = {252--263},
publisher = {{IEEE} Computer Society},
year = {2009}
}
@inproceedings{DBLP:conf/micai/ColungaSM09,
author = {Mario Chirinos Colunga and
Oscar S{\'{a}}nchez Siordia and
Stephen J. Maybank},
title = {Leukocyte Recognition Using EM-Algorithm},
booktitle = {{MICAI}},
series = {Lecture Notes in Computer Science},
volume = {5845},
pages = {545--555},
publisher = {Springer},
year = {2009}
}
@inproceedings{DBLP:conf/nldb/Segura-BedmarCP09,
author = {Isabel Segura{-}Bedmar and
Mario Crespo and
C{\'{e}}sar de Pablo{-}S{\'{a}}nchez},
title = {Score-Based Approach for Anaphora Resolution in Drug-Drug Interactions
Documents},
booktitle = {{NLDB}},
series = {Lecture Notes in Computer Science},
volume = {5723},
pages = {91--102},
publisher = {Springer},
year = {2009}
}
@inproceedings{DBLP:conf/sis/SanchezPFP09,
author = {Luis Enrique S{\'{a}}nchez and
Antonio Santos{-}Olmo and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
title = {{MMSM-SME:} Methodology for the Management of Security and its Maturity
in {SME}},
booktitle = {{WOSIS}},
pages = {67--78},
publisher = {{INSTICC} Press},
year = {2009}
}
@inproceedings{DBLP:conf/sws/LischkaEC09,
author = {Mario Lischka and
Yukiko Endo and
Manuel S{\'{a}}nchez Cuenca},
title = {Deductive policies with {XACML}},
booktitle = {{SWS}},
pages = {37--44},
publisher = {{ACM}},
year = {2009}
}
@inproceedings{DBLP:conf/tools/SanchezJVD09,
author = {Mario E. S{\'{a}}nchez and
Camilo Jim{\'{e}}nez and
Jorge Villalobos and
Dirk Deridder},
title = {Extensibility in Model-Based Business Process Engines},
booktitle = {{TOOLS} {(47)}},
series = {Lecture Notes in Business Information Processing},
volume = {33},
pages = {157--174},
publisher = {Springer},
year = {2009}
}
@inproceedings{DBLP:conf/wecwis/AguilarSCRPCV09,
author = {Elvira Rol{\'{o}}n Aguilar and
Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
F{\'{e}}lix Garc{\'{\i}}a and
Francisco Ruiz and
Mario Piattini and
Danilo Caivano and
Giuseppe Visaggio},
title = {Prediction Models for {BPMN} Usability and Maintainability},
booktitle = {{CEC}},
pages = {383--390},
publisher = {{IEEE} Computer Society},
year = {2009}
}
@incollection{DBLP:books/igi/09/Sanchez-GonzalezD00P09,
author = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
Andrea Delgado and
Francisco Ruiz and
F{\'{e}}lix Garc{\'{\i}}a and
Mario Piattini},
title = {Measurement and Maturity of Business Processes},
booktitle = {Handbook of Research on Business Process Modeling},
pages = {532--556},
publisher = {{IGI} Global},
year = {2009}
}
@article{DBLP:journals/titb/SalvadorRMRCSFCGMM08,
author = {Carlos Hern{\'{a}}ndez Salvador and
Antonio Ruiz{-}Sanchez and
M. A. Gonz{\'{a}}lez de Mingo and
Montserrat Carmona Rodriguez and
Mario Pascual Carrasco and
Pilar G. Sagredo and
Juan A. Fragua and
Fernando Caballero{-}Martinez and
Fernando Garcia{-}Lopez and
J. M{\'{a}}rquez Montes and
Jose Luis Monteagudo},
title = {Evaluation of a Telemedicine-Based Service for the Follow-Up and Monitoring
of Patients Treated With Oral Anticoagulant Therapy},
journal = {{IEEE} Trans. Inf. Technol. Biomed.},
volume = {12},
number = {6},
pages = {696--706},
year = {2008}
}
@inproceedings{DBLP:conf/IEEEares/Anzures-GarciaS08,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez},
title = {Policy-based Group Organizational Structure Management using an Ontological
Approach},
booktitle = {{ARES}},
pages = {807--812},
publisher = {{IEEE} Computer Society},
year = {2008}
}
@inproceedings{DBLP:conf/aosd/SanchezV08,
author = {Mario E. S{\'{a}}nchez and
Jorge Villalobos},
title = {A flexible architecture to build workflows using aspect-oriented concepts},
booktitle = {AOM@AOSD},
pages = {25--30},
publisher = {{ACM}},
year = {2008}
}
@inproceedings{DBLP:conf/cisis/Anzures-GarciaS08,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez},
title = {Group Organizational Structure Adaptation for Groupware Applications},
booktitle = {{CISIS}},
pages = {435--440},
publisher = {{IEEE} Computer Society},
year = {2008}
}
@inproceedings{DBLP:conf/secrypt/SanchezVFP08,
author = {Luis Enrique S{\'{a}}nchez and
Daniel Villafranca and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
title = {Practical Application of a Security Management Maturity Model for
SMEs based on Predefined Schemas},
booktitle = {{SECRYPT}},
pages = {391--398},
publisher = {{INSTICC} Press},
year = {2008}
}
@proceedings{DBLP:conf/his/2008,
editor = {Fatos Xhafa and
Francisco Herrera and
Ajith Abraham and
Mario K{\"{o}}ppen and
Jos{\'{e}} Manuel Ben{\'{\i}}tez},
title = {8th International Conference on Hybrid Intelligent Systems {(HIS}
2008), September 10-12, 2008, Barcelona, Spain},
publisher = {{IEEE} Computer Society},
year = {2008}
}
@inproceedings{DBLP:conf/cikm/Martinez-BazanMGNSL07,
author = {Norbert Mart{\'{\i}}nez{-}Bazan and
Victor Munt{\'{e}}s{-}Mulero and
Sergio G{\'{o}}mez{-}Villamor and
Jordi Nin and
Mario{-}A. S{\'{a}}nchez{-}Mart{\'{\i}}nez and
Josep Llu{\'{\i}}s Larriba{-}Pey},
title = {Dex: high-performance exploration on large graphs for information
retrieval},
booktitle = {{CIKM}},
pages = {573--582},
publisher = {{ACM}},
year = {2007}
}
@inproceedings{DBLP:conf/eurocast/Anzures-GarciaSHP07,
author = {Mario Anzures{-}Garc{\'{\i}}a and
Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
Miguel J. Hornos and
Patricia Paderewski{-}Rodr{\'{\i}}guez},
title = {Ontology-Based Modelling of Session Management Policies for Groupware
Applications},
booktitle = {{EUROCAST}},
series = {Lecture Notes in Computer Science},
volume = {4739},
pages = {57--64},
publisher = {Springer},
year = {2007}
}
@inproceedings{DBLP:conf/iasam/AzcondoOMDBRPDC07,
author = {Francisco J. Azcondo and
Alfredo Ortiz and
Mario Ma{\~{n}}ana and
F. Javier D{\'{\i}}az and
Christian Bra{\~{n}}as and
Carlos Renedo and
Severiano P{\'{e}}rez and
Fernando Delgado and
Rosario Casanueva},
title = {Effects of Flicker on Different Types of 150-W High-Pressure Sodium
Lamps and Ballasts},
booktitle = {{IAS}},
pages = {833--838},
publisher = {{IEEE}},
year = {2007}
}
@inproceedings{DBLP:conf/ibpria/Anton-CanalisHS07,
author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
Mario Hern{\'{a}}ndez{-}Tejera and
Elena S{\'{a}}nchez{-}Nielsen},
title = {Analysis of Relevant Maxima in Distance Transform. An Application
to Fast Coarse Image Segmentation},
booktitle = {IbPRIA {(1)}},
series = {Lecture Notes in Computer Science},
volume = {4477},
pages = {97--104},
publisher = {Springer},
year = {2007}
}
@inproceedings{DBLP:conf/icsoft/SanchezVFP07,
author = {Luis Enrique S{\'{a}}nchez and
Daniel Villafranca and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
title = {Scmm-Tool - Tool for Computer Automation of the Information Security
Management Systems},
booktitle = {{ICSOFT} {(SE)}},
pages = {311--318},
publisher = {{INSTICC} Press},
year = {2007}
}
@inproceedings{DBLP:conf/secrypt/SanchezVFP07,
author = {Luis Enrique S{\'{a}}nchez and
Daniel Villafranca and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
title = {Developing a Model and a Tool to Manage the Information Security in
Small and Medium Enterprises},
booktitle = {{SECRYPT}},
pages = {355--362},
publisher = {{INSTICC} Press},
year = {2007}
}
@inproceedings{DBLP:conf/sis/SachezVP07,
author = {Lu{\'{\i}}s Enrique Sanchez and
Daniel Villafranca and
Mario Piattini},
title = {{MMISS-SME} Practical Development: Maturity Model for Information
Systems Security Management in SMEs},
booktitle = {{WOSIS}},
pages = {233--244},
publisher = {{INSTICC} Press},
year = {2007}
}
@article{DBLP:journals/corr/abs-0712-2684,
author = {Ricardo L{\'{o}}pez{-}Ruiz and
J. Gonzalez{-}Estevez and
Mario G. Cosenza and
J. R. S{\'{a}}nchez},
title = {An Economic Model of Coupled Exponential Maps},
journal = {CoRR},
volume = {abs/0712.2684},
year = {2007}
}
@article{DBLP:journals/rasi/RodriguezSC06,
author = {Elkin Rodr{\'{\i}}guez and
Andr{\'{e}}s Felipe S{\'{a}}nchez and
Jorge Mario Chaverra},
title = {Desarrollo de una Herramienta para la Minimizaci{\'{o}}n de Tardanza
Total en Ambientes Job Shop Apoyada en B{\'{u}}squeda Tab{\'{u}}},
journal = {Rev. Avances en Sistemas Inform{\'{a}}tica},
volume = {3},
number = {1},
pages = {75--78},
year = {2006}
}
@article{DBLP:journals/sigmod/VelaFMP06,
author = {Bel{\'{e}}n Vela and
Eduardo Fern{\'{a}}ndez{-}Medina and
Esperanza Marcos and
Mario Piattini},
title = {Model driven development of secure {XML} databases},
journal = {{SIGMOD} Rec.},
volume = {35},
number = {3},
pages = {22--27},
year = {2006}
}
@inproceedings{DBLP:conf/IEEEares/SanchezVFP06,
author = {Luis Enrique S{\'{a}}nchez and
Daniel Villafranca and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
title = {Practical Approach of a Secure Management System based on {ISO/IEC}
17799},
booktitle = {{ARES}},
pages = {585--592},
publisher = {{IEEE} Computer Society},
year = {2006}
}
@inproceedings{DBLP:conf/acivs/Anton-CanalisHS06,
author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
Mario Hern{\'{a}}ndez{-}Tejera and
Elena S{\'{a}}nchez{-}Nielsen},
title = {AddCanny: Edge Detector for Video Processing},
booktitle = {{ACIVS}},
series = {Lecture Notes in Computer Science},
volume = {4179},
pages = {501--512},
publisher = {Springer},
year = {2006}
}
@inproceedings{DBLP:conf/cdc/SznaierPP06,
author = {Mario Sznaier and
Ricardo Salvador S{\'{a}}nchez Pe{\~{n}}a and
Vicen{\c{c}} Puig},
title = {Set-Membership Identification of Parametric Systems},
booktitle = {{CDC}},
pages = {151--156},
publisher = {{IEEE}},
year = {2006}
}
@inproceedings{DBLP:conf/cibse/VelaFMP06,
author = {Bel{\'{e}}n Vela and
Eduardo Fern{\'{a}}ndez{-}Medina and
Esperanza Marcos and
Mario Piattini},
title = {Una Aproximaci{\'{o}}n Dirigida por Modelos para el Dise{\~{n}}o
de Bases de Datos {XML} Seguras},
booktitle = {CIbSE},
pages = {229--242},
year = {2006}
}
@inproceedings{DBLP:conf/fpt/MarcosGLL06,
author = {Miguel A. S{\'{a}}nchez Marcos and
Mario Garrido and
Marisa L{\'{o}}pez{-}Vallejo and
Carlos A. L{\'{o}}pez{-}Barrio},
title = {Automated design space exploration of FPGA-based {FFT} architectures
based on area and power estimation},
booktitle = {{FPT}},
pages = {127--134},
publisher = {{IEEE}},
year = {2006}
}
@inproceedings{DBLP:conf/glvlsi/GargSGJGK06,
author = {Rajesh Garg and
Mario S{\'{a}}nchez and
Kanupriya Gulati and
Nikhil Jayakumar and
Anshul Gupta and
Sunil P. Khatri},
title = {A design flow to optimize circuit delay by using standard cells and
PLAs},
booktitle = {{ACM} Great Lakes Symposium on {VLSI}},
pages = {217--222},
publisher = {{ACM}},
year = {2006}
}
@inproceedings{DBLP:conf/isda/Anton-CanalisHS06,
author = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
Mario Hern{\'{a}}ndez{-}Tejera and
Elena S{\'{a}}nchez{-}Nielsen},
title = {Particle Swarms as Video Sequence Inhabitants For Object Tracking
in Computer Vision},
booktitle = {{ISDA} {(2)}},
pages = {604--609},
publisher = {{IEEE} Computer Society},
year = {2006}
}
@inproceedings{DBLP:conf/sis/SanchezVFP06,
author = {Luis Enrique S{\'{a}}nchez and
Daniel Villafranca and
Eduardo Fern{\'{a}}ndez{-}Medina and
Mario Piattini},
title = {Developing a Maturity Model for Information System Security Management
within Small and Medium Size Enterprises},
booktitle = {{WOSIS}},
pages = {256--266},
publisher = {{INSTICC} Press},
year = {2006}
}
@inproceedings{DBLP:conf/sis/VelaFMP06,
author = {Bel{\'{e}}n Vela and
Eduardo Fern{\'{a}}ndez{-}Medina and
Esperanza Marcos and
Mario Piattini},
title = {A Model Driven Approach for Secure {XML} Database Development},
booktitle = {{WOSIS}},
pages = {33--46},
publisher = {{INSTICC} Press},
year = {2006}
}
@inproceedings{DBLP:conf/wises/IbanezSMS06,
author = {Mario Ib{\'{a}}{\~{n}}ez and
Juan Jes{\'{u}}s S{\'{a}}nchez S{\'{a}}nchez and
Natividad Mart{\'{\i}}nez Madrid and
Ralf Seepold},
title = {Portable Profiles for Residential Gateways},
booktitle = {{WISES}},
pages = {189--200},
publisher = {{IEEE}},
year = {2006}
}
@inproceedings{DBLP:conf/acivs/Sanchez-NielsenH05,
author = {Elena S{\'{a}}nchez{-}Nielsen and
Mario Hern{\'{a}}ndez{-}Tejera},
title = {Heuristic Algorithm for Computing Fast Template Motion in Video Streams},
booktitle = {{ACIVS}},
series = {Lecture Notes in Computer Science},
volume = {3708},
pages = {547--554},
publisher = {Springer},
year = {2005}
}
@inproceedings{DBLP:conf/bvai/Sanchez-NielsenH05,
author = {Elena S{\'{a}}nchez{-}Nielsen and
Mario Hern{\'{a}}ndez{-}Tejera},
title = {Heuristic Algorithms for Fast and Accurate Tracking of Moving Objects
in Unrestricted Environments},
booktitle = {{BVAI}},
series = {Lecture Notes in Computer Science},
volume = {3704},
pages = {507--516},
publisher = {Springer},
year = {2005}
}
@inproceedings{DBLP:conf/cdc/OsorioOPPJKG05,
author = {Ren{\'{e}} Osorio and
Marco Antonio Oliver{-}Salazar and
Mario Ponce{-}Silva and
Sergio Pinto and
Mario A. Ju{\'{a}}rez and
Reza Katebi and
M. J. Grimble},
title = {Analysis and Design of Discrete-Sliding-Mode Control for a Square-Waveform-Ballast},
booktitle = {{CDC/ECC}},
pages = {584--589},
publisher = {{IEEE}},
year = {2005}
}
@inproceedings{DBLP:conf/cdc/PenaSP05,
author = {Ricardo S. S{\'{a}}nchez Pe{\~{n}}a and
Mario Sznaier and
Vicen{\c{c}} Puig},
title = {Robust Interpolation using Interval Structures},
booktitle = {{CDC/ECC}},
pages = {4983--4987},
publisher = {{IEEE}},
year = {2005}
}
@inproceedings{DBLP:conf/egc/GomesDMBGHKMMRDCSGSFLNLOWBNPWFFCFTXDACHSKRG05,
author = {Jorge A. T. Gomes and
M{\'{a}}rio David and
J. Martins and
Lu{\'{\i}}s Bernardo and
Ariel Garc{\'{\i}}a and
Markus Hardt and
Harald Kornmayer and
J. Marco and
R. Marco and
D. Rodr{\'{\i}}guez and
Iv{\'{a}}n D{\'{\i}}az and
D. Cano and
Jos{\'{e}} Salt and
S. Gonzalez and
Javier S{\'{a}}nchez and
Farida Fassi and
V. Lara and
P. Nyczyk and
Patryk Lason and
Andrzej Ozieblo and
Pawel Wolniewicz and
Michal Bluj and
Krzysztof Nawrocki and
Adam Padee and
Wojciech Wislicki and
C. Fern{\'{a}}ndez and
J. Font{\'{a}}n and
Yannis Cotronis and
Evangelos Floros and
George Tsouloupas and
Wei Xing and
Marios D. Dikaiakos and
J{\'{a}}n Astalos and
Brian A. Coghlan and
Elisa Heymann and
Miquel A. Senar and
C. Kanellopoulos and
A. Ramos and
Derek Groen},
title = {Experience with the International Testbed in the CrossGrid Project},
booktitle = {{EGC}},
series = {Lecture Notes in Computer Science},
volume = {3470},
pages = {98--110},
publisher = {Springer},
year = {2005}
}
@inproceedings{DBLP:conf/ijcai/Sanchez-NielsenH05,
author = {Elena S{\'{a}}nchez{-}Nielsen and
Mario Hern{\'{a}}ndez{-}Tejera},
title = {An Heuristic Search based Approach for Moving Objects Tracking},
booktitle = {{IJCAI}},
pages = {1736--1737},
publisher = {Professional Book Center},
year = {2005}
}
@incollection{DBLP:books/idea/encyclopedia2005/BarcaMVM05,
author = {Jos{\'{e}} Mar{\'{\i}}a Cavero Barca and
Esperanza Marcos Mart{\'{\i}}nez and
Mario Piattini and
Adolfo Sanchez de Miguel},
title = {Data Warehouse Development},
booktitle = {Encyclopedia of Information Science and Technology {(II)}},
pages = {729--733},
publisher = {Idea Group},
year = {2005}
}
@article{DBLP:journals/jcsc/EchavarriaSPCC04,
author = {Rodolfo Echavarr{\'{\i}}a and
Victor M. Sanchez and
Mario Ponce and
Maria Cotorogea and
Abraham Claudio},
title = {Analysis And Design Of {A} Quasi-Resonant Fast On-Load Tap Changing
Regulator},
journal = {J. Circuits Syst. Comput.},
volume = {13},
number = {4},
pages = {877--899},
year = {2004}
}
@article{DBLP:journals/tsp/FernandezPAP04,
author = {Matilde S{\'{a}}nchez Fern{\'{a}}ndez and
Mario de Prado{-}Cumplido and
Jer{\'{o}}nimo Arenas{-}Garc{\'{\i}}a and
Fernando P{\'{e}}rez{-}Cruz},
title = {{SVM} multiregression for nonlinear channel estimation in multiple-input
multiple-output systems},
journal = {{IEEE} Trans. Signal Process.},
volume = {52},
number = {8},
pages = {2298--2307},
year = {2004}
}
@inproceedings{DBLP:conf/wscg/Sanchez-NielsenAH04,
author = {Elena S{\'{a}}nchez{-}Nielsen and
Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
Mario Hern{\'{a}}ndez{-}Tejera},
title = {Hand Gesture Recognition for Human-Machine Interaction},
booktitle = {{WSCG}},
pages = {395--402},
year = {2004}
}
@article{DBLP:journals/corr/cs-PL-0404050,
author = {Puri Arenas{-}S{\'{a}}nchez and
Mario Rodr{\'{\i}}guez{-}Artalejo},
title = {A General Framework For Lazy Functional Logic Programming With Algebraic
Polymorphic Types},
journal = {CoRR},
volume = {cs.PL/0404050},
year = {2004}
}
@article{DBLP:journals/jcmc/ClimentMOSSTV03,
author = {Salvador Climent and
Joaquim Mor{\'{e}} and
Antoni Oliver and
M{\'{\i}}riam Salvatierra and
Imma S{\`{a}}nchez and
Mariona Taul{\'{e}} and
Llu{\"{\i}}sa Vallmanya},
title = {Bilingual Newsgroups in Catalonia: {A} Challenge for Machine Translation},
journal = {J. Comput. Mediat. Commun.},
volume = {9},
number = {1},
pages = {0},
year = {2003}
}
@article{DBLP:journals/pdln/AdurizAAABCCIFGHMMMMMMMNOPPPRSSSST03,
author = {Itziar Aduriz and
Alicia Ageno and
Bertol Arrieta and
Jose Maria Arriola and
Empar Bisbal and
N{\'{u}}ria Castell and
Montserrat Civit and
Arantza D{\'{\i}}az de Ilarraza and
Bel{\'{e}}n Fern{\'{a}}ndez and
Koldo Gojenola and
Reda Halkoum and
Raquel Marcos and
Llu{\'{\i}}s M{\`{a}}rquez and
Maria Ant{\`{o}}nia Mart{\'{\i}} and
Patricio Mart{\'{\i}}nez{-}Barco and
Antonio Molina and
Paloma Moreda and
Lidia Moreno and
Borja Navarro and
Maite Oronoz and
Llu{\'{\i}}s Padr{\'{o}} and
Manuel Palomar and
Ferran Pla and
Horacio Rodr{\'{\i}}guez and
Maximiliano Saiz{-}Noeda and
Emilio Sanchis and
Kepa Sarasola and
Armando Su{\'{a}}rez and
Mariona Taul{\'{e}}},
title = {3LB: Construcci{\'{o}}n de una base de datos de {\'{a}}rboles
sint{\'{a}}ctico sem{\'{a}}nticos},
journal = {Proces. del Leng. Natural},
volume = {31},
year = {2003}
}
@inproceedings{DBLP:conf/eagc/GomesDMBMMRSGSFHGNOWBNPWFFGLCFTXDACHSMKA03,
author = {Jorge A. T. Gomes and
M{\'{a}}rio David and
J. Martins and
Lu{\'{\i}}s Bernardo and
J. Marco and
R. Marco and
D. Rodr{\'{\i}}guez and
Jos{\'{e}} Salt and
S. Gonzalez and
Javier S{\'{a}}nchez and
A. Fuentes and
Markus Hardt and
Ariel Garc{\'{\i}}a and
P. Nyczyk and
Andrzej Ozieblo and
Pawel Wolniewicz and
Michal Bluj and
Krzysztof Nawrocki and
Adam Padee and
Wojciech Wislicki and
C. Fern{\'{a}}ndez and
J. Font{\'{a}}n and
A. G{\'{o}}mez and
I. L{\'{o}}pez and
Yannis Cotronis and
Evangelos Floros and
George Tsouloupas and
Wei Xing and
Marios D. Dikaiakos and
J{\'{a}}n Astalos and
Brian A. Coghlan and
Elisa Heymann and
Miquel A. Senar and
Gonzalo Merino and
C. Kanellopoulos and
G. Dick van Albada},
title = {First Prototype of the CrossGrid Testbed},
booktitle = {European Across Grids Conference},
series = {Lecture Notes in Computer Science},
volume = {2970},
pages = {67--77},
publisher = {Springer},
year = {2003}
}
@inproceedings{DBLP:conf/iscas/EchavarriaSPCC02,
author = {Rodolfo Echavarr{\'{\i}}a and
Victor M. Sanchez and
Mario Ponce and
Maria Cotorogea and
Abraham Claudio},
title = {Analysis of a power topology for a quasi-resonant fast on-load tap
changing regulator},
booktitle = {{ISCAS} {(5)}},
pages = {837--840},
publisher = {{IEEE}},
year = {2002}
}
@article{DBLP:journals/tcst/InancSPP01,
author = {Tamer Inanc and
Mario Sznaier and
Pablo A. Parrilo and
Ricardo S. S{\'{a}}nchez Pe{\~{n}}a},
title = {Robust identification with mixed parametric/nonparametric models and
time/frequency-domain experiments: theory and an application},
journal = {{IEEE} Trans. Control. Syst. Technol.},
volume = {9},
number = {4},
pages = {608--617},
year = {2001}
}
@article{DBLP:journals/tplp/Arenas-SanchezR01,
author = {Puri Arenas{-}S{\'{a}}nchez and
Mario Rodr{\'{\i}}guez{-}Artalejo},
title = {A General Framework for Lazy Functional Logic, Programming with Algebraic
Polymorphic Types},
journal = {Theory Pract. Log. Program.},
volume = {1},
number = {2},
pages = {185--245},
year = {2001}
}
@inproceedings{DBLP:conf/iciap/NielsenLH01,
author = {Elena S{\'{a}}nchez{-}Nielsen and
Javier Lorenzo{-}Navarro and
Mario Hern{\'{a}}ndez{-}Tejera},
title = {Increasing Efficiency of Hausdorff Approach for Tracking Real Scenes
with Complex Environments},
booktitle = {{ICIAP}},
pages = {131--136},
publisher = {{IEEE} Computer Society},
year = {2001}
}
@article{DBLP:journals/tac/ParriloPS99,
author = {Pablo A. Parrilo and
Ricardo S. S{\'{a}}nchez Pe{\~{n}}a and
Mario Sznaier},
title = {A parametric extension of mixed time/frequency robust identification},
journal = {{IEEE} Trans. Autom. Control.},
volume = {44},
number = {2},
pages = {364--369},
year = {1999}
}
@inproceedings{DBLP:conf/infocom/PazosSG99,
author = {Carlos M. D. Pazos and
Juan C. Sanchez{-}Agrelo and
Mario Gerla},
title = {Using Back-Pressure to Improve {TCP} Performance with Many Flows},
booktitle = {{INFOCOM}},
pages = {431--438},
publisher = {{IEEE} Computer Society},
year = {1999}
}
@inproceedings{DBLP:conf/iscas/TeschPBS99,
author = {Bruce J. Tesch and
Philip M. Pratt and
Kanti Bacrania and
Mario Sanchez},
title = {A 14-b, 125 {MSPS} digital-to-analog converter and bandgap voltage
reference in 0.5 um {CMOS}},
booktitle = {{ISCAS} {(2)}},
pages = {452--455},
publisher = {{IEEE}},
year = {1999}
}
@inproceedings{DBLP:conf/ppdp/Arenas-SanchezLR99,
author = {Puri Arenas{-}S{\'{a}}nchez and
Francisco Javier L{\'{o}}pez{-}Fraguas and
Mario Rodr{\'{u}}guez{-}Arteljo},
title = {Functional Plus Logic Programming with Built-In and Symbolic Constraints},
booktitle = {{PPDP}},
series = {Lecture Notes in Computer Science},
volume = {1702},
pages = {152--169},
publisher = {Springer},
year = {1999}
}
@article{DBLP:journals/automatica/ParriloSPI98,
author = {Pablo A. Parrilo and
Mario Sznaier and
Ricardo S. S{\'{a}}nchez Pe{\~{n}}a and
Tamer Inanc},
title = {Mixed Time/Frequency-Domain Based Robust Identification},
journal = {Autom.},
volume = {34},
number = {11},
pages = {1375--1389},
year = {1998}
}
@inproceedings{DBLP:conf/plilp/Arenas-SanchezLR98,
author = {Puri Arenas{-}S{\'{a}}nchez and
Francisco Javier L{\'{o}}pez{-}Fraguas and
Mario Rodr{\'{u}}guez{-}Arteljo},
title = {Embedding Multiset Constraints into a Lazy Functional Logic Language},
booktitle = {{PLILP/ALP}},
series = {Lecture Notes in Computer Science},
volume = {1490},
pages = {429--444},
publisher = {Springer},
year = {1998}
}
@inproceedings{DBLP:conf/slp/Arenas-SanchezR97,
author = {Puri Arenas{-}S{\'{a}}nchez and
Mario Rodr{\'{\i}}guez{-}Artalejo},
title = {A Lazy Narrowing Calculus for Functional Logic Programming with Algebraic
Polymorphic Types},
booktitle = {{ILPS}},
pages = {53--67},
publisher = {{MIT} Press},
year = {1997}
}
@inproceedings{DBLP:conf/tapsoft/Arenas-SanchezR97,
author = {Puri Arenas{-}S{\'{a}}nchez and
Mario Rodr{\'{\i}}guez{-}Artalejo},
title = {A Semantic Framework for Functional Logic Programming with Algebraic
Polymorphic Types},
booktitle = {{TAPSOFT}},
series = {Lecture Notes in Computer Science},
volume = {1214},
pages = {453--464},
publisher = {Springer},
year = {1997}
}
@inproceedings{DBLP:conf/time/SanchezS96,
author = {Mario R. S{\'{a}}nchez and
Anil M. Shende},
title = {Time Accountability for Lattice Computers},
booktitle = {{TIME}},
pages = {211--216},
publisher = {{IEEE} Computer Society},
year = {1996}
}
@article{DBLP:journals/sigmod/RisheSBDOALOSS95,
author = {Naphtali Rishe and
Wei Sun and
David Barton and
Yi Deng and
Cyril U. Orji and
Michael Alexopoulos and
Leonard Loureiro and
Carlos Ordonez and
Mario R. S{\'{a}}nchez and
Artyom Shaposhnikov},
title = {Florida International University High Performance Database Research
Center},
journal = {{SIGMOD} Rec.},
volume = {24},
number = {3},
pages = {71--76},
year = {1995}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-07-28 05:57 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
