Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "David Howard"
download as .bib file
@article{DBLP:journals/aisy/PinskierWLXKLH24,
author = {Joshua Pinskier and
Xing Wang and
Lois Liow and
Yue Xie and
Prabhat Kumar and
Matthijs Langelaar and
David Howard},
title = {Diversity-Based Topology Optimization of Soft Robotic Grippers},
journal = {Adv. Intell. Syst.},
volume = {6},
number = {4},
year = {2024},
url = {https://doi.org/10.1002/aisy.202300505},
doi = {10.1002/AISY.202300505},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aisy/PinskierWLXKLH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijim/SamalaMBHC24,
author = {Agariadne Dwinggo Samala and
David Mhlanga and
Ljubisa Bojic and
Natalie{-}Jane Howard and
Diogo Pereira Coelho},
title = {Blockchain Technology in Education: Opportunities, Challenges, and
Beyond},
journal = {Int. J. Interact. Mob. Technol.},
volume = {18},
number = {1},
pages = {20--42},
year = {2024},
url = {https://doi.org/10.3991/ijim.v18i01.46307},
doi = {10.3991/IJIM.V18I01.46307},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijim/SamalaMBHC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/LoTWACCZSJLCHVW24,
author = {Brian Lo and
Bemnet Teferi and
Howard W. Wong and
Alexxa Abi{-}Jaoud{\'{e}} and
Jasmine Chopra and
Rebecca Charow and
Melody Zhang and
Jenny Shi and
Andrew Johnson and
Andrea Levinson and
Kristin Cleverley and
Jo Henderson and
Aristotle N. Voineskos and
David Wiljer},
title = {Enhancing the value of digital health tools for mental health help-seeking
in Canadian transitional aged youth during the pandemic: Qualitative
study},
journal = {Int. J. Medical Informatics},
volume = {182},
pages = {105299},
year = {2024},
url = {https://doi.org/10.1016/j.ijmedinf.2023.105299},
doi = {10.1016/J.IJMEDINF.2023.105299},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijmi/LoTWACCZSJLCHVW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmmod/ChuPLKLSCHH24,
author = {David C. Y. Chu and
Rithvik Panchapakesan and
Shadaj Laddad and
Lucky E. Katahanas and
Chris Liu and
Kaushik Shivakumar and
Natacha Crooks and
Joseph M. Hellerstein and
Heidi Howard},
title = {Optimizing Distributed Protocols with Query Rewrites},
journal = {Proc. {ACM} Manag. Data},
volume = {2},
number = {1},
pages = {2:1--2:25},
year = {2024},
url = {https://doi.org/10.1145/3639257},
doi = {10.1145/3639257},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pacmmod/ChuPLKLSCHH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/SkroceZFMLTRZ24,
author = {Kristina Skroce and
Andrea Zignoli and
Federico Y. Fontana and
Felipe M. Maturana and
David Lipman and
Andrea Tryfonos and
Michael C. Riddell and
Howard C. Zisser},
title = {Real World Interstitial Glucose Profiles of a Large Cohort of Physically
Active Men and Women},
journal = {Sensors},
volume = {24},
number = {3},
pages = {744},
year = {2024},
url = {https://doi.org/10.3390/s24030744},
doi = {10.3390/S24030744},
timestamp = {Thu, 29 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/SkroceZFMLTRZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biostec/StellCWWBHSA24,
author = {Anthony Stell and
Ernesto C. Caparo and
Zhe Wang and
Chenyang Wang and
David Berlowitz and
Mark Howard and
Richard O. Sinnott and
Uwe Aickelin},
editor = {Hannes Schlieter and
Ana L. N. Fred and
Hugo Gamboa},
title = {Identification of Patient Ventilator Asynchrony in Physiological Data
Through Integrating Machine-Learning},
booktitle = {Proceedings of the 17th International Joint Conference on Biomedical
Engineering Systems and Technologies, {BIOSTEC} 2024, Volume 2, Rome,
Italy, February 21-23, 2024},
pages = {436--443},
publisher = {{SCITEPRESS}},
year = {2024},
url = {https://doi.org/10.5220/0012366700003657},
doi = {10.5220/0012366700003657},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/biostec/StellCWWBHSA24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eacl/KimWLLWQL24,
author = {Siun Kim and
Jung{-}Hyun Won and
David Seung U. Lee and
Renqian Luo and
Lijun Wu and
Tao Qin and
Howard Lee},
editor = {Yvette Graham and
Matthew Purver},
title = {CReSE: Benchmark Data and Automatic Evaluation Framework for Recommending
Eligibility Criteria from Clinical Trial Information},
booktitle = {Findings of the Association for Computational Linguistics: {EACL}
2024, St. Julian's, Malta, March 17-22, 2024},
pages = {2243--2273},
publisher = {Association for Computational Linguistics},
year = {2024},
url = {https://aclanthology.org/2024.findings-eacl.149},
timestamp = {Tue, 02 Apr 2024 16:32:10 +0200},
biburl = {https://dblp.org/rec/conf/eacl/KimWLLWQL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/papoc/ChuLCHH24,
author = {David C. Y. Chu and
Chris Liu and
Natacha Crooks and
Joseph M. Hellerstein and
Heidi Howard},
title = {Bigger, not Badder: Safely Scaling {BFT} Protocols},
booktitle = {Proceedings of the 11th Workshop on Principles and Practice of Consistency
for Distributed Data, PaPoC 2024, Athens, Greece, 22 April 2024},
pages = {30--36},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3642976.3653033},
doi = {10.1145/3642976.3653033},
timestamp = {Sat, 04 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/papoc/ChuLCHH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robosoft/KannoNPHSK24,
author = {Ryo Kanno and
Pham H. Nguyen and
Joshua Pinskier and
David Howard and
Sukho Song and
Mirko Kovac},
title = {Hybrid Soft Electrostatic Metamaterial Gripper for Multi-surface,
Multi-object Adaptation},
booktitle = {7th {IEEE} International Conference on Soft Robotics, RoboSoft 2024,
San Diego, CA, USA, April 14-17, 2024},
pages = {851--857},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/RoboSoft60065.2024.10522020},
doi = {10.1109/ROBOSOFT60065.2024.10522020},
timestamp = {Mon, 03 Jun 2024 20:37:01 +0200},
biburl = {https://dblp.org/rec/conf/robosoft/KannoNPHSK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robosoft/PinskierBH24,
author = {Joshua Pinskier and
James Brett and
David Howard},
title = {Towards Bespoke Soft Grippers through Voxel-Scale Metamaterial Topology
Optimisation},
booktitle = {7th {IEEE} International Conference on Soft Robotics, RoboSoft 2024,
San Diego, CA, USA, April 14-17, 2024},
pages = {291--298},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/RoboSoft60065.2024.10521942},
doi = {10.1109/ROBOSOFT60065.2024.10521942},
timestamp = {Mon, 03 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/robosoft/PinskierBH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robosoft/XieWIH24,
author = {Yue Xie and
Xing Wang and
Fumiya Iida and
David Howard},
title = {Fin-QD: {A} Computational Design Framework for Soft Grippers: Integrating
MAP-Elites and High-fidelity {FEM}},
booktitle = {7th {IEEE} International Conference on Soft Robotics, RoboSoft 2024,
San Diego, CA, USA, April 14-17, 2024},
pages = {692--697},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/RoboSoft60065.2024.10521959},
doi = {10.1109/ROBOSOFT60065.2024.10521959},
timestamp = {Mon, 03 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/robosoft/XieWIH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-13903,
author = {Callum Bennie and
Bridget Casey and
C{\'{e}}cile Paris and
Dana Kulic and
Brendan Tidd and
Nicholas Lawrance and
Alex Pitt and
Fletcher Talbot and
Jason Williams and
David Howard and
Pavan Sikka and
Hashini Senaratne},
title = {Alternative Interfaces for Human-initiated Natural Language Communication
and Robot-initiated Haptic Feedback: Towards Better Situational Awareness
in Human-Robot Collaboration},
journal = {CoRR},
volume = {abs/2401.13903},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2401.13903},
doi = {10.48550/ARXIV.2401.13903},
eprinttype = {arXiv},
eprint = {2401.13903},
timestamp = {Wed, 06 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2401-13903.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-06327,
author = {Ryo Kanno and
Pham H. Nguyen and
Joshua Pinskier and
David Howard and
Sukho Song and
Mirko Kovac},
title = {Hybrid Soft Electrostatic Metamaterial Gripper for Multi-surface,
Multi-object Adaptation},
journal = {CoRR},
volume = {abs/2403.06327},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.06327},
doi = {10.48550/ARXIV.2403.06327},
eprinttype = {arXiv},
eprint = {2403.06327},
timestamp = {Thu, 04 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-06327.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-13793,
author = {Mary Phuong and
Matthew Aitchison and
Elliot Catt and
Sarah Cogan and
Alexandre Kaskasoli and
Victoria Krakovna and
David Lindner and
Matthew Rahtz and
Yannis Assael and
Sarah Hodkinson and
Heidi Howard and
Tom Lieberum and
Ramana Kumar and
Maria Abi Raad and
Albert Webson and
Lewis Ho and
Sharon Lin and
Sebastian Farquhar and
Marcus Hutter and
Gr{\'{e}}goire Del{\'{e}}tang and
Anian Ruoss and
Seliem El{-}Sayed and
Sasha Brown and
Anca D. Dragan and
Rohin Shah and
Allan Dafoe and
Toby Shevlane},
title = {Evaluating Frontier Models for Dangerous Capabilities},
journal = {CoRR},
volume = {abs/2403.13793},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.13793},
doi = {10.48550/ARXIV.2403.13793},
eprinttype = {arXiv},
eprint = {2403.13793},
timestamp = {Mon, 08 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-13793.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-01593,
author = {David Chu and
Rithvik Panchapakesan and
Shadaj Laddad and
Lucky Katahanas and
Chris Liu and
Kaushik Shivakumar and
Natacha Crooks and
Joseph M. Hellerstein and
Heidi Howard},
title = {Optimizing Distributed Protocols with Query Rewrites [Technical Report]},
journal = {CoRR},
volume = {abs/2404.01593},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2404.01593},
doi = {10.48550/ARXIV.2404.01593},
eprinttype = {arXiv},
eprint = {2404.01593},
timestamp = {Wed, 08 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2404-01593.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-05674,
author = {Meixu Chen and
Kai Wang and
Michael Dohopolski and
Howard E. Morgan and
David J. Sher and
Jing Wang},
title = {TransAnaNet: Transformer-based Anatomy Change Prediction Network for
Head and Neck Cancer Patient Radiotherapy},
journal = {CoRR},
volume = {abs/2405.05674},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2405.05674},
doi = {10.48550/ARXIV.2405.05674},
eprinttype = {arXiv},
eprint = {2405.05674},
timestamp = {Mon, 17 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2405-05674.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-14440,
author = {Rafael Oliveira and
Dino Sejdinovic and
David Howard and
Edwin Bonilla},
title = {Bayesian Adaptive Calibration and Optimal Design},
journal = {CoRR},
volume = {abs/2405.14440},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2405.14440},
doi = {10.48550/ARXIV.2405.14440},
eprinttype = {arXiv},
eprint = {2405.14440},
timestamp = {Mon, 24 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2405-14440.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aiethics/DouglasLH23,
author = {David M. Douglas and
Justine Lacey and
David Howard},
title = {Ethical risks of AI-designed products: bespoke surgical tools as a
case study},
journal = {{AI} Ethics},
volume = {3},
number = {4},
pages = {1117--1133},
year = {2023},
url = {https://doi.org/10.1007/s43681-022-00219-8},
doi = {10.1007/S43681-022-00219-8},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aiethics/DouglasLH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/HosseiniGeramiHCLEBB23,
author = {Layla Hosseini{-}Gerami and
Ixavier Alonzo Higgins and
David A. Collier and
Emma Laing and
David Evans and
Howard Broughton and
Andreas Bender},
title = {Benchmarking causal reasoning algorithms for gene expression-based
compound mechanism of action analysis},
journal = {{BMC} Bioinform.},
volume = {24},
number = {1},
pages = {154},
year = {2023},
url = {https://doi.org/10.1186/s12859-023-05277-1},
doi = {10.1186/S12859-023-05277-1},
timestamp = {Mon, 24 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/HosseiniGeramiHCLEBB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/HosseiniGeramiHLBCB23,
author = {Layla Hosseini{-}Gerami and
Rosa D. Hernansaiz{-}Ballesteros and
Anika Liu and
Howard Broughton and
David A. Collier and
Andreas Bender},
title = {{MAVEN:} compound mechanism of action analysis and visualisation using
transcriptomics and compound structure data in R/Shiny},
journal = {{BMC} Bioinform.},
volume = {24},
number = {1},
pages = {344},
year = {2023},
url = {https://doi.org/10.1186/s12859-023-05416-8},
doi = {10.1186/S12859-023-05416-8},
timestamp = {Sun, 24 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/HosseiniGeramiHLBCB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chb/MayshakHBKSHPSKH23,
author = {Richelle Mayshak and
Dominika Howard and
Michelle Benstead and
Anna Klas and
David Skvarc and
Travis Harries and
Brittany Patafio and
Abby Sleep and
Ross King and
Shannon Hyder},
title = {Dating in the dark: {A} qualitative examination of dating experiences
in Dark Tetrad personalities},
journal = {Comput. Hum. Behav.},
volume = {143},
pages = {107680},
year = {2023},
url = {https://doi.org/10.1016/j.chb.2023.107680},
doi = {10.1016/J.CHB.2023.107680},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/chb/MayshakHBKSHPSKH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocn/VolfartMHZ23,
author = {Ang{\'{e}}lique Volfart and
Katie L. McMahon and
David Howard and
Greig I. de Zubicaray},
title = {Neural Correlates of Naturally Occurring Speech Errors during Picture
Naming in Healthy Participants},
journal = {J. Cogn. Neurosci.},
volume = {35},
number = {1},
pages = {111--127},
year = {2023},
url = {https://doi.org/10.1162/jocn\_a\_01927},
doi = {10.1162/JOCN\_A\_01927},
timestamp = {Sun, 12 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jocn/VolfartMHZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/natmi/KarargyrisUSAGWPKZBMCGNRKXBCBEATS23,
author = {Alexandros Karargyris and
Renato Umeton and
Micah J. Sheller and
Alejandro Aristizabal and
Johnu George and
Anna Wuest and
Sarthak Pati and
Hasan Kassem and
Maximilian Zenk and
Ujjwal Baid and
Prakash Narayana Moorthy and
Alexander Chowdhury and
Junyi Guo and
Sahil S. Nalawade and
Jacob Rosenthal and
David Kanter and
Maria Xenochristou and
Daniel J. Beutel and
Verena Chung and
Timothy Bergquist and
James A. Eddy and
Abubakar Abid and
Lewis Tunstall and
Omar Sanseviero and
Dimitrios Dimitriadis and
Yiming Qian and
Xinxing Xu and
Yong Liu and
Rick Siow Mong Goh and
Srini Bala and
Victor Bittorf and
Sreekar Reddy Puchala and
Biagio Ricciuti and
Soujanya Samineni and
Eshna Sengupta and
Akshay Chaudhari and
Cody Coleman and
Bala Desinghu and
Gregory F. Diamos and
Debo Dutta and
Diane Feddema and
Grigori Fursin and
Xinyuan Huang and
Satyananda Kashyap and
Nicholas D. Lane and
Indranil Mallick and
Pietro Mascagni and
Virendra Mehta and
Cassiano Ferro Moraes and
Vivek Natarajan and
Nikola Nikolov and
Nicolas Padoy and
Gennady Pekhimenko and
Vijay Janapa Reddi and
G. Anthony Reina and
Pablo Ribalta and
Abhishek Singh and
Jayaraman J. Thiagarajan and
Jacob Albrecht and
Thomas Wolf and
Geralyn Miller and
Huazhu Fu and
Prashant Shah and
Daguang Xu and
Poonam Yadav and
David Talby and
Mark M. Awad and
Jeremy P. Howard and
Michael Rosenthal and
Luigi Marchionni and
Massimo Loda and
Jason M. Johnson and
Spyridon Bakas and
Peter Mattson},
title = {Federated benchmarking of medical artificial intelligence with MedPerf},
journal = {Nat. Mac. Intell.},
volume = {5},
number = {7},
pages = {799--810},
year = {2023},
url = {https://doi.org/10.1038/s42256-023-00652-2},
doi = {10.1038/S42256-023-00652-2},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/natmi/KarargyrisUSAGWPKZBMCGNRKXBCBEATS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/JiangLNNWAERLPM23,
author = {Lavender Yao Jiang and
Xujin Chris Liu and
Nima Pour Nejatian and
Mustafa Nasir{-}Moin and
Duo Wang and
Anas Z. Abidin and
Kevin Eaton and
Howard Antony Riina and
Ilya Laufer and
Paawan Punjabi and
Madeline Miceli and
Nora C. Kim and
Cordelia Orillac and
Zane Schnurman and
Christopher Livia and
Hannah Weiss and
David Kurland and
Sean Neifert and
Yosef Dastagirzada and
Douglas Kondziolka and
Alexander T. M. Cheung and
Grace Yang and
Ming Cao and
Mona Flores and
Anthony B. Costa and
Yindalon Aphinyanaphongs and
Kyunghyun Cho and
Eric Karl Oermann},
title = {Health system-scale language models are all-purpose prediction engines},
journal = {Nat.},
volume = {619},
number = {7969},
pages = {357--362},
year = {2023},
url = {https://doi.org/10.1038/s41586-023-06160-y},
doi = {10.1038/S41586-023-06160-Y},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/JiangLNNWAERLPM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/EstevaFWHSDCSMS23,
author = {Andre Esteva and
Jean Feng and
Douwe van der Wal and
Shih{-}Cheng Huang and
Jeffry P. Simko and
Sandy Devries and
Emmalyn Chen and
Edward M. Schaeffer and
Todd M. Morgan and
Yilun Sun and
Amirata Ghorbani and
Nikhil Naik and
Dhruv Nathawani and
Richard Socher and
Jeff M. Michalski and
Mack Roach and
Thomas M. Pisansky and
Jedidiah M. Monson and
Farah Naz and
James Wallace and
Michelle J. Ferguson and
Jean{-}Paul Bahary and
James Zou and
Matthew P. Lungren and
Serena Yeung and
Ashley E. Ross and
Michael J. Kucharczyk and
Luis Souhami and
Leslie Ballas and
Christopher A. Peters and
Sandy Liu and
Alexander G. Balogh and
Pamela D. Randolph{-}Jackson and
David L. Schwartz and
Michael R. Girvigian and
Naoyuki G. Saito and
Adam Raben and
Rachel A. Rabinovitch and
Khalil Katato and
Howard M. Sandler and
Phuoc T. Tran and
Daniel E. Spratt and
Stephanie Pugh and
Felix Y. Feng and
Osama Mohamad},
title = {Author Correction: Prostate cancer therapy personalization via multi-modal
deep learning on randomized phase {III} clinical trials},
journal = {npj Digit. Medicine},
volume = {6},
year = {2023},
url = {https://doi.org/10.1038/s41746-023-00769-z},
doi = {10.1038/S41746-023-00769-Z},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/EstevaFWHSDCSMS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tochi/HodgeFLBMC0M23,
author = {James Hodge and
Sarah Foley and
Daniel Lambton{-}Howard and
Laura Booi and
Kyle Montague and
Sandra Coulter and
David Kirk and
Kellie Morrissey},
title = {Exploring Participants' Representations and Shifting Sensitivities
in a Hackathon for Dementia},
journal = {{ACM} Trans. Comput. Hum. Interact.},
volume = {30},
number = {3},
pages = {46:1--46:35},
year = {2023},
url = {https://doi.org/10.1145/3571814},
doi = {10.1145/3571814},
timestamp = {Fri, 21 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tochi/HodgeFLBMC0M23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chil/KimWLLWXQL23,
author = {Siun Kim and
Jung{-}Hyun Won and
David Seung U. Lee and
Renqian Luo and
Lijun Wu and
Yingce Xia and
Tao Qin and
Howard Lee},
editor = {Bobak J. Mortazavi and
Tasmie Sarker and
Andrew Beam and
Joyce C. Ho},
title = {Revisiting Machine-Learning based Drug Repurposing: Drug Indications
Are Not a Right Prediction Target},
booktitle = {Conference on Health, Inference, and Learning, {CHIL} 2023, Broad
Institute of {MIT} and Harvard (Merkin Building), 415 Main Street,
Cambridge, MA, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {209},
pages = {100--116},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v209/kim23a.html},
timestamp = {Mon, 29 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/chil/KimWLLWXQL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/PeakKNFKW23,
author = {Preston Peak and
Sai Kode and
David Nguyen and
O. Howard Frazier and
Nobuyuki Kurita and
Yaxin Wang},
title = {A Novel Design of an Elastance-Controlled Linear Motor-Driven Left
Ventricle Simulator},
booktitle = {49th Annual Conference of the {IEEE} Industrial Electronics Society,
{IECON} 2023, Singapore, October 16-19, 2023},
pages = {1--7},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IECON51785.2023.10311936},
doi = {10.1109/IECON51785.2023.10311936},
timestamp = {Sat, 25 Nov 2023 16:52:31 +0100},
biburl = {https://dblp.org/rec/conf/iecon/PeakKNFKW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mobicom/FanPHST23,
author = {Xiaoran Fan and
David Pearl and
Richard E. Howard and
Longfei Shangguan and
Trausti Thormundsson},
editor = {Xavier Costa{-}P{\'{e}}rez and
Joerg Widmer and
Diego Perino and
Domenico Giustiniano and
Haitham Al{-}Hassanieh and
Arash Asadi and
Landon P. Cox},
title = {{APG:} Audioplethysmography for Cardiac Monitoring in Hearables},
booktitle = {Proceedings of the 29th Annual International Conference on Mobile
Computing and Networking, {ACM} MobiCom 2023, Madrid, Spain, October
2-6, 2023},
pages = {67:1--67:15},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3570361.3613281},
doi = {10.1145/3570361.3613281},
timestamp = {Fri, 27 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mobicom/FanPHST23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/MazumderBYKRDDH23,
author = {Mark Mazumder and
Colby R. Banbury and
Xiaozhe Yao and
Bojan Karlas and
William Gaviria Rojas and
Sudnya Frederick Diamos and
Greg Diamos and
Lynn He and
Alicia Parrish and
Hannah Rose Kirk and
Jessica Quaye and
Charvi Rastogi and
Douwe Kiela and
David Jurado and
David Kanter and
Rafael Mosquera and
Will Cukierski and
Juan Ciro and
Lora Aroyo and
Bilge Acun and
Lingjiao Chen and
Mehul Raje and
Max Bartolo and
Evan Sabri Eyuboglu and
Amirata Ghorbani and
Emmett D. Goodman and
Addison Howard and
Oana Inel and
Tariq Kane and
Christine R. Kirkpatrick and
D. Sculley and
Tzu{-}Sheng Kuo and
Jonas W. Mueller and
Tristan Thrush and
Joaquin Vanschoren and
Margaret Warren and
Adina Williams and
Serena Yeung and
Newsha Ardalani and
Praveen K. Paritosh and
Ce Zhang and
James Y. Zou and
Carole{-}Jean Wu and
Cody Coleman and
Andrew Y. Ng and
Peter Mattson and
Vijay Janapa Reddi},
editor = {Alice Oh and
Tristan Naumann and
Amir Globerson and
Kate Saenko and
Moritz Hardt and
Sergey Levine},
title = {DataPerf: Benchmarks for Data-Centric {AI} Development},
booktitle = {Advances in Neural Information Processing Systems 36: Annual Conference
on Neural Information Processing Systems 2023, NeurIPS 2023, New Orleans,
LA, USA, December 10 - 16, 2023},
year = {2023},
url = {http://papers.nips.cc/paper\_files/paper/2023/hash/112db88215e25b3ae2750e9eefcded94-Abstract-Datasets\_and\_Benchmarks.html},
timestamp = {Fri, 01 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/MazumderBYKRDDH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ozchi/JohansenSBMMCDD23,
author = {Stine S. Johansen and
Hashini Senaratne and
Alan Burden and
Melanie J. McGrath and
Claire Mason and
Glenda Amayo Caldwell and
Jared Donovan and
Andreas Duenser and
Matthias Guertler and
David Howard and
Yanrang Jiang and
C{\'{e}}cile Paris and
Markus Rittenbruch and
Jonathan Roberts},
editor = {Judy Bowen and
Nadia Pantidi and
Dana McKay and
Jennifer Ferreira and
Alessandro Soro and
Rachel Blagojevic and
Chris Lawrence and
Nic Vanderschantz and
Te Taka Keegan and
Jane Turner and
Hilary Davis and
Mark D. Apperley and
Jacob Young},
title = {Empowering People in Human-Robot Collaboration: Why, How, When, and
for Whom},
booktitle = {Proceedings of the 35th Australian Computer-Human Interaction Conference,
OzCHI 2023, Wellington, New Zealand, December 2-6, 2023},
pages = {684--688},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3638380.3638442},
doi = {10.1145/3638380.3638442},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ozchi/JohansenSBMMCDD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ro-man/SenaratnePTMSHWKP23,
author = {Hashini Senaratne and
Alex Pitt and
Fletcher Talbot and
Peyman Moghadam and
Pavan Sikka and
David Howard and
Jason Williams and
Dana Kulic and
C{\'{e}}cile Paris},
title = {Measuring Situational Awareness Latency in Human-Robot Teaming Experiments},
booktitle = {32nd {IEEE} International Conference on Robot and Human Interactive
Communication, {RO-MAN} 2023, Busan, Republic of Korea, August 28-31,
2023},
pages = {2624--2631},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/RO-MAN57019.2023.10309377},
doi = {10.1109/RO-MAN57019.2023.10309377},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ro-man/SenaratnePTMSHWKP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robosoft/CoombeBMDH23,
author = {Cameron Coombe and
James Brett and
Raghav Mishra and
Gary W. Delaney and
David Howard},
title = {Active Vibration Fluidization for Granular Jamming Grippers},
booktitle = {{IEEE} International Conference on Soft Robotics, RoboSoft 2023, Singapore,
April 3-7, 2023},
pages = {1--8},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/RoboSoft55895.2023.10122019},
doi = {10.1109/ROBOSOFT55895.2023.10122019},
timestamp = {Mon, 22 May 2023 21:13:41 +0200},
biburl = {https://dblp.org/rec/conf/robosoft/CoombeBMDH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robosoft/HowardOLJLBD23,
author = {David Howard and
Jack O'Connor and
Jordan Letchford and
Therese Joseph and
Sophia Lin and
Sarah Baldwin and
Gary W. Delaney},
title = {A Comprehensive Dataset of Grains for Granular Jamming in Soft Robotics:
Grip Strength and Shock Absorption},
booktitle = {{IEEE} International Conference on Soft Robotics, RoboSoft 2023, Singapore,
April 3-7, 2023},
pages = {1--8},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/RoboSoft55895.2023.10122060},
doi = {10.1109/ROBOSOFT55895.2023.10122060},
timestamp = {Mon, 22 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/robosoft/HowardOLJLBD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robosoft/JosephBGBH23,
author = {Therese Joseph and
Sarah Baldwin and
Lillian Guan and
James Brett and
David Howard},
title = {The Jamming Donut: {A} Free-Space Gripper Based on Granular Jamming},
booktitle = {{IEEE} International Conference on Soft Robotics, RoboSoft 2023, Singapore,
April 3-7, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/RoboSoft55895.2023.10121993},
doi = {10.1109/ROBOSOFT55895.2023.10121993},
timestamp = {Mon, 22 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/robosoft/JosephBGBH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robosoft/PinskierKLH23,
author = {Joshua Pinskier and
Prabhat Kumar and
Matthijs Langelaar and
David Howard},
title = {Automated design of pneumatic soft grippers through design-dependent
multi-material topology optimization},
booktitle = {{IEEE} International Conference on Soft Robotics, RoboSoft 2023, Singapore,
April 3-7, 2023},
pages = {1--7},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/RoboSoft55895.2023.10122069},
doi = {10.1109/ROBOSOFT55895.2023.10122069},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/robosoft/PinskierKLH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2301-12670,
author = {Peter Xiangyuan Ma and
Cherry Ng and
Leandro Rizk and
Steve Croft and
Andrew P. V. Siemion and
Bryan Brzycki and
Daniel Czech and
Jamie Drew and
Vishal Gajjar and
John Hoang and
Howard Isaacson and
Matt Lebofsky and
David MacMahon and
Imke de Pater and
Danny C. Price and
Sofia Z. Sheikh and
S. Pete Worden},
title = {A deep-learning search for technosignatures of 820 nearby stars},
journal = {CoRR},
volume = {abs/2301.12670},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2301.12670},
doi = {10.48550/ARXIV.2301.12670},
eprinttype = {arXiv},
eprint = {2301.12670},
timestamp = {Tue, 31 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2301-12670.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-14384,
author = {Alicia Parrish and
Hannah Rose Kirk and
Jessica Quaye and
Charvi Rastogi and
Max Bartolo and
Oana Inel and
Juan Ciro and
Rafael Mosquera and
Addison Howard and
Will Cukierski and
D. Sculley and
Vijay Janapa Reddi and
Lora Aroyo},
title = {Adversarial Nibbler: {A} Data-Centric Challenge for Improving the
Safety of Text-to-Image Models},
journal = {CoRR},
volume = {abs/2305.14384},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.14384},
doi = {10.48550/ARXIV.2305.14384},
eprinttype = {arXiv},
eprint = {2305.14384},
timestamp = {Tue, 06 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-14384.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-13485,
author = {Gratianus Wesley Putra Data and
Henry Howard{-}Jenkins and
David William Murray and
Victor Prisacariu},
title = {Cos {R-CNN} for Online Few-shot Object Detection},
journal = {CoRR},
volume = {abs/2307.13485},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.13485},
doi = {10.48550/ARXIV.2307.13485},
eprinttype = {arXiv},
eprint = {2307.13485},
timestamp = {Tue, 01 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-13485.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-01758,
author = {Lois Liow and
James Brett and
Joshua Pinskier and
Lauren Hanson and
Louis Tidswell and
Navinda Kottege and
David Howard},
title = {A Compliant Robotic Leg Based on Fibre Jamming},
journal = {CoRR},
volume = {abs/2308.01758},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.01758},
doi = {10.48550/ARXIV.2308.01758},
eprinttype = {arXiv},
eprint = {2308.01758},
timestamp = {Mon, 21 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-01758.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-10355,
author = {Prabhat Kumar and
Joshua Pinskier and
David Howard and
Matthijs Langelaar},
title = {Topology optimization of fluidic pressure-driven multi-material compliant
mechanisms},
journal = {CoRR},
volume = {abs/2310.10355},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.10355},
doi = {10.48550/ARXIV.2310.10355},
eprinttype = {arXiv},
eprint = {2310.10355},
timestamp = {Wed, 25 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-10355.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-12477,
author = {Yue Xie and
Xing Wang and
Fumiya Iida and
David Howard},
title = {Fin-QD: {A} Computational Design Framework for Soft Grippers: Integrating
MAP-Elites and High-fidelity {FEM}},
journal = {CoRR},
volume = {abs/2311.12477},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.12477},
doi = {10.48550/ARXIV.2311.12477},
eprinttype = {arXiv},
eprint = {2311.12477},
timestamp = {Wed, 29 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-12477.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/XavierTZPHYLHYB22,
author = {Matheus S. Xavier and
Charbel Tawk and
Ali Zolfagharian and
Joshua Pinskier and
David Howard and
Taylor R. Young and
Jiewen Lai and
Simon M. Harrison and
Yuen Kuan Yong and
Mahdi Bodaghi and
Andrew J. Fleming},
title = {Soft Pneumatic Actuators: {A} Review of Design, Fabrication, Modeling,
Sensing, Control and Applications},
journal = {{IEEE} Access},
volume = {10},
pages = {59442--59485},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3179589},
doi = {10.1109/ACCESS.2022.3179589},
timestamp = {Tue, 28 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/XavierTZPHYLHYB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aisy/PinskierH22,
author = {Joshua Pinskier and
David Howard},
title = {From Bioinspiration to Computer Generation: Developments in Autonomous
Soft Robot Design},
journal = {Adv. Intell. Syst.},
volume = {4},
number = {1},
year = {2022},
url = {https://doi.org/10.1002/aisy.202100086},
doi = {10.1002/AISY.202100086},
timestamp = {Tue, 15 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aisy/PinskierH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csl/MargeEWAABBCDDH22,
author = {Matthew Marge and
Carol Y. Espy{-}Wilson and
Nigel G. Ward and
Abeer Alwan and
Yoav Artzi and
Mohit Bansal and
Gilmer L. Blankenship and
Joyce Chai and
Hal Daum{\'{e}} III and
Debadeepta Dey and
Mary P. Harper and
Thomas Howard and
Casey Kennington and
Ivana Kruijff{-}Korbayov{\'{a}} and
Dinesh Manocha and
Cynthia Matuszek and
Ross Mead and
Raymond J. Mooney and
Roger K. Moore and
Mari Ostendorf and
Heather Pon{-}Barry and
Alexander I. Rudnicky and
Matthias Scheutz and
Robert St. Amant and
Tong Sun and
Stefanie Tellex and
David R. Traum and
Zhou Yu},
title = {Spoken language interaction with robots: Recommendations for future
research},
journal = {Comput. Speech Lang.},
volume = {71},
pages = {101255},
year = {2022},
url = {https://doi.org/10.1016/j.csl.2021.101255},
doi = {10.1016/J.CSL.2021.101255},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/csl/MargeEWAABBCDDH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cssc/NgwaCCGLC22,
author = {Julius S. Ngwa and
Howard J. Cabral and
Debbie M. Cheng and
David R. Gagnon and
Michael P. Lavalley and
L. Adrienne Cupples},
title = {Generating survival times with time-varying covariates using the Lambert
{W} Function},
journal = {Commun. Stat. Simul. Comput.},
volume = {51},
number = {1},
pages = {135--153},
year = {2022},
url = {https://doi.org/10.1080/03610918.2019.1648822},
doi = {10.1080/03610918.2019.1648822},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cssc/NgwaCCGLC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ethicsit/DouglasLH22,
author = {David M. Douglas and
Justine Lacey and
David Howard},
title = {Ethical responsibility and computational design: bespoke surgical
tools as an instructive case study},
journal = {Ethics Inf. Technol.},
volume = {24},
number = {1},
pages = {11},
year = {2022},
url = {https://doi.org/10.1007/s10676-022-09641-2},
doi = {10.1007/S10676-022-09641-2},
timestamp = {Fri, 13 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ethicsit/DouglasLH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/firai/Howard22,
author = {David Howard},
title = {From the lab to the field with Evolutionary Field Robotics},
journal = {Frontiers Robotics {AI}},
volume = {9},
year = {2022},
url = {https://doi.org/10.3389/frobt.2022.1027389},
doi = {10.3389/FROBT.2022.1027389},
timestamp = {Tue, 28 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/firai/Howard22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/firai/HowardGC22,
author = {David Howard and
Kyrre Glette and
Nick Cheney},
title = {Editorial: Evolving Robotic Morphologies},
journal = {Frontiers Robotics {AI}},
volume = {9},
pages = {874853},
year = {2022},
url = {https://doi.org/10.3389/frobt.2022.874853},
doi = {10.3389/FROBT.2022.874853},
timestamp = {Fri, 13 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/firai/HowardGC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/ShabatSMJSKSTWA22,
author = {Niv Ben Shabat and
Gal Sharvit and
Ben Meimis and
Daniel Ben Joya and
Ariel Sloma and
David Kiderman and
Aviv Shabat and
Avishai M. Tsur and
Abdulla Watad and
Howard Amital},
title = {Assessing data gathering of chatbot based symptom checkers - a clinical
vignettes study},
journal = {Int. J. Medical Informatics},
volume = {168},
pages = {104897},
year = {2022},
url = {https://doi.org/10.1016/j.ijmedinf.2022.104897},
doi = {10.1016/J.IJMEDINF.2022.104897},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmi/ShabatSMJSKSTWA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/AlbinLHRGDHHBS22,
author = {John S. Albin and
Jacob E. Lazarus and
Kristen M. Hysell and
David M. Rubins and
Lindsay Germaine and
Caitlin M. Dugdale and
Howard M. Heller and
Elizabeth L. Hohmann and
Joshua J. Baugh and
Erica S. Shenoy},
title = {Development and implementation of a clinical decision support system
tool for the evaluation of suspected monkeypox infection},
journal = {J. Am. Medical Informatics Assoc.},
volume = {29},
number = {12},
pages = {2124--2127},
year = {2022},
url = {https://doi.org/10.1093/jamia/ocac151},
doi = {10.1093/JAMIA/OCAC151},
timestamp = {Sun, 15 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jamia/AlbinLHRGDHHBS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/EstevaFWHSDCSMS22,
author = {Andre Esteva and
Jean Feng and
Douwe van der Wal and
Shih{-}Cheng Huang and
Jeffry P. Simko and
Sandy Devries and
Emmalyn Chen and
Edward M. Schaeffer and
Todd M. Morgan and
Yilun Sun and
Amirata Ghorbani and
Nikhil Naik and
Dhruv Nathawani and
Richard Socher and
Jeff M. Michalski and
Mack Roach and
Thomas M. Pisansky and
Jedidiah M. Monson and
Farah Naz and
James Wallace and
Michelle J. Ferguson and
Jean{-}Paul Bahary and
James Zou and
Matthew P. Lungren and
Serena Yeung and
Ashley E. Ross and
Michael J. Kucharczyk and
Luis Souhami and
Leslie Ballas and
Christopher A. Peters and
Sandy Liu and
Alexander G. Balogh and
Pamela D. Randolph{-}Jackson and
David L. Schwartz and
Michael R. Girvigian and
Naoyuki G. Saito and
Adam Raben and
Rachel A. Rabinovitch and
Khalil Katato and
Howard M. Sandler and
Phuoc T. Tran and
Daniel E. Spratt and
Stephanie Pugh and
Felix Y. Feng and
Osama Mohamad},
title = {Prostate cancer therapy personalization via multi-modal deep learning
on randomized phase {III} clinical trials},
journal = {npj Digit. Medicine},
volume = {5},
year = {2022},
url = {https://doi.org/10.1038/s41746-022-00613-w},
doi = {10.1038/S41746-022-00613-W},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/EstevaFWHSDCSMS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/percom/DopplerLMAKCHGK22,
author = {Klaus Doppler and
David L{\'{o}}pez{-}P{\'{e}}rez and
Swetha Muniraju and
Traian E. Abrudan and
Step{\'{a}}n Kucera and
Holger Claussen and
Howard Huang and
Haris Gacanin and
Veli{-}Matti Kolmonen and
Enrico Rantala},
title = {Future indoor network with a sixth sense: Requirements, challenges
and enabling technologies},
journal = {Pervasive Mob. Comput.},
volume = {83},
pages = {101571},
year = {2022},
url = {https://doi.org/10.1016/j.pmcj.2022.101571},
doi = {10.1016/J.PMCJ.2022.101571},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/percom/DopplerLMAKCHGK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/AhmedVRMCPWM22,
author = {Waseem Ahmed and
Aneesh Vincent Veluthandath and
David J. Rowe and
Jens Madsen and
Howard W. Clark and
Anthony D. Postle and
James S. Wilkinson and
Ganapathy Senthil Murugan},
title = {Prediction of Neonatal Respiratory Distress Biomarker Concentration
by Application of Machine Learning to Mid-Infrared Spectra},
journal = {Sensors},
volume = {22},
number = {5},
pages = {1744},
year = {2022},
url = {https://doi.org/10.3390/s22051744},
doi = {10.3390/S22051744},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/AhmedVRMCPWM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tai/NitschkeH22,
author = {Geoff Nitschke and
David Howard},
title = {AutoFac: The Perpetual Robot Machine},
journal = {{IEEE} Trans. Artif. Intell.},
volume = {3},
number = {1},
pages = {2--10},
year = {2022},
url = {https://doi.org/10.1109/TAI.2021.3104789},
doi = {10.1109/TAI.2021.3104789},
timestamp = {Tue, 08 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tai/NitschkeH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/WuHLJPHKY22,
author = {Chengyue Wu and
David A. Hormuth and
Guillermo Lorenzo and
Angela M. Jarrett and
Federico Pineda and
Frederick M. Howard and
Gregory S. Karczmar and
Thomas E. Yankeelov},
title = {Towards Patient-Specific Optimization of Neoadjuvant Treatment Protocols
for Breast Cancer Based on Image-Guided Fluid Dynamics},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {69},
number = {11},
pages = {3334--3344},
year = {2022},
url = {https://doi.org/10.1109/TBME.2022.3168402},
doi = {10.1109/TBME.2022.3168402},
timestamp = {Tue, 06 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbe/WuHLJPHKY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/technometrics/Lipovetsky22,
author = {Stan Lipovetsky},
title = {Analyzing Spatial Models of Choice and Judgment, Second Edition: by
David A. Armstrong II, Ryan Bakker, Royce Carroll, Christopher Hare,
Keith T. Poole, and Howard Rosenthal. {CRC} Press. Taylor {\&}
Francis Group, Chapman and Hall, Boca Raton, FL, 2021, {ISBN} 978-1-138-71533-2,
320 pp., {\textdollar}63.96 (hbk)},
journal = {Technometrics},
volume = {64},
number = {1},
pages = {139--143},
year = {2022},
url = {https://doi.org/10.1080/00401706.2021.2020519},
doi = {10.1080/00401706.2021.2020519},
timestamp = {Thu, 20 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/technometrics/Lipovetsky22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgis/OldelandEIS22,
author = {Jens Oldeland and
Pia Maria Eibes and
Severin David Howard Irl and
Ute Schmiedel},
title = {Do image resolution and classifier choice impact island biogeographical
parameters of terrestrial islands?},
journal = {Trans. {GIS}},
volume = {26},
number = {4},
pages = {2004--2022},
year = {2022},
url = {https://doi.org/10.1111/tgis.12920},
doi = {10.1111/TGIS.12920},
timestamp = {Wed, 27 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgis/OldelandEIS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tits/WaibelLNHBB22,
author = {Gabriel G{\"{u}}nter Waibel and
Tobias L{\"{o}}w and
Mathieu Nass and
David Howard and
Tirthankar Bandyopadhyay and
Paulo Vinicius Koerich Borges},
title = {How Rough Is the Path? Terrain Traversability Estimation for Local
and Global Path Planning},
journal = {{IEEE} Trans. Intell. Transp. Syst.},
volume = {23},
number = {9},
pages = {16462--16473},
year = {2022},
url = {https://doi.org/10.1109/TITS.2022.3150328},
doi = {10.1109/TITS.2022.3150328},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tits/WaibelLNHBB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/trob/RazjigaevPHRW22,
author = {Andrew Razjigaev and
Ajay K. Pandey and
David Howard and
Jonathan Roberts and
Liao Wu},
title = {End-to-End Design of Bespoke, Dexterous Snake-Like Surgical Robots:
{A} Case Study With the {RAVEN} {II}},
journal = {{IEEE} Trans. Robotics},
volume = {38},
number = {5},
pages = {2827--2840},
year = {2022},
url = {https://doi.org/10.1109/TRO.2022.3164841},
doi = {10.1109/TRO.2022.3164841},
timestamp = {Tue, 18 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/trob/RazjigaevPHRW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aime/GaoRABH22,
author = {Erdi Gao and
Goce Ristanoski and
Uwe Aickelin and
David Berlowitz and
Mark Howard},
editor = {Martin Michalowski and
Syed Sibte Raza Abidi and
Samina Abidi},
title = {Early Detection and Classification of Patient-Ventilator Asynchrony
Using Machine Learning},
booktitle = {Artificial Intelligence in Medicine - 20th International Conference
on Artificial Intelligence in Medicine, {AIME} 2022, Halifax, NS,
Canada, June 14-17, 2022, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13263},
pages = {238--248},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-09342-5\_23},
doi = {10.1007/978-3-031-09342-5\_23},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aime/GaoRABH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/TeferiLA0WW22,
author = {Bemnet Teferi and
Brian Lo and
Alexxa Abi{-}Jaoud{\'{e}} and
Andrew Johnson and
Howard W. Wong and
David Wiljer},
title = {Enhancing the Value of Digital Health Support for Mental Health Help-Seeking
in Transitional Aged Youth: What should we do next?},
booktitle = {{AMIA} 2022, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 5-9, 2022},
publisher = {{AMIA}},
year = {2022},
url = {https://knowledge.amia.org/76677-amia-1.4637602/f008-1.4640715/f008-1.4640716/973-1.4640864/153-1.4640861},
timestamp = {Wed, 17 Apr 2024 11:46:45 +0200},
biburl = {https://dblp.org/rec/conf/amia/TeferiLA0WW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/FitzgeraldDHM22,
author = {Seth G. Fitzgerald and
Gary W. Delaney and
David Howard and
Fr{\'{e}}d{\'{e}}ric Maire},
editor = {Jonathan E. Fieldsend and
Markus Wagner},
title = {Evolving polydisperse soft robotic jamming grippers},
booktitle = {{GECCO} '22: Genetic and Evolutionary Computation Conference, Companion
Volume, Boston, Massachusetts, USA, July 9 - 13, 2022},
pages = {707--710},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3520304.3529072},
doi = {10.1145/3520304.3529072},
timestamp = {Mon, 25 Jul 2022 17:04:27 +0200},
biburl = {https://dblp.org/rec/conf/gecco/FitzgeraldDHM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/HowardMDKR22,
author = {David Howard and
Humphrey Munn and
Davide Dolcetti and
Josh Kannemeyer and
Nicole L. Robinson},
editor = {Jonathan E. Fieldsend and
Markus Wagner},
title = {Assessing evolutionary terrain generation methods for curriculum reinforcement
learning},
booktitle = {{GECCO} '22: Genetic and Evolutionary Computation Conference, Boston,
Massachusetts, USA, July 9 - 13, 2022},
pages = {377--384},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3512290.3528870},
doi = {10.1145/3512290.3528870},
timestamp = {Tue, 12 Jul 2022 15:09:18 +0200},
biburl = {https://dblp.org/rec/conf/gecco/HowardMDKR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/HuangWHS22,
author = {Zonghao Huang and
Quinn Wu and
David Howard and
Cynthia R. Sung},
editor = {Jonathan E. Fieldsend and
Markus Wagner},
title = {EvoRobogami: co-designing with humans in evolutionary robotics experiments},
booktitle = {{GECCO} '22: Genetic and Evolutionary Computation Conference, Boston,
Massachusetts, USA, July 9 - 13, 2022},
pages = {168--176},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3512290.3528867},
doi = {10.1145/3512290.3528867},
timestamp = {Tue, 12 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gecco/HuangWHS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/KentNTH22,
author = {Nathan D. Kent and
David Neiman and
Matthew Travers and
Thomas M. Howard},
title = {Improved Performance of {CPG} Parameter Inference for Path-following
Control of Legged Robots},
booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems,
{IROS} 2022, Kyoto, Japan, October 23-27, 2022},
pages = {11963--11970},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IROS47612.2022.9981859},
doi = {10.1109/IROS47612.2022.9981859},
timestamp = {Tue, 03 Jan 2023 14:18:21 +0100},
biburl = {https://dblp.org/rec/conf/iros/KentNTH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/PinskierBHSH22,
author = {Joshua Pinskier and
James Brett and
Lauren Hanson and
Katrina Lo Surdo and
David Howard},
title = {Jammkle: Fibre jamming 3D printed multi-material tendons and their
application in a robotic ankle},
booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems,
{IROS} 2022, Kyoto, Japan, October 23-27, 2022},
pages = {8507--8514},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IROS47612.2022.9982171},
doi = {10.1109/IROS47612.2022.9982171},
timestamp = {Tue, 03 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iros/PinskierBHSH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ozchi/JohansenSBHCDDG22,
author = {Stine S. Johansen and
Hashini Senaratne and
Alan Burden and
David Howard and
Glenda Amayo Caldwell and
Jared Donovan and
Andreas Duenser and
Matthias Guertler and
Melanie J. McGrath and
C{\'{e}}cile Paris and
Markus Rittenbruch and
Jonathan Roberts},
editor = {Penny Sweetser and
Jennyfer Lawrence Taylor and
Charles Martin and
Dana McMay and
Melissa J. Rogerson and
Bronwyn J. Cumbo and
Greg Wadley and
Luke Hespanhol and
Jess Tsimeris and
Mingze Xi and
Jane Turner and
Soojeong Yoo and
Ned Cooper and
Jessica S. Rahman and
Josh Andres and
Ajit G. Pillai and
Cat Kutay},
title = {Empowering People in Human-Robot Collaboration: Bringing Together
and Synthesising Perspectives},
booktitle = {Proceedings of the 34th Australian Conference on Human-Computer Interaction,
OzCHI 2022, Canberra, ACT, Australia, 29 November 2022 - 2 December
2022},
pages = {352--355},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3572921.3572955},
doi = {10.1145/3572921.3572955},
timestamp = {Wed, 08 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ozchi/JohansenSBHCDDG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robosoft/HowardOLBJLFD22,
author = {David Howard and
Jack O'Connor and
Jordan Letchford and
James Brett and
Therese Joseph and
Sophia Lin and
Daniel Furby and
Gary W. Delaney},
title = {Getting a Grip: in Materio Evolution of Membrane Morphology for Soft
Robotic Jamming Grippers},
booktitle = {5th {IEEE} International Conference on Soft Robotics, RoboSoft 2022,
Edinburgh, United Kingdom, April 4-8, 2022},
pages = {531--538},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/RoboSoft54090.2022.9762197},
doi = {10.1109/ROBOSOFT54090.2022.9762197},
timestamp = {Thu, 05 May 2022 16:45:02 +0200},
biburl = {https://dblp.org/rec/conf/robosoft/HowardOLBJLFD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/LangermanQSSWH22,
author = {Jack Langerman and
Ziming Qiu and
G{\'{a}}bor S{\"{o}}r{\"{o}}s and
D{\'{a}}vid Sebok and
Yao Wang and
Howard Huang},
title = {Bell Labs robot garage for {DANCE:} Domain Adaptation of Networks
for Camera Pose Estimation},
publisher = {{IEEE} DataPort},
year = {2022},
month = jan,
howpublished = {\url{https://doi.org/10.21227/mjek-j791}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.21227/mjek-j791},
doi = {10.21227/MJEK-J791},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/LangermanQSSWH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-11846,
author = {Shane Walsh and
Alex Frost and
William Anderson and
Toby Digney and
Benjamin Dix{-}Matthews and
David R. Gozzard and
Charles T. Gravestock and
Lewis Howard and
Skevos F. E. Karpathakis and
Ayden McCann and
Sascha W. Schediwy},
title = {The Western Australian Optical Ground Station},
journal = {CoRR},
volume = {abs/2201.11846},
year = {2022},
url = {https://arxiv.org/abs/2201.11846},
eprinttype = {arXiv},
eprint = {2201.11846},
timestamp = {Wed, 02 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2201-11846.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-15172,
author = {David Howard and
Josh Kannemeyer and
Davide Dolcetti and
Humphrey Munn and
Nicole L. Robinson},
title = {Assessing Evolutionary Terrain Generation Methods for Curriculum Reinforcement
Learning},
journal = {CoRR},
volume = {abs/2203.15172},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2203.15172},
doi = {10.48550/ARXIV.2203.15172},
eprinttype = {arXiv},
eprint = {2203.15172},
timestamp = {Tue, 24 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2203-15172.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-08086,
author = {Zonghao Huang and
Quinn Wu and
David Howard and
Cynthia Sung},
title = {EvoRobogami: Co-designing with Humans in Evolutionary Robotics Experiments},
journal = {CoRR},
volume = {abs/2205.08086},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.08086},
doi = {10.48550/ARXIV.2205.08086},
eprinttype = {arXiv},
eprint = {2205.08086},
timestamp = {Tue, 12 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-08086.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-13843,
author = {Joshua Pinskier and
Prabhat Kumar and
David Howard and
Matthijs Langelaar},
title = {Automated design of pneumatic soft grippers through design-dependent
multi-material topology optimization},
journal = {CoRR},
volume = {abs/2211.13843},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.13843},
doi = {10.48550/ARXIV.2211.13843},
eprinttype = {arXiv},
eprint = {2211.13843},
timestamp = {Tue, 29 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-13843.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-05626,
author = {Nicole L. Robinson and
Jason Williams and
David Howard and
Brendan Tidd and
Fletcher Talbot and
Brett Wood and
Alex Pitt and
Navinda Kottege and
Dana Kulic},
title = {Human-Robot Team Performance Compared to Full Robot Autonomy in 16
Real-World Search and Rescue Missions: Adaptation of the {DARPA} Subterranean
Challenge},
journal = {CoRR},
volume = {abs/2212.05626},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.05626},
doi = {10.48550/ARXIV.2212.05626},
eprinttype = {arXiv},
eprint = {2212.05626},
timestamp = {Mon, 04 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-05626.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-06485,
author = {Therese Joseph and
Sarah Baldwin and
Lillian Guan and
James Brett and
David Howard},
title = {The Jamming Donut: {A} Free-Space Gripper based on Granular Jamming},
journal = {CoRR},
volume = {abs/2212.06485},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.06485},
doi = {10.48550/ARXIV.2212.06485},
eprinttype = {arXiv},
eprint = {2212.06485},
timestamp = {Mon, 02 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-06485.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-06498,
author = {Cameron Coombe and
James Brett and
Raghav Mishra and
Gary W. Delaney and
David Howard},
title = {Active Vibration Fluidization for Granular Jamming Grippers},
journal = {CoRR},
volume = {abs/2212.06498},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.06498},
doi = {10.48550/ARXIV.2212.06498},
eprinttype = {arXiv},
eprint = {2212.06498},
timestamp = {Mon, 02 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-06498.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-06511,
author = {David Howard and
Jack O'Connor and
Jordan Letchford and
Therese Joseph and
Sophia Lin and
Sarah Baldwin and
Gary W. Delaney},
title = {A Comprehensive Dataset of Grains for Granular Jamming in Soft Robotics:
Grip Strength and Shock Absorption},
journal = {CoRR},
volume = {abs/2212.06511},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.06511},
doi = {10.48550/ARXIV.2212.06511},
eprinttype = {arXiv},
eprint = {2212.06511},
timestamp = {Mon, 02 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-06511.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/CollinsCVH21,
author = {Jack Collins and
Shelvin Chand and
Anthony Vanderkop and
David Howard},
title = {A Review of Physics Simulators for Robotic Applications},
journal = {{IEEE} Access},
volume = {9},
pages = {51416--51431},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3068769},
doi = {10.1109/ACCESS.2021.3068769},
timestamp = {Thu, 16 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/CollinsCVH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aiethics/DouglasHL21,
author = {David M. Douglas and
David Howard and
Justine Lacey},
title = {Moral responsibility for computationally designed products},
journal = {{AI} Ethics},
volume = {1},
number = {3},
pages = {273--281},
year = {2021},
url = {https://doi.org/10.1007/s43681-020-00034-z},
doi = {10.1007/S43681-020-00034-Z},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aiethics/DouglasHL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csur/KolbAKC20,
author = {John Kolb and
Moustafa AbdelBaky and
Randy H. Katz and
David E. Culler},
title = {Core Concepts, Challenges, and Future Directions in Blockchain: {A}
Centralized Tutorial},
journal = {{ACM} Comput. Surv.},
volume = {53},
number = {1},
pages = {9:1--9:39},
year = {2021},
url = {https://doi.org/10.1145/3366370},
doi = {10.1145/3366370},
timestamp = {Wed, 23 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/csur/KolbAKC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ec/NygaardMHTG21,
author = {T{\o}nnes F. Nygaard and
Charles P. Martin and
David Howard and
Jim T{\o}rresen and
Kyrre Glette},
title = {Environmental Adaptation of Robot Morphology and Control Through Real-World
Evolution},
journal = {Evol. Comput.},
volume = {29},
number = {4},
pages = {441--461},
year = {2021},
url = {https://doi.org/10.1162/evco\_a\_00291},
doi = {10.1162/EVCO\_A\_00291},
timestamp = {Wed, 12 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ec/NygaardMHTG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/firai/ChandH21,
author = {Shelvin Chand and
David Howard},
title = {Multi-Level Evolution for Robotic Design},
journal = {Frontiers Robotics {AI}},
volume = {8},
pages = {684304},
year = {2021},
url = {https://doi.org/10.3389/frobt.2021.684304},
doi = {10.3389/FROBT.2021.684304},
timestamp = {Tue, 06 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/firai/ChandH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jirs/OliveiraNHBCM21,
author = {Felipe G. Oliveira and
Armando Alves Neto and
David Howard and
Paulo V. K. Borges and
Mario F. M. Campos and
Douglas G. Macharet},
title = {Three-Dimensional Mapping with Augmented Navigation Cost through Deep
Learning},
journal = {J. Intell. Robotic Syst.},
volume = {101},
number = {3},
pages = {50},
year = {2021},
url = {https://doi.org/10.1007/s10846-020-01304-y},
doi = {10.1007/S10846-020-01304-Y},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jirs/OliveiraNHBCM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mlst/YanxonZTMZ21,
author = {Howard Yanxon and
David Zagaceta and
Binh Tang and
David S. Matteson and
Qiang Zhu},
title = {PyXtal{\_}FF: a python library for automated force field generation},
journal = {Mach. Learn. Sci. Technol.},
volume = {2},
number = {2},
pages = {27001},
year = {2021},
url = {https://doi.org/10.1088/2632-2153/abc940},
doi = {10.1088/2632-2153/ABC940},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mlst/YanxonZTMZ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/natmi/NygaardMTGH21,
author = {T{\o}nnes F. Nygaard and
Charles P. Martin and
Jim T{\o}rresen and
Kyrre Glette and
David Howard},
title = {Real-world embodied {AI} through a morphologically adaptive quadruped
robot},
journal = {Nat. Mach. Intell.},
volume = {3},
number = {5},
pages = {410--419},
year = {2021},
url = {https://doi.org/10.1038/s42256-021-00320-3},
doi = {10.1038/S42256-021-00320-3},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/natmi/NygaardMTGH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ral/AhmadiNKHH21,
author = {Ahmadreza Ahmadi and
T{\o}nnes F. Nygaard and
Navinda Kottege and
David Howard and
Nicolas Hudson},
title = {Semi-Supervised Gated Recurrent Neural Networks for Robotic Terrain
Classification},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {6},
number = {2},
pages = {1848--1855},
year = {2021},
url = {https://doi.org/10.1109/LRA.2021.3060437},
doi = {10.1109/LRA.2021.3060437},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ral/AhmadiNKHH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spm/TookAYH21,
author = {Clive Cheong Took and
Stephen R. Alty and
Anush Yardim and
David M. Howard},
title = {Creativity First, Science Follows: Lessons in Digital Signal Processing
Education},
journal = {{IEEE} Signal Process. Mag.},
volume = {38},
number = {3},
pages = {51--61},
year = {2021},
url = {https://doi.org/10.1109/MSP.2021.3058459},
doi = {10.1109/MSP.2021.3058459},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/spm/TookAYH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/LoSWAH0W21,
author = {Brian Lo and
Jenny Shi and
Howard W. Wong and
Alexxa Abi{-}Jaoud{\'{e}} and
Elisa Hollenberg and
Andrew Johnson and
David Wiljer},
title = {Engaging the disengaged: recommendations for partnering with transitional
aged youth to improve mental health help-seeking in the digital age},
booktitle = {{AMIA} 2021, American Medical Informatics Association Annual Symposium,
San Diego, CA, USA, October 30, 2021 - November 3, 2021},
publisher = {{AMIA}},
year = {2021},
url = {https://knowledge.amia.org/74229-amia-1.4622266/t005-1.4625076/t005-1.4625077/3577213-1.4625570/3576668-1.4625567},
timestamp = {Wed, 17 Apr 2024 11:46:53 +0200},
biburl = {https://dblp.org/rec/conf/amia/LoSWAH0W21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LowellHLW21,
author = {David Lowell and
Brian E. Howard and
Zachary C. Lipton and
Byron C. Wallace},
editor = {Marie{-}Francine Moens and
Xuanjing Huang and
Lucia Specia and
Scott Wen{-}tau Yih},
title = {Unsupervised Data Augmentation with Naive Augmentation and without
Unlabeled Data},
booktitle = {Proceedings of the 2021 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2021, Virtual Event / Punta Cana, Dominican
Republic, 7-11 November, 2021},
pages = {4992--5001},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.emnlp-main.408},
doi = {10.18653/V1/2021.EMNLP-MAIN.408},
timestamp = {Fri, 16 Feb 2024 08:27:36 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/LowellHLW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euspn/GuzmanZBD21,
author = {Jey Howard Escorcia Guzman and
Rohemi Alfredo Zuluaga{-}Ortiz and
David Andres Barrios{-}Miranda and
Enrique Jos{\'{e}} Delahoz{-}Dom{\'{\i}}nguez},
editor = {Nuno Varandas and
Ansar{-}Ul{-}Haque Yasar and
Haroon Malik and
St{\'{e}}phane Galland},
title = {Information and Communication Technologies {(ICT)} in the processes
of distribution and use of knowledge in Higher Education Institutions
(HEIs)},
booktitle = {The 12th International Conference on Emerging Ubiquitous Systems and
Pervasive Networks {(EUSPN} 2021) / The 11th International Conference
on Current and Future Trends of Information and Communication Technologies
in Healthcare (ICTH-2021), Leuven, Belgium, November 1-4, 2021},
series = {Procedia Computer Science},
volume = {198},
pages = {644--649},
publisher = {Elsevier},
year = {2021},
url = {https://doi.org/10.1016/j.procs.2021.12.300},
doi = {10.1016/J.PROCS.2021.12.300},
timestamp = {Sun, 17 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/euspn/GuzmanZBD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/FitzgeraldDHM21,
author = {Seth G. Fitzgerald and
Gary W. Delaney and
David Howard and
Fr{\'{e}}d{\'{e}}ric Maire},
editor = {Francisco Chicano and
Krzysztof Krawiec},
title = {Evolving soft robotic jamming grippers},
booktitle = {{GECCO} '21: Genetic and Evolutionary Computation Conference, Lille,
France, July 10-14, 2021},
pages = {102--110},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3449639.3459331},
doi = {10.1145/3449639.3459331},
timestamp = {Thu, 24 Jun 2021 08:56:59 +0200},
biburl = {https://dblp.org/rec/conf/gecco/FitzgeraldDHM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/DimitrovGHL21,
author = {Marin Dimitrov and
Keir Groves and
David Howard and
Barry Lennox},
title = {Model Identification of a Small Fully-Actuated Aquatic Surface Vehicle
Using a Long Short-Term Memory Neural Network},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2021, Xi'an, China, May 30 - June 5, 2021},
pages = {5966--5972},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICRA48506.2021.9561454},
doi = {10.1109/ICRA48506.2021.9561454},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/DimitrovGHL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/SimonsBBDFJLLMO21,
author = {Mark Simons and
David Bekaert and
Adrian A. Borsa and
Andrea Donnellan and
Eric J. Fielding and
Cathleen E. Jones and
Rowena Lohman and
Zhong Lu and
Franz Meyer and
Susan Owen and
Paul A. Rosen and
Howard A. Zebker},
title = {Nisar Requirements and Validation Approach for Solid Earth Science},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2021, Brussels, Belgium, July 11-16, 2021},
pages = {543--546},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IGARSS47720.2021.9554894},
doi = {10.1109/IGARSS47720.2021.9554894},
timestamp = {Fri, 29 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/SimonsBBDFJLLMO21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/RazjigaevPH0W21,
author = {Andrew Razjigaev and
Ajay K. Pandey and
David Howard and
Jonathan Roberts and
Liao Wu},
title = {SnakeRaven: Teleoperation of a 3D Printed Snake-like Manipulator Integrated
to the {RAVEN} {II} Surgical Robot},
booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems,
{IROS} 2021, Prague, Czech Republic, September 27 - Oct. 1, 2021},
pages = {5282--5288},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IROS51168.2021.9636878},
doi = {10.1109/IROS51168.2021.9636878},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iros/RazjigaevPH0W21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/LaCroixCSNMMMLZ21,
author = {Marc{-}Andre LaCroix and
Euhan Chong and
Weilun Shen and
Ehud Nir and
Faisal Ahmed Musa and
Haitao Mei and
Mohammad{-}Mahdi Mohsenpour and
Semyon Lebedev and
Babak Zamanlooy and
Carlos Carvalho and
Qian Xin and
Dmitry Petrov and
Henry Wong and
Huong Ho and
Yang Xu and
Sina Naderi Shahi and
Peter Krotnev and
Chris Feist and
Howard Huang and
Davide Tonietto},
title = {8.4 {A} 116Gb/s DSP-Based Wireline Transceiver in 7nm {CMOS} Achieving
6pJ/b at 45dB Loss in PAM-4/Duo-PAM-4 and 52dB in {PAM-2}},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2021,
San Francisco, CA, USA, February 13-22, 2021},
pages = {132--134},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISSCC42613.2021.9366030},
doi = {10.1109/ISSCC42613.2021.9366030},
timestamp = {Mon, 15 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/LaCroixCSNMMMLZ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/CachayRCBR21,
author = {Salva R{\"{u}}hling Cachay and
Venkatesh Ramesh and
Jason N. S. Cole and
Howard Barker and
David Rolnick},
editor = {Joaquin Vanschoren and
Sai{-}Kit Yeung},
title = {ClimART: {A} Benchmark Dataset for Emulating Atmospheric Radiative
Transfer in Weather and Climate Models},
booktitle = {Proceedings of the Neural Information Processing Systems Track on
Datasets and Benchmarks 1, NeurIPS Datasets and Benchmarks 2021, December
2021, virtual},
year = {2021},
url = {https://datasets-benchmarks-proceedings.neurips.cc/paper/2021/hash/f718499c1c8cef6730f9fd03c8125cab-Abstract-round2.html},
timestamp = {Thu, 05 May 2022 16:30:03 +0200},
biburl = {https://dblp.org/rec/conf/nips/CachayRCBR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robosoft/HowardOBD21,
author = {David Howard and
Jack O'Connor and
James Brett and
Gary W. Delaney},
title = {Shape, Size, and Fabrication Effects in 3D Printed Granular Jamming
Grippers},
booktitle = {4th {IEEE} International Conference on Soft Robotics, RoboSoft 2021,
New Haven, CT, USA, April 12-16, 2021},
pages = {458--464},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/RoboSoft51838.2021.9479438},
doi = {10.1109/ROBOSOFT51838.2021.9479438},
timestamp = {Tue, 20 Jul 2021 14:40:20 +0200},
biburl = {https://dblp.org/rec/conf/robosoft/HowardOBD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2104-04171,
author = {David Howard and
Jack O'Connor and
James Brett and
Gary W. Delaney},
title = {Shape, Size, and Fabrication Effects in 3D Printed Granular Jamming
Grippers},
journal = {CoRR},
volume = {abs/2104.04171},
year = {2021},
url = {https://arxiv.org/abs/2104.04171},
eprinttype = {arXiv},
eprint = {2104.04171},
timestamp = {Tue, 13 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2104-04171.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-13465,
author = {Ti Bai and
Anjali Balagopal and
Michael Dohopolski and
Howard E. Morgan and
Rafe McBeth and
Jun Tan and
Mu{-}Han Lin and
David J. Sher and
Dan Nguyen and
Steve B. Jiang},
title = {A Proof-of-Concept Study of Artificial Intelligence Assisted Contour
Revision},
journal = {CoRR},
volume = {abs/2107.13465},
year = {2021},
url = {https://arxiv.org/abs/2107.13465},
eprinttype = {arXiv},
eprint = {2107.13465},
timestamp = {Fri, 30 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2107-13465.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-04674,
author = {Jack Collins and
Ross Brown and
J{\"{u}}rgen Leitner and
David Howard},
title = {Follow the Gradient: Crossing the Reality Gap using Differentiable
Physics (RealityGrad)},
journal = {CoRR},
volume = {abs/2109.04674},
year = {2021},
url = {https://arxiv.org/abs/2109.04674},
eprinttype = {arXiv},
eprint = {2109.04674},
timestamp = {Tue, 21 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-04674.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-04681,
author = {James Brett and
Katrina Lo Surdo and
Lauren Hanson and
Joshua Pinskier and
David Howard},
title = {Jammkle: Fibre jamming 3D printed multi-material tendons and their
application in a robotic ankle},
journal = {CoRR},
volume = {abs/2109.04681},
year = {2021},
url = {https://arxiv.org/abs/2109.04681},
eprinttype = {arXiv},
eprint = {2109.04681},
timestamp = {Tue, 21 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-04681.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-10496,
author = {Raghav Mishra and
Tyson Philips and
Gary W. Delaney and
David Howard},
title = {Vibration Improves Performance in Granular Jamming Grippers},
journal = {CoRR},
volume = {abs/2109.10496},
year = {2021},
url = {https://arxiv.org/abs/2109.10496},
eprinttype = {arXiv},
eprint = {2109.10496},
timestamp = {Mon, 27 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-10496.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-01952,
author = {David Howard and
Jack O'Connor and
Jordan Letchford and
James Brett and
Therese Joseph and
Sophia Lin and
Daniel Furby and
Gary W. Delaney},
title = {Getting a Grip: in Materio Evolution of Membrane Morphology for Soft
Robotic Jamming Grippers},
journal = {CoRR},
volume = {abs/2111.01952},
year = {2021},
url = {https://arxiv.org/abs/2111.01952},
eprinttype = {arXiv},
eprint = {2111.01952},
timestamp = {Fri, 05 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-01952.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-14671,
author = {Salva R{\"{u}}hling Cachay and
Venkatesh Ramesh and
Jason N. S. Cole and
Howard Barker and
David Rolnick},
title = {ClimART: {A} Benchmark Dataset for Emulating Atmospheric Radiative
Transfer in Weather and Climate Models},
journal = {CoRR},
volume = {abs/2111.14671},
year = {2021},
url = {https://arxiv.org/abs/2111.14671},
eprinttype = {arXiv},
eprint = {2111.14671},
timestamp = {Wed, 01 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-14671.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-14741,
author = {Jack Langerman and
Ziming Qiu and
G{\'{a}}bor S{\"{o}}r{\"{o}}s and
D{\'{a}}vid Sebok and
Yao Wang and
Howard Huang},
title = {Domain Adaptation of Networks for Camera Pose Estimation: Learning
Camera Pose Estimation Without Pose Labels},
journal = {CoRR},
volume = {abs/2111.14741},
year = {2021},
url = {https://arxiv.org/abs/2111.14741},
eprinttype = {arXiv},
eprint = {2111.14741},
timestamp = {Wed, 01 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-14741.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/concurrency/BernholdtBBVGNP20,
author = {David E. Bernholdt and
Swen Boehm and
George Bosilca and
Manjunath Gorentla Venkata and
Ryan E. Grant and
Thomas J. Naughton and
Howard Pritchard and
Martin Schulz and
Geoffroy R. Vall{\'{e}}e},
title = {A survey of {MPI} usage in the {US} exascale computing project},
journal = {Concurr. Comput. Pract. Exp.},
volume = {32},
number = {3},
year = {2020},
url = {https://doi.org/10.1002/cpe.4851},
doi = {10.1002/CPE.4851},
timestamp = {Fri, 27 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/concurrency/BernholdtBBVGNP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ior/JohnsonBDDGHKRS20,
author = {David S. Johnson and
Lee Breslau and
Ilias Diakonikolas and
Nick Duffield and
Yu Gu and
MohammadTaghi Hajiaghayi and
Howard J. Karloff and
Mauricio G. C. Resende and
Subhabrata Sen},
title = {Near-Optimal Disjoint-Path Facility Location Through Set Cover by
Pairs},
journal = {Oper. Res.},
volume = {68},
number = {3},
pages = {896--926},
year = {2020},
url = {https://doi.org/10.1287/opre.2019.1956},
doi = {10.1287/OPRE.2019.1956},
timestamp = {Tue, 30 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ior/JohnsonBDDGHKRS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocch/MillardPHH20,
author = {David E. Millard and
Heather S. Packer and
Yvonne Margaret Howard and
Charlie Hargood},
title = {The Balance of Attention: The Challenges of Creating Locative Cultural
Storytelling Experiences},
journal = {{ACM} Journal on Computing and Cultural Heritage},
volume = {13},
number = {4},
pages = {35:1--35:24},
year = {2020},
url = {https://doi.org/10.1145/3404195},
doi = {10.1145/3404195},
timestamp = {Mon, 11 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jocch/MillardPHH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/AmidBGGKLMMOPRS20,
author = {Alon Amid and
David Biancolin and
Abraham Gonzalez and
Daniel Grubb and
Sagar Karandikar and
Harrison Liew and
Albert Magyar and
Howard Mao and
Albert J. Ou and
Nathan Pemberton and
Paul Rigge and
Colin Schmidt and
John Charles Wright and
Jerry Zhao and
Yakun Sophia Shao and
Krste Asanovic and
Borivoje Nikolic},
title = {Chipyard: Integrated Design, Simulation, and Implementation Framework
for Custom SoCs},
journal = {{IEEE} Micro},
volume = {40},
number = {4},
pages = {10--21},
year = {2020},
url = {https://doi.org/10.1109/MM.2020.2996616},
doi = {10.1109/MM.2020.2996616},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/AmidBGGKLMMOPRS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/TanDCRCMMJGMSAT20,
author = {Audrey Tan and
Mark Durbin and
Frank R. Chung and
Ada L. Rubin and
Allison M. Cuthel and
Jordan A. McQuilkin and
Aram S. Modrek and
Catherine T. Jamin and
Nicholas Gavin and
Devin M. Mann and
Jordan L. Swartz and
Jonathan S. Austrian and
Paul A. Testa and
Jacob D. Hill and
Corita R. Grudzen and
Benjamin Abella and
David Allard and
M. Fernanda Bellolio and
Michael Blum and
Todd Burstain and
Jeffrey Caterino and
Julie Cooper and
Bruce Darrow and
Marie{-}Carmelle Elie and
Ahmed Elsayem and
John Frenzel and
Howard Goldberg and
Iris Herrera and
John Howell and
Allen Hsaio and
Eric Isaacs and
Karen Jubanyik and
Ken Kawamoto and
Sangeeta Lamba and
Troy Madsen and
Joseph Miller and
Kei Ouchi and
Rajesh Patel and
Rajiv Pramanik and
Lynne Richardson and
Milisa Rizer and
Elizabeth Schoenfeld and
Timothy Shiuh and
Ashley Shreves and
Robert Swor and
Arvind Venkat and
Kendall Webb and
Howard Weeks and
Robert White and
Decker Wyatt and
Matthew Zimmie and
Erin Zimny},
title = {Design and implementation of a clinical decision support tool for
primary palliative Care for Emergency Medicine {(PRIM-ER)}},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {20},
number = {1},
pages = {13},
year = {2020},
url = {https://doi.org/10.1186/s12911-020-1021-7},
doi = {10.1186/S12911-020-1021-7},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/TanDCRCMMJGMSAT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/natmi/RichRJFWSDOBLPT20,
author = {Alexander S. Rich and
Cynthia Rudin and
David M. P. Jacoby and
Robin Freeman and
Oliver R. Wearn and
Henry Shevlin and
Kanta Dihal and
Se{\'{a}}n S. {\'{O}}h{\'{E}}igeartaigh and
James Butcher and
Marco Lippi and
Przemyslaw Palka and
Paolo Torroni and
Shannon Wongvibulsin and
Edmon Begoli and
Gisbert Schneider and
Stephen Cave and
Mona Sloane and
Emanuel Moss and
Iyad Rahwan and
Ken Goldberg and
David Howard and
Luciano Floridi and
Jack Stilgoe},
title = {{AI} reflections in 2019},
journal = {Nat. Mach. Intell.},
volume = {2},
number = {1},
pages = {2--9},
year = {2020},
url = {https://doi.org/10.1038/s42256-019-0141-1},
doi = {10.1038/S42256-019-0141-1},
timestamp = {Wed, 08 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/natmi/RichRJFWSDOBLPT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/TurroAMGGSASFTS20,
author = {Ernest Turro and
William J. Astle and
Karyn Megy and
Stefan Gr{\"{a}}f and
Daniel Greene and
Olga Shamardina and
Hana Lango Allen and
Alba Sanchis{-}Juan and
Mattia Frontini and
Chantal Thys and
Jonathan Stephens and
Rutendo Mapeta and
Oliver S. Burren and
Kate Downes and
Matthias Haimel and
Salih Tuna and
Sri V. V. Deevi and
Timothy J. Aitman and
David L. H. Bennett and
Paul Calleja and
Keren Carss and
Mark J. Caulfield and
Patrick F. Chinnery and
Peter H. Dixon and
Daniel P. Gale and
Roger James and
Ania Koziell and
Michael A. Laffan and
Adam P. Levine and
Eamonn R. Maher and
Hugh S. Markus and
Joannella Morales and
Nicholas W. Morrell and
Andrew D. Mumford and
Elizabeth Ormondroyd and
Stuart Rankin and
Augusto Rendon and
Sylvia Richardson and
Irene Roberts and
Noemi B. A. Roy and
Moin A. Saleem and
Kenneth G. C. Smith and
Hannah Stark and
Rhea Y. Y. Tan and
Andreas C. Themistocleous and
Adrian J. Thrasher and
Hugh Watkins and
Andrew R. Webster and
Martin R. Wilkins and
Catherine Williamson and
James Whitworth and
Sean Humphray and
David R. Bentley and
Stephen Abbs and
Lara Abulhoul and
Julian Adlard and
Munaza Ahmed and
Hana Alachkar and
David J. Allsup and
Jeff Almeida{-}King and
Philip Ancliff and
Richard Antrobus and
Ruth Armstrong and
Gavin Arno and
Sofie Ashford and
Anthony Attwood and
Paul Aurora and
Christian Babbs and
Chiara Bacchelli and
Tamam Bakchoul and
Siddharth Banka and
Tadbir Bariana and
Julian Barwell and
Joana Batista and
Helen E. Baxendale and
Phil L. Beales and
Agnieszka Bierzynska and
Tina Biss and
Maria A. K. Bitner{-}Glindzicz and
Graeme C. M. Black and
Marta Bleda and
Iulia Blesneac and
Detlef Bockenhauer and
Harm Bogaard and
Christian J. Bourne and
Sara Boyce and
John R. Bradley and
Eugene Bragin and
Gerome Breen and
Paul Brennan and
Carole Brewer and
Matthew Brown and
Andrew C. Browning and
Michael J. Browning and
Rachel J. Buchan and
Matthew S. Buckland and
Teofila Bueser and
Carmen Bugarin Diz and
John Burn and
Siobhan O. Burns and
Nigel Burrows and
Carolyn Campbell and
Gerald Carr{-}White and
Ruth Casey and
Jenny Chambers and
John Chambers and
Melanie M. Y. Chan and
Calvin Cheah and
Floria Cheng and
Manali Chitre and
Martin T. Christian and
Colin Church and
Jill Clayton{-}Smith and
Maureen Cleary and
Naomi Clements Brod and
Gerry Coghlan and
Elizabeth Colby and
Trevor R. P. Cole and
Janine Collins and
Peter W. Collins and
Camilla Colombo and
Cecilia J. Compton and
Robin Condliffe and
Stuart A. Cook and
H. Terence Cook and
Nichola Cooper and
Paul A. Corris and
Abigail Furnell and
Fiona Cunningham and
Nicola S. Curry and
Antony J. Cutler and
Matthew J. Daniels and
Mehul Dattani and
Louise C. Daugherty and
John Davis and
Anthony De Soyza and
Timothy Dent and
Charu Deshpande and
Eleanor F. Dewhurst and
Sofia Douzgou and
Anna M. Drazyk and
Elizabeth Drewe and
Daniel Duarte and
Tina Dutt and
J. David M. Edgar and
Karen Edwards and
William Egner and
Melanie N. Ekani and
Perry Elliott and
Wendy N. Erber and
Marie Erwood and
Maria C. Estiu and
Dafydd Gareth Evans and
Gillian Evans and
Tamara Everington and
M{\'{e}}lanie Eyries and
Hiva Fassihi and
Remi Favier and
Jack Findhammer and
Debra Fletcher and
Frances A. Flinter and
R. Andres Floto and
Tom Fowler and
James Fox and
Amy J. Frary and
Courtney E. French and
Kathleen Freson and
Henning Gall and
Vijeya Ganesan and
Michael Gattens and
Claire Geoghegan and
Terence S. A. Gerighty and
Ali G. Gharavi and
Stefano Ghio and
Hossein{-}Ardeschir Ghofrani and
J. Simon R. Gibbs and
Kate Gibson and
Kimberly C. Gilmour and
Barbara Girerd and
Nicholas S. Gleadall and
Sarah Goddard and
David B. Goldstein and
Keith Gomez and
Pavels Gordins and
David Gosal and
Jodie Graham and
Luigi Grassi and
Lynn Greenhalgh and
Andreas Greinacher and
Paolo Gresele and
Philip Griffiths and
Sofia Grigoriadou and
Russell J. Grocock and
Detelina Grozeva and
Mark Gurnell and
Scott Hackett and
Charaka Hadinnapola and
William M. Hague and
Rosie Hague and
Matthew Hall and
Helen L. Hanson and
Eshika Haque and
Kirsty Harkness and
Andrew R. Harper and
Claire L. Harris and
Daniel Hart and
Ahamad Hassan and
Grant Hayman and
Alex Henderson and
Archana Herwadkar and
Jonathan Hoffman and
Simon Holden and
Rita Horvath and
Henry Houlden and
Arjan C. Houweling and
Luke S. G. E. Howard and
Fengyuan Hu and
Gavin Hudson and
Joseph Hughes and
Aarnoud P. Huissoon and
Marc Humbert and
Sarah Hunter and
Matthew E. Hurles and
Melita Irving and
Louise Izatt and
Sally A. Johnson and
Stephen Jolles and
Jennifer Jolley and
Dragana Josifova and
Neringa Jurkute and
Tim Karten and
Johannes Karten and
Mary A. Kasanicki and
Hanadi Kazkaz and
Rashid Kazmi and
Peter Kelleher and
Anne M. Kelly and
Wilf Kelsall and
Carly Kempster and
David G. Kiely and
Nathalie Kingston and
Robert Klima and
Nils Koelling and
Myrto Kostadima and
Gabor Kovacs and
Roman Kreuzhuber and
Taco W. Kuijpers and
Ajith Kumar and
Dinakantha Kumararatne and
Manju A. Kurian and
Fiona Lalloo and
Michele Lambert and
Allan Lawrie and
D. Mark Layton and
Nick Lench and
Claire Lentaigne and
Tracy Lester and
Rachel Linger and
Hilary Longhurst and
Lorena E. Lorenzo and
Eleni Louka and
Paul A. Lyons and
Rajiv D. Machado and
Robert V. MacKenzie Ross and
Bella Madan and
Jesmeen Maimaris and
Samantha Malka and
Sarah Mangles and
Kevin J. Marchbank and
Stephen Marks and
Hanns{-}Ulrich Marschall and
Andrew G. Marshall and
Jennifer Martin and
Mary Mathias and
Emma Matthews and
Heather Maxwell and
Paul McAlinden and
Mark I. McCarthy and
Harriet McKinney and
Aoife McMahon and
Stuart Meacham and
Adam J. Mead and
Ignacio Medina Castello and
Sarju G. Mehta and
Michel Michaelides and
Carolyn Millar and
Shehla N. Mohammed and
Shahin Moledina and
David Montani and
Anthony T. Moore and
Monika Mozere and
Keith W. Muir and
Andrea H. Nemeth and
William G. Newman and
Michael Newnham and
Sadia Noorani and
Paquita Nurden and
Jennifer O'Sullivan and
Samya Obaji and
Chris Odhams and
Steven Okoli and
Andrea Olschewski and
Horst Olschewski and
Kai Ren Ong and
S. Helen Oram and
Willem H. Ouwehand and
Claire Palles and
Sofia Papadia and
Soo{-}Mi Park and
David Parry and
Smita Patel and
Joan Paterson and
Andrew Peacock and
Simon H. Pearce and
John Peden and
Kathelijne Peerlinck and
Christopher J. Penkett and
Joanna Pepke{-}Zaba and
Romina Petersen and
Clarissa Pilkington and
Kenneth E. S. Poole and
Radhika Prathalingam and
Bethan Psaila and
Angela Pyle and
Richard Quinton and
Shamima Rahman and
Anupama Rao and
F. Lucy Raymond and
Paula J. Rayner{-}Matthews and
Christine Rees and
Tara Renton and
Christopher J. Rhodes and
Andrew S. C. Rice and
Alex Richter and
Leema Robert and
Anthony Rogers and
Sarah J. Rose and
Robert Ross{-}Russell and
Catherine Roughley and
Deborah M. Ruddy and
Omid Sadeghi{-}Alavijeh and
Nilesh J. Samani and
Crina Samarghitean and
Ravishankar B. Sargur and
Robert N. Sarkany and
Simon Satchell and
Sinisa Savic and
John A. Sayer and
Genevieve Sayer and
Laura Scelsi and
Andrew M. Schaefer and
Sol Schulman and
Richard Scott and
Marie Scully and
Claire Searle and
Werner Seeger and
Arjune Sen and
W. A. Carrock Sewell and
Denis Seyres and
Neil Shah and
Susan E. Shapiro and
Adam C. Shaw and
Patrick J. Short and
Keith Sibson and
Lucy Side and
Ilenia Simeoni and
Michael A. Simpson and
Matthew C. Sims and
Suthesh Sivapalaratnam and
Damian Smedley and
Katherine R. Smith and
Katie Snape and
Nicole Soranzo and
Florent Soubrier and
Laura Southgate and
Olivera Spasic{-}Boskovic and
Simon Staines and
Emily Staples and
Charles A. Steward and
Kathleen E. Stirrups and
Alex Stuckey and
Jay Suntharalingam and
Emilia M. Swietlik and
Petros Syrris and
R. Campbell Tait and
Kate Talks and
Katie Tate and
John M. Taylor and
Jenny C. Taylor and
James E. Thaventhiran and
Ellen Thomas and
David Thomas and
Moira J. Thomas and
Patrick Thomas and
Kate Thomson and
Glen Threadgold and
Tobias Tilly and
Marc Tischkowitz and
Catherine Titterton and
John A. Todd and
Cheng{-}Hock Toh and
Bas Tolhuis and
Ian P. Tomlinson and
Mark Toshner and
Matthew Traylor and
Carmen Treacy and
Paul Treadaway and
Richard Trembath and
Wojciech Turek and
Philip Twiss and
Tom Vale and
Chris Van Geet and
Natalie van Zuydam and
Maarten Vandekuilen and
Anthony M. Vandersteen and
Marta Vazquez{-}Lopez and
Julie von Ziegenweidt and
Anton Vonk{-}Noordegraaf and
Annette Wagner and
Quinten Waisfisz and
Suellen M. Walker and
Neil Walker and
Klaudia Walter and
James S. Ware and
Christopher Watt and
Lucy Wedderburn and
Wei Wei and
Steven B. Welch and
Julie Wessels and
Sarah K. Westbury and
John{-}Paul Westwood and
John Wharton and
Deborah Whitehorn and
Andrew O. M. Wilkie and
Brian T. Wilson and
Edwin K. S. Wong and
Nicholas W. Wood and
Yvette Wood and
Christopher Geoffrey Woods and
Emma R. Woodward and
Stephen J. Wort and
Austen Worth and
Michael Wright and
Katherine Yates and
Patrick F. K. Yong and
Timothy Young and
Ping Yu and
Patrick Yu{-}Wai{-}Man and
Eliska Zlamalova},
title = {Whole-genome sequencing of patients with rare diseases in a national
health system},
journal = {Nat.},
volume = {583},
number = {7814},
pages = {96--102},
year = {2020},
url = {https://doi.org/10.1038/s41586-020-2434-2},
doi = {10.1038/S41586-020-2434-2},
timestamp = {Fri, 22 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nature/TurroAMGGSASFTS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ral/CollinsMWBHL20,
author = {Jack Collins and
Jessie McVicar and
David Wedlock and
Ross Brown and
David Howard and
J{\"{u}}rgen Leitner},
title = {Benchmarking Simulated Robotic Manipulation Through a Real World Dataset},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {5},
number = {1},
pages = {250--257},
year = {2020},
url = {https://doi.org/10.1109/LRA.2019.2953663},
doi = {10.1109/LRA.2019.2953663},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ral/CollinsMWBHL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/MushkinGABHTTB20,
author = {Amit Mushkin and
Alan R. Gillespie and
Elsa A. Abbott and
Jigjidsurengiin Batbaatar and
Glynn C. Hulley and
Howard Tan and
David M. Tratt and
Kerry N. Buckland},
title = {Validation of {ASTER} Emissivity Retrieval Using the Mako Airborne
{TIR} Imaging Spectrometer at the Algodones Dune Field in Southern
California, {USA}},
journal = {Remote. Sens.},
volume = {12},
number = {5},
pages = {815},
year = {2020},
url = {https://doi.org/10.3390/rs12050815},
doi = {10.3390/RS12050815},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/MushkinGABHTTB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamco/KerimkulovSS20,
author = {Bekzhan Kerimkulov and
David Siska and
Lukasz Szpruch},
title = {Exponential Convergence and Stability of Howard's Policy Improvement
Algorithm for Controlled Diffusions},
journal = {{SIAM} J. Control. Optim.},
volume = {58},
number = {3},
pages = {1314--1340},
year = {2020},
url = {https://doi.org/10.1137/19M1236758},
doi = {10.1137/19M1236758},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamco/KerimkulovSS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/SaltHIS20,
author = {Llewyn Salt and
David Howard and
Giacomo Indiveri and
Yulia Sandamirskaya},
title = {Parameter Optimization and Learning in a Spiking Neural Network for
{UAV} Obstacle Avoidance Targeting Neuromorphic Processors},
journal = {{IEEE} Trans. Neural Networks Learn. Syst.},
volume = {31},
number = {9},
pages = {3305--3318},
year = {2020},
url = {https://doi.org/10.1109/TNNLS.2019.2941506},
doi = {10.1109/TNNLS.2019.2941506},
timestamp = {Sun, 11 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tnn/SaltHIS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/AmidBGGKLMMOPR020,
author = {Alon Amid and
David Biancolin and
Abraham Gonzalez and
Daniel Grubb and
Sagar Karandikar and
Harrison Liew and
Albert Magyar and
Howard Mao and
Albert J. Ou and
Nathan Pemberton and
Paul Rigge and
Colin Schmidt and
John Charles Wright and
Jerry Zhao and
Jonathan Bachrach and
Yakun Sophia Shao and
Borivoje Nikolic and
Krste Asanovic},
title = {Invited: Chipyard - An Integrated SoC Research and Implementation
Environment},
booktitle = {57th {ACM/IEEE} Design Automation Conference, {DAC} 2020, San Francisco,
CA, USA, July 20-24, 2020},
pages = {1--6},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/DAC18072.2020.9218756},
doi = {10.1109/DAC18072.2020.9218756},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dac/AmidBGGKLMMOPR020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/ChandH20,
author = {Shelvin Chand and
David Howard},
editor = {Carlos Artemio Coello Coello},
title = {Path towards multilevel evolution of robots},
booktitle = {{GECCO} '20: Genetic and Evolutionary Computation Conference, Companion
Volume, Canc{\'{u}}n, Mexico, July 8-12, 2020},
pages = {1381--1382},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3377929.3398075},
doi = {10.1145/3377929.3398075},
timestamp = {Mon, 20 Jul 2020 07:42:25 +0200},
biburl = {https://dblp.org/rec/conf/gecco/ChandH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/DelaneyH20,
author = {Gary W. Delaney and
Gerard David Howard},
editor = {Carlos Artemio Coello Coello},
title = {Multi-objective exploration of a granular matter design space},
booktitle = {{GECCO} '20: Genetic and Evolutionary Computation Conference, Companion
Volume, Canc{\'{u}}n, Mexico, July 8-12, 2020},
pages = {263--264},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3377929.3389951},
doi = {10.1145/3377929.3389951},
timestamp = {Wed, 18 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gecco/DelaneyH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/HowardLG20,
author = {Gerard David Howard and
Thomas Lowe and
Wade Geles},
editor = {Carlos Artemio Coello Coello},
title = {Diversity-based design assist for large legged robots},
booktitle = {{GECCO} '20: Genetic and Evolutionary Computation Conference, Companion
Volume, Canc{\'{u}}n, Mexico, July 8-12, 2020},
pages = {81--82},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3377929.3389950},
doi = {10.1145/3377929.3389950},
timestamp = {Wed, 18 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gecco/HowardLG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/NygaardHG20,
author = {T{\o}nnes F. Nygaard and
David Howard and
Kyrre Glette},
editor = {Carlos Artemio Coello Coello},
title = {Real world morphological evolution is feasible},
booktitle = {{GECCO} '20: Genetic and Evolutionary Computation Conference, Companion
Volume, Canc{\'{u}}n, Mexico, July 8-12, 2020},
pages = {1392--1394},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3377929.3398095},
doi = {10.1145/3377929.3398095},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gecco/NygaardHG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/QiuGHA20,
author = {Huanneng Qiu and
Matthew Garratt and
David Howard and
Sreenatha G. Anavatti},
editor = {Carlos Artemio Coello Coello},
title = {Towards crossing the reality gap with evolved plastic neurocontrollers},
booktitle = {{GECCO} '20: Genetic and Evolutionary Computation Conference, Canc{\'{u}}n
Mexico, July 8-12, 2020},
pages = {130--138},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3377930.3389843},
doi = {10.1145/3377930.3389843},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gecco/QiuGHA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icics/TangeHSPFD20,
author = {Koen Tange and
David Howard and
Travis Shanahan and
Stefano Pepe and
Xenofon Fafoutis and
Nicola Dragoni},
editor = {Weizhi Meng and
Dieter Gollmann and
Christian Damsgaard Jensen and
Jianying Zhou},
title = {rTLS: Lightweight {TLS} Session Resumption for Constrained IoT Devices},
booktitle = {Information and Communications Security - 22nd International Conference,
{ICICS} 2020, Copenhagen, Denmark, August 24-26, 2020, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12282},
pages = {243--258},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-61078-4\_14},
doi = {10.1007/978-3-030-61078-4\_14},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icics/TangeHSPFD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ChenISMTJST20,
author = {Yong Chen and
Flavio Iturbide{-}Sanchez and
Larrabee L. Strow and
Howard E. Motteler and
Dave Tobin and
David Johnson and
Lawrence Suwinski and
Denis Tremblay},
title = {Derivation of {JPSS-2} {CRIS} Pre-Launch Spectral Calibration Parameters
from the Thermal Vacuum Test Data},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2020, Waikoloa, HI, USA, September 26 - October 2, 2020},
pages = {6043--6046},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IGARSS39084.2020.9323240},
doi = {10.1109/IGARSS39084.2020.9323240},
timestamp = {Thu, 09 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/ChenISMTJST20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/plans/DouglassMJCB20,
author = {Samuel Paul Douglass and
Scott M. Martin and
Andrew Jennings and
Howard Chen and
David M. Bevly},
title = {Deep Learned Multi-Modal Traffic Agent Predictions for Truck Platooning
Cut-Ins},
booktitle = {{IEEE/ION} Position, Location and Navigation Symposium, {PLANS} 2020,
Portland, OR, USA, April 20-23, 2020},
pages = {688--697},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/PLANS46316.2020.9109809},
doi = {10.1109/PLANS46316.2020.9109809},
timestamp = {Fri, 24 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/plans/DouglassMJCB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ssci/QiuGHA20,
author = {Huanneng Qiu and
Matthew Garratt and
David Howard and
Sreenatha G. Anavatti},
title = {Evolving Spiking Neurocontrollers for UAVs},
booktitle = {2020 {IEEE} Symposium Series on Computational Intelligence, {SSCI}
2020, Canberra, Australia, December 1-4, 2020},
pages = {1928--1935},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/SSCI47803.2020.9308275},
doi = {10.1109/SSCI47803.2020.9308275},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ssci/QiuGHA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tei/ChenHZDSCWAO20,
author = {Christopher Chen and
David Howard and
Steven L. Zhang and
Youngwook Do and
Sienna Xin Sun and
Tingyu Cheng and
Zhong Lin Wang and
Gregory D. Abowd and
HyunJoo Oh},
editor = {Elise van den Hoven and
Lian Loke and
Orit Shaer and
Jelle van Dijk and
Andrew L. Kun},
title = {{SPIN} (Self-powered Paper Interfaces): Bridging Triboelectric Nanogenerator
with Folding Paper Creases},
booktitle = {{TEI} '20: Fourteenth International Conference on Tangible, Embedded,
and Embodied Interaction, Sydney, NSW, Australia, February 9-12, 2020},
pages = {431--442},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3374920.3374946},
doi = {10.1145/3374920.3374946},
timestamp = {Mon, 27 Feb 2023 08:37:12 +0100},
biburl = {https://dblp.org/rec/conf/tei/ChenHZDSCWAO20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2002-09854,
author = {Huanneng Qiu and
Matthew Garratt and
David Howard and
Sreenatha G. Anavatti},
title = {Crossing the Reality Gap with Evolved Plastic Neurocontrollers},
journal = {CoRR},
volume = {abs/2002.09854},
year = {2020},
url = {https://arxiv.org/abs/2002.09854},
eprinttype = {arXiv},
eprint = {2002.09854},
timestamp = {Tue, 03 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2002-09854.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2003-01369,
author = {Jack Collins and
Ross Brown and
J{\"{u}}rgen Leitner and
David Howard},
title = {Traversing the Reality Gap via Simulator Tuning},
journal = {CoRR},
volume = {abs/2003.01369},
year = {2020},
url = {https://arxiv.org/abs/2003.01369},
eprinttype = {arXiv},
eprint = {2003.01369},
timestamp = {Mon, 18 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2003-01369.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2003-13254,
author = {T{\o}nnes F. Nygaard and
Charles P. Martin and
David Howard and
Jim T{\o}rresen and
Kyrre Glette},
title = {Environmental Adaptation of Robot Morphology and Control through Real-world
Evolution},
journal = {CoRR},
volume = {abs/2003.13254},
year = {2020},
url = {https://arxiv.org/abs/2003.13254},
eprinttype = {arXiv},
eprint = {2003.13254},
timestamp = {Wed, 01 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2003-13254.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-08057,
author = {David Howard and
Thomas Lowe and
Wade Geles},
title = {Diversity-based Design Assist for Large Legged Robots},
journal = {CoRR},
volume = {abs/2004.08057},
year = {2020},
url = {https://arxiv.org/abs/2004.08057},
eprinttype = {arXiv},
eprint = {2004.08057},
timestamp = {Tue, 21 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2004-08057.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-09288,
author = {T{\o}nnes F. Nygaard and
David Howard and
Kyrre Glette},
title = {Real World Morphological Evolution is Feasible},
journal = {CoRR},
volume = {abs/2005.09288},
year = {2020},
url = {https://arxiv.org/abs/2005.09288},
eprinttype = {arXiv},
eprint = {2005.09288},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-09288.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-03266,
author = {Shelvin Chand and
David Howard},
title = {Path Towards Multilevel Evolution of Robots},
journal = {CoRR},
volume = {abs/2006.03266},
year = {2020},
url = {https://arxiv.org/abs/2006.03266},
eprinttype = {arXiv},
eprint = {2006.03266},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2006-03266.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-05994,
author = {Lars A. Bratholm and
Will Gerrard and
Brandon M. Anderson and
Shaojie Bai and
Sunghwan Choi and
Lam Dang and
Pavel Hanchar and
Addison Howard and
Guillaume Huard and
Sanghoon Kim and
J. Zico Kolter and
Risi Kondor and
Mordechai Kornbluth and
Youhan Lee and
Youngsoo Lee and
Jonathan P. Mailoa and
Thanh Tu Nguyen and
Milos Popovic and
Goran Rakocevic and
Walter Reade and
Wonho Song and
Luka Stojanovic and
Erik H. Thiede and
Nebojsa Tijanic and
Andres Torrubia and
Devin Willmott and
Craig P. Butts and
David R. Glowacki and
Kaggle participants},
title = {A community-powered search of machine learning strategy space to find
{NMR} property prediction models},
journal = {CoRR},
volume = {abs/2008.05994},
year = {2020},
url = {https://arxiv.org/abs/2008.05994},
eprinttype = {arXiv},
eprint = {2008.05994},
timestamp = {Tue, 18 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2008-05994.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-07653,
author = {David B. Huberman and
Brian J. Reich and
Howard D. Bondell},
title = {Nonparametric Conditional Density Estimation In {A} Deep Learning
Framework For Short-Term Forecasting},
journal = {CoRR},
volume = {abs/2008.07653},
year = {2020},
url = {https://arxiv.org/abs/2008.07653},
eprinttype = {arXiv},
eprint = {2008.07653},
timestamp = {Fri, 21 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2008-07653.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-11966,
author = {David Lowell and
Brian E. Howard and
Zachary C. Lipton and
Byron C. Wallace},
title = {Unsupervised Data Augmentation with Naive Augmentation and without
Unlabeled Data},
journal = {CoRR},
volume = {abs/2010.11966},
year = {2020},
url = {https://arxiv.org/abs/2010.11966},
eprinttype = {arXiv},
eprint = {2010.11966},
timestamp = {Tue, 27 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-11966.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-11913,
author = {Ahmadreza Ahmadi and
T{\o}nnes F. Nygaard and
Navinda Kottege and
David Howard and
Nicolas Hudson},
title = {Semi-supervised Gated Recurrent Neural Networks for Robotic Terrain
Classification},
journal = {CoRR},
volume = {abs/2011.11913},
year = {2020},
url = {https://arxiv.org/abs/2011.11913},
eprinttype = {arXiv},
eprint = {2011.11913},
timestamp = {Thu, 26 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-11913.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejc/AharoniBCHS19,
author = {Ron Aharoni and
Eli Berger and
Maria Chudnovsky and
David M. Howard and
Paul D. Seymour},
title = {Large rainbow matchings in general graphs},
journal = {Eur. J. Comb.},
volume = {79},
pages = {222--227},
year = {2019},
url = {https://doi.org/10.1016/j.ejc.2019.01.012},
doi = {10.1016/J.EJC.2019.01.012},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ejc/AharoniBCHS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejc/DuffusHL19,
author = {Dwight Duffus and
David M. Howard and
Imre Leader},
title = {The width of downsets},
journal = {Eur. J. Comb.},
volume = {79},
pages = {46--59},
year = {2019},
url = {https://doi.org/10.1016/j.ejc.2018.11.005},
doi = {10.1016/J.EJC.2018.11.005},
timestamp = {Wed, 12 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ejc/DuffusHL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esticas/AlyamkinABBCCCF19,
author = {Sergei Alyamkin and
Matthew Ardi and
Alexander C. Berg and
Achille Brighton and
Bo Chen and
Yiran Chen and
Hsin{-}Pai Cheng and
Zichen Fan and
Chen Feng and
Bo Fu and
Kent Gauen and
Abhinav Goel and
Alexander Goncharenko and
Xuyang Guo and
Soonhoi Ha and
Andrew Howard and
Xiao Hu and
Yuanjun Huang and
Donghyun Kang and
Jaeyoun Kim and
Jong{-}gook Ko and
Alexander Kondratyev and
Junhyeok Lee and
Seungjae Lee and
Suwoong Lee and
Zichao Li and
Zhiyu Liang and
Juzheng Liu and
Xin Liu and
Yang Lu and
Yung{-}Hsiang Lu and
Deeptanshu Malik and
Hong Hanh Nguyen and
Eunbyung Park and
Denis Repin and
Liang Shen and
Tao Sheng and
Fei Sun and
David Svitov and
George K. Thiruvathukal and
Baiwu Zhang and
Jingchi Zhang and
Xiaopeng Zhang and
Shaojie Zhuo},
title = {Low-Power Computer Vision: Status, Challenges, and Opportunities},
journal = {{IEEE} J. Emerg. Sel. Topics Circuits Syst.},
volume = {9},
number = {2},
pages = {411--421},
year = {2019},
url = {https://doi.org/10.1109/JETCAS.2019.2911899},
doi = {10.1109/JETCAS.2019.2911899},
timestamp = {Wed, 04 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/esticas/AlyamkinABBCCCF19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/evi/HowardE19,
author = {Gerard David Howard and
Alberto Elfes},
title = {A staged approach to evolving real-world {UAV} controllers},
journal = {Evol. Intell.},
volume = {12},
number = {3},
pages = {491--502},
year = {2019},
url = {https://doi.org/10.1007/s12065-019-00242-5},
doi = {10.1007/S12065-019-00242-5},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/evi/HowardE19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jct/HowardSTWW19,
author = {David M. Howard and
Noah Streib and
William T. Trotter and
Bartosz Walczak and
Ruidong Wang},
title = {Dimension of posets with planar cover graphs excluding two long incomparable
chains},
journal = {J. Comb. Theory {A}},
volume = {164},
pages = {1--23},
year = {2019},
url = {https://doi.org/10.1016/j.jcta.2018.11.016},
doi = {10.1016/J.JCTA.2018.11.016},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jct/HowardSTWW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jitm/ChallenerVHPJ19,
author = {David C. Challener and
Maria E. Vachino and
James P. Howard II and
Christina K. Pikas and
Anil John},
title = {Blockchain Basics and Suitability: {A} Primer for Program Managers},
journal = {J. Inf. Technol. Manag.},
volume = {30},
number = {3},
pages = {33--44},
year = {2019},
url = {https://jitm.ubalt.edu/XXX-3/article3.pdf},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jitm/ChallenerVHPJ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/RegierFPNRLHGSM19,
author = {Jeffrey Regier and
Keno Fischer and
Kiran Pamnany and
Andreas Noack and
Jarrett Revels and
Maximilian Lam and
Steve Howard and
Ryan Giordano and
David Schlegel and
Jon McAuliffe and
Rollin C. Thomas and
Prabhat},
title = {Cataloging the visible universe through Bayesian inference in Julia
at petascale},
journal = {J. Parallel Distributed Comput.},
volume = {127},
pages = {89--104},
year = {2019},
url = {https://doi.org/10.1016/j.jpdc.2018.12.008},
doi = {10.1016/J.JPDC.2018.12.008},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jpdc/RegierFPNRLHGSM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/KarandikarMKBAL19,
author = {Sagar Karandikar and
Howard Mao and
Donggyu Kim and
David Biancolin and
Alon Amid and
Dayeol Lee and
Nathan Pemberton and
Emmanuel Amaro and
Colin Schmidt and
Aditya Chopra and
Qijing Huang and
Kyle Kovacs and
Borivoje Nikolic and
Randy Howard Katz and
Jonathan Bachrach and
Krste Asanovic},
title = {FireSim: FPGA-Accelerated Cycle-Exact Scale-Out System Simulation
in the Public Cloud},
journal = {{IEEE} Micro},
volume = {39},
number = {3},
pages = {56--65},
year = {2019},
url = {https://doi.org/10.1109/MM.2019.2910175},
doi = {10.1109/MM.2019.2910175},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/KarandikarMKBAL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/natmi/HowardEKMVW19,
author = {David Howard and
{\'{A}}goston E. Eiben and
Danielle Frances Kennedy and
Jean{-}Baptiste Mouret and
Philip Valencia and
David A. Winkler},
title = {Evolving embodied intelligence from materials to machines},
journal = {Nat. Mach. Intell.},
volume = {1},
number = {1},
pages = {12--19},
year = {2019},
url = {https://doi.org/10.1038/s42256-018-0009-9},
doi = {10.1038/S42256-018-0009-9},
timestamp = {Fri, 22 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/natmi/HowardEKMVW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/HarrisMHWCBBCCC19,
author = {Julie A. Harris and
Stefan Mihalas and
Karla E. Hirokawa and
Jennifer D. Whitesell and
Hannah Choi and
Amy Bernard and
Phillip Bohn and
Shiella Caldejon and
Linzy Casal and
Andrew Cho and
Aaron Feiner and
David Feng and
Nathalie Gaudreault and
Charles R. Gerfen and
Nile Graddis and
Peter A. Groblewski and
Alex M. Henry and
Anh Ho and
Robert Howard and
Joseph E. Knox and
Leonard Kuan and
Xiuli Kuang and
J{\'{e}}r{\^{o}}me A. Lecoq and
Phil Lesnar and
Yaoyao Li and
Jennifer Luviano and
Stephen McConoughey and
Marty T. Mortrud and
Maitham Naeemi and
Lydia Ng and
Seung{-}Wook Oh and
Benjamin Ouellette and
Elise Shen and
Staci A. Sorensen and
Wayne Wakeman and
Quanxin Wang and
Yun Wang and
Ali Williford and
John W. Phillips and
Allan R. Jones and
Christof Koch and
Hongkui Zeng},
title = {Hierarchical organization of cortical and thalamic connectivity},
journal = {Nat.},
volume = {575},
number = {7781},
pages = {195--202},
year = {2019},
url = {https://doi.org/10.1038/s41586-019-1716-z},
doi = {10.1038/S41586-019-1716-Z},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/HarrisMHWCBBCCC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/HoogenGRFTWGAAA19,
author = {Johan van den Hoogen and
Stefan Geisen and
Devin Routh and
Howard Ferris and
Walter Traunspurger and
David A. Wardle and
Ron G. M. de Goede and
Byron J. Adams and
Wasim Ahmad and
Walter S. Andriuzzi and
Richard D. Bardgett and
Michael Bonkowski and
Raquel Campos{-}Herrera and
Juvenil E. Cares and
Tancredi Caruso and
Larissa de Brito Caixeta and
Xiaoyun Chen and
Sofia R. Costa and
Rachel Creamer and
Jos{\'{e}} Mauro da Cunha Castro and
Marie Dam and
Djibril Djigal and
Miguel Escuer and
Bryan S. Griffiths and
Carmen Guti{\'{e}}rrez and
Karin Hohberg and
Daria Kalinkina and
Paul Kardol and
Alan Kergunteuil and
Gerard Korthals and
Valentyna Krashevska and
Alexey A. Kudrin and
Qi Li and
Wenju Liang and
Matthew Magilton and
Mariette Marais and
Jos{\'{e}} Antonio Rodr{\'{\i}}guez Mart{\'{\i}}n and
Elizaveta Matveeva and
El Hassan Mayad and
Christian Mulder and
Peter Mullin and
Roy Neilson and
T. A. Duong Nguyen and
Uffe N. Nielsen and
Hiroaki Okada and
Juan Emilio Palomares Rius and
Kaiwen Pan and
Vlada Peneva and
Lo{\"{\i}}c Pellissier and
Julio Carlos Pereira da Silva and
Camille Pitteloud and
Thomas O. Powers and
Kirsten Powers and
Casper W. Quist and
Sergio Rasmann and
Sara S{\'{a}}nchez Moreno and
Stefan Scheu and
Heikki Set{\"{a}}l{\"{a}} and
Anna Sushchuk and
Alexei V. Tiunov and
Jean Trap and
Wim H. van der Putten and
Mette Vesterg{\aa}rd and
Cecile Villenave and
Lieven Waeyenberge and
Diana H. Wall and
Rutger Wilschut and
Daniel G. Wright and
Jiue{-}in Yang and
Thomas Ward Crowther},
title = {Soil nematode abundance and functional group composition at a global
scale},
journal = {Nat.},
volume = {572},
number = {7768},
pages = {194--198},
year = {2019},
url = {https://doi.org/10.1038/s41586-019-1418-6},
doi = {10.1038/S41586-019-1418-6},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/HoogenGRFTWGAAA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/ChitnisGGHSSDPT19,
author = {Tanuja Chitnis and
Bonnie I. Glanz and
Cindy Gonzalez and
Brian C. Healy and
Taylor J. Saraceno and
Neda Sattarnezhad and
Camilo Diaz{-}Cruz and
Mariann Polgar{-}Turcsanyi and
Subhash Tummala and
Rohit Bakshi and
Vikram Bajaj and
David Ben Shimol and
Nikhil Bikhchandani and
Alexander W. Blocker and
Joshua Burkart and
Raphael Cendrillon and
Michael P. Cusack and
Emre Demiralp and
Sarel Kobus Jooste and
Alaa Kharbouch and
Amy A. Lee and
Joseph Lehar and
Manway Liu and
Swaminathan Mahadevan and
Mark Murphy and
Linda C. Norton and
Tushar Anil Parlikar and
Anupam Pathak and
Ali Shoeb and
Erin Soderberg and
Philip Stephens and
Aaron H. Stoertz and
Florence Thng and
Kashyap R. Tumkur and
Hongsheng Wang and
Jane Rhodes and
Richard A. Rudick and
Richard M. Ransohoff and
Glenn A. Phillips and
Effie Bruzik and
William J. Marks and
Howard L. Weiner and
Thomas M. Snyder},
title = {Quantifying neurologic disease using biosensor measurements in-clinic
and in free-living settings in multiple sclerosis},
journal = {npj Digit. Medicine},
volume = {2},
year = {2019},
url = {https://doi.org/10.1038/s41746-019-0197-7},
doi = {10.1038/S41746-019-0197-7},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/ChitnisGGHSSDPT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/CollinsCH19,
author = {Jack Collins and
Ben Cottier and
David Howard},
title = {Comparing Direct and Indirect Representations for Environment-Specific
Robot Component Design},
booktitle = {{IEEE} Congress on Evolutionary Computation, {CEC} 2019, Wellington,
New Zealand, June 10-13, 2019},
pages = {2705--2712},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CEC.2019.8790166},
doi = {10.1109/CEC.2019.8790166},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cec/CollinsCH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/JuhlinMSSSOYMAA19,
author = {David Juhlin and
Chris Morris and
Peter Schmaltz and
Howard Shane and
Ralf Schlosser and
Amanda O'Brien and
Christina Yu and
Drew Mancini and
Anna Allen and
Jennifer Abramson},
editor = {Margherita Antona and
Constantine Stephanidis},
title = {The {PTC} and Boston Children's Hospital Collaborative {AR} Experience
for Children with Autism Spectrum Disorder},
booktitle = {Universal Access in Human-Computer Interaction. Multimodality and
Assistive Environments - 13th International Conference, {UAHCI} 2019,
Held as Part of the 21st {HCI} International Conference, {HCII} 2019,
Orlando, FL, USA, July 26-31, 2019, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {11573},
pages = {116--122},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-23563-5\_10},
doi = {10.1007/978-3-030-23563-5\_10},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hci/JuhlinMSSSOYMAA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/WuBNHKLLMSAPJ19,
author = {Lisa Wu and
David Bruns{-}Smith and
Frank A. Nothaft and
Qijing Huang and
Sagar Karandikar and
Johnny Le and
Andrew Lin and
Howard Mao and
Brendan Sweeney and
Krste Asanovic and
David A. Patterson and
Anthony D. Joseph},
title = {{FPGA} Accelerated {INDEL} Realignment in the Cloud},
booktitle = {25th {IEEE} International Symposium on High Performance Computer Architecture,
{HPCA} 2019, Washington, DC, USA, February 16-20, 2019},
pages = {277--290},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/HPCA.2019.00044},
doi = {10.1109/HPCA.2019.00044},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hpca/WuBNHKLLMSAPJ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmla/DelaneyHN19,
author = {Gary W. Delaney and
David Howard and
Krystal De Napoli},
editor = {M. Arif Wani and
Taghi M. Khoshgoftaar and
Dingding Wang and
Huanjing Wang and
Naeem Seliya},
title = {Utilising Evolutionary Algorithms to Design Granular Materials for
Industrial Applications},
booktitle = {18th {IEEE} International Conference On Machine Learning And Applications,
{ICMLA} 2019, Boca Raton, FL, USA, December 16-19, 2019},
pages = {1897--1902},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICMLA.2019.00305},
doi = {10.1109/ICMLA.2019.00305},
timestamp = {Mon, 24 Feb 2020 16:18:11 +0100},
biburl = {https://dblp.org/rec/conf/icmla/DelaneyHN19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/CollinsHL19,
author = {Jack Collins and
David Howard and
J{\"{u}}rgen Leitner},
title = {Quantifying the Reality Gap in Robotic Manipulation Tasks},
booktitle = {International Conference on Robotics and Automation, {ICRA} 2019,
Montreal, QC, Canada, May 20-24, 2019},
pages = {6706--6712},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICRA.2019.8793591},
doi = {10.1109/ICRA.2019.8793591},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icra/CollinsHL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/KayyilRYAY19,
author = {Ajmal Vadakkan Kayyil and
Pavan Kumar Ramakrishna and
OnnLim Yong and
David J. Allstot and
Howard C. Yang},
title = {A Two-Stage {CMOS} {OTA} with Load-Pole Cancellation},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2019,
Sapporo, Japan, May 26-29, 2019},
pages = {1--5},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISCAS.2019.8702347},
doi = {10.1109/ISCAS.2019.8702347},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/KayyilRYAY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/KarlinPSWSBBCCC19,
author = {Ian Karlin and
Yoonho Park and
Bronis R. de Supinski and
Peng Wang and
Bert Still and
David Beckingsale and
Robert Blake and
Tong Chen and
Guojing Cong and
Carlos H. A. Costa and
Johann Dahm and
Giacomo Domeniconi and
Thomas Epperly and
Aaron Fisher and
Sara Kokkila Schumacher and
Steven H. Langer and
Hai Le and
Eun Kyung Lee and
Naoya Maruyama and
Xinyu Que and
David F. Richards and
Bj{\"{o}}rn Sj{\"{o}}green and
Jonathan Wong and
Carol S. Woodward and
Ulrike Meier Yang and
Xiaohua Zhang and
Bob Anderson and
David Appelhans and
Levi Barnes and
Peter D. Barnes Jr. and
Sorin Bastea and
David B{\"{o}}hme and
Jamie A. Bramwell and
James M. Brase and
Jos{\'{e}} R. Brunheroto and
Barry Chen and
Charway R. Cooper and
Tony Degroot and
Robert D. Falgout and
Todd Gamblin and
David J. Gardner and
James N. Glosli and
John A. Gunnels and
Max P. Katz and
Tzanio V. Kolev and
I{-}Feng W. Kuo and
Matthew P. LeGendre and
Ruipeng Li and
Pei{-}Hung Lin and
Shelby Lockhart and
Kathleen McCandless and
Claudia Misale and
Jaime H. Moreno and
Rob Neely and
Jarom Nelson and
Rao Nimmakayala and
Kathryn M. O'Brien and
Kevin O'Brien and
Ramesh Pankajakshan and
Roger Pearce and
Slaven Peles and
Phil Regier and
Steven C. Rennich and
Martin Schulz and
Howard Scott and
James C. Sexton and
Kathleen Shoga and
Shiv Sundram and
Guillaume Thomas{-}Collignon and
Brian Van Essen and
Alexey Voronin and
Bob Walkup and
Lu Wang and
Chris Ward and
Hui{-}Fang Wen and
Daniel A. White and
Christopher Young and
Cyril Zeller and
Edward Zywicz},
editor = {Michela Taufer and
Pavan Balaji and
Antonio J. Pe{\~{n}}a},
title = {Preparation and optimization of a diverse workload for a large-scale
heterogeneous system},
booktitle = {Proceedings of the International Conference for High Performance Computing,
Networking, Storage and Analysis, {SC} 2019, Denver, Colorado, USA,
November 17-19, 2019},
pages = {32:1--32:17},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3295500.3356192},
doi = {10.1145/3295500.3356192},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sc/KarlinPSWSBBCCC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/19/HowardBCGA19,
author = {Gerard David Howard and
Larry Bull and
Ben de Lacy Costello and
Ella Gale and
Andrew Adamatzky},
editor = {Leon O. Chua and
Georgios Ch. Sirakoulis and
Andrew Adamatzky},
title = {Evolving Memristive Neural Networks},
booktitle = {Handbook of Memristor Networks},
pages = {661--690},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-319-76375-0\_24},
doi = {10.1007/978-3-319-76375-0\_24},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/sp/19/HowardBCGA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1901-05704,
author = {David Howard and
{\'{A}}goston E. Eiben and
Danielle Frances Kennedy and
Jean{-}Baptiste Mouret and
Philip Valencia and
David A. Winkler},
title = {Evolving embodied intelligence from materials to machines},
journal = {CoRR},
volume = {abs/1901.05704},
year = {2019},
url = {http://arxiv.org/abs/1901.05704},
eprinttype = {arXiv},
eprint = {1901.05704},
timestamp = {Fri, 22 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1901-05704.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1901-06775,
author = {Jack Collins and
Ben Cottier and
David Howard},
title = {Comparing Direct and Indirect Representations for Environment-Specific
Robot Component Design},
journal = {CoRR},
volume = {abs/1901.06775},
year = {2019},
url = {http://arxiv.org/abs/1901.06775},
eprinttype = {arXiv},
eprint = {1901.06775},
timestamp = {Fri, 01 Feb 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1901-06775.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1903-01180,
author = {Huanneng Qiu and
Matthew Garratt and
David Howard and
Sreenatha G. Anavatti},
title = {Evolving Spiking Neural Networks for Nonlinear Control Problems},
journal = {CoRR},
volume = {abs/1903.01180},
year = {2019},
url = {http://arxiv.org/abs/1903.01180},
eprinttype = {arXiv},
eprint = {1903.01180},
timestamp = {Mon, 01 Apr 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1903-01180.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1904-07714,
author = {Sergei Alyamkin and
Matthew Ardi and
Alexander C. Berg and
Achille Brighton and
Bo Chen and
Yiran Chen and
Hsin{-}Pai Cheng and
Zichen Fan and
Chen Feng and
Bo Fu and
Kent Gauen and
Abhinav Goel and
Alexander Goncharenko and
Xuyang Guo and
Soonhoi Ha and
Andrew Howard and
Xiao Hu and
Yuanjun Huang and
Donghyun Kang and
Jaeyoun Kim and
Jong{-}gook Ko and
Alexander Kondratyev and
Junhyeok Lee and
Seungjae Lee and
Suwoong Lee and
Zichao Li and
Zhiyu Liang and
Juzheng Liu and
Xin Liu and
Yang Lu and
Yung{-}Hsiang Lu and
Deeptanshu Malik and
Hong Hanh Nguyen and
Eunbyung Park and
Denis Repin and
Liang Shen and
Tao Sheng and
Fei Sun and
David Svitov and
George K. Thiruvathukal and
Baiwu Zhang and
Jingchi Zhang and
Xiaopeng Zhang and
Shaojie Zhuo},
title = {Low-Power Computer Vision: Status, Challenges, Opportunities},
journal = {CoRR},
volume = {abs/1904.07714},
year = {2019},
url = {http://arxiv.org/abs/1904.07714},
eprinttype = {arXiv},
eprint = {1904.07714},
timestamp = {Tue, 23 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1904-07714.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1905-10762,
author = {Gerard David Howard and
Alberto Elfes},
title = {A Staged Approach to Evolving Real-world {UAV} Controllers},
journal = {CoRR},
volume = {abs/1905.10762},
year = {2019},
url = {http://arxiv.org/abs/1905.10762},
eprinttype = {arXiv},
eprint = {1905.10762},
timestamp = {Mon, 03 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1905-10762.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1910-07960,
author = {Llewyn Salt and
David Howard and
Giacomo Indiveri and
Yulia Sandamirskaya},
title = {Parameter Optimization and Learning in a Spiking Neural Network for
{UAV} Obstacle Avoidance targeting Neuromorphic Processors},
journal = {CoRR},
volume = {abs/1910.07960},
year = {2019},
url = {http://arxiv.org/abs/1910.07960},
eprinttype = {arXiv},
eprint = {1910.07960},
timestamp = {Tue, 22 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1910-07960.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1911-01557,
author = {Jack Collins and
Jessie McVicar and
David Wedlock and
Ross Brown and
David Howard and
J{\"{u}}rgen Leitner},
title = {Benchmarking Simulated Robotic Manipulation through a Real World Dataset},
journal = {CoRR},
volume = {abs/1911.01557},
year = {2019},
url = {http://arxiv.org/abs/1911.01557},
eprinttype = {arXiv},
eprint = {1911.01557},
timestamp = {Mon, 18 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1911-01557.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/0001BBCFGGGJKKK18,
author = {Bruno Bouchard and
Kevin Bouchard and
Noam Brown and
Niyati Chhaya and
Eitan Farchi and
S{\'{e}}bastien Gaboury and
Christopher W. Geib and
Amelie Gyrard and
Kokil Jaidka and
Sarah Keren and
Roni Khardon and
Parisa Kordjamshidi and
David R. Martinez and
Nicholas Mattei and
Martin Michalowski and
Reuth Mirsky and
Joseph C. Osborn and
Cem Sahin and
Onn Shehory and
Arash Shaban{-}Nejad and
Amit P. Sheth and
Ilan Shimshoni and
Howard E. Shrobe and
Arunesh Sinha and
Atanu R. Sinha and
Biplav Srivastava and
William W. Streilein and
Georgios Theocharous and
Kristen Brent Venable and
Neal Wagner and
Anna Zamansky},
title = {Reports of the Workshops of the 32nd {AAAI} Conference on Artificial
Intelligence},
journal = {{AI} Mag.},
volume = {39},
number = {4},
pages = {45--56},
year = {2018},
url = {https://doi.org/10.1609/aimag.v39i4.2823},
doi = {10.1609/AIMAG.V39I4.2823},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/0001BBCFGGGJKKK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eis/CorkindaleRC18,
author = {David Corkindale and
Jiwat Ram and
Howard Chen},
title = {The adoption of Firm-Hosted Online Communities: an empirical investigation
into the role of service quality and social interactions},
journal = {Enterp. Inf. Syst.},
volume = {12},
number = {2},
pages = {173--195},
year = {2018},
url = {https://doi.org/10.1080/17517575.2017.1287431},
doi = {10.1080/17517575.2017.1287431},
timestamp = {Fri, 24 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eis/CorkindaleRC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fini/MohaddesDASBCHT18,
author = {Zia Mohaddes and
Samir Das and
Rida Abou{-}Haidar and
Mouna Safi{-}Harb and
David Blader and
Jessica Callegaro and
Charlie Henri{-}Bellemare and
Jingla{-}Fri Tunteng and
Leigh Evans and
Tara Campbell and
Derek Lo and
Pierre{-}Emmanuel Morin and
Victor Whitehead and
Howard Chertkow and
Alan C. Evans},
title = {National Neuroinformatics Framework for Canadian Consortium on Neurodegeneration
in Aging {(CCNA)}},
journal = {Frontiers Neuroinformatics},
volume = {12},
pages = {85},
year = {2018},
url = {https://doi.org/10.3389/fninf.2018.00085},
doi = {10.3389/FNINF.2018.00085},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fini/MohaddesDASBCHT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamsc/ElmanS18,
author = {Howard C. Elman and
David J. Silvester},
title = {Collocation Methods for Exploring Perturbations in Linear Stability
Analysis},
journal = {{SIAM} J. Sci. Comput.},
volume = {40},
number = {4},
pages = {A2667--A2693},
year = {2018},
url = {https://doi.org/10.1137/17M1117689},
doi = {10.1137/17M1117689},
timestamp = {Thu, 30 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamsc/ElmanS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tosn/AndersenKCFCK18,
author = {Michael P. Andersen and
John Kolb and
Kaifei Chen and
Gabe Fierro and
David E. Culler and
Randy H. Katz},
title = {Democratizing Authority in the Built Environment},
journal = {{ACM} Trans. Sens. Networks},
volume = {14},
number = {3-4},
pages = {17:1--17:26},
year = {2018},
url = {https://doi.org/10.1145/3199665},
doi = {10.1145/3199665},
timestamp = {Sat, 08 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tosn/AndersenKCFCK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/BellBLBWMLHKLSH18,
author = {Douglas S. Bell and
Kevin M. Baldwin and
Christoph U. Lehmann and
Elijah J. Bell and
Emily C. Webber and
Vishnu Mohan and
Michael G. Leu and
Jeffrey Hoffman and
David C. Kaelber and
Adam B. Landman and
Howard D. Silverman and
Jonathan D. Hron and
Bruce P. Levy and
Anthony A. Luberti and
John T. Finnell and
Charles Safran and
Jonathan P. Palma and
Peter L. Elkin and
Bruce Forman and
Eric G. Poon and
James P. Killeen and
David E. Avrin and
Michael A. Pfeffer},
title = {Characteristics of the National Applicant Pool for Clinical Informatics
Fellowships {(2016-2017)}},
booktitle = {{AMIA} 2018, American Medical Informatics Association Annual Symposium,
San Francisco, CA, November 3-7, 2018},
publisher = {{AMIA}},
year = {2018},
url = {https://knowledge.amia.org/67852-amia-1.4259402/t004-1.4263758/t004-1.4263759/2975669-1.4264066/2976137-1.4264063},
timestamp = {Wed, 17 Apr 2024 11:47:15 +0200},
biburl = {https://dblp.org/rec/conf/amia/BellBLBWMLHKLSH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/CollinsGHM18,
author = {Jack Collins and
Wade Geles and
David Howard and
Fr{\'{e}}d{\'{e}}ric Maire},
editor = {Hern{\'{a}}n E. Aguirre and
Keiki Takadama},
title = {Towards the targeted environment-specific evolution of robot components},
booktitle = {Proceedings of the Genetic and Evolutionary Computation Conference,
{GECCO} 2018, Kyoto, Japan, July 15-19, 2018},
pages = {61--68},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3205455.3205541},
doi = {10.1145/3205455.3205541},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gecco/CollinsGHM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/GongKLSDE18,
author = {Seong{-}Lyong Gong and
Jungrae Kim and
Sangkug Lym and
Michael B. Sullivan and
Howard David and
Mattan Erez},
title = {{DUO:} Exposing On-Chip Redundancy to Rank-Level {ECC} for High Reliability},
booktitle = {{IEEE} International Symposium on High Performance Computer Architecture,
{HPCA} 2018, Vienna, Austria, February 24-28, 2018},
pages = {683--695},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/HPCA.2018.00064},
doi = {10.1109/HPCA.2018.00064},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpca/GongKLSDE18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/RegierPFNLRHGSM18,
author = {Jeffrey Regier and
Kiran Pamnany and
Keno Fischer and
Andreas Noack and
Maximilian Lam and
Jarrett Revels and
Steve Howard and
Ryan Giordano and
David Schlegel and
Jon McAuliffe and
Rollin C. Thomas and
Prabhat},
title = {Cataloging the Visible Universe Through Bayesian Inference at Petascale},
booktitle = {2018 {IEEE} International Parallel and Distributed Processing Symposium,
{IPDPS} 2018, Vancouver, BC, Canada, May 21-25, 2018},
pages = {44--53},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/IPDPS.2018.00015},
doi = {10.1109/IPDPS.2018.00015},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/RegierPFNLRHGSM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/KarandikarMKBAL18,
author = {Sagar Karandikar and
Howard Mao and
Donggyu Kim and
David Biancolin and
Alon Amid and
Dayeol Lee and
Nathan Pemberton and
Emmanuel Amaro and
Colin Schmidt and
Aditya Chopra and
Qijing Huang and
Kyle Kovacs and
Borivoje Nikolic and
Randy H. Katz and
Jonathan Bachrach and
Krste Asanovic},
editor = {Murali Annavaram and
Timothy Mark Pinkston and
Babak Falsafi},
title = {FireSim: FPGA-Accelerated Cycle-Exact Scale-Out System Simulation
in the Public Cloud},
booktitle = {45th {ACM/IEEE} Annual International Symposium on Computer Architecture,
{ISCA} 2018, Los Angeles, CA, USA, June 1-6, 2018},
pages = {29--42},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/ISCA.2018.00014},
doi = {10.1109/ISCA.2018.00014},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isca/KarandikarMKBAL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sensys/ChenLKCK18,
author = {Kaifei Chen and
Tong Li and
Hyung{-}Sin Kim and
David E. Culler and
Randy H. Katz},
editor = {Gowri Sankar Ramachandran and
Bhaskar Krishnamachari},
title = {{MARVEL:} Enabling Mobile Augmented Reality with Low Energy and Low
Latency},
booktitle = {Proceedings of the 16th {ACM} Conference on Embedded Networked Sensor
Systems, SenSys 2018, Shenzhen, China, November 4-7, 2018},
pages = {292--304},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3274783.3274834},
doi = {10.1145/3274783.3274834},
timestamp = {Wed, 21 Nov 2018 12:44:16 +0100},
biburl = {https://dblp.org/rec/conf/sensys/ChenLKCK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ssci/QiuGHA18,
author = {Huanneng Qiu and
Matthew Garratt and
David Howard and
Sreenatha G. Anavatti},
title = {Evolving Spiking Neural Networks for Nonlinear Control Problems},
booktitle = {{IEEE} Symposium Series on Computational Intelligence, {SSCI} 2018,
Bangalore, India, November 18-21, 2018},
pages = {1367--1373},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/SSCI.2018.8628848},
doi = {10.1109/SSCI.2018.8628848},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ssci/QiuGHA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1801-10277,
author = {Jeffrey Regier and
Kiran Pamnany and
Keno Fischer and
Andreas Noack and
Maximilian Lam and
Jarrett Revels and
Steve Howard and
Ryan Giordano and
David Schlegel and
Jon McAuliffe and
Rollin C. Thomas and
Prabhat},
title = {Cataloging the Visible Universe through Bayesian Inference at Petascale},
journal = {CoRR},
volume = {abs/1801.10277},
year = {2018},
url = {http://arxiv.org/abs/1801.10277},
eprinttype = {arXiv},
eprint = {1801.10277},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1801-10277.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1810-01732,
author = {Sergei Alyamkin and
Matthew Ardi and
Achille Brighton and
Alexander C. Berg and
Yiran Chen and
Hsin{-}Pai Cheng and
Bo Chen and
Zichen Fan and
Chen Feng and
Bo Fu and
Kent Gauen and
Jongkook Go and
Alexander Goncharenko and
Xuyang Guo and
Hong Hanh Nguyen and
Andrew Howard and
Yuanjun Huang and
Donghyun Kang and
Jaeyoun Kim and
Alexander Kondratyev and
Seungjae Lee and
Suwoong Lee and
Junhyeok Lee and
Zhiyu Liang and
Xin Liu and
Juzheng Liu and
Zichao Li and
Yang Lu and
Yung{-}Hsiang Lu and
Deeptanshu Malik and
Eunbyung Park and
Denis Repin and
Tao Sheng and
Liang Shen and
Fei Sun and
David Svitov and
George K. Thiruvathukal and
Baiwu Zhang and
Jingchi Zhang and
Xiaopeng Zhang and
Shaojie Zhuo},
title = {2018 Low-Power Image Recognition Challenge},
journal = {CoRR},
volume = {abs/1810.01732},
year = {2018},
url = {http://arxiv.org/abs/1810.01732},
eprinttype = {arXiv},
eprint = {1810.01732},
timestamp = {Tue, 23 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1810-01732.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1810-04735,
author = {Jack Collins and
Wade Geles and
David Howard and
Fr{\'{e}}d{\'{e}}ric Maire},
title = {Towards the Targeted Environment-Specific Evolution of Robot Components},
journal = {CoRR},
volume = {abs/1810.04735},
year = {2018},
url = {http://arxiv.org/abs/1810.04735},
eprinttype = {arXiv},
eprint = {1810.04735},
timestamp = {Tue, 30 Oct 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1810-04735.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-01484,
author = {Jack Collins and
David Howard and
J{\"{u}}rgen Leitner},
title = {Quantifying the Reality Gap in Robotic Manipulation Tasks},
journal = {CoRR},
volume = {abs/1811.01484},
year = {2018},
url = {http://arxiv.org/abs/1811.01484},
eprinttype = {arXiv},
eprint = {1811.01484},
timestamp = {Thu, 22 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1811-01484.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cogcom/BergmannFGHH17,
author = {Jeroen H. M. Bergmann and
Joan Fei and
David A. Green and
Amir Hussain and
Newton Howard},
title = {A Bayesian Assessment of Real-World Behavior During Multitasking},
journal = {Cogn. Comput.},
volume = {9},
number = {6},
pages = {749--757},
year = {2017},
url = {https://doi.org/10.1007/s12559-017-9500-6},
doi = {10.1007/S12559-017-9500-6},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cogcom/BergmannFGHH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cpc/AharoniH17,
author = {Ron Aharoni and
David M. Howard},
title = {A Rainbow r-Partite Version of the Erd{\H{o}}s-Ko-Rado Theorem},
journal = {Comb. Probab. Comput.},
volume = {26},
number = {3},
pages = {321--337},
year = {2017},
url = {https://doi.org/10.1017/S0963548316000353},
doi = {10.1017/S0963548316000353},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cpc/AharoniH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/GongLPMFSMKK17,
author = {Min Gong and
Robert Lempert and
Andrew R. Parker and
Lauren A. Mayer and
Jordan Fischbach and
Matthew Sisco and
Zhimin Mao and
David H. Krantz and
Howard Kunreuther},
title = {Testing the scenario hypothesis: An experimental comparison of scenarios
and forecasts for decision support in a complex decision environment},
journal = {Environ. Model. Softw.},
volume = {91},
pages = {135--155},
year = {2017},
url = {https://doi.org/10.1016/j.envsoft.2017.02.002},
doi = {10.1016/J.ENVSOFT.2017.02.002},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/envsoft/GongLPMFSMKK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsg/CoovertWBH17,
author = {Michael D. Coovert and
Jennifer Winner and
Winston Bennett and
David J. Howard},
title = {Serious Games are a Serious Tool for Team Research},
journal = {Int. J. Serious Games},
volume = {4},
number = {1},
year = {2017},
url = {https://doi.org/10.17083/ijsg.v4i1.141},
doi = {10.17083/IJSG.V4I1.141},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijsg/CoovertWBH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/imwut/ChenFKKJCK17,
author = {Kaifei Chen and
Jonathan F{\"{u}}rst and
John Kolb and
Hyung{-}Sin Kim and
Xin Jin and
David E. Culler and
Randy H. Katz},
title = {SnapLink: Fast and Accurate Vision-Based Appliance Control in Large
Commercial Buildings},
journal = {Proc. {ACM} Interact. Mob. Wearable Ubiquitous Technol.},
volume = {1},
number = {4},
pages = {129:1--129:27},
year = {2017},
url = {https://doi.org/10.1145/3161173},
doi = {10.1145/3161173},
timestamp = {Fri, 29 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/imwut/ChenFKKJCK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/KukharevaSNMWSW17,
author = {Polina V. Kukhareva and
Catherine J. Staes and
Kevin Noonan and
Heather Mueller and
Phillip B. Warner and
David Shields and
Howard Weeks and
Kensaku Kawamoto},
title = {Single-reviewer electronic phenotyping validation in operational settings:
Comparison of strategies and recommendations},
journal = {J. Biomed. Informatics},
volume = {66},
pages = {1--10},
year = {2017},
url = {https://doi.org/10.1016/j.jbi.2016.12.004},
doi = {10.1016/J.JBI.2016.12.004},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/KukharevaSNMWSW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jct/AharoniH17,
author = {Ron Aharoni and
David M. Howard},
title = {Cross-intersecting pairs of hypergraphs},
journal = {J. Comb. Theory {A}},
volume = {148},
pages = {15--26},
year = {2017},
url = {https://doi.org/10.1016/j.jcta.2016.12.002},
doi = {10.1016/J.JCTA.2016.12.002},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jct/AharoniH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamsc/BuiEM17,
author = {Quan M. Bui and
Howard C. Elman and
J. David Moulton},
title = {Algebraic Multigrid Preconditioners for Multiphase Flow in Porous
Media},
journal = {{SIAM} J. Sci. Comput.},
volume = {39},
number = {5},
year = {2017},
url = {https://doi.org/10.1137/16M1082652},
doi = {10.1137/16M1082652},
timestamp = {Thu, 30 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamsc/BuiEM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/superfri/NoajeDLSLOCLTPK17,
author = {Gabriel Noaje and
Alan Davis and
Jonathan Low and
Lim Seng and
Tan Geok Lian and
Lukasz Orlowski and
Dominic Chien and
Sing{-}Wu Liou and
Tin Wee Tan and
Yves Poppe and
Kenneth Ban Hon Kim and
Andrew Howard and
David Southwell and
Jason Gunthorpe and
Marek T. Michalewicz},
title = {InfiniCortex - From Proof-of-concept to Production},
journal = {Supercomput. Front. Innov.},
volume = {4},
number = {2},
pages = {87--102},
year = {2017},
url = {https://doi.org/10.14529/jsfi170207},
doi = {10.14529/JSFI170207},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/superfri/NoajeDLSLOCLTPK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tec/Howard17,
author = {David Howard},
title = {A Platform That Directly Evolves Multirotor Controllers},
journal = {{IEEE} Trans. Evol. Comput.},
volume = {21},
number = {6},
pages = {943--955},
year = {2017},
url = {https://doi.org/10.1109/TEVC.2017.2703142},
doi = {10.1109/TEVC.2017.2703142},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tec/Howard17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/egItaly/TanasiMGSK17,
author = {Davide Tanasi and
Filippo Luigi Maria Milotta and
Ilenia Gradante and
Filippo Stanco and
Howard Kaplan},
editor = {Andrea Giachetti and
Paolo Pingi and
Filippo Stanco},
title = {A Digital Approach for the Study of Roman Signacula From Syracuse,
Sicily},
booktitle = {Italian Chapter Conference 2017 - Smart Tools and Apps in computer
Graphics, {STAG} 2017, Catania, Italy, September 11-12, 2017},
pages = {63--69},
publisher = {Eurographics Association},
year = {2017},
url = {https://doi.org/10.2312/stag.20171228},
doi = {10.2312/STAG.20171228},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/egItaly/TanasiMGSK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/Howard17,
author = {Gerard David Howard},
editor = {Peter A. N. Bosman},
title = {On self-adaptive rate restarts for evolutionary robotics with real
rotorcraft},
booktitle = {Proceedings of the Genetic and Evolutionary Computation Conference,
{GECCO} 2017, Berlin, Germany, July 15-19, 2017},
pages = {123--130},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3071178.3071248},
doi = {10.1145/3071178.3071248},
timestamp = {Tue, 06 Nov 2018 11:06:34 +0100},
biburl = {https://dblp.org/rec/conf/gecco/Howard17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icids/PackerHHPM17,
author = {Heather S. Packer and
Charlie Hargood and
Yvonne Margaret Howard and
Petros Papadopoulos and
David E. Millard},
editor = {Nuno Nunes and
Ian Oakley and
Valentina Nisi},
title = {Developing a Writer's Toolkit for Interactive Locative Storytelling},
booktitle = {Interactive Storytelling - 10th International Conference on Interactive
Digital Storytelling, {ICIDS} 2017, Funchal, Madeira, Portugal, November
14-17, 2017, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {10690},
pages = {63--74},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-71027-3\_6},
doi = {10.1007/978-3-319-71027-3\_6},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/icids/PackerHHPM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/HeijnenHK17,
author = {Huub Heijnen and
David Howard and
Navinda Kottege},
title = {A testbed that evolves hexapod controllers in hardware},
booktitle = {2017 {IEEE} International Conference on Robotics and Automation, {ICRA}
2017, Singapore, Singapore, May 29 - June 3, 2017},
pages = {1065--1071},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICRA.2017.7989128},
doi = {10.1109/ICRA.2017.7989128},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/icra/HeijnenHK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sensys/AndersenKCCK17,
author = {Michael P. Andersen and
John Kolb and
Kaifei Chen and
David E. Culler and
Randy H. Katz},
editor = {Kamin Whitehouse and
Prabal Dutta and
Hae Young Noh},
title = {Democratizing authority in the built environment},
booktitle = {Proceedings of the 4th {ACM} International Conference on Systems for
Energy-Efficient Built Environments, BuildSys 2017, Delft, The Netherlands,
November 08-09, 2017},
pages = {23:1--23:10},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3137133.3137151},
doi = {10.1145/3137133.3137151},
timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sensys/AndersenKCCK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/Howard17,
author = {Gerard David Howard},
title = {On Self-Adaptive Mutation Restarts for Evolutionary Robotics with
Real Rotorcraft},
journal = {CoRR},
volume = {abs/1703.10754},
year = {2017},
url = {http://arxiv.org/abs/1703.10754},
eprinttype = {arXiv},
eprint = {1703.10754},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/Howard17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/SaltH17,
author = {Llewyn Salt and
David Howard and
Giacomo Indiveri and
Yulia Sandamirskaya},
title = {Differential Evolution and Bayesian Optimisation for Hyper-Parameter
Selection in Mixed-Signal Neuromorphic Circuits Applied to {UAV} Obstacle
Avoidance},
journal = {CoRR},
volume = {abs/1704.04853},
year = {2017},
url = {http://arxiv.org/abs/1704.04853},
eprinttype = {arXiv},
eprint = {1704.04853},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/SaltH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1712-05855,
author = {Ion Stoica and
Dawn Song and
Raluca Ada Popa and
David A. Patterson and
Michael W. Mahoney and
Randy H. Katz and
Anthony D. Joseph and
Michael I. Jordan and
Joseph M. Hellerstein and
Joseph E. Gonzalez and
Ken Goldberg and
Ali Ghodsi and
David E. Culler and
Pieter Abbeel},
title = {A Berkeley View of Systems Challenges for {AI}},
journal = {CoRR},
volume = {abs/1712.05855},
year = {2017},
url = {http://arxiv.org/abs/1712.05855},
eprinttype = {arXiv},
eprint = {1712.05855},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1712-05855.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/da/Bell16,
author = {David Bell},
title = {The Legacy of Howard Raiffa},
journal = {Decis. Anal.},
volume = {13},
number = {3},
pages = {219--220},
year = {2016},
url = {https://doi.org/10.1287/deca.2016.0335},
doi = {10.1287/DECA.2016.0335},
timestamp = {Wed, 22 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/da/Bell16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/firai/LivingstonBLSSB16,
author = {Nicholas Livingston and
Anton Bernatskiy and
Kenneth R. Livingston and
Marc L. Smith and
Jodi Schwarz and
Josh C. Bongard and
David Wallach and
John H. Long Jr.},
title = {Modularity and Sparsity: Evolution of Neural Net Controllers in Physically
Embodied Robots},
journal = {Frontiers Robotics {AI}},
volume = {3},
pages = {75},
year = {2016},
url = {https://doi.org/10.3389/frobt.2016.00075},
doi = {10.3389/FROBT.2016.00075},
timestamp = {Mon, 29 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/firai/LivingstonBLSSB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpca/LagunaRGSSMP16,
author = {Ignacio Laguna and
David F. Richards and
Todd Gamblin and
Martin Schulz and
Bronis R. de Supinski and
Kathryn M. Mohror and
Howard Pritchard},
title = {Evaluating and extending user-level fault tolerance in {MPI} applications},
journal = {Int. J. High Perform. Comput. Appl.},
volume = {30},
number = {3},
pages = {305--319},
year = {2016},
url = {https://doi.org/10.1177/1094342015623623},
doi = {10.1177/1094342015623623},
timestamp = {Tue, 25 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhpca/LagunaRGSSMP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ited/KopcsoSG16,
author = {David P. Kopcso and
Howard Simon and
Annie Gao},
title = {Case Article - Idiopathic Pulmonary Fibrosis},
journal = {{INFORMS} Trans. Educ.},
volume = {16},
number = {3},
pages = {104--106},
year = {2016},
url = {https://doi.org/10.1287/ited.2016.0155ca},
doi = {10.1287/ITED.2016.0155CA},
timestamp = {Thu, 08 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ited/KopcsoSG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ited/KopcsoSG16a,
author = {David P. Kopcso and
Howard Simon and
Annie Gao},
title = {Case - Idiopathic Pulmonary Fibrosis},
journal = {{INFORMS} Trans. Educ.},
volume = {16},
number = {3},
pages = {107--109},
year = {2016},
url = {https://doi.org/10.1287/ited.2016.0155cs},
doi = {10.1287/ITED.2016.0155CS},
timestamp = {Thu, 08 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ited/KopcsoSG16a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/SalehiSMSCABRSL16,
author = {Mohsen Amini Salehi and
Jay Smith and
Anthony A. Maciejewski and
Howard Jay Siegel and
Edwin K. P. Chong and
Jonathan Apodaca and
Luis Diego Briceno and
Timothy Renner and
Vladimir Shestak and
Joshua Ladd and
Andrew M. Sutton and
David L. Janovy and
Sudha Govindasamy and
Amin Alqudah and
Rinku Dewri and
Puneet Prakash},
title = {Stochastic-based robust dynamic resource allocation for independent
tasks in a heterogeneous computing system},
journal = {J. Parallel Distributed Comput.},
volume = {97},
pages = {96--111},
year = {2016},
url = {https://doi.org/10.1016/j.jpdc.2016.06.008},
doi = {10.1016/J.JPDC.2016.06.008},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jpdc/SalehiSMSCABRSL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MyersSGHPF16,
author = {James Myers and
Anand Savanth and
Rohan Gaddh and
David Howard and
Pranay Prabhat and
David Flynn},
title = {A Subthreshold {ARM} Cortex-M0+ Subsystem in 65 nm {CMOS} for {WSN}
Applications with 14 Power Domains, 10T SRAM, and Integrated Voltage
Regulator},
journal = {{IEEE} J. Solid State Circuits},
volume = {51},
number = {1},
pages = {31--44},
year = {2016},
url = {https://doi.org/10.1109/JSSC.2015.2477046},
doi = {10.1109/JSSC.2015.2477046},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/MyersSGHPF16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/KeshavanPBZPSSA16,
author = {Anisha Keshavan and
Friedemann Paul and
Mona K. Beyer and
Alyssa H. Zhu and
Nico Papinutto and
Russell T. Shinohara and
William Stern and
Michael Amann and
Rohit Bakshi and
Antje Bischof and
Alessandro Carriero and
Manuel Comabella and
Jason C. Crane and
Sandra D'Alfonso and
Philippe Demaerel and
Benedicte Dubois and
Massimo Filippi and
Vinzenz Fleischer and
Bertrand Fontaine and
Laura Gaetano and
An Goris and
Christiane Graetz and
Adriane Gr{\"{o}}ger and
Sergiu Groppa and
David A. Hafler and
Hanne F. Harbo and
Bernhard Hemmer and
Kesshi Jordan and
Ludwig Kappos and
Gina Kirkish and
Sara Llufriu and
Stefano Magon and
Filippo Martinelli{-}Boneschi and
Jacob L. McCauley and
Xavier Montalban and
Mark M{\"{u}}hlau and
Daniel Pelletier and
Pradip M. Pattany and
Margaret A. Pericak{-}Vance and
Isabelle Cournu{-}Rebeix and
Maria Assunta Rocca and
Alex Rovira and
Regina Schlaeger and
Albert Saiz and
Till Sprenger and
Alessandro Stecco and
Bernard M. J. Uitdehaag and
Pablo Villoslada and
Mike P. Wattjes and
Howard L. Weiner and
Jens Wuerfel and
Claus Zimmer and
Frauke Zipp and
Stephen L. Hauser and
Jorge R. Oksenberg and
Roland G. Henry},
title = {Power estimation for non-standardized multisite studies},
journal = {NeuroImage},
volume = {134},
pages = {281--294},
year = {2016},
url = {https://doi.org/10.1016/j.neuroimage.2016.03.051},
doi = {10.1016/J.NEUROIMAGE.2016.03.051},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/KeshavanPBZPSSA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npl/HowardBL16,
author = {Gerard David Howard and
Larry Bull and
Pier Luca Lanzi},
title = {A Cognitive Architecture Based on a Learning Classifier System with
Spiking Classifiers},
journal = {Neural Process. Lett.},
volume = {44},
number = {1},
pages = {125--147},
year = {2016},
url = {https://doi.org/10.1007/s11063-015-9451-4},
doi = {10.1007/S11063-015-9451-4},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/npl/HowardBL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/see/JohnsonE16,
author = {David R. Johnson and
Elaine Howard Ecklund},
title = {Ethical Ambiguity in Science},
journal = {Sci. Eng. Ethics},
volume = {22},
number = {4},
pages = {989--1005},
year = {2016},
url = {https://doi.org/10.1007/s11948-015-9682-9},
doi = {10.1007/S11948-015-9682-9},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/see/JohnsonE16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tjs/DauweJFPMBS16,
author = {Daniel Dauwe and
Eric Jonardi and
Ryan D. Friese and
Sudeep Pasricha and
Anthony A. Maciejewski and
David A. Bader and
Howard Jay Siegel},
title = {{HPC} node performance and energy modeling with the co-location of
applications},
journal = {J. Supercomput.},
volume = {72},
number = {12},
pages = {4771--4809},
year = {2016},
url = {https://doi.org/10.1007/s11227-016-1783-y},
doi = {10.1007/S11227-016-1783-Y},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tjs/DauweJFPMBS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acal/HowardK16,
author = {David Howard and
Farid Kendoul},
editor = {Tapabrata Ray and
Ruhul A. Sarker and
Xiaodong Li},
title = {Towards Evolved Time to Contact Neurocontrollers for Quadcopters},
booktitle = {Artificial Life and Computational Intelligence - Second Australasian
Conference, {ACALCI} 2016, Canberra, ACT, Australia, February 2-5,
2016, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9592},
pages = {336--347},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-28270-1\_28},
doi = {10.1007/978-3-319-28270-1\_28},
timestamp = {Mon, 16 Sep 2019 15:23:23 +0200},
biburl = {https://dblp.org/rec/conf/acal/HowardK16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/JrMSNSM16,
author = {David P. McCallie Jr. and
Joshua C. Mandel and
Howard R. Strasberg and
Scott P. Narus and
Kevin Shekleton and
Peregrin Marshall},
title = {Beyond {SMART:} Remote decision support with {CDS} Hooks},
booktitle = {{AMIA} 2016, American Medical Informatics Association Annual Symposium,
Chicago, IL, USA, November 12-16, 2016},
publisher = {{AMIA}},
year = {2016},
url = {https://knowledge.amia.org/amia-63300-1.3360278/t008-1.3362585/f008-1.3362586/2499182-1.3362628/2497392-1.3362623},
timestamp = {Wed, 17 Apr 2024 11:47:32 +0200},
biburl = {https://dblp.org/rec/conf/amia/JrMSNSM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/KawamotoAABLMFS16,
author = {Kensaku Kawamoto and
Kevin J. Anstrom and
John B. Anderson and
Hayden B. Bosworth and
David F. Lobach and
Carrie McAdam{-}Marx and
Jeffrey M. Ferranti and
Howard Shang and
Kimberly S. Hawblitzel Yarnall},
title = {Long-Term Impact of an Electronic Health Record-Enabled, Team-Based,
and Scalable Population Health Strategy Based on the Chronic Care
Model},
booktitle = {{AMIA} 2016, American Medical Informatics Association Annual Symposium,
Chicago, IL, USA, November 12-16, 2016},
publisher = {{AMIA}},
year = {2016},
url = {https://knowledge.amia.org/amia-63300-1.3360278/t004-1.3364525/f004-1.3364526/2498160-1.3364828/2494235-1.3364823},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/KawamotoAABLMFS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cd/MichalewiczLSLS16,
author = {Marek T. Michalewicz and
Tan Geok Lian and
Lim Seng and
Jonathan Low and
David Southwell and
Jason Gunthorpe and
Gabriel Noaje and
Dominic Chien and
Yves Poppe and
Jakub Chrzeszczyk and
Andrew Howard and
Tin Wee Tan and
Sing{-}Wu Liou},
editor = {Gianluca Palermo and
John Feo},
title = {InfiniCortex: present and future invited paper},
booktitle = {Proceedings of the {ACM} International Conference on Computing Frontiers,
CF'16, Como, Italy, May 16-19, 2016},
pages = {267--273},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2903150.2912887},
doi = {10.1145/2903150.2912887},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cd/MichalewiczLSLS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/SchubotzVC16,
author = {Moritz Schubotz and
David Veenhuis and
Howard S. Cohl},
editor = {Andrea Kohlhase and
Paul Libbrecht and
Bruce R. Miller and
Adam Naumowicz and
Walther Neuper and
Pedro Quaresma and
Frank Wm. Tompa and
Martin Suda},
title = {Getting the units right},
booktitle = {Joint Proceedings of the FM4M, MathUI, and ThEdu Workshops, Doctoral
Program, and Work in Progress at the Conference on Intelligent Computer
Mathematics 2016 co-located with the 9th Conference on Intelligent
Computer Mathematics {(CICM} 2016), Bialystok, Poland, July 25-29,
2016},
series = {{CEUR} Workshop Proceedings},
volume = {1785},
pages = {146--156},
publisher = {CEUR-WS.org},
year = {2016},
url = {https://ceur-ws.org/Vol-1785/W45.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:32 +0100},
biburl = {https://dblp.org/rec/conf/cikm/SchubotzVC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/LivingstonBLSSB16,
author = {Nicholas Livingston and
Anton Bernatskiy and
Kenneth R. Livingston and
Marc L. Smith and
Jodi Schwarz and
Joshua Clifford Bongard and
David Wallach and
Evan Altiero and
John H. Long Jr.},
editor = {Anna Papafragou and
Daniel Grodner and
Daniel Mirman and
John C. Trueswell},
title = {Embodiment Effects in Evolutionary Robotics},
booktitle = {Proceedings of the 38th Annual Meeting of the Cognitive Science Society,
Recognizing and Representing Events, CogSci 2016, Philadelphia, PA,
USA, August 10-13, 2016},
publisher = {cognitivesciencesociety.org},
year = {2016},
url = {https://mindmodeling.org/cogsci2016/papers/0514/index.html},
timestamp = {Thu, 18 Apr 2024 13:03:08 +0200},
biburl = {https://dblp.org/rec/conf/cogsci/LivingstonBLSSB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icrc/BalynskyGCKKKDF16,
author = {Michael Balynsky and
David Gutierrez and
Howard Chiang and
Alexander Khitun and
Alexander Kozhevnikov and
Yuri Khivintsev and
Galina Dudko and
Yuri Filimonov},
title = {Parallel data processing with Magnonic Holographic Co-Processor},
booktitle = {{IEEE} International Conference on Rebooting Computing, {ICRC} 2016,
San Diego, CA, USA, October 17-19, 2016},
pages = {1--4},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/ICRC.2016.7738708},
doi = {10.1109/ICRC.2016.7738708},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icrc/BalynskyGCKKKDF16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itsc/WuSKKCPHB16,
author = {Cathy Wu and
Kalyanaraman Shankari and
Ece Kamar and
Randy H. Katz and
David E. Culler and
Christos H. Papadimitriou and
Eric Horvitz and
Alexandre M. Bayen},
title = {Optimizing the diamond lane: {A} more tractable carpool problem and
algorithms},
booktitle = {19th {IEEE} International Conference on Intelligent Transportation
Systems, {ITSC} 2016, Rio de Janeiro, Brazil, November 1-4, 2016},
pages = {1389--1396},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ITSC.2016.7795739},
doi = {10.1109/ITSC.2016.7795739},
timestamp = {Tue, 02 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/itsc/WuSKKCPHB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ud/BevanPCCCSGA16,
author = {Mark Bevan and
Helen Petrie and
Howard Cambridge and
Steve Cinderby and
Karen Croucher and
David Swallow and
Rose Gilroy and
Katia Attuyer},
editor = {Helen Petrie and
Jenny S. Darzentas and
Tanja Walsh and
David Swallow and
Leonardo Sandoval{-}Guzman and
Andrew Lewis and
Christopher Power},
title = {Co-Motion: Mobility and Wellbeing in Later Life},
booktitle = {Universal Design 2016: Learning from the Past, Designing for the Future
- Proceedings of the 3rd International Conference on Universal Design
{(UD} 2016), York, United Kingdom, August 21-24, 2016},
series = {Studies in Health Technology and Informatics},
volume = {229},
pages = {627--628},
publisher = {{IOS} Press},
year = {2016},
url = {https://doi.org/10.3233/978-1-61499-684-2-627},
doi = {10.3233/978-1-61499-684-2-627},
timestamp = {Fri, 07 Jul 2023 13:16:29 +0200},
biburl = {https://dblp.org/rec/conf/ud/BevanPCCCSGA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/0002STWW16,
author = {David M. Howard and
Noah Streib and
William T. Trotter and
Bartosz Walczak and
Ruidong Wang},
title = {The dimension of posets with planar cover graphs excluding two long
incomparable chains},
journal = {CoRR},
volume = {abs/1608.08843},
year = {2016},
url = {http://arxiv.org/abs/1608.08843},
eprinttype = {arXiv},
eprint = {1608.08843},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/0002STWW16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/BuiEM16,
author = {Quan M. Bui and
Howard C. Elman and
J. David Moulton},
title = {Algebraic Multigrid Preconditioners for Multiphase Flow in Porous
Media},
journal = {CoRR},
volume = {abs/1611.00127},
year = {2016},
url = {http://arxiv.org/abs/1611.00127},
eprinttype = {arXiv},
eprint = {1611.00127},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/BuiEM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/JohnsonBDD0HKRS16,
author = {David S. Johnson and
Lee Breslau and
Ilias Diakonikolas and
Nick G. Duffield and
Yu Gu and
MohammadTaghi Hajiaghayi and
Howard J. Karloff and
Mauricio G. C. Resende and
Subhabrata Sen},
title = {Near-Optimal Disjoint-Path Facility Location Through Set Cover by
Pairs},
journal = {CoRR},
volume = {abs/1611.01210},
year = {2016},
url = {http://arxiv.org/abs/1611.01210},
eprinttype = {arXiv},
eprint = {1611.01210},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/JohnsonBDD0HKRS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/AimoLHNGGKDGRBX15,
author = {Lucila Aimo and
Robin Liechti and
Nevila Hyka{-}Nouspikel and
Anne Niknejad and
Anne Gleizes and
Lou G{\"{o}}tz and
Dmitry Kuznetsov and
Fabrice P. A. David and
F. Gisou van der Goot and
Howard Riezman and
Lydie Bougueleret and
Ioannis Xenarios and
Alan J. Bridge},
title = {The SwissLipids knowledgebase for lipid biology},
journal = {Bioinform.},
volume = {31},
number = {17},
pages = {2860--2866},
year = {2015},
url = {https://doi.org/10.1093/bioinformatics/btv285},
doi = {10.1093/BIOINFORMATICS/BTV285},
timestamp = {Fri, 15 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/AimoLHNGGKDGRBX15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chb/CoovertHCN15,
author = {Sally A. Coovert and
David J. Howard and
Michael D. Coovert and
Robert M. Nelson},
title = {An evaluation of medical residents utilization of tablet computers},
journal = {Comput. Hum. Behav.},
volume = {53},
pages = {289--293},
year = {2015},
url = {https://doi.org/10.1016/j.chb.2015.07.021},
doi = {10.1016/J.CHB.2015.07.021},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/chb/CoovertHCN15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmmm/McGrathHB15,
author = {Michael McGrath and
David Howard and
Richard Baker},
title = {A Forward Dynamic Modelling Investigation of Cause-and-Effect Relationships
in Single Support Phase of Human Walking},
journal = {Comput. Math. Methods Medicine},
volume = {2015},
pages = {383705:1--383705:9},
year = {2015},
url = {https://doi.org/10.1155/2015/383705},
doi = {10.1155/2015/383705},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cmmm/McGrathHB15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/combinatorics/AharoniHHS15,
author = {Ron Aharoni and
Ron Holzman and
David M. Howard and
Philipp Spr{\"{u}}ssel},
title = {Cooperative Colorings and Independent Systems of Representatives},
journal = {Electron. J. Comb.},
volume = {22},
number = {2},
pages = {2},
year = {2015},
url = {https://doi.org/10.37236/2488},
doi = {10.37236/2488},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/combinatorics/AharoniHHS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/connection/HowardBC15,
author = {Gerard David Howard and
Larry Bull and
Ben de Lacy Costello},
title = {Evolving unipolar memristor spiking neural networks},
journal = {Connect. Sci.},
volume = {27},
number = {4},
pages = {397--416},
year = {2015},
url = {https://doi.org/10.1080/09540091.2015.1080225},
doi = {10.1080/09540091.2015.1080225},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/connection/HowardBC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isem/AndersonGWZ15,
author = {David Anderson and
Bruce L. Golden and
Edward A. Wasil and
Hao Howard Zhang},
title = {Predicting prostate cancer risk using magnetic resonance imaging data},
journal = {Inf. Syst. {E} Bus. Manag.},
volume = {13},
number = {4},
pages = {599--608},
year = {2015},
url = {https://doi.org/10.1007/s10257-014-0239-2},
doi = {10.1007/S10257-014-0239-2},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/isem/AndersonGWZ15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/RadfordSHMVDHSN15,
author = {Nicolaus A. Radford and
Philip Strawser and
Kimberly A. Hambuchen and
Joshua S. Mehling and
William K. Verdeyen and
A. Stuart Donnan and
James Holley and
Jairo Sanchez and
Vienny Nguyen and
Lyndon B. Bridgwater and
Reginald Berka and
Robert O. Ambrose and
Mason Myles Markee and
N. J. Fraser{-}Chanpong and
Christopher McQuin and
John D. Yamokoski and
Stephen Hart and
Raymond Guo and
Adam Parsons and
Brian Wightman and
Paul Dinh and
Barrett Ames and
Charles Blakely and
Courtney Edmondson and
Brett Sommers and
Rochelle Rea and
Chad Tobler and
Heather Bibby and
Brice Howard and
Lei Niu and
Andrew Lee and
Michael Conover and
Lily Truong and
Ryan Reed and
David Chesney and
Robert Platt Jr. and
Gwendolyn Johnson and
Chien{-}Liang Fok and
Nicholas Paine and
Luis Sentis and
Eric A. Cousineau and
Ryan W. Sinnet and
Jordan Lack and
Matthew J. Powell and
Benjamin Morris and
Aaron D. Ames and
Jide Akinyode},
title = {Valkyrie: NASA's First Bipedal Humanoid Robot},
journal = {J. Field Robotics},
volume = {32},
number = {3},
pages = {397--419},
year = {2015},
url = {https://doi.org/10.1002/rob.21560},
doi = {10.1002/ROB.21560},
timestamp = {Mon, 29 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfr/RadfordSHMVDHSN15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jgt/AharoniCH15,
author = {Ron Aharoni and
Pierre Charbit and
David M. Howard},
title = {On a Generalization of the Ryser-Brualdi-Stein Conjecture},
journal = {J. Graph Theory},
volume = {78},
number = {2},
pages = {143--156},
year = {2015},
url = {https://doi.org/10.1002/jgt.21796},
doi = {10.1002/JGT.21796},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jgt/AharoniCH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/Aartsen15,
author = {Mark G. Aartsen and
Rasha U. Abbasi and
Markus Ackermann and
Jenni Adams and
Juan Antonio Aguilar S{\'{a}}nchez and
Markus Ahlers and
David Altmann and
Carlos A. Arg{\"{u}}elles Delgado and
Jan Auffenberg and
Xinhua Bai and
Michael F. Baker and
Steven W. Barwick and
Volker Baum and
Ryan Bay and
James J. Beatty and
Julia K. Becker Tjus and
Karl{-}Heinz Becker and
Segev BenZvi and
Patrick Berghaus and
David Berley and
Elisa Bernardini and
Anna Bernhard and
David Z. Besson and
G. Binder and
Daniel Bindig and
Martin Bissok and
Erik Blaufuss and
Jan Blumenthal and
David J. Boersma and
Christian Bohm and
Debanjan Bose and
Sebastian B{\"{o}}ser and
Olga Botner and
Lionel Brayeur and
Hans{-}Peter Bretz and
Anthony M. Brown and
Ronald Bruijn and
James Casey and
Martin Casier and
Dmitry Chirkin and
Asen Christov and
Brian John Christy and
Ken Clark and
Lew Classen and
Fabian Clevermann and
Stefan Coenders and
Shirit Cohen and
Doug F. Cowen and
Angel H. Cruz Silva and
Matthias Danninger and
Jacob Daughhetee and
James C. Davis and
Melanie Day and
Catherine De Clercq and
Sam De Ridder and
Paolo Desiati and
Krijn D. de Vries and
Meike de With and
Tyce DeYoung and
Juan Carlos D{\'{\i}}az{-}V{\'{e}}lez and
Matthew Dunkman and
Ryan Eagan and
Benjamin Eberhardt and
Bj{\"{o}}rn Eichmann and
Jonathan Eisch and
Sebastian Euler and
Paul A. Evenson and
Oladipo O. Fadiran and
Ali R. Fazely and
Anatoli Fedynitch and
Jacob Feintzeig and
Tom Feusels and
Kirill Filimonov and
Chad Finley and
Tobias Fischer{-}Wasels and
Samuel Flis and
Anna Franckowiak and
Katharina Frantzen and
Tomasz Fuchs and
Thomas K. Gaisser and
Joseph S. Gallagher and
Lisa Marie Gerhardt and
Laura E. Gladstone and
Thorsten Gl{\"{u}}senkamp and
Azriel Goldschmidt and
Geraldina Golup and
Javier G. Gonz{\'{a}}lez and
Jordan A. Goodman and
Dariusz G{\'{o}}ra and
Dylan T. Grandmont and
Darren Grant and
Pavel Gretskov and
John C. Groh and
Andreas Gro{\ss} and
Chang Hyon Ha and
Abd Al Karim Haj Ismail and
Patrick Hallen and
Allan Hallgren and
Francis Halzen and
Kael D. Hanson and
Dustin Hebecker and
David Heereman and
Dirk Heinen and
Klaus Helbing and
Robert Eugene Hellauer III and
Stephanie Virginia Hickford and
Gary C. Hill and
Kara D. Hoffman and
Ruth Hoffmann and
Andreas Homeier and
Kotoyo Hoshina and
Feifei Huang and
Warren Huelsnitz and
Per Olof Hulth and
Klas Hultqvist and
Shahid Hussain and
Aya Ishihara and
Emanuel Jacobi and
John E. Jacobsen and
Kai Jagielski and
George S. Japaridze and
Kyle Jero and
Ola Jlelati and
Basho Kaminsky and
Alexander Kappes and
Timo Karg and
Albrecht Karle and
Matthew Kauer and
John Lawrence Kelley and
Joanna Kiryluk and
J. Kl{\"{a}}s and
Spencer R. Klein and
Jan{-}Hendrik K{\"{o}}hne and
Georges Kohnen and
Hermann Kolanoski and
Lutz K{\"{o}}pke and
Claudio Kopper and
Sandro Kopper and
D. Jason Koskinen and
Marek Kowalski and
Mark Krasberg and
Anna Kriesten and
Kai Michael Krings and
G{\"{o}}sta Kroll and
Jan Kunnen and
Naoko Kurahashi and
Takao Kuwabara and
Mathieu L. M. Labare and
Hagar Landsman and
Michael James Larson and
Mariola Lesiak{-}Bzdak and
Martin Leuermann and
Julia Leute and
Jan L{\"{u}}nemann and
Oscar A. Mac{\'{\i}}as{-}Ram{\'{\i}}rez and
James Madsen and
Giuliano Maggi and
Reina Maruyama and
Keiichi Mase and
Howard S. Matis and
Frank McNally and
Kevin James Meagher and
Martin Merck and
Gonzalo Merino Ar{\'{e}}valo and
Thomas Meures and
Sandra Miarecki and
Eike Middell and
Natalie Milke and
John Lester Miller and
Lars Mohrmann and
Teresa Montaruli and
Robert M. Morse and
Rolf Nahnhauer and
Uwe Naumann and
Hans Niederhausen and
Sarah C. Nowicki and
David R. Nygren and
Anna Obertacke and
Sirin Odrowski and
Alex Olivas and
Ahmad Omairat and
Aongus Starbuck {\'{O}} Murchadha and
Larissa Paul and
Joshua A. Pepper and
Carlos P{\'{e}}rez de los Heros and
Carl Pfendner and
Damian Pieloth and
Elisa Pinat and
Jonas Posselt and
P. Buford Price and
Gerald T. Przybylski and
Melissa Quinnan and
Leif R{\"{a}}del and
Ian Rae and
Mohamed Rameez and
Katherine Rawlins and
Peter Christian Redl and
Ren{\'{e}} Reimann and
Elisa Resconi and
Wolfgang Rhode and
Mathieu Ribordy and
Michael Richman and
Benedikt Riedel and
J. P. Rodrigues and
Carsten Rott and
Tim Ruhe and
Bakhtiyar Ruzybayev and
Dirk Ryckbosch and
Sabine M. Saba and
Heinz{-}Georg Sander and
Juan Marcos Santander and
Subir Sarkar and
Kai Schatto and
Florian Scheriau and
Torsten Schmidt and
Martin Schmitz and
Sebastian Schoenen and
Sebastian Sch{\"{o}}neberg and
Arne Sch{\"{o}}nwald and
Anne Schukraft and
Lukas Schulte and
David Schultz and
Olaf Schulz and
David Seckel and
Yolanda Sestayo de la Cerra and
Surujhdeo Seunarine and
Rezo Shanidze and
Chris Sheremata and
Miles W. E. Smith and
Dennis Soldin and
Glenn M. Spiczak and
Christian Spiering and
Michael Stamatikos and
Todor Stanev and
Nick A. Stanisha and
Alexander Stasik and
Thorsten Stezelberger and
Robert G. Stokstad and
Achim St{\"{o}}{\ss}l and
Erik A. Strahler and
Rickard Str{\"{o}}m and
Nora Linn Strotjohann and
Gregory W. Sullivan and
Henric Taavola and
Ignacio J. Taboada and
Alessio Tamburro and
Andreas Tepe and
Samvel Ter{-}Antonyan and
Gordana Tesic and
Serap Tilav and
Patrick A. Toale and
Moriah Natasha Tobin and
Simona Toscano and
Maria Tselengidou and
Elisabeth Unger and
Marcel Usner and
Sofia Vallecorsa and
Nick van Eijndhoven and
Arne Van Overloop and
Jakob van Santen and
Markus Vehring and
Markus Voge and
Matthias Vraeghe and
Christian Walck and
Tilo Waldenmaier and
Marius Wallraff and
Christopher N. Weaver and
Mark T. Wellons and
Christopher H. Wendt and
Stefan Westerhoff and
Nathan Whitehorn and
Klaus Wiebe and
Christopher Wiebusch and
Dawn R. Williams and
Henrike Wissing and
Martin Wolf and
Terri R. Wood and
Kurt Woschnagg and
Donglian Xu and
Xianwu Xu and
Juan Pablo Y{\'{a}}{\~{n}}ez Garza and
Gaurang B. Yodh and
Shigeru Yoshida and
Pavel Zarzhitsky and
Jan Ziemann and
Simon Zierke and
Marcel Zoll},
title = {The IceProd framework: Distributed data processing for the IceCube
neutrino observatory},
journal = {J. Parallel Distributed Comput.},
volume = {75},
pages = {198--211},
year = {2015},
url = {https://doi.org/10.1016/j.jpdc.2014.08.001},
doi = {10.1016/J.JPDC.2014.08.001},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jpdc/Aartsen15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigsoft/RegerBR15,
author = {Giles Reger and
Howard Barringer and
David E. Rydeheard},
title = {Automata-based Pattern Mining from Imperfect Traces},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {40},
number = {1},
pages = {1--8},
year = {2015},
url = {https://doi.org/10.1145/2693208.2693220},
doi = {10.1145/2693208.2693220},
timestamp = {Thu, 17 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigsoft/RegerBR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acal/HowardBC15,
author = {Gerard David Howard and
Larry Bull and
Ben de Lacy Costello},
editor = {Stephan K. Chalup and
Alan D. Blair and
Marcus Randall},
title = {Evolving Unipolar Memristor Spiking Neural Networks},
booktitle = {Artificial Life and Computational Intelligence - First Australasian
Conference, {ACALCI} 2015, Newcastle, NSW, Australia, February 5-7,
2015. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8955},
pages = {258--272},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-14803-8\_20},
doi = {10.1007/978-3-319-14803-8\_20},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acal/HowardBC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biocas/CourellisPPCI15,
author = {Hristos S. Courellis and
David A. Peterson and
Howard Poizner and
Gert Cauwenberghs and
John R. Iversen},
title = {{EEG} based inference of causal cortical network dynamics in reward-based
decision making},
booktitle = {{IEEE} Biomedical Circuits and Systems Conference, BioCAS 2015, Atlanta,
GA, USA, October 22-24, 2015},
pages = {1--4},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/BioCAS.2015.7348346},
doi = {10.1109/BIOCAS.2015.7348346},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/biocas/CourellisPPCI15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/birthday/HowardR15,
author = {Emily Howard and
David De Roure},
title = {Turning numbers into notes},
booktitle = {Ada Lovelace Symposium 2015 - Celebrating 200 Years of a Computer
Visionary, Ada Lovelace Symposium 2015, Oxford, UK, December 10, 2015},
pages = {13},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2867731.2867746},
doi = {10.1145/2867731.2867746},
timestamp = {Sat, 24 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/birthday/HowardR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/AndersonKJEHV15,
author = {Bonnie Brinton Anderson and
C. Brock Kirwan and
Jeffrey L. Jenkins and
David Eargle and
Seth Howard and
Anthony Vance},
editor = {Bo Begole and
Jinwoo Kim and
Kori Inkpen and
Woontack Woo},
title = {How Polymorphic Warnings Reduce Habituation in the Brain: Insights
from an fMRI Study},
booktitle = {Proceedings of the 33rd Annual {ACM} Conference on Human Factors in
Computing Systems, {CHI} 2015, Seoul, Republic of Korea, April 18-23,
2015},
pages = {2883--2892},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2702123.2702322},
doi = {10.1145/2702123.2702322},
timestamp = {Fri, 12 Mar 2021 15:27:48 +0100},
biburl = {https://dblp.org/rec/conf/chi/AndersonKJEHV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cloud/ZatsIAAKSV15,
author = {David Zats and
Anand Padmanabha Iyer and
Ganesh Ananthanarayanan and
Rachit Agarwal and
Randy H. Katz and
Ion Stoica and
Amin Vahdat},
editor = {Shahram Ghandeharizadeh and
Sumita Barahmand and
Magdalena Balazinska and
Michael J. Freedman},
title = {FastLane: making short flows shorter with agile drop notification},
booktitle = {Proceedings of the Sixth {ACM} Symposium on Cloud Computing, SoCC
2015, Kohala Coast, Hawaii, USA, August 27-29, 2015},
pages = {84--96},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2806777.2806852},
doi = {10.1145/2806777.2806852},
timestamp = {Tue, 06 Nov 2018 11:07:34 +0100},
biburl = {https://dblp.org/rec/conf/cloud/ZatsIAAKSV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cloudcom/FoxMRW15,
author = {Geoffrey C. Fox and
Siddharth Maini and
Howard Rosenbaum and
David J. Wild},
title = {Data Science and Online Education},
booktitle = {7th {IEEE} International Conference on Cloud Computing Technology
and Science, CloudCom 2015, Vancouver, BC, Canada, November 30 - December
3, 2015},
pages = {582--587},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/CloudCom.2015.82},
doi = {10.1109/CLOUDCOM.2015.82},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cloudcom/FoxMRW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/FulpGJMTZ15,
author = {Errin W. Fulp and
H. Donald Gage and
David J. John and
Matthew R. McNiece and
William H. Turkett Jr. and
Xin Zhou},
title = {An Evolutionary Strategy for Resilient Cyber Defense},
booktitle = {2015 {IEEE} Global Communications Conference, {GLOBECOM} 2015, San
Diego, CA, USA, December 6-10, 2015},
pages = {1--6},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/GLOCOM.2014.7417814},
doi = {10.1109/GLOCOM.2014.7417814},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/globecom/FulpGJMTZ15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hoti/GrunHSGRPS15,
author = {Paul Grun and
Sean Hefty and
Sayantan Sur and
David Goodell and
Robert D. Russell and
Howard Pritchard and
Jeffrey M. Squyres},
title = {A Brief Introduction to the OpenFabrics Interfaces - {A} New Network
{API} for Maximizing High Performance Application Efficiency},
booktitle = {23rd {IEEE} Annual Symposium on High-Performance Interconnects, {HOTI}
2015, Santa Clara, CA, USA, August 26-28, 2015},
pages = {34--39},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/HOTI.2015.19},
doi = {10.1109/HOTI.2015.19},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hoti/GrunHSGRPS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icad/HindeET015,
author = {Alistair F. Hinde and
Michael Evans and
Anthony I. Tew and
David M. Howard},
editor = {Katharina Vogt and
Areti Andreopoulou and
Visda Goudarzi},
title = {Onset asynchrony in spoken menus},
booktitle = {Proceedings of the 21st International Conference on Auditory Display,
{ICAD} 2015, Graz, Austria, July 8-10, 2015},
pages = {86--93},
publisher = {Institute of Electronic Music and Acoustics (IEM), University of Music
and Performing Arts Graz (KUG), Austria},
year = {2015},
timestamp = {Thu, 19 Nov 2020 15:50:59 +0100},
biburl = {https://dblp.org/rec/conf/icad/HindeET015.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/DauweJFPMBS15,
author = {Daniel Dauwe and
Eric Jonardi and
Ryan D. Friese and
Sudeep Pasricha and
Anthony A. Maciejewski and
David A. Bader and
Howard Jay Siegel},
title = {A Methodology for Co-Location Aware Application Performance Modeling
in Multicore Computing},
booktitle = {2015 {IEEE} International Parallel and Distributed Processing Symposium
Workshop, {IPDPS} 2015, Hyderabad, India, May 25-29, 2015},
pages = {434--443},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/IPDPSW.2015.38},
doi = {10.1109/IPDPSW.2015.38},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ipps/DauweJFPMBS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/HowardM15,
author = {David Howard and
Torsten Merz},
title = {A platform for the direct hardware evolution of quadcopter controllers},
booktitle = {2015 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, {IROS} 2015, Hamburg, Germany, September 28 - October 2,
2015},
pages = {4614--4619},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/IROS.2015.7354034},
doi = {10.1109/IROS.2015.7354034},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/HowardM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/MyersSHGPF15,
author = {James Myers and
Anand Savanth and
David Howard and
Rohan Gaddh and
Pranay Prabhat and
David Flynn},
title = {8.1 An 80nW retention 11.7pJ/cycle active subthreshold {ARM} Cortex-M0+
subsystem in 65nm {CMOS} for {WSN} applications},
booktitle = {2015 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2015, Digest of Technical Papers, San Francisco, CA, USA, February
22-26, 2015},
pages = {1--3},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ISSCC.2015.7062967},
doi = {10.1109/ISSCC.2015.7062967},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/MyersSHGPF15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mobisys/ChenHCKKC15,
author = {Kaifei Chen and
Siyuan He and
Bei Di Chen and
John Kolb and
Randy H. Katz and
David E. Culler},
editor = {Simone Cirani and
Mischa Dohler and
Gianluigi Ferrari and
Luigi Alfredo Grieco and
Marco Picone and
Thomas Watteyne},
title = {BearLoc: {A} Composable Distributed Framework for Indoor Localization
Systems},
booktitle = {Proceedings of the 2015 Workshop on IoT challenges in Mobile and Industrial
Systems, IoT-Sys@MobiSys 2015, Florence, Italy, May 18, 2015},
pages = {7--12},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2753476.2753478},
doi = {10.1145/2753476.2753478},
timestamp = {Fri, 23 Jun 2023 22:30:53 +0200},
biburl = {https://dblp.org/rec/conf/mobisys/ChenHCKKC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/percom/ShankariYCK15,
author = {Kalyanaraman Shankari and
Mogeng Yin and
David E. Culler and
Randy H. Katz},
title = {E-mission: Automated transportation emission calculation using smartphones},
booktitle = {2015 {IEEE} International Conference on Pervasive Computing and Communication
Workshops, PerCom Workshops 2015, St. Louis, MO, USA, March 23-27,
2015},
pages = {268--271},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/PERCOMW.2015.7134044},
doi = {10.1109/PERCOMW.2015.7134044},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/percom/ShankariYCK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/GlynnTBH15,
author = {Chris Glynn and
Surya T. Tokdar and
David L. Banks and
Brian Howard},
title = {Bayesian Analysis of Dynamic Linear Topic Models},
journal = {CoRR},
volume = {abs/1511.03947},
year = {2015},
url = {http://arxiv.org/abs/1511.03947},
eprinttype = {arXiv},
eprint = {1511.03947},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/GlynnTBH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/HowardBC15,
author = {Gerard David Howard and
Larry Bull and
Ben de Lacy Costello},
title = {Evolving Unipolar Memristor Spiking Neural Networks},
journal = {CoRR},
volume = {abs/1509.00105},
year = {2015},
url = {http://arxiv.org/abs/1509.00105},
eprinttype = {arXiv},
eprint = {1509.00105},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/HowardBC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/HowardBCAG15,
author = {Gerard David Howard and
Larry Bull and
Ben de Lacy Costello and
Andrew Adamatzky and
Ella Gale},
title = {Evolving Spiking Networks with Variable Resistive Memories},
journal = {CoRR},
volume = {abs/1505.04357},
year = {2015},
url = {http://arxiv.org/abs/1505.04357},
eprinttype = {arXiv},
eprint = {1505.04357},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/HowardBCAG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/HowardBL15,
author = {Gerard David Howard and
Larry Bull and
Pier Luca Lanzi},
title = {A Cognitive Architecture Based on a Learning Classifier System with
Spiking Classifiers},
journal = {CoRR},
volume = {abs/1508.07700},
year = {2015},
url = {http://arxiv.org/abs/1508.07700},
eprinttype = {arXiv},
eprint = {1508.07700},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/HowardBL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/PattenBJI15,
author = {Daniel R. Patten and
Howard A. Blair and
David W. Jakel and
Robert J. Irwin},
title = {Differential Calculus on Cayley Graphs},
journal = {CoRR},
volume = {abs/1504.08013},
year = {2015},
url = {http://arxiv.org/abs/1504.08013},
eprinttype = {arXiv},
eprint = {1504.08013},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/PattenBJI15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/basesearch/Millis14,
author = {David Howard Millis},
title = {Multiple Kernel Learning for Gene Prioritization, Clustering, and
Functional Enrichment Analysis},
school = {George Mason University, Fairfax, Virginia, {USA}},
year = {2014},
url = {https://hdl.handle.net/1920/8892},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/basesearch/Millis14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dsj/ChuangLPH14,
author = {Howard Hao{-}Chun Chuang and
Guanyi Lu and
David Xiaosong Peng and
Gregory R. Heim},
title = {Impact of Value-Added Service Features in e-Retailing Processes: An
Econometric Analysis of Web Site Functions},
journal = {Decis. Sci.},
volume = {45},
number = {6},
pages = {1159--1186},
year = {2014},
url = {https://doi.org/10.1111/deci.12105},
doi = {10.1111/DECI.12105},
timestamp = {Wed, 10 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dsj/ChuangLPH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ec/HowardBCGA14,
author = {Gerard David Howard and
Larry Bull and
Ben de Lacy Costello and
Ella Gale and
Andrew Adamatzky},
title = {Evolving Spiking Networks with Variable Resistive Memories},
journal = {Evol. Comput.},
volume = {22},
number = {1},
pages = {79--103},
year = {2014},
url = {https://doi.org/10.1162/EVCO\_a\_00103},
doi = {10.1162/EVCO\_A\_00103},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ec/HowardBCGA14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ecoi/WarrenAOISJ14,
author = {Steven D. Warren and
Martin Helmut Alt and
Keith D. Olson and
Severin David Howard Irl and
Manuel J. Steinbauer and
Anke Jentsch},
title = {The relationship between the spectral diversity of satellite imagery,
habitat heterogeneity, and plant species richness},
journal = {Ecol. Informatics},
volume = {24},
pages = {160--168},
year = {2014},
url = {https://doi.org/10.1016/j.ecoinf.2014.08.006},
doi = {10.1016/J.ECOINF.2014.08.006},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ecoi/WarrenAOISJ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WarnockCHCSMPZJSDGBMCMRSSSWMSPW14,
author = {James D. Warnock and
Yuen H. Chan and
Hubert Harrer and
Sean M. Carey and
Gerard Salem and
Doug Malone and
Ruchir Puri and
Jeffrey A. Zitz and
Adam Jatkowski and
Gerald Strevig and
Ayan Datta and
Anne Gattiker and
Aditya Bansal and
Guenter Mayer and
Yiu{-}Hing Chan and
Mark D. Mayo and
David L. Rude and
Leon J. Sigal and
Thomas Strach and
Howard H. Smith and
Huajun Wen and
Pak{-}kin Mak and
Chung{-}Lung Kevin Shum and
Donald W. Plass and
Charles F. Webb},
title = {Circuit and Physical Design of the zEnterprise{\texttrademark} {EC12}
Microprocessor Chips and Multi-Chip Module},
journal = {{IEEE} J. Solid State Circuits},
volume = {49},
number = {1},
pages = {9--18},
year = {2014},
url = {https://doi.org/10.1109/JSSC.2013.2284647},
doi = {10.1109/JSSC.2013.2284647},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WarnockCHCSMPZJSDGBMCMRSSSWMSPW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ress/HansenBBBCGHHHJLLMMMPRSSSW14,
author = {Clifford W. Hansen and
Jens T. Birkholzer and
J. Blink and
C. R. Bryan and
Y. Chen and
M. B. Gross and
E. Hardin and
James E. Houseworth and
Robert L. Howard and
R. Jarek and
K. P. Lee and
B. Lester and
P. Mariner and
P. D. Mattie and
S. Mehta and
F. V. Perry and
Bruce A. Robinson and
D. Sassani and
S. David Sevougian and
Joshua S. Stein and
M. Wasiolek},
title = {Overview of total system model used for the 2008 performance assessment
for the proposed high-level radioactive waste repository at Yucca
Mountain, Nevada},
journal = {Reliab. Eng. Syst. Saf.},
volume = {122},
pages = {249--266},
year = {2014},
url = {https://doi.org/10.1016/j.ress.2013.06.001},
doi = {10.1016/J.RESS.2013.06.001},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ress/HansenBBBCGHHHJLLMMMPRSSSW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ress/SwiftHHHKMMS14,
author = {Peter N. Swift and
Clifford W. Hansen and
Jon C. Helton and
Robert L. Howard and
M. Kathryn Knowles and
Robert J. MacKinnon and
Jerry A. McNeish and
S. David Sevougian},
title = {Summary discussion of the 2008 performance assessment for the proposed
high-level radioactive waste repository at Yucca Mountain, Nevada},
journal = {Reliab. Eng. Syst. Saf.},
volume = {122},
pages = {449--456},
year = {2014},
url = {https://doi.org/10.1016/j.ress.2013.06.009},
doi = {10.1016/J.RESS.2013.06.009},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ress/SwiftHHHKMMS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamrev/ElmanRS14,
author = {Howard C. Elman and
Alison Ramage and
David J. Silvester},
title = {{IFISS:} {A} Computational Laboratory for Investigating Incompressible
Flow Problems},
journal = {{SIAM} Rev.},
volume = {56},
number = {2},
pages = {261--273},
year = {2014},
url = {https://doi.org/10.1137/120891393},
doi = {10.1137/120891393},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamrev/ElmanRS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/SpeedMH14,
author = {Matt Speed and
Damian T. Murphy and
David M. Howard},
title = {Modeling the Vocal Tract Transfer Function Using a 3D Digital Waveguide
Mesh},
journal = {{IEEE} {ACM} Trans. Audio Speech Lang. Process.},
volume = {22},
number = {2},
pages = {453--464},
year = {2014},
url = {https://doi.org/10.1109/TASLP.2013.2294579},
doi = {10.1109/TASLP.2013.2294579},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/taslp/SpeedMH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/FreedmanCDKH14,
author = {David S. Freedman and
Howard I. Cohen and
Socrates Deligeorges and
Christian Karl and
Allyn E. Hubbard},
title = {An Analog {VLSI} Implementation of the Inner Hair Cell and Auditory
Nerve Using a Dual {AGC} Model},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {8},
number = {2},
pages = {240--256},
year = {2014},
url = {https://doi.org/10.1109/TBCAS.2013.2259165},
doi = {10.1109/TBCAS.2013.2259165},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbcas/FreedmanCDKH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcs/Howard14,
author = {David M. Howard},
title = {Determining membership with 2 simultaneous queries},
journal = {Theor. Comput. Sci.},
volume = {543},
pages = {112--119},
year = {2014},
url = {https://doi.org/10.1016/j.tcs.2014.05.020},
doi = {10.1016/J.TCS.2014.05.020},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcs/Howard14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/alife/HowardE14,
author = {Gerard David Howard and
Alberto Elfes},
title = {Evolving Spiking Networks for Turbulence-Tolerant Quadrotor Control},
booktitle = {Fourteenth International Conference on the Simulation and Synthesis
of Living Systems, {ALIFE} 2014, New York, NY, USA, July 30 - August
2, 2014},
pages = {431--438},
publisher = {{MIT} Press},
year = {2014},
url = {https://doi.org/10.7551/978-0-262-32621-6-ch071},
doi = {10.7551/978-0-262-32621-6-CH071},
timestamp = {Sun, 03 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/alife/HowardE14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/birthday/BarringerRG14,
author = {Howard Barringer and
David E. Rydeheard and
Dov M. Gabbay},
editor = {Nachum Dershowitz and
Ephraim Nissan},
title = {Reactivity and Grammars: An Exploration},
booktitle = {Language, Culture, Computation. Computing - Theory and Technology
- Essays Dedicated to Yaacov Choueka on the Occasion of His 75th Birthday,
Part {I}},
series = {Lecture Notes in Computer Science},
volume = {8001},
pages = {103--155},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-642-45321-2\_6},
doi = {10.1007/978-3-642-45321-2\_6},
timestamp = {Tue, 14 May 2019 10:00:52 +0200},
biburl = {https://dblp.org/rec/conf/birthday/BarringerRG14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chinasip/RugchatjaroenH14,
author = {Anocha Rugchatjaroen and
David M. Howard},
title = {Flexibility of cosine impedance function in 2-D Digital Waveguide
Mesh for plosive synthesis},
booktitle = {{IEEE} China Summit {\&} International Conference on Signal and
Information Processing, ChinaSIP 2014, Xi'an, China, July 9-13, 2014},
pages = {32--36},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ChinaSIP.2014.6889196},
doi = {10.1109/CHINASIP.2014.6889196},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/chinasip/RugchatjaroenH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icis/AndersonVKEH14,
author = {Bonnie Brinton Anderson and
Tony Vance and
C. Brock Kirwan and
David Eargle and
Seth Howard},
editor = {Michael D. Myers and
Detmar W. Straub},
title = {Users Aren't (Necessarily) Lazy: Using NeuroIS to Explain Habituation
to Security Warnings},
booktitle = {Proceedings of the International Conference on Information Systems
- Building a Better World through Information Systems, {ICIS} 2014,
Auckland, New Zealand, December 14-17, 2014},
publisher = {Association for Information Systems},
year = {2014},
url = {http://aisel.aisnet.org/icis2014/proceedings/ISSecurity/13},
timestamp = {Tue, 24 Mar 2015 08:43:46 +0100},
biburl = {https://dblp.org/rec/conf/icis/AndersonVKEH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/CullimoreHG14,
author = {Jason Cullimore and
Howard Hamilton and
David Gerhard},
title = {Directed Transitional Composition for Gaming and Adaptive Music Using
Q-Learning},
booktitle = {Music Technology meets Philosophy - From Digital Echos to Virtual
Ethos: Joint Proceedings of the 40th International Computer Music
Conference, {ICMC} 2014, and the 11th Sound and Music Computing Conference,
{SMC} 2014, Athens, Greece, September 14-20, 2014},
publisher = {Michigan Publishing},
year = {2014},
url = {https://hdl.handle.net/2027/spo.bbp2372.2014.051},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/CullimoreHG14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ondm/SamadiCWB14,
author = {Payman Samadi and
David M. Calhoun and
Howard Wang and
Keren Bergman},
title = {Accelerating cast traffic delivery in data centers leveraging physical
layer optics and {SDN}},
booktitle = {18th International Conference on Optical Network Design and Modeling,
{ONDM} 2014, Stockholm, Sweden, May 19-22, 2014},
pages = {73--77},
publisher = {{IEEE}},
year = {2014},
url = {https://ieeexplore.ieee.org/document/6855802/},
timestamp = {Wed, 07 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ondm/SamadiCWB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/BurgeGCHSVWA14,
author = {Janet E. Burge and
Gerald C. Gannod and
Mike Carter and
Alanna Howard and
Brian Schultz and
Mladen A. Vouk and
David Wright and
Paul V. Anderson},
editor = {J. D. Dougherty and
Kris Nagel and
Adrienne Decker and
Kurt Eiselt},
title = {Developing {CS/SE} students' communication abilities through a program-wide
framework},
booktitle = {The 45th {ACM} Technical Symposium on Computer Science Education,
{SIGCSE} 2014, Atlanta, GA, USA, March 5-8, 2014},
pages = {579--584},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2538862.2538984},
doi = {10.1145/2538862.2538984},
timestamp = {Tue, 23 Mar 2021 10:54:19 +0100},
biburl = {https://dblp.org/rec/conf/sigcse/BurgeGCHSVWA14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:conf/birthday/KwiatkowskaPQU14,
author = {Marta Z. Kwiatkowska and
David Parker and
Hongyang Qu and
Mateusz Ujma},
editor = {Andrei Voronkov and
Margarita V. Korovina},
title = {On Incremental Quantitative Verification for Probabilistic Systems},
booktitle = {{HOWARD-60:} {A} Festschrift on the Occasion of Howard Barringer's
60th Birthday},
series = {EPiC Series in Computing},
volume = {42},
pages = {245--257},
publisher = {EasyChair},
year = {2014},
url = {https://doi.org/10.29007/bmcf},
doi = {10.29007/BMCF},
timestamp = {Sun, 15 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/birthday/KwiatkowskaPQU14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:conf/birthday/RydeheardS14,
author = {David E. Rydeheard and
Jes{\'{u}}s H{\'{e}}ctor Dom{\'{\i}}nguez S{\'{a}}nchez},
editor = {Andrei Voronkov and
Margarita V. Korovina},
title = {A note on first-order reasoning for minimum models},
booktitle = {{HOWARD-60:} {A} Festschrift on the Occasion of Howard Barringer's
60th Birthday},
series = {EPiC Series in Computing},
volume = {42},
pages = {289--305},
publisher = {EasyChair},
year = {2014},
url = {https://doi.org/10.29007/5bvp},
doi = {10.29007/5BVP},
timestamp = {Sun, 15 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/birthday/RydeheardS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ce/MillardBHMH13,
author = {David E. Millard and
Kate Borthwick and
Yvonne Margaret Howard and
Patrick McSweeney and
Charlie Hargood},
title = {The HumBox: Changing educational practice around a learning resource
repository},
journal = {Comput. Educ.},
volume = {69},
pages = {287--302},
year = {2013},
url = {https://doi.org/10.1016/j.compedu.2013.07.028},
doi = {10.1016/J.COMPEDU.2013.07.028},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ce/MillardBHMH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbc/HowardBCAE13,
author = {Gerard David Howard and
Larry Bull and
Ben de Lacy Costello and
Andrew Adamatzky and
Victor Erokhin},
title = {A {SPICE} Model of the PEO-Pani memristor},
journal = {Int. J. Bifurc. Chaos},
volume = {23},
number = {6},
year = {2013},
url = {https://doi.org/10.1142/S0218127413501125},
doi = {10.1142/S0218127413501125},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbc/HowardBCAE13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jam/RenHJ13,
author = {Lei Ren and
David Howard and
Richard K. Jones},
title = {Mathematical Modelling of Biomechanical Interactions between Backpack
and Bearer during Load Carriage},
journal = {J. Appl. Math.},
volume = {2013},
pages = {349638:1--349638:12},
year = {2013},
url = {https://doi.org/10.1155/2013/349638},
doi = {10.1155/2013/349638},
timestamp = {Thu, 16 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jam/RenHJ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/GeAUGC13,
author = {Yaorong Ge and
David K. Ahn and
Bhagyashree Unde and
H. Donald Gage and
John Jeffrey Carr},
title = {Patient-controlled sharing of medical imaging data across unaffiliated
healthcare organizations},
journal = {J. Am. Medical Informatics Assoc.},
volume = {20},
number = {1},
pages = {157--163},
year = {2013},
url = {https://doi.org/10.1136/amiajnl-2012-001146},
doi = {10.1136/AMIAJNL-2012-001146},
timestamp = {Thu, 29 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/GeAUGC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/SheehanNDKBABGHOMSTTVJB13,
author = {Barbara Sheehan and
Lise E. Nigrovic and
Peter S. Dayan and
Nathan Kuppermann and
Dustin W. Ballard and
Evaline Alessandrini and
Lalit Bajaj and
Howard Goldberg and
Jeffrey Hoffman and
Steven R. Offerman and
Dustin G. Mark and
Marguerite Swietlik and
Eric Tham and
Leah Tzimenatos and
David R. Vinson and
Grant S. Jones and
Suzanne Bakken},
title = {Informing the design of clinical decision support services for evaluation
of children with minor blunt head trauma in the emergency department:
{A} sociotechnical analysis},
journal = {J. Biomed. Informatics},
volume = {46},
number = {5},
pages = {905--913},
year = {2013},
url = {https://doi.org/10.1016/j.jbi.2013.07.005},
doi = {10.1016/J.JBI.2013.07.005},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jbi/SheehanNDKBABGHOMSTTVJB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jeric/RabkinRKP13,
author = {Ariel Rabkin and
Charles Reiss and
Randy H. Katz and
David A. Patterson},
title = {Using clouds for MapReduce measurement assignments},
journal = {{ACM} Trans. Comput. Educ.},
volume = {13},
number = {1},
pages = {2:1--2:18},
year = {2013},
url = {https://doi.org/10.1145/2414446.2414448},
doi = {10.1145/2414446.2414448},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jeric/RabkinRKP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/YangSGELFBBSTRFHSBMG13,
author = {Wanjuan Yang and
Jorge Soares and
Patricia Greninger and
Elena J. Edelman and
Howard Lightfoot and
Simon A. Forbes and
Nidhi Bindal and
David Beare and
James A. Smith and
I. Richard Thompson and
Sridhar Ramaswamy and
P. Andrew Futreal and
Daniel A. Haber and
Michael R. Stratton and
Cyril Benes and
Ultan McDermott and
Mathew Garnett},
title = {Genomics of Drug Sensitivity in Cancer {(GDSC):} a resource for therapeutic
biomarker discovery in cancer cells},
journal = {Nucleic Acids Res.},
volume = {41},
number = {Database-Issue},
pages = {955--961},
year = {2013},
url = {https://doi.org/10.1093/nar/gks1111},
doi = {10.1093/NAR/GKS1111},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/YangSGELFBBSTRFHSBMG13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/KiranABCHFMT13,
author = {Swathi Kiran and
Ana In{\'{e}}s Ansaldo and
Roelien Bastiaanse and
Leora R. Cherney and
David Howard and
Yasmeen Faroqi{-}Shah and
Marcus Meinzer and
Cynthia K. Thompson},
title = {Neuroimaging in aphasia treatment research: Standards for establishing
the effects of treatment},
journal = {NeuroImage},
volume = {76},
pages = {428--435},
year = {2013},
url = {https://doi.org/10.1016/j.neuroimage.2012.10.011},
doi = {10.1016/J.NEUROIMAGE.2012.10.011},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/KiranABCHFMT13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/SpeedMH13,
author = {Matt Speed and
Damian T. Murphy and
David M. Howard},
title = {Three-Dimensional Digital Waveguide Mesh Simulation of Cylindrical
Vocal Tract Analogs},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {21},
number = {2},
pages = {449--455},
year = {2013},
url = {https://doi.org/10.1109/TASL.2012.2224342},
doi = {10.1109/TASL.2012.2224342},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taslp/SpeedMH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/trob/HowardBV13,
author = {Matthew Howard and
David J. Braun and
Sethu Vijayakumar},
title = {Transferring Human Impedance Behavior to Heterogeneous Variable Impedance
Actuators},
journal = {{IEEE} Trans. Robotics},
volume = {29},
number = {4},
pages = {847--862},
year = {2013},
url = {https://doi.org/10.1109/TRO.2013.2256311},
doi = {10.1109/TRO.2013.2256311},
timestamp = {Thu, 05 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/trob/HowardBV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aiide/ThueBH13,
author = {David Thue and
Vadim Bulitko and
Howard J. Hamilton},
editor = {Marc Cavazza and
Mei Si and
Alexander Zook},
title = {Implementation Cost and Efficiency for {AI} Experience Managers},
booktitle = {Intelligent Narrative Technologies VI, Papers from the 2013 {AIIDE}
Workshop, Boston, MA, USA, October 14-15, 2013},
series = {{AAAI} Technical Report},
volume = {{WS-13-21}},
publisher = {{AAAI}},
year = {2013},
url = {http://www.aaai.org/ocs/index.php/AIIDE/AIIDE13/paper/view/7461},
timestamp = {Tue, 08 Feb 2022 18:32:58 +0100},
biburl = {https://dblp.org/rec/conf/aiide/ThueBH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/KawamotoHBRMPNLMSSCSPSBHKVLMPLSR13,
author = {Kensaku Kawamoto and
Tonya Hongsermeier and
Aziz A. Boxwala and
Bryn Rhodes and
Alicia A. Morton and
Jamie Parker and
Claude J. Nanjo and
Victor C. Lee and
Bernadette K. Minton and
Davide Sottara and
Howard R. Strasberg and
Stephen Claypool and
Julie A. Scherer and
Matthew D. Pfeffer and
David Shields and
Keith W. Boone and
Peter J. Haug and
Thomson M. Kuhn and
Merideth C. Vida and
Anna Langhans and
Cem Mangir and
Erik Pupo and
Robert F. Lario and
David S. Shevlin and
Jacob Reider},
title = {Health eDecisions (HeD): a Public-Private Partnership to Develop and
Validate Standards to Enable Clinical Decision Support at Scale},
booktitle = {{AMIA} 2013, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 16-20, 2013},
publisher = {{AMIA}},
year = {2013},
url = {https://knowledge.amia.org/amia-55142-a2013e-1.580047/t-06-1.582200/f-006-1.582201/a-254-1.583244/a-256-1.583238},
timestamp = {Wed, 17 Apr 2024 11:47:55 +0200},
biburl = {https://dblp.org/rec/conf/amia/KawamotoHBRMPNLMSSCSPSBHKVLMPLSR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccece/GrantSD13,
author = {Howard A. Grant and
Eric Salt and
David E. Dodds},
title = {Geolocation of communications satellite interference},
booktitle = {26th {IEEE} Canadian Conference on Electrical and Computer Engineering
{CCECE} 2013, Regina, SK, Canada, May 5-8, 2013},
pages = {1--4},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/CCECE.2013.6567745},
doi = {10.1109/CCECE.2013.6567745},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/ccece/GrantSD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/flairs/HowardJCCB13,
author = {Ayanna M. Howard and
David Johnson and
Cristina Conati and
Frederick W. Chen and
Nikolaj S. Bj{\o}rner},
editor = {Chutima Boonthum{-}Denecke and
G. Michael Youngblood},
title = {Invited Talk Abstracts},
booktitle = {Proceedings of the Twenty-Sixth International Florida Artificial Intelligence
Research Society Conference, {FLAIRS} 2013, St. Pete Beach, Florida,
USA, May 22-24, 2013},
publisher = {{AAAI} Press},
year = {2013},
url = {http://www.aaai.org/ocs/index.php/FLAIRS/FLAIRS13/paper/view/7197},
timestamp = {Wed, 26 Oct 2022 08:35:16 +0200},
biburl = {https://dblp.org/rec/conf/flairs/HowardJCCB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/KirchhubelSH13,
author = {Christin Kirchh{\"{u}}bel and
Alex W. Stedmon and
David M. Howard},
editor = {Don Harris},
title = {Analyzing Deceptive Speech},
booktitle = {Engineering Psychology and Cognitive Ergonomics. Understanding Human
Cognition - 10th International Conference, {EPCE} 2013, Held as Part
of {HCI} International 2013, Las Vegas, NV, USA, July 21-26, 2013,
Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {8019},
pages = {134--141},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-39360-0\_15},
doi = {10.1007/978-3-642-39360-0\_15},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/hci/KirchhubelSH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/WatsonBHSBABHMGCK13,
author = {Benjamin Watson and
David Berube and
Nickolay Hristov and
Carol Strohecker and
Scott Betz and
Louise Allen and
Matthew Burczyk and
Amber Howard and
William Anthony McGee and
Matthew Gymer and
Daniel A. Ca{\~{n}}as and
Mark Kirstner},
editor = {Norbert A. Streitz and
Constantine Stephanidis},
title = {{VIA} - Visualizing Individual Actions to Develop a Sustainable Community
Culture through Cycling},
booktitle = {Distributed, Ambient, and Pervasive Interactions - First International
Conference, {DAPI} 2013, Held as Part of {HCI} International 2013,
Las Vegas, NV, USA, July 21-26, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8028},
pages = {316--325},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-39351-8\_35},
doi = {10.1007/978-3-642-39351-8\_35},
timestamp = {Fri, 02 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hci/WatsonBHSBABHMGCK13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/CarterABCDDFGGKLMMPTTVVX13,
author = {Nicholas P. Carter and
Aditya Agrawal and
Shekhar Borkar and
Romain Cledat and
Howard David and
Dave Dunning and
Joshua B. Fryman and
Ivan Ganev and
Roger A. Golliver and
Rob C. Knauerhase and
Richard Lethin and
Beno{\^{\i}}t Meister and
Asit K. Mishra and
Wilfred R. Pinfold and
Justin Teller and
Josep Torrellas and
Nicolas Vasilache and
Ganesh Venkatesh and
Jianping Xu},
title = {Runnemede: An architecture for Ubiquitous High-Performance Computing},
booktitle = {19th {IEEE} International Symposium on High Performance Computer Architecture,
{HPCA} 2013, Shenzhen, China, February 23-27, 2013},
pages = {198--209},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/HPCA.2013.6522319},
doi = {10.1109/HPCA.2013.6522319},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hpca/CarterABCDDFGGKLMMPTTVVX13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kbse/RegerBR13,
author = {Giles Reger and
Howard Barringer and
David E. Rydeheard},
editor = {Ewen Denney and
Tevfik Bultan and
Andreas Zeller},
title = {A pattern-based approach to parametric specification mining},
booktitle = {2013 28th {IEEE/ACM} International Conference on Automated Software
Engineering, {ASE} 2013, Silicon Valley, CA, USA, November 11-15,
2013},
pages = {658--663},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ASE.2013.6693129},
doi = {10.1109/ASE.2013.6693129},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/kbse/RegerBR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/BarkaiKFM13,
author = {Sharon Barkai and
Randy H. Katz and
Dino Farinacci and
David Meyer},
editor = {Nate Foster and
Rob Sherwood},
title = {Software defined flow-mapping for scaling virtualized network functions},
booktitle = {Proceedings of the Second {ACM} {SIGCOMM} Workshop on Hot Topics in
Software Defined Networking, HotSDN 2013, The Chinese University of
Hong Kong, Hong Kong, China, Friday, August 16, 2013},
pages = {149--150},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2491185.2491210},
doi = {10.1145/2491185.2491210},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigcomm/BarkaiKFM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/socialcom/RajasekarSLCCKCKZ13,
author = {Arcot Rajasekar and
Sharlini Sankaran and
Howard Lander and
Thomas M. Carsey and
Jonathan David Crabtree and
Hye{-}Chung Kum and
Merc{\`{e}} Crosas and
Gary King and
Justin Zhan},
title = {Sociometric Methods for Relevancy Analysis of Long Tail Science Data},
booktitle = {International Conference on Social Computing, SocialCom 2013, SocialCom/PASSAT/BigData/EconCom/BioMedCom
2013, Washington, DC, USA, 8-14 September, 2013},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/SocialCom.2013.6},
doi = {10.1109/SOCIALCOM.2013.6},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/socialcom/RajasekarSLCCKCKZ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uss/RotsosHSMMCC13,
author = {Charalampos Rotsos and
Heidi Howard and
David Sheets and
Richard Mortier and
Anil Madhavapeddy and
Amir Chaudhry and
Jon Crowcroft},
editor = {Jedidiah R. Crandall and
Joss Wright},
title = {Lost in the Edge: Finding Your Way with {DNSSEC} Signposts},
booktitle = {3rd {USENIX} Workshop on Free and Open Communications on the Internet,
{FOCI} '13, Washington, D.C., USA, August 13, 2013},
publisher = {{USENIX} Association},
year = {2013},
url = {https://www.usenix.org/conference/foci13/workshop-program/presentation/rotsos},
timestamp = {Mon, 01 Feb 2021 08:42:59 +0100},
biburl = {https://dblp.org/rec/conf/uss/RotsosHSMMCC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/AartsenA13,
author = {Mark G. Aartsen and
Rasha U. Abbasi and
Markus Ackermann and
Jenni Adams and
Juan Antonio Aguilar S{\'{a}}nchez and
Markus Ahlers and
David Altmann and
Carlos A. Arg{\"{u}}elles Delgado and
Jan Auffenberg and
Xinhua Bai and
Michael F. Baker and
Steven W. Barwick and
Volker Baum and
Ryan Bay and
James J. Beatty and
Julia K. Becker Tjus and
Karl{-}Heinz Becker and
Segev BenZvi and
Patrick Berghaus and
David Berley and
Elisa Bernardini and
Anna Bernhard and
David Z. Besson and
G. Binder and
Daniel Bindig and
Martin Bissok and
Erik Blaufuss and
Jan Blumenthal and
David J. Boersma and
Christian Bohm and
Debanjan Bose and
Sebastian B{\"{o}}ser and
Olga Botner and
Lionel Brayeur and
Hans{-}Peter Bretz and
Anthony M. Brown and
Ronald Bruijn and
James Casey and
Martin Casier and
Dmitry Chirkin and
Asen Christov and
Brian John Christy and
Ken Clark and
Lew Classen and
Fabian Clevermann and
Stefan Coenders and
Shirit Cohen and
Doug F. Cowen and
Angel H. Cruz Silva and
Matthias Danninger and
Jacob Daughhetee and
James C. Davis and
Melanie Day and
Catherine De Clercq and
Sam De Ridder and
Paolo Desiati and
Krijn D. de Vries and
Meike de With and
Tyce DeYoung and
Juan Carlos D{\'{\i}}az{-}V{\'{e}}lez and
Matthew Dunkman and
Ryan Eagan and
Benjamin Eberhardt and
Bj{\"{o}}rn Eichmann and
Jonathan Eisch and
Sebastian Euler and
Paul A. Evenson and
Oladipo O. Fadiran and
Ali R. Fazely and
Anatoli Fedynitch and
Jacob Feintzeig and
Tom Feusels and
Kirill Filimonov and
Chad Finley and
Tobias Fischer{-}Wasels and
Samuel Flis and
Anna Franckowiak and
Katharina Frantzen and
Tomasz Fuchs and
Thomas K. Gaisser and
Joseph S. Gallagher and
Lisa Marie Gerhardt and
Laura E. Gladstone and
Thorsten Gl{\"{u}}senkamp and
Azriel Goldschmidt and
Geraldina Golup and
Javier G. Gonz{\'{a}}lez and
Jordan A. Goodman and
Dariusz G{\'{o}}ra and
Dylan T. Grandmont and
Darren Grant and
Pavel Gretskov and
John C. Groh and
Andreas Gro{\ss} and
Chang Hyon Ha and
Abd Al Karim Haj Ismail and
Patrick Hallen and
Allan Hallgren and
Francis Halzen and
Kael D. Hanson and
Dustin Hebecker and
David Heereman and
Dirk Heinen and
Klaus Helbing and
Robert Eugene Hellauer III and
Stephanie Virginia Hickford and
Gary C. Hill and
Kara D. Hoffman and
Ruth Hoffmann and
Andreas Homeier and
Kotoyo Hoshina and
Feifei Huang and
Warren Huelsnitz and
Per Olof Hulth and
Klas Hultqvist and
Shahid Hussain and
Aya Ishihara and
Emanuel Jacobi and
John E. Jacobsen and
Kai Jagielski and
George S. Japaridze and
Kyle Jero and
Ola Jlelati and
Basho Kaminsky and
Alexander Kappes and
Timo Karg and
Albrecht Karle and
Matthew Kauer and
John Lawrence Kelley and
Joanna Kiryluk and
J. Kl{\"{a}}s and
Spencer R. Klein and
Jan{-}Hendrik K{\"{o}}hne and
Georges Kohnen and
Hermann Kolanoski and
Lutz K{\"{o}}pke and
Claudio Kopper and
Sandro Kopper and
D. Jason Koskinen and
Marek Kowalski and
Mark Krasberg and
Anna Kriesten and
Kai Michael Krings and
G{\"{o}}sta Kroll and
Jan Kunnen and
Naoko Kurahashi and
Takao Kuwabara and
Mathieu L. M. Labare and
Hagar Landsman and
Michael James Larson and
Mariola Lesiak{-}Bzdak and
Martin Leuermann and
Julia Leute and
Jan L{\"{u}}nemann and
Oscar A. Mac{\'{\i}}as{-}Ram{\'{\i}}rez and
James Madsen and
Giuliano Maggi and
Reina Maruyama and
Keiichi Mase and
Howard S. Matis and
Frank McNally and
Kevin James Meagher and
Martin Merck and
Gonzalo Merino Ar{\'{e}}valo and
Thomas Meures and
Sandra Miarecki and
Eike Middell and
Natalie Milke and
John Lester Miller and
Lars Mohrmann and
Teresa Montaruli and
Robert M. Morse and
Rolf Nahnhauer and
Uwe Naumann and
Hans Niederhausen and
Sarah C. Nowicki and
David R. Nygren and
Anna Obertacke and
Sirin Odrowski and
Alex Olivas and
Ahmad Omairat and
Aongus Starbuck {\'{O}} Murchadha and
Larissa Paul and
Joshua A. Pepper and
Carlos P{\'{e}}rez de los Heros and
Carl Pfendner and
Damian Pieloth and
Elisa Pinat and
Jonas Posselt and
P. Buford Price and
Gerald T. Przybylski and
Melissa Quinnan and
Leif R{\"{a}}del and
Ian Rae and
Mohamed Rameez and
Katherine Rawlins and
Peter Christian Redl and
Ren{\'{e}} Reimann and
Elisa Resconi and
Wolfgang Rhode and
Mathieu Ribordy and
Michael Richman and
Benedikt Riedel and
J. P. Rodrigues and
Carsten Rott and
Tim Ruhe and
Bakhtiyar Ruzybayev and
Dirk Ryckbosch and
Sabine M. Saba and
Heinz{-}Georg Sander and
Juan Marcos Santander and
Subir Sarkar and
Kai Schatto and
Florian Scheriau and
Torsten Schmidt and
Martin Schmitz and
Sebastian Schoenen and
Sebastian Sch{\"{o}}neberg and
Arne Sch{\"{o}}nwald and
Anne Schukraft and
Lukas Schulte and
David Schultz and
Olaf Schulz and
David Seckel and
Yolanda Sestayo de la Cerra and
Surujhdeo Seunarine and
Rezo Shanidze and
Chris Sheremata and
Miles W. E. Smith and
Dennis Soldin and
Glenn M. Spiczak and
Christian Spiering and
Michael Stamatikos and
Todor Stanev and
Nick A. Stanisha and
Alexander Stasik and
Thorsten Stezelberger and
Robert G. Stokstad and
Achim St{\"{o}}{\ss}l and
Erik A. Strahler and
Rickard Str{\"{o}}m and
Nora Linn Strotjohann and
Gregory W. Sullivan and
Henric Taavola and
Ignacio J. Taboada and
Alessio Tamburro and
Andreas Tepe and
Samvel Ter{-}Antonyan and
Gordana Tesic and
Serap Tilav and
Patrick A. Toale and
Moriah Natasha Tobin and
Simona Toscano and
Maria Tselengidou and
Elisabeth Unger and
Marcel Usner and
Sofia Vallecorsa and
Nick van Eijndhoven and
Arne Van Overloop and
Jakob van Santen and
Markus Vehring and
Markus Voge and
Matthias Vraeghe and
Christian Walck and
Tilo Waldenmaier and
Marius Wallraff and
Christopher N. Weaver and
Mark T. Wellons and
Christopher H. Wendt and
Stefan Westerhoff and
Nathan Whitehorn and
Klaus Wiebe and
Christopher Wiebusch and
Dawn R. Williams and
Henrike Wissing and
Martin Wolf and
Terri R. Wood and
Kurt Woschnagg and
Donglian Xu and
Xianwu Xu and
Juan Pablo Y{\'{a}}{\~{n}}ez Garza and
Gaurang B. Yodh and
Shigeru Yoshida and
Pavel Zarzhitsky and
Jan Ziemann and
Simon Zierke and
Marcel Zoll},
title = {The IceProd Framework: Distributed Data Processing for the IceCube
Neutrino Observatory},
journal = {CoRR},
volume = {abs/1311.5904},
year = {2013},
url = {http://arxiv.org/abs/1311.5904},
eprinttype = {arXiv},
eprint = {1311.5904},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/AartsenA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1305-6164,
author = {Ron Aharoni and
Pierre Charbit and
David M. Howard},
title = {On a Generalization of the Ryser-Brualdi-Stein Conjecture},
journal = {CoRR},
volume = {abs/1305.6164},
year = {2013},
url = {http://arxiv.org/abs/1305.6164},
eprinttype = {arXiv},
eprint = {1305.6164},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1305-6164.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/arobots/BraunHV12,
author = {David J. Braun and
Matthew Howard and
Sethu Vijayakumar},
title = {Optimal variable stiffness control: formulation and application to
explosive movement tasks},
journal = {Auton. Robots},
volume = {33},
number = {3},
pages = {237--253},
year = {2012},
url = {https://doi.org/10.1007/s10514-012-9302-3},
doi = {10.1007/S10514-012-9302-3},
timestamp = {Thu, 05 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/arobots/BraunHV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/TengIPWMCKFEEL12,
author = {Mingxiang Teng and
Shoji Ichikawa and
Leah R. Padgett and
Yadong Wang and
Matthew E. Mort and
David N. Cooper and
Daniel L. Koller and
Tatiana Foroud and
Howard J. Edenberg and
Michael J. Econs and
Yunlong Liu},
title = {regSNPs: a strategy for prioritizing regulatory single nucleotide
substitutions},
journal = {Bioinform.},
volume = {28},
number = {14},
pages = {1879--1886},
year = {2012},
url = {https://doi.org/10.1093/bioinformatics/bts275},
doi = {10.1093/BIOINFORMATICS/BTS275},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/TengIPWMCKFEEL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bspc/HowardDB12,
author = {David M. Howard and
Helena Daffern and
Jude Brereton},
title = {Quantitative voice quality analyses of a soprano singing early music
in three different performance styles},
journal = {Biomed. Signal Process. Control.},
volume = {7},
number = {1},
pages = {58--64},
year = {2012},
url = {https://doi.org/10.1016/j.bspc.2011.05.013},
doi = {10.1016/J.BSPC.2011.05.013},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bspc/HowardDB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cgf/HulusicHDTWHC12,
author = {Vedad Hulusic and
Carlo Harvey and
Kurt Debattista and
Nicolas Tsingos and
Steve Walker and
David M. Howard and
Alan Chalmers},
title = {Acoustic Rendering and Auditory-Visual Cross-Modal Perception and
Interaction},
journal = {Comput. Graph. Forum},
volume = {31},
number = {1},
pages = {102--131},
year = {2012},
url = {https://doi.org/10.1111/j.1467-8659.2011.02086.x},
doi = {10.1111/J.1467-8659.2011.02086.X},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cgf/HulusicHDTWHC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cse/HowardPMJ12,
author = {Jessica Howard and
Omar Padron and
Patricia Morreale and
David A. Joiner},
title = {Applications of Computational Science: Data-Intensive Computing for
Student Projects},
journal = {Comput. Sci. Eng.},
volume = {14},
number = {2},
pages = {84--89},
year = {2012},
url = {https://doi.org/10.1109/MCSE.2012.18},
doi = {10.1109/MCSE.2012.18},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cse/HowardPMJ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/HowardS12,
author = {David M. Howard and
Clifford D. Smyth},
title = {Revolutionaries and Spies},
journal = {Discret. Math.},
volume = {312},
number = {22},
pages = {3384--3391},
year = {2012},
url = {https://doi.org/10.1016/j.disc.2012.08.001},
doi = {10.1016/J.DISC.2012.08.001},
timestamp = {Wed, 09 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dm/HowardS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dt/Dawson-HaggertyOTCK12,
author = {Stephen Dawson{-}Haggerty and
Jorge Ortiz and
Jason Trager and
David E. Culler and
Randy H. Katz},
title = {Energy Savings and the "Software-Defined" Building},
journal = {{IEEE} Des. Test Comput.},
volume = {29},
number = {4},
pages = {56--57},
year = {2012},
url = {https://doi.org/10.1109/MDT.2012.2202566},
doi = {10.1109/MDT.2012.2202566},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dt/Dawson-HaggertyOTCK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gac/SnodgrassDLFMBH12,
author = {Jeffrey G. Snodgrass and
H. J. Fran{\c{c}}ois Dengah II and
Michael G. Lacy and
Jesse Fagan and
David Most and
Michael Blank and
Lahoma Howard and
Chad R. Kershner and
Gregory Krambeer and
Alissa Leavitt{-}Reynolds and
Adam Reynolds and
Jessica Vyvial{-}Larson and
Josh Whaley and
Benjamin Wintersteen},
title = {Restorative Magical Adventure or Warcrack? Motivated {MMO} Play and
the Pleasures and Perils of Online Experience},
journal = {Games Cult.},
volume = {7},
number = {1},
pages = {3--28},
year = {2012},
url = {https://doi.org/10.1177/1555412012440312},
doi = {10.1177/1555412012440312},
timestamp = {Wed, 17 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/gac/SnodgrassDLFMBH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbc/ErokhinHA12,
author = {Victor Erokhin and
Gerard David Howard and
Andrew Adamatzky},
title = {Organic memristor Devices for Logic Elements with Memory},
journal = {Int. J. Bifurc. Chaos},
volume = {22},
number = {11},
year = {2012},
url = {https://doi.org/10.1142/S0218127412502835},
doi = {10.1142/S0218127412502835},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbc/ErokhinHA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WarnockCCWMGSCDBPRPSMMNRH12,
author = {James D. Warnock and
Yiu{-}Hing Chan and
Sean M. Carey and
Huajun Wen and
Patrick J. Meaney and
Guenter Gerwig and
Howard H. Smith and
Yuen H. Chan and
John Davis and
Paul Bunce and
Antonio Pelella and
Daniel Rodko and
Pradip Patel and
Thomas Strach and
Doug Malone and
Frank Malgioglio and
Jos{\'{e}} Neves and
David L. Rude and
William V. Huott},
title = {Circuit and Physical Design Implementation of the Microprocessor Chip
for the zEnterprise System},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {151--163},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2011.2169308},
doi = {10.1109/JSSC.2011.2169308},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WarnockCCWMGSCDBPRPSMMNRH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HowardP12,
author = {Mary F. Howard and
David Poeppel},
title = {The neuromagnetic response to spoken sentences: Co-modulation of theta
band amplitude and phase},
journal = {NeuroImage},
volume = {60},
number = {4},
pages = {2118--2127},
year = {2012},
url = {https://doi.org/10.1016/j.neuroimage.2012.02.028},
doi = {10.1016/J.NEUROIMAGE.2012.02.028},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/HowardP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/RichardsGMMSH12,
author = {David M. Richards and
Emma Greer and
Azahara C. Martin and
Graham Moore and
Peter J. Shaw and
Martin Howard},
title = {Quantitative Dynamics of Telomere Bouquet Formation},
journal = {PLoS Comput. Biol.},
volume = {8},
number = {12},
year = {2012},
url = {https://doi.org/10.1371/journal.pcbi.1002812},
doi = {10.1371/JOURNAL.PCBI.1002812},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/RichardsGMMSH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/RichardsHFBH12,
author = {David M. Richards and
Antje M. Hempel and
Klas Fl{\"{a}}rdh and
Mark J. Buttner and
Martin Howard},
title = {Mechanistic Basis of Branch-Site Selection in Filamentous Bacteria},
journal = {PLoS Comput. Biol.},
volume = {8},
number = {3},
year = {2012},
url = {https://doi.org/10.1371/journal.pcbi.1002423},
doi = {10.1371/JOURNAL.PCBI.1002423},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/RichardsHFBH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/speech/HowardAF12,
author = {David M. Howard and
Evelyn Abberton and
Adrian Fourcin},
title = {Disordered voice measurement and auditory analysis},
journal = {Speech Commun.},
volume = {54},
number = {5},
pages = {611--621},
year = {2012},
url = {https://doi.org/10.1016/j.specom.2011.03.008},
doi = {10.1016/J.SPECOM.2011.03.008},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/speech/HowardAF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/speech/HowardAF12a,
author = {David M. Howard and
Evelyn Abberton and
Adrian Fourcin},
title = {Erratum to "Disordered voice measurement and auditory analysis" [Speech
Comm. 54(2012) 611-621]},
journal = {Speech Commun.},
volume = {54},
number = {6},
pages = {844},
year = {2012},
url = {https://doi.org/10.1016/j.specom.2012.03.007},
doi = {10.1016/J.SPECOM.2012.03.007},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/speech/HowardAF12a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tec/HowardGBCA12,
author = {Gerard David Howard and
Ella Gale and
Larry Bull and
Ben de Lacy Costello and
Andy Adamatzky},
title = {Evolution of Plastic Learning in Spiking Networks via Memristive Connections},
journal = {{IEEE} Trans. Evol. Comput.},
volume = {16},
number = {5},
pages = {711--729},
year = {2012},
url = {https://doi.org/10.1109/TEVC.2011.2170199},
doi = {10.1109/TEVC.2011.2170199},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tec/HowardGBCA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/usenix-login/ChenGZJK12,
author = {Yanpei Chen and
Rean Griffith and
David Zats and
Anthony D. Joseph and
Randy H. Katz},
title = {Understanding {TCP} Incast and Its Implications for Big Data Workloads},
journal = {login Usenix Mag.},
volume = {37},
number = {3},
year = {2012},
url = {https://www.usenix.org/publications/login/june-2012/understanding-tcp-incast},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/usenix-login/ChenGZJK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/KawamotoJWHPFSSHLJRCFAC12,
author = {Kensaku Kawamoto and
Jason R. Jacobs and
Brandon M. Welch and
Vojtech Huser and
Marilyn D. Paterno and
Guilherme Del Fiol and
David Shields and
Howard R. Strasberg and
Peter J. Haug and
Zhijing Liu and
Robert A. Jenders and
David Rowed and
Daryl Chertcoff and
Karsten Fehre and
Klaus{-}Peter Adlassnig and
Arthur Curtis},
title = {Clinical Information System Services and Capabilities Desired for
Scalable, Standards-Based, Service-oriented Decision Support: Consensus
Assessment of the Health Level 7 Clinical Decision Support Work Group},
booktitle = {{AMIA} 2012, American Medical Informatics Association Annual Symposium,
Chicago, Illinois, USA, November 3-7, 2012},
publisher = {{AMIA}},
year = {2012},
url = {https://knowledge.amia.org/amia-55142-a2012a-1.636547/t-003-1.640625/f-001-1.640626/a-053-1.641075/a-054-1.641072},
timestamp = {Wed, 17 Apr 2024 11:48:03 +0200},
biburl = {https://dblp.org/rec/conf/amia/KawamotoJWHPFSSHLJRCFAC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eisic/JohnsonH12,
author = {David E. A. Johnson and
Newton Howard},
editor = {Nasrullah Memon and
Daniel Zeng},
title = {Network Intelligence: An Emerging Discipline},
booktitle = {2012 European Intelligence and Security Informatics Conference, {EISIC}
2012, Odense, Denmark, August 22-24, 2012},
pages = {287--288},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/EISIC.2012.52},
doi = {10.1109/EISIC.2012.52},
timestamp = {Tue, 16 May 2023 16:54:39 +0200},
biburl = {https://dblp.org/rec/conf/eisic/JohnsonH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eurogp/HowardBA12,
author = {Gerard David Howard and
Larry Bull and
Andrew Adamatzky},
editor = {Alberto Moraglio and
Sara Silva and
Krzysztof Krawiec and
Penousal Machado and
Carlos Cotta},
title = {Cartesian Genetic Programming for Memristive Logic Circuits},
booktitle = {Genetic Programming - 15th European Conference, EuroGP 2012, M{\'{a}}laga,
Spain, April 11-13, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7244},
pages = {37--48},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-29139-5\_4},
doi = {10.1007/978-3-642-29139-5\_4},
timestamp = {Sun, 25 Oct 2020 22:37:02 +0100},
biburl = {https://dblp.org/rec/conf/eurogp/HowardBA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fm/BarringerFHRR12,
author = {Howard Barringer and
Yli{\`{e}}s Falcone and
Klaus Havelund and
Giles Reger and
David E. Rydeheard},
editor = {Dimitra Giannakopoulou and
Dominique M{\'{e}}ry},
title = {Quantified Event Automata: Towards Expressive and Efficient Runtime
Monitors},
booktitle = {{FM} 2012: Formal Methods - 18th International Symposium, Paris, France,
August 27-31, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7436},
pages = {68--84},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-32759-9\_9},
doi = {10.1007/978-3-642-32759-9\_9},
timestamp = {Tue, 14 May 2019 10:00:46 +0200},
biburl = {https://dblp.org/rec/conf/fm/BarringerFHRR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/grapp/PettiferHBEL12,
author = {Steve Pettifer and
Toby Howard and
Benjamin James Blundell and
David Edwards and
Ilan Lieberman},
editor = {Paul Richard and
Martin Kraus and
Robert S. Laramee and
Jos{\'{e}} Braz},
title = {An Immersive Virtual Environment for Phantom Limb Pain Rehabilitation},
booktitle = {{GRAPP} {\&} {IVAPP} 2012: Proceedings of the International Conference
on Computer Graphics Theory and Applications and International Conference
on Information Visualization Theory and Applications, Rome, Italy,
24-26 February, 2012},
pages = {426--433},
publisher = {SciTePress},
year = {2012},
url = {https://doi.org/10.5220/0003831704260433},
doi = {10.5220/0003831704260433},
timestamp = {Tue, 05 Mar 2024 11:15:19 +0100},
biburl = {https://dblp.org/rec/conf/grapp/PettiferHBEL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccps/TanejaKC12,
author = {Jay Taneja and
Randy H. Katz and
David E. Culler},
title = {Defining {CPS} Challenges in a Sustainable Electricity Grid},
booktitle = {2012 {IEEE/ACM} Third International Conference on Cyber-Physical Systems,
{ICCPS} 2012, Beijing, China, April 17-19, 2012},
pages = {119--128},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/ICCPS.2012.20},
doi = {10.1109/ICCPS.2012.20},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccps/TanejaKC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceac/ErcanGD12,
author = {Furkan Ercan and
Neven Abou Gazala and
Howard David},
title = {An integrated approach to system-level {CPU} and memory energy efficiency
on computing systems},
booktitle = {International Conference on Energy Aware Computing, {ICEAC} 2012,
Guzelyurt, Cyprus, December 3-5, 2012},
pages = {1--6},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICEAC.2012.6471018},
doi = {10.1109/ICEAC.2012.6471018},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iceac/ErcanGD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/milcom/DuboisGLV12,
author = {David Dubois and
Howard Gans and
Terence Lei and
Rolando Ventura},
title = {Front End Mission Modeling},
booktitle = {31st {IEEE} Military Communications Conference, {MILCOM} 2012, Orlando,
FL, USA, October 29 - November 1, 2012},
pages = {1--6},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/MILCOM.2012.6415658},
doi = {10.1109/MILCOM.2012.6415658},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/milcom/DuboisGLV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/milcom/SwainFM12,
author = {Darcy Swain and
David Fritz and
Howard McDonald},
title = {A phased approach to policy-based Spectrum operations},
booktitle = {31st {IEEE} Military Communications Conference, {MILCOM} 2012, Orlando,
FL, USA, October 29 - November 1, 2012},
pages = {1--6},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/MILCOM.2012.6415754},
doi = {10.1109/MILCOM.2012.6415754},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/milcom/SwainFM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ni/SheehanNDKBABGHOMSTTV12,
author = {Barbara Sheehan and
Lise E. Nigrovic and
Peter S. Dayan and
Nathan Kuppermann and
Dustin W. Ballard and
Evaline Alessandrini and
Lalit Bajaj and
Howard Goldberg and
Jeffrey Hoffman and
Steven R. Offerman and
Dustin G. Mark and
Marguerite Swietlik and
Eric Tham and
Leah Tzimenatos and
David R. Vinson},
editor = {Kaija Saranto and
Charlotte A. Weaver and
Polun Chang},
title = {An Activity Theory Based Analysis of Work Activities in the Emergency
Department},
booktitle = {Nursing Informatics 2014 - East Meets West eSMART+ - Proceedings of
the 12th International Congress on Nursing Informatics, Taipei, Taiwan,
June 21-25, 2014},
series = {Studies in Health Technology and Informatics},
volume = {201},
publisher = {{IOS} Press},
year = {2012},
url = {http://knowledge.amia.org/amia-55142-cni2012a-1.641359/t-005-1.642724/f-001-1.642725/a-299-1.642863/a-300-1.642860},
timestamp = {Wed, 29 Mar 2017 16:45:22 +0200},
biburl = {https://dblp.org/rec/conf/ni/SheehanNDKBABGHOMSTTV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scipy/PrasadHKF12,
author = {Aakash Prasad and
David Howard and
Shoaib Kamil and
Armando Fox},
editor = {Aron Ahmadia and
K. Jarrod Millman and
St{\'{e}}fan van der Walt},
title = {Parallel High Performance Bootstrapping in Python},
booktitle = {Proceedings of the 11th Python in Science Conference 2012 (SciPy 2012),
Austin, Texas, July 16--21, 2012, 2012},
pages = {1--5},
publisher = {scipy.org},
year = {2012},
url = {https://doi.org/10.25080/Majora-54c7f2c8-000},
doi = {10.25080/MAJORA-54C7F2C8-000},
timestamp = {Thu, 11 May 2023 17:08:22 +0200},
biburl = {https://dblp.org/rec/conf/scipy/PrasadHKF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/ZatsDMBK12,
author = {David Zats and
Tathagata Das and
Prashanth Mohan and
Dhruba Borthakur and
Randy H. Katz},
editor = {Lars Eggert and
J{\"{o}}rg Ott and
Venkata N. Padmanabhan and
George Varghese},
title = {DeTail: reducing the flow completion time tail in datacenter networks},
booktitle = {{ACM} {SIGCOMM} 2012 Conference, {SIGCOMM} '12, Helsinki, Finland
- August 13 - 17, 2012},
pages = {139--150},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2342356.2342390},
doi = {10.1145/2342356.2342390},
timestamp = {Mon, 22 Mar 2021 16:55:03 +0100},
biburl = {https://dblp.org/rec/conf/sigcomm/ZatsDMBK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/RabkinRKP12,
author = {Ariel Rabkin and
Charles Reiss and
Randy H. Katz and
David A. Patterson},
editor = {Laurie A. Smith King and
David R. Musicant and
Tracy Camp and
Paul T. Tymann},
title = {Experiences teaching MapReduce in the cloud},
booktitle = {Proceedings of the 43rd {ACM} technical symposium on Computer science
education, {SIGCSE} 2012, Raleigh, NC, USA, February 29 - March 3,
2012},
pages = {601--606},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2157136.2157310},
doi = {10.1145/2157136.2157310},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigcse/RabkinRKP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1201-3249,
author = {Gerard David Howard and
Larry Bull and
Pier Luca Lanzi},
title = {A Spiking Neural Learning Classifier System},
journal = {CoRR},
volume = {abs/1201.3249},
year = {2012},
url = {http://arxiv.org/abs/1201.3249},
eprinttype = {arXiv},
eprint = {1201.3249},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1201-3249.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1212-3425,
author = {Victor Erokhin and
Gerard David Howard and
Andrew Adamatzky},
title = {Organic Memristor Devices for Logic Elements with Memory},
journal = {CoRR},
volume = {abs/1212.3425},
year = {2012},
url = {http://arxiv.org/abs/1212.3425},
eprinttype = {arXiv},
eprint = {1212.3425},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1212-3425.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1212-3441,
author = {Gerard David Howard and
Ella Gale and
Larry Bull and
Ben de Lacy Costello and
Andy Adamatzky},
title = {Evolution of Plastic Learning in Spiking Networks via Memristive Connections},
journal = {CoRR},
volume = {abs/1212.3441},
year = {2012},
url = {http://arxiv.org/abs/1212.3441},
eprinttype = {arXiv},
eprint = {1212.3441},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1212-3441.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/ethos/Howard11,
author = {Gerard David Howard},
title = {Constructivist and spiking neural learning classifier systems},
school = {University of the West of England, Bristol, {UK}},
year = {2011},
url = {https://ethos.bl.uk/OrderDetails.do?uin=uk.bl.ethos.573442},
timestamp = {Tue, 05 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/ethos/Howard11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ccr/KrioukovMAKCK11,
author = {Andrew Krioukov and
Prashanth Mohan and
Sara Alspaugh and
Laura Keys and
David E. Culler and
Randy H. Katz},
title = {NapSAC: design and implementation of a power-proportional web cluster},
journal = {Comput. Commun. Rev.},
volume = {41},
number = {1},
pages = {102--108},
year = {2011},
url = {https://doi.org/10.1145/1925861.1925878},
doi = {10.1145/1925861.1925878},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ccr/KrioukovMAKCK11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/da/CaswellHP11,
author = {David J. Caswell and
Ronald A. Howard and
Marie{-}Elisabeth Pat{\'{e}}{-}Cornell},
title = {Analysis of National Strategies to Counter a Country's Nuclear Weapons
Program},
journal = {Decis. Anal.},
volume = {8},
number = {1},
pages = {30--45},
year = {2011},
url = {https://doi.org/10.1287/deca.1110.0198},
doi = {10.1287/DECA.1110.0198},
timestamp = {Wed, 22 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/da/CaswellHP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/debu/KrioukovGACCK11,
author = {Andrew Krioukov and
Christoph Goebel and
Sara Alspaugh and
Yanpei Chen and
David E. Culler and
Randy H. Katz},
title = {Integrating Renewable Energy Using Data Analytics Systems: Challenges
and Opportunities},
journal = {{IEEE} Data Eng. Bull.},
volume = {34},
number = {1},
pages = {3--11},
year = {2011},
url = {http://sites.computer.org/debull/A11mar/IntegratingRenewableEnergy\_final1.pdf},
timestamp = {Tue, 10 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/debu/KrioukovGACCK11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/HowardY11,
author = {David M. Howard and
Stephen J. Young},
title = {When linear and weak discrepancy are equal},
journal = {Discret. Math.},
volume = {311},
number = {4},
pages = {252--257},
year = {2011},
url = {https://doi.org/10.1016/j.disc.2010.11.003},
doi = {10.1016/J.DISC.2010.11.003},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dm/HowardY11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dsp/PalmerPSMSH11,
author = {James Palmer and
Simon Palumbo and
Ashley Summers and
David Merrett and
Stephen J. Searle and
Stephen D. Howard},
title = {An overview of an illuminator of opportunity passive radar research
project and its signal processing research directions},
journal = {Digit. Signal Process.},
volume = {21},
number = {5},
pages = {593--599},
year = {2011},
url = {https://doi.org/10.1016/j.dsp.2011.01.002},
doi = {10.1016/J.DSP.2011.01.002},
timestamp = {Wed, 29 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dsp/PalmerPSMSH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijpop/StedmonHK11,
author = {Alex W. Stedmon and
David M. Howard and
Christin Kirchh{\"{u}}bel},
title = {Developing Speech Input for Virtual Applications: {A} Human Factors
Perspective},
journal = {Int. J. People Oriented Program.},
volume = {1},
number = {2},
pages = {50--65},
year = {2011},
url = {https://doi.org/10.4018/ijpop.2011070103},
doi = {10.4018/IJPOP.2011070103},
timestamp = {Sun, 21 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijpop/StedmonHK11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcamd/HowardTM11,
author = {Brittany L. Howard and
Philip E. Thompson and
David T. Manallack},
title = {Active site similarity between human and Plasmodium falciparum phosphodiesterases:
considerations for antimalarial drug design},
journal = {J. Comput. Aided Mol. Des.},
volume = {25},
number = {8},
pages = {753--762},
year = {2011},
url = {https://doi.org/10.1007/s10822-011-9458-5},
doi = {10.1007/S10822-011-9458-5},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcamd/HowardTM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcphy/ElmanMS11,
author = {Howard C. Elman and
Milan D. Mihajlovic and
David J. Silvester},
title = {Fast iterative solvers for buoyancy driven flow problems},
journal = {J. Comput. Phys.},
volume = {230},
number = {10},
pages = {3900--3914},
year = {2011},
url = {https://doi.org/10.1016/j.jcp.2011.02.014},
doi = {10.1016/J.JCP.2011.02.014},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcphy/ElmanMS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/HuntsbergerAHT11,
author = {Terry Huntsberger and
Hrand Aghazarian and
Andrew Howard and
David C. Trotz},
title = {Stereo vision-based navigation for autonomous surface vessels},
journal = {J. Field Robotics},
volume = {28},
number = {1},
pages = {3--18},
year = {2011},
url = {https://doi.org/10.1002/rob.20380},
doi = {10.1002/ROB.20380},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfr/HuntsbergerAHT11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/PetersonLHSP11,
author = {David A. Peterson and
Daniel T. Lotz and
Eric Halgren and
Terrence J. Sejnowski and
Howard Poizner},
title = {Choice modulates the neural dynamics of prediction error processing
during rewarded learning},
journal = {NeuroImage},
volume = {54},
number = {2},
pages = {1385--1394},
year = {2011},
url = {https://doi.org/10.1016/j.neuroimage.2010.09.051},
doi = {10.1016/J.NEUROIMAGE.2010.09.051},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/PetersonLHSP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamsc/TuminaroBCDEFJKKKLMMSW11,
author = {Ray Tuminaro and
Michele Benzi and
Xiao{-}Chuan Cai and
Iain Duff and
Howard C. Elman and
Roland Freund and
Kirk E. Jordan and
Tim Kelley and
David E. Keyes and
Misha Elena Kilmer and
Sven Leyffer and
Tom Manteuffel and
Steve F. McCormick and
David J. Silvester and
Homer F. Walker},
title = {Special Section: 2010 Copper Mountain Conference},
journal = {{SIAM} J. Sci. Comput.},
volume = {33},
number = {5},
pages = {2685},
year = {2011},
url = {https://doi.org/10.1137/SJOCE3000033000005002685000001},
doi = {10.1137/SJOCE3000033000005002685000001},
timestamp = {Mon, 26 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamsc/TuminaroBCDEFJKKKLMMSW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/suscom/KatzCSACDDHJKKL11,
author = {Randy H. Katz and
David E. Culler and
Seth Sanders and
Sara Alspaugh and
Yanpei Chen and
Stephen Dawson{-}Haggerty and
Prabal Dutta and
Mike He and
Xiaofan Jiang and
Laura Keys and
Andrew Krioukov and
Ken Lutz and
Jorge Ortiz and
Prashanth Mohan and
Evan Reutzel and
Jay Taneja and
Jeff Hsu and
Sushant Shankar},
title = {An information-centric energy infrastructure: The Berkeley view},
journal = {Sustain. Comput. Informatics Syst.},
volume = {1},
number = {1},
pages = {7--22},
year = {2011},
url = {https://doi.org/10.1016/j.suscom.2010.10.001},
doi = {10.1016/J.SUSCOM.2010.10.001},
timestamp = {Thu, 20 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/suscom/KatzCSACDDHJKKL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/GrahnDH11,
author = {Dennis A. Grahn and
Howard L. Davidson and
H. Craig Heller},
title = {Incorporating Variable Vascular Heat Exchangers Into Models Of Human
Thermoregulation},
booktitle = {Computational Physiology, Papers from the 2011 {AAAI} Spring Symposium,
Technical Report SS-11-04, Stanford, California, USA, March 21-23,
2011},
publisher = {{AAAI}},
year = {2011},
url = {http://www.aaai.org/ocs/index.php/SSS/SSS11/paper/view/2405},
timestamp = {Mon, 13 Feb 2012 17:06:00 +0100},
biburl = {https://dblp.org/rec/conf/aaaiss/GrahnDH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/alenex/BreslauDDGHJKRS11,
author = {Lee Breslau and
Ilias Diakonikolas and
Nick G. Duffield and
Yu Gu and
Mohammad Taghi Hajiaghayi and
David S. Johnson and
Howard J. Karloff and
Mauricio G. C. Resende and
Subhabrata Sen},
editor = {Matthias M{\"{u}}ller{-}Hannemann and
Renato Fonseca F. Werneck},
title = {Disjoint-Path Facility Location: Theory and Practice},
booktitle = {Proceedings of the Thirteenth Workshop on Algorithm Engineering and
Experiments, {ALENEX} 2011, Holiday Inn San Francisco Golden Gateway,
San Francisco, California, USA, January 22, 2011},
pages = {60--74},
publisher = {{SIAM}},
year = {2011},
url = {https://doi.org/10.1137/1.9781611972917.7},
doi = {10.1137/1.9781611972917.7},
timestamp = {Wed, 14 Nov 2018 10:52:08 +0100},
biburl = {https://dblp.org/rec/conf/alenex/BreslauDDGHJKRS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ats/GrayKWB11,
author = {Carl Gray and
David C. Keezer and
Howard Wang and
Keren Bergman},
title = {Burst-Mode Transmission and Data Recovery for Multi-GHz Optical Packet
Switching Network Testing},
booktitle = {Proceedings of the 20th {IEEE} Asian Test Symposium, {ATS} 2011, New
Delhi, India, November 20-23, 2011},
pages = {545--551},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ATS.2011.81},
doi = {10.1109/ATS.2011.81},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ats/GrayKWB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eurographics/HulusicHTDWHC11,
author = {Vedad Hulusic and
Carlo Harvey and
Nicolas Tsingos and
Kurt Debattista and
Steve Walker and
David M. Howard and
Alan Chalmers},
editor = {Nigel W. John and
Brian Wyvill},
title = {Acoustic Rendering and Auditory-Visual Cross-Modal Perception and
Interaction},
booktitle = {32nd Annual Conference of the European Association for Computer Graphics,
Eurographics 2011 - State of the Art Reports, Llandudno, UK, April
11-15, 2011},
pages = {151--184},
publisher = {Eurographics Association},
year = {2011},
url = {https://doi.org/10.2312/EG2011/stars/151-184},
doi = {10.2312/EG2011/STARS/151-184},
timestamp = {Fri, 03 Jul 2020 16:45:59 +0200},
biburl = {https://dblp.org/rec/conf/eurographics/HulusicHTDWHC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/HowardGBCA11,
author = {Gerard David Howard and
Ella Gale and
Larry Bull and
Benjamin de Lacy Costello and
Andrew Adamatzky},
editor = {Natalio Krasnogor and
Pier Luca Lanzi},
title = {Evolving spiking networks with variable memristors},
booktitle = {13th Annual Genetic and Evolutionary Computation Conference, {GECCO}
2011, Proceedings, Dublin, Ireland, July 12-16, 2011},
pages = {1275--1282},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2001576.2001748},
doi = {10.1145/2001576.2001748},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gecco/HowardGBCA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/HowardK11,
author = {David M. Howard and
Christin Kirchh{\"{u}}bel},
editor = {Don Harris},
title = {Acoustic Correlates of Deceptive Speech - An Exploratory Study},
booktitle = {Engineering Psychology and Cognitive Ergonomics - 9th International
Conference, {EPCE} 2011, Held as Part of {HCI} International 2011,
Orlando, FL, USA, July 9-14, 2011. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6781},
pages = {28--37},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-21741-8\_4},
doi = {10.1007/978-3-642-21741-8\_4},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/hci/HowardK11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icac/DavidFGHM11,
author = {Howard David and
Chris Fallin and
Eugene Gorbatov and
Ulf R. Hanebutte and
Onur Mutlu},
editor = {Hartmut Schmeck and
Wolfgang Rosenstiel and
Tarek F. Abdelzaher and
Joseph L. Hellerstein},
title = {Memory power management via dynamic voltage/frequency scaling},
booktitle = {Proceedings of the 8th International Conference on Autonomic Computing,
{ICAC} 2011, Karlsruhe, Germany, June 14-18, 2011},
pages = {31--40},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/1998582.1998590},
doi = {10.1145/1998582.1998590},
timestamp = {Tue, 06 Nov 2018 11:06:50 +0100},
biburl = {https://dblp.org/rec/conf/icac/DavidFGHM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icphs/Kirchhubel011,
author = {Christin Kirchh{\"{u}}bel and
David M. Howard},
title = {Investigating the Acoustic Characteristics of Deceptive Speech},
booktitle = {17th International Congress of Phonetic Sciences, ICPhS 2011, Hong
Kong, China, August 17-21, 2011},
pages = {1094--1097},
year = {2011},
url = {https://www.internationalphoneticassociation.org/icphs-proceedings/ICPhS2011/OnlineProceedings/RegularSession/Kirchhubel/Kirchhubel.pdf},
timestamp = {Thu, 12 Mar 2020 12:19:12 +0100},
biburl = {https://dblp.org/rec/conf/icphs/Kirchhubel011.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/HowardBV11,
author = {Matthew Howard and
David J. Braun and
Sethu Vijayakumar},
title = {Constraint-based equilibrium and stiffness control of variable stiffness
actuators},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2011, Shanghai, China, 9-13 May 2011},
pages = {5554--5560},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ICRA.2011.5979776},
doi = {10.1109/ICRA.2011.5979776},
timestamp = {Thu, 05 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icra/HowardBV11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictai/ManfredottiFHZ11,
author = {Cristina E. Manfredotti and
David J. Fleet and
Howard J. Hamilton and
Sandra Zilles},
title = {Simultaneous Tracking and Activity Recognition},
booktitle = {{IEEE} 23rd International Conference on Tools with Artificial Intelligence,
{ICTAI} 2011, Boca Raton, FL, USA, November 7-9, 2011},
pages = {189--196},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ICTAI.2011.36},
doi = {10.1109/ICTAI.2011.36},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ictai/ManfredottiFHZ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieeealife/HowardGBCA11,
author = {Gerard David Howard and
Ella Gale and
Larry Bull and
Benjamin de Lacy Costello and
Andy Adamatzky},
title = {Towards evolving spiking networks with memristive synapses},
booktitle = {2011 {IEEE} Symposium on Artificial Life, {ALIFE} 2011, Paris, France,
April 13-15, 2011},
pages = {14--21},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ALIFE.2011.5954655},
doi = {10.1109/ALIFE.2011.5954655},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ieeealife/HowardGBCA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/DuYWLLDH11,
author = {Hongwei Du and
Qiang Ye and
Weili Wu and
Wonjun Lee and
Deying Li and
Ding{-}Zhu Du and
Stephen Howard},
title = {Constant approximation for virtual backbone construction with Guaranteed
Routing Cost in wireless sensor networks},
booktitle = {{INFOCOM} 2011. 30th {IEEE} International Conference on Computer Communications,
Joint Conference of the {IEEE} Computer and Communications Societies,
10-15 April 2011, Shanghai, China},
pages = {1737--1744},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/INFCOM.2011.5934967},
doi = {10.1109/INFCOM.2011.5934967},
timestamp = {Mon, 21 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/infocom/DuYWLLDH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/WarnockCHCFWSMMPCMMSRAWSSCSEMWMMW11,
author = {James D. Warnock and
Y. Chan and
William V. Huott and
Sean M. Carey and
Michael F. Fee and
Huajun Wen and
Mary Jo Saccamango and
Frank Malgioglio and
Patrick J. Meaney and
Donald W. Plass and
Yuen H. Chan and
Mark D. Mayo and
Guenter Mayer and
Leon J. Sigal and
David L. Rude and
Robert M. Averill III and
Michael H. Wood and
Thomas Strach and
Howard H. Smith and
Brian W. Curran and
Eric M. Schwarz and
Lee Eisen and
Doug Malone and
Steve Weitzel and
Pak{-}kin Mak and
Thomas J. McPherson and
Charles F. Webb},
title = {A 5.2GHz microprocessor chip for the {IBM} zEnterprise{\texttrademark}
system},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2011,
Digest of Technical Papers, San Francisco, CA, USA, 20-24 February,
2011},
pages = {70--72},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ISSCC.2011.5746223},
doi = {10.1109/ISSCC.2011.5746223},
timestamp = {Thu, 07 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/WarnockCHCFWSMMPCMMSRAWSSCSEMWMMW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pvm/HurseyGBBPS11,
author = {Joshua Hursey and
Richard L. Graham and
Greg Bronevetsky and
Darius Buntinas and
Howard Pritchard and
David G. Solt},
editor = {Yiannis Cotronis and
Anthony Danalis and
Dimitrios S. Nikolopoulos and
Jack J. Dongarra},
title = {Run-Through Stabilization: An {MPI} Proposal for Process Fault Tolerance},
booktitle = {Recent Advances in the Message Passing Interface - 18th European {MPI}
Users' Group Meeting, EuroMPI 2011, Santorini, Greece, September 18-21,
2011. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6960},
pages = {329--332},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-24449-0\_40},
doi = {10.1007/978-3-642-24449-0\_40},
timestamp = {Tue, 14 May 2019 10:00:52 +0200},
biburl = {https://dblp.org/rec/conf/pvm/HurseyGBBPS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rss/BraunHV11,
author = {David J. Braun and
Matthew Howard and
Sethu Vijayakumar},
editor = {Hugh F. Durrant{-}Whyte and
Nicholas Roy and
Pieter Abbeel},
title = {Exploiting Variable Stiffness in Explosive Movement Tasks},
booktitle = {Robotics: Science and Systems VII, University of Southern California,
Los Angeles, CA, USA, June 27-30, 2011},
year = {2011},
url = {http://www.roboticsproceedings.org/rss07/p04.html},
doi = {10.15607/RSS.2011.VII.004},
timestamp = {Fri, 29 Jan 2021 22:08:10 +0100},
biburl = {https://dblp.org/rec/conf/rss/BraunHV11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/KoziolLHCHH11,
author = {Scott Koziol and
David Lenz and
Sebastian Hilsenbeck and
Smriti Chopra and
Paul E. Hasler and
Ayanna M. Howard},
title = {Using floating-gate based programmable analog arrays for real-time
control of a game-playing robot},
booktitle = {Proceedings of the {IEEE} International Conference on Systems, Man
and Cybernetics, Anchorage, Alaska, USA, October 9-12, 2011},
pages = {3566--3571},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ICSMC.2011.6084222},
doi = {10.1109/ICSMC.2011.6084222},
timestamp = {Thu, 04 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/smc/KoziolLHCHH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/sensoria2011/FosterMRU11,
author = {Howard Foster and
Arun Mukhija and
David S. Rosenblum and
Sebasti{\'{a}}n Uchitel},
editor = {Martin Wirsing and
Matthias M. H{\"{o}}lzl},
title = {Specification and Analysis of Dynamically-Reconfigurable Service Architectures},
booktitle = {Rigorous Software Engineering for Service-Oriented Systems - Results
of the {SENSORIA} Project on Software Engineering for Service-Oriented
Computing},
series = {Lecture Notes in Computer Science},
volume = {6582},
pages = {428--446},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-20401-2\_20},
doi = {10.1007/978-3-642-20401-2\_20},
timestamp = {Tue, 14 May 2019 10:00:35 +0200},
biburl = {https://dblp.org/rec/books/sp/sensoria2011/FosterMRU11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/sensoria2011/MukhijaRFU11,
author = {Arun Mukhija and
David S. Rosenblum and
Howard Foster and
Sebasti{\'{a}}n Uchitel},
editor = {Martin Wirsing and
Matthias M. H{\"{o}}lzl},
title = {Runtime Support for Dynamic and Adaptive Service Composition},
booktitle = {Rigorous Software Engineering for Service-Oriented Systems - Results
of the {SENSORIA} Project on Software Engineering for Service-Oriented
Computing},
series = {Lecture Notes in Computer Science},
volume = {6582},
pages = {585--603},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-20401-2\_28},
doi = {10.1007/978-3-642-20401-2\_28},
timestamp = {Mon, 29 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/sp/sensoria2011/MukhijaRFU11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/wi/Smith11/HowardTC11,
author = {David M. Howard and
Andy M. Tyrrell and
Crispin H. V. Cooper},
editor = {Stephen L. Smith and
Stefano Cagnoni},
title = {Towards an Alternative to Magnetic Resonance Imaging for Vocal Tract
Shape Measurement using the Principles of Evolution},
booktitle = {Genetic and Evolutionary Computation: Medical Applications},
publisher = {Wiley},
year = {2011},
timestamp = {Mon, 28 Jan 2019 07:23:51 +0100},
biburl = {https://dblp.org/rec/books/wi/Smith11/HowardTC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/KorpelaABCHLSKW11,
author = {Eric Korpela and
David P. Anderson and
Robert Bankay and
Jeff Cobb and
Andrew Howard and
Matt Lebofsky and
Andrew P. V. Siemion and
Joshua Von Korff and
Dan Werthimer},
title = {Status of the UC-Berkeley {SETI} Efforts},
journal = {CoRR},
volume = {abs/1108.3134},
year = {2011},
url = {http://arxiv.org/abs/1108.3134},
eprinttype = {arXiv},
eprint = {1108.3134},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/KorpelaABCHLSKW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ArmbrustFGJKKLPRSZ10,
author = {Michael Armbrust and
Armando Fox and
Rean Griffith and
Anthony D. Joseph and
Randy H. Katz and
Andy Konwinski and
Gunho Lee and
David A. Patterson and
Ariel Rabkin and
Ion Stoica and
Matei Zaharia},
title = {A view of cloud computing},
journal = {Commun. {ACM}},
volume = {53},
number = {4},
pages = {50--58},
year = {2010},
url = {https://doi.org/10.1145/1721654.1721672},
doi = {10.1145/1721654.1721672},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/ArmbrustFGJKKLPRSZ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dam/HowardT10,
author = {David M. Howard and
Ann N. Trenk},
title = {The t-discrepancy of a poset},
journal = {Discret. Appl. Math.},
volume = {158},
number = {16},
pages = {1789--1798},
year = {2010},
url = {https://doi.org/10.1016/j.dam.2010.07.010},
doi = {10.1016/J.DAM.2010.07.010},
timestamp = {Thu, 11 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dam/HowardT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/HowardSST10,
author = {David M. Howard and
Randy Shull and
Noah Streib and
Ann N. Trenk},
title = {The total linear discrepancy of an ordered set},
journal = {Discret. Math.},
volume = {310},
number = {5},
pages = {1022--1025},
year = {2010},
url = {https://doi.org/10.1016/j.disc.2009.10.015},
doi = {10.1016/J.DISC.2009.10.015},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dm/HowardSST10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/HowardT10,
author = {David M. Howard and
William T. Trotter},
title = {On the size of maximal antichains and the number of pairwise disjoint
maximal chains},
journal = {Discret. Math.},
volume = {310},
number = {21},
pages = {2890--2894},
year = {2010},
url = {https://doi.org/10.1016/j.disc.2010.06.034},
doi = {10.1016/J.DISC.2010.06.034},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dm/HowardT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdsn/EidsonEGHHLPSWW10,
author = {Gene W. Eidson and
Sam T. Esswein and
Jill B. Gemmill and
Jason O. Hallstrom and
T. R. Howard and
J. K. Lawrence and
Christopher J. Post and
C. B. Sawyer and
Kuang{-}Ching Wang and
David L. White},
title = {The South Carolina Digital Watershed: End-to-End Support for Real-Time
Management of Water Resources},
journal = {Int. J. Distributed Sens. Networks},
volume = {6},
number = {1},
year = {2010},
url = {https://doi.org/10.1155/2010/970868},
doi = {10.1155/2010/970868},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijdsn/EidsonEGHHLPSWW10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jacic/BarringerGHS10,
author = {Howard Barringer and
Alex Groce and
Klaus Havelund and
Margaret H. Smith},
title = {Formal Analysis of Log Files},
journal = {J. Aerosp. Comput. Inf. Commun.},
volume = {7},
number = {11},
pages = {365--390},
year = {2010},
url = {https://doi.org/10.2514/1.49356},
doi = {10.2514/1.49356},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jacic/BarringerGHS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jct/BiroHKTY10,
author = {Csaba Bir{\'{o}} and
David M. Howard and
Mitchel T. Keller and
William T. Trotter and
Stephen J. Young},
title = {Interval partitions and Stanley depth},
journal = {J. Comb. Theory {A}},
volume = {117},
number = {4},
pages = {475--482},
year = {2010},
url = {https://doi.org/10.1016/j.jcta.2009.07.008},
doi = {10.1016/J.JCTA.2009.07.008},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jct/BiroHKTY10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/WolfAKHAZLTH10,
author = {Michael T. Wolf and
Christopher Assad and
Yoshiaki Kuwata and
Andrew Howard and
Hrand Aghazarian and
David Zhu and
Thomas Lu and
Ashitey Trebi{-}Ollennu and
Terry Huntsberger},
title = {360-degree visual detection and target tracking on an autonomous surface
vehicle},
journal = {J. Field Robotics},
volume = {27},
number = {6},
pages = {819--833},
year = {2010},
url = {https://doi.org/10.1002/rob.20371},
doi = {10.1002/ROB.20371},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfr/WolfAKHAZLTH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/GesbertHHSSY10,
author = {David Gesbert and
Stephen V. Hanly and
Howard C. Huang and
Shlomo Shamai and
Osvaldo Simeone and
Wei Yu},
title = {Multi-Cell {MIMO} Cooperative Networks: {A} New Look at Interference},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {28},
number = {9},
pages = {1380--1408},
year = {2010},
url = {https://doi.org/10.1109/JSAC.2010.101202},
doi = {10.1109/JSAC.2010.101202},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/GesbertHHSSY10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/GesbertHHSYP10,
author = {David Gesbert and
Stephen V. Hanly and
Howard C. Huang and
Shlomo Shamai and
Wei Yu and
Michael B. Pursley},
title = {Guest Editorial Cooperative Communications in {MIMO} Cellular Networks},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {28},
number = {9},
pages = {1377--1379},
year = {2010},
url = {https://doi.org/10.1109/JSAC.2010.101201},
doi = {10.1109/JSAC.2010.101201},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/GesbertHHSYP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/logcom/BarringerRH10,
author = {Howard Barringer and
David E. Rydeheard and
Klaus Havelund},
title = {Rule Systems for Run-time Monitoring: from Eagle to RuleR},
journal = {J. Log. Comput.},
volume = {20},
number = {3},
pages = {675--706},
year = {2010},
url = {https://doi.org/10.1093/logcom/exn076},
doi = {10.1093/LOGCOM/EXN076},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/logcom/BarringerRH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ram/SmithDHPACDGHORSSSSTCJS10,
author = {Ryan N. Smith and
Jnaneshwar Das and
Hordur Kristinn Heidarsson and
Arvind Pereira and
Filippo Arrichiello and
Ivona Cetnic and
Lindsay Darjany and
Marie{-}Eve Garneau and
Meredith Howard and
Carl Oberg and
Matthew Ragan and
Erica Seubert and
Ellen C. Smith and
Beth Stauffer and
Astrid Schnetzer and
Gerardo Toro{-}Farmer and
David A. Caron and
Burton H. Jones and
Gaurav S. Sukhatme},
title = {{USC} {CINAPS} Builds Bridges},
journal = {{IEEE} Robotics Autom. Mag.},
volume = {17},
number = {1},
pages = {20--30},
year = {2010},
url = {https://doi.org/10.1109/MRA.2010.935795},
doi = {10.1109/MRA.2010.935795},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ram/SmithDHPACDGHORSSSSTCJS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tlt/DavisCHHMMW10,
author = {Hugh C. Davis and
Leslie Carr and
Jessie M. N. Hey and
Yvonne Margaret Howard and
David E. Millard and
Debra Morris and
Su White},
title = {Bootstrapping a Culture of Sharing to Facilitate Open Educational
Resources},
journal = {{IEEE} Trans. Learn. Technol.},
volume = {3},
number = {2},
pages = {96--109},
year = {2010},
url = {https://doi.org/10.1109/TLT.2009.34},
doi = {10.1109/TLT.2009.34},
timestamp = {Fri, 03 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tlt/DavisCHHMMW10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biostec/PaulLPSP10,
author = {Padma Polash Paul and
Howard Leung and
David A. Peterson and
Terrence J. Sejnowski and
Howard Poizner},
editor = {Ana L. N. Fred and
Joaquim Filipe and
Hugo Gamboa},
title = {Combining Temporal and Frequency based Prediction for {EEG} Signals},
booktitle = {{BIOSIGNALS} 2010 - Proceedings of the Third International Conference
on Bio-inspired Systems and Signal Processing, Valencia, Spain, January
20-23, 2010},
pages = {29--36},
publisher = {{INSTICC} Press},
year = {2010},
timestamp = {Fri, 29 Apr 2011 08:18:44 +0200},
biburl = {https://dblp.org/rec/conf/biostec/PaulLPSP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cade/AfifiRB10,
author = {Djihed Afifi and
David E. Rydeheard and
Howard Barringer},
editor = {Renate A. Schmidt and
Stephan Schulz and
Boris Konev},
title = {Automated Reasoning in the Simulation of Evolvable Systems},
booktitle = {Proceedings of the 2nd Workshop on Practical Aspects of Automated
Reasoning, PAAR-2010, Edinburgh, Scotland, UK, July 14, 2010},
series = {EPiC Series in Computing},
volume = {9},
pages = {11--21},
publisher = {EasyChair},
year = {2010},
url = {https://doi.org/10.29007/jj86},
doi = {10.29007/JJ86},
timestamp = {Sun, 15 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cade/AfifiRB10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/HowardBL10,
author = {Gerard David Howard and
Larry Bull and
Pier Luca Lanzi},
title = {A spiking neural representation for {XCSF}},
booktitle = {Proceedings of the {IEEE} Congress on Evolutionary Computation, {CEC}
2010, Barcelona, Spain, 18-23 July 2010},
pages = {1--8},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/CEC.2010.5586035},
doi = {10.1109/CEC.2010.5586035},
timestamp = {Thu, 16 Dec 2021 14:02:32 +0100},
biburl = {https://dblp.org/rec/conf/cec/HowardBL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ectel/MillardH10,
author = {David E. Millard and
Yvonne Margaret Howard},
editor = {Martin Wolpers and
Paul A. Kirschner and
Maren Scheffel and
Stefanie N. Lindstaedt and
Vania Dimitrova},
title = {Towards an Ergonomics of Knowledge Systems: Improving the Design of
Technology Enhanced Learning},
booktitle = {Sustaining {TEL:} From Innovation to Learning and Practice - 5th European
Conference on Technology Enhanced Learning, {EC-TEL} 2010, Barcelona,
Spain, September 28 - October 1, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6383},
pages = {566--571},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-16020-2\_55},
doi = {10.1007/978-3-642-16020-2\_55},
timestamp = {Mon, 28 Aug 2023 21:17:28 +0200},
biburl = {https://dblp.org/rec/conf/ectel/MillardH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icai/HowardDPCS10,
author = {Mike Howard and
Mike Daily and
David W. Payton and
Yang Chen and
Rashmi Sundareswara},
editor = {Hamid R. Arabnia and
David de la Fuente and
Elena B. Kozerenko and
Jos{\'{e}} Angel Olivas and
Rui Chang and
Peter M. LaMonica and
Raymond A. Liuzzi and
Ashu M. G. Solo},
title = {Further Explorations of a Minimal Polychronous Memory},
booktitle = {Proceedings of the 2010 International Conference on Artificial Intelligence,
{ICAI} 2010, July 12-15, 2010, Las Vegas Nevada, USA, 2 Volumes},
pages = {325--330},
publisher = {{CSREA} Press},
year = {2010},
timestamp = {Tue, 07 Dec 2010 11:23:59 +0100},
biburl = {https://dblp.org/rec/conf/icai/HowardDPCS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icde/GanapathiCFKP10,
author = {Archana Ganapathi and
Yanpei Chen and
Armando Fox and
Randy H. Katz and
David A. Patterson},
title = {Statistics-driven workload modeling for the Cloud},
booktitle = {Workshops Proceedings of the 26th International Conference on Data
Engineering, {ICDE} 2010, March 1-6, 2010, Long Beach, California,
{USA}},
pages = {87--92},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/ICDEW.2010.5452742},
doi = {10.1109/ICDEW.2010.5452742},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icde/GanapathiCFKP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/WoodenMBHRR10,
author = {David Wooden and
Matthew Malchano and
Kevin Blankespoor and
Andrew Howard and
Alfred A. Rizzi and
Marc H. Raibert},
title = {Autonomous navigation for BigDog},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2010, Anchorage, Alaska, USA, 3-7 May 2010},
pages = {4736--4741},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ROBOT.2010.5509226},
doi = {10.1109/ROBOT.2010.5509226},
timestamp = {Sat, 01 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icra/WoodenMBHRR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/islped/DavidGHKL10,
author = {Howard David and
Eugene Gorbatov and
Ulf R. Hanebutte and
Rahul Khanna and
Christian Le},
editor = {Vojin G. Oklobdzija and
Barry Pangle and
Naehyuck Chang and
Naresh R. Shanbhag and
Chris H. Kim},
title = {{RAPL:} memory power estimation and capping},
booktitle = {Proceedings of the 2010 International Symposium on Low Power Electronics
and Design, 2010, Austin, Texas, USA, August 18-20, 2010},
pages = {189--194},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1840845.1840883},
doi = {10.1145/1840845.1840883},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/islped/DavidGHKL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/HowardDHVFRJWBSPJJYMSEKRDLGAHLSBDWM10,
author = {Jason Howard and
Saurabh Dighe and
Yatin Vasant Hoskote and
Sriram R. Vangal and
David Finan and
Gregory Ruhl and
David Jenkins and
Howard Wilson and
Nitin Borkar and
Gerhard Schrom and
Fabric Pailet and
Shailendra Jain and
Tiju Jacob and
Satish Yada and
Sraven Marella and
Praveen Salihundam and
Vasantha Erraguntla and
Michael Konow and
Michael Riepen and
Guido Droege and
Joerg Lindemann and
Matthias Gries and
Thomas Apel and
Kersten Henriss and
Tor Lund{-}Larsen and
Sebastian Steibl and
Shekhar Borkar and
Vivek De and
Rob F. Van der Wijngaart and
Timothy G. Mattson},
title = {A 48-Core {IA-32} message-passing processor with {DVFS} in 45nm {CMOS}},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2010,
Digest of Technical Papers, San Francisco, CA, USA, 7-11 February,
2010},
pages = {108--109},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ISSCC.2010.5434077},
doi = {10.1109/ISSCC.2010.5434077},
timestamp = {Wed, 20 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/HowardDHVFRJWBSPJJYMSEKRDLGAHLSBDWM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/osdi/RabkinXWFPK10,
author = {Ariel Rabkin and
Wei Xu and
Avani Wildani and
Armando Fox and
David A. Patterson and
Randy H. Katz},
editor = {Greg Bronevetsky and
Kathryn M. Mohror and
Alice Zheng},
title = {A Graphical Representation for Identifier Structure in Logs},
booktitle = {Workshop on Managing Systems via Log Analysis and Machine Learning
Techniques, SLAML'10, Vancouver, BC, Canada, October 3, 2010},
publisher = {{USENIX} Association},
year = {2010},
url = {https://www.usenix.org/conference/slaml10/graphical-representation-identifier-structure-logs},
timestamp = {Tue, 25 Jul 2023 13:44:09 +0200},
biburl = {https://dblp.org/rec/conf/osdi/RabkinXWFPK10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rv/AfifiRB10,
author = {Djihed Afifi and
David E. Rydeheard and
Howard Barringer},
editor = {Howard Barringer and
Yli{\`{e}}s Falcone and
Bernd Finkbeiner and
Klaus Havelund and
Insup Lee and
Gordon J. Pace and
Grigore Rosu and
Oleg Sokolsky and
Nikolai Tillmann},
title = {{ESAT:} {A} Tool for Animating Logic-Based Specifications of Evolvable
Component Systems},
booktitle = {Runtime Verification - First International Conference, {RV} 2010,
St. Julians, Malta, November 1-4, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6418},
pages = {469--474},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-16612-9\_36},
doi = {10.1007/978-3-642-16612-9\_36},
timestamp = {Thu, 26 Jan 2023 14:05:55 +0100},
biburl = {https://dblp.org/rec/conf/rv/AfifiRB10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/KrioukovMAKCK10,
author = {Andrew Krioukov and
Prashanth Mohan and
Sara Alspaugh and
Laura Keys and
David E. Culler and
Randy H. Katz},
editor = {Paul Barford and
Jitendra Padhye and
Sambit Sahu},
title = {NapSAC: design and implementation of a power-proportional web cluster},
booktitle = {Proceedings of the 1st {ACM} {SIGCOMM} Workshop on Green Networking
2010, New Delhi, India, August 30, 2010},
pages = {15--22},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1851290.1851294},
doi = {10.1145/1851290.1851294},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigcomm/KrioukovMAKCK10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ife/MillardHADGWW09,
author = {David E. Millard and
Yvonne Margaret Howard and
Noura Abbas and
Hugh C. Davis and
Lester Gilbert and
Gary B. Wills and
Robert John Walters},
title = {Pragmatic web service design: An agile approach with the service responsibility
and interaction design method},
journal = {Comput. Sci. Res. Dev.},
volume = {24},
number = {4},
pages = {173--184},
year = {2009},
url = {https://doi.org/10.1007/s00450-009-0064-x},
doi = {10.1007/S00450-009-0064-X},
timestamp = {Wed, 04 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ife/MillardHADGWW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/igpl/BarringerGR09,
author = {Howard Barringer and
Dov M. Gabbay and
David E. Rydeheard},
title = {Modelling evolvable component systems: Part {I:} {A} logical framework},
journal = {Log. J. {IGPL}},
volume = {17},
number = {6},
pages = {631--696},
year = {2009},
url = {https://doi.org/10.1093/jigpal/jzp026},
doi = {10.1093/JIGPAL/JZP026},
timestamp = {Fri, 06 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/igpl/BarringerGR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/RohamCDRHHGM09,
author = {Masoud Roham and
Daniel P. Covey and
David P. Daberkow and
Eric S. Ramsson and
Christopher D. Howard and
Byron A. Heidenreich and
Paul A. Garris and
Pedram Mohseni},
title = {A Wireless {IC} for Time-Share Chemical and Electrical Neural Recording},
journal = {{IEEE} J. Solid State Circuits},
volume = {44},
number = {12},
pages = {3645--3658},
year = {2009},
url = {https://doi.org/10.1109/JSSC.2009.2035549},
doi = {10.1109/JSSC.2009.2035549},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/RohamCDRHHGM09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/NeemaGGHGHWHHAB09,
author = {Mohit Neema and
Daniel Goldberg{-}Zimring and
Zachary D. Guss and
Brian C. Healy and
Charles R. G. Guttmann and
Maria K. Houtchens and
Howard L. Weiner and
Mark A. Horsfield and
David B. Hackney and
David C. Alsop and
Rohit Bakshi},
title = {3 {T} {MRI} relaxometry detects {T2} prolongation in the cerebral
normal-appearing white matter in multiple sclerosis},
journal = {NeuroImage},
volume = {46},
number = {3},
pages = {633--641},
year = {2009},
url = {https://doi.org/10.1016/j.neuroimage.2009.03.001},
doi = {10.1016/J.NEUROIMAGE.2009.03.001},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/NeemaGGHGHWHHAB09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/order/BiroH09,
author = {Csaba Bir{\'{o}} and
David M. Howard},
title = {The First Three Levels of an Order Preserving Hamiltonian Path in
the Subset Lattice},
journal = {Order},
volume = {26},
number = {2},
pages = {101--107},
year = {2009},
url = {https://doi.org/10.1007/s11083-009-9107-y},
doi = {10.1007/S11083-009-9107-Y},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/order/BiroH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/PreeceGKH09,
author = {Stephen J. Preece and
John Yannis Goulermas and
Laurence P. J. Kenney and
David Howard},
title = {A Comparison of Feature Extraction Methods for the Classification
of Dynamic Activities From Accelerometer Data},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {56},
number = {3},
pages = {871--879},
year = {2009},
url = {https://doi.org/10.1109/TBME.2008.2006190},
doi = {10.1109/TBME.2008.2006190},
timestamp = {Wed, 02 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/PreeceGKH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/candc/BusseBHDFL09,
author = {Daniela K. Busse and
Eli Blevis and
Catherine Howard and
Brinda Dalal and
David Fore and
Lara Lee},
editor = {Nick Bryan{-}Kinns and
Mark D. Gross and
Hilary Johnson and
Jack Ox and
Ron Wakkary},
title = {Designing for a sustainable future},
booktitle = {Proceedings of the 7th Conference on Creativity {\&} Cognition,
Berkeley, California, USA, October 26-30, 2009},
pages = {493--494},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1640233.1640373},
doi = {10.1145/1640233.1640373},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/candc/BusseBHDFL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/darpa/FergusonHL09,
author = {Dave Ferguson and
Thomas M. Howard and
Maxim Likhachev},
editor = {Martin Buehler and
Karl Iagnemma and
Sanjiv Singh},
title = {Motion Planning in Urban Environments},
booktitle = {The {DARPA} Urban Challenge: Autonomous Vehicles in City Traffic,
George Air Force Base, Victorville, California, {USA}},
series = {Springer Tracts in Advanced Robotics},
volume = {56},
pages = {61--89},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-03991-1\_2},
doi = {10.1007/978-3-642-03991-1\_2},
timestamp = {Mon, 23 Oct 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/darpa/FergusonHL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/darpa/UrmsonABBBCDDGGGHHHKKLMMPPRRSSSSSWWZBBDLNSZSTDF09,
author = {Chris Urmson and
Joshua Anhalt and
Drew Bagnell and
Christopher R. Baker and
Robert Bittner and
M. N. Clark and
John M. Dolan and
Dave Duggins and
Tugrul Galatali and
Christopher Geyer and
Michele Gittleman and
Sam Harbaugh and
Martial Hebert and
Thomas M. Howard and
Sascha Kolski and
Alonzo Kelly and
Maxim Likhachev and
Matthew McNaughton and
Nick Miller and
Kevin M. Peterson and
Brian Pilnick and
Raj Rajkumar and
Paul E. Rybski and
Bryan Salesky and
Young{-}Woo Seo and
Sanjiv Singh and
Jarrod M. Snider and
Anthony Stentz and
William Whittaker and
Ziv Wolkowicki and
Jason Ziglar and
Hong Bae and
Thomas Brown and
Daniel Demitrish and
Bakhtiar Litkouhi and
Jim Nickolaou and
Varsha Sadekar and
Wende Zhang and
Joshua Struble and
Michael Taylor and
Michael Darms and
Dave Ferguson},
editor = {Martin Buehler and
Karl Iagnemma and
Sanjiv Singh},
title = {Autonomous Driving in Urban Environments: Boss and the Urban Challenge},
booktitle = {The {DARPA} Urban Challenge: Autonomous Vehicles in City Traffic,
George Air Force Base, Victorville, California, {USA}},
series = {Springer Tracts in Advanced Robotics},
volume = {56},
pages = {1--59},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-03991-1\_1},
doi = {10.1007/978-3-642-03991-1\_1},
timestamp = {Mon, 23 Oct 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/darpa/UrmsonABBBCDDGGGHHHKKLMMPPRRSSSSSWWZBBDLNSZSTDF09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ectel/MillardHMABV09,
author = {David E. Millard and
Yvonne Margaret Howard and
Patrick McSweeney and
Miguel Arrebola and
Kate Borthwick and
Stavroula Varella},
editor = {Ulrike Cress and
Vania Dimitrova and
Marcus Specht},
title = {Phantom Tasks and Invisible Rubric: The Challenges of Remixing Learning
Objects in the Wild},
booktitle = {Learning in the Synergy of Multiple Disciplines, 4th European Conference
on Technology Enhanced Learning, {EC-TEL} 2009, Nice, France, September
29 - October 2, 2009, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5794},
pages = {127--139},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-04636-0\_14},
doi = {10.1007/978-3-642-04636-0\_14},
timestamp = {Mon, 28 Aug 2023 21:17:28 +0200},
biburl = {https://dblp.org/rec/conf/ectel/MillardHMABV09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fsr/FurlongHW09,
author = {P. Michael Furlong and
Thomas M. Howard and
David Wettergreen},
editor = {Andrew Howard and
Karl Iagnemma and
Alonzo Kelly},
title = {Model Predictive Control for Mobile Robots with Actively Reconfigurable
Chassis},
booktitle = {Field and Service Robotics, Results of the 7th International Conference,
{FSR} 2009, Cambridge, Massachusetts, USA, 14-16 July 2009},
series = {Springer Tracts in Advanced Robotics},
volume = {62},
pages = {469--478},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-13408-1\_42},
doi = {10.1007/978-3-642-13408-1\_42},
timestamp = {Mon, 22 May 2017 17:10:59 +0200},
biburl = {https://dblp.org/rec/conf/fsr/FurlongHW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/HowardBL09,
author = {Gerard David Howard and
Larry Bull and
Pier Luca Lanzi},
editor = {Franz Rothlauf},
title = {Towards continuous actions in continuous space and time using self-adaptive
constructivism in neural {XCSF}},
booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2009, Proceedings,
Montreal, Qu{\'{e}}bec, Canada, July 8-12, 2009},
pages = {1219--1226},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1569901.1570065},
doi = {10.1145/1569901.1570065},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gecco/HowardBL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/MillardHMABW09,
author = {David E. Millard and
Yvonne Margaret Howard and
Patrick McSweeney and
Miguel Arrebola and
Kate Borthwick and
Julie Watson},
title = {The Language Box: Re-imagining Teaching and Learning Repositories},
booktitle = {The 9th {IEEE} International Conference on Advanced Learning Technologies,
{ICALT} 2009, Riga, Latvia, July 15-17, 2009},
pages = {619--623},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ICALT.2009.118},
doi = {10.1109/ICALT.2009.118},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icalt/MillardHMABW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsoc/FosterMRU09,
author = {Howard Foster and
Arun Mukhija and
David S. Rosenblum and
Sebasti{\'{a}}n Uchitel},
editor = {Luciano Baresi and
Chi{-}Hung Chi and
Jun Suzuki},
title = {Engage: Engineering Service Modes with WS-Engineer and Dino},
booktitle = {Service-Oriented Computing, 7th International Joint Conference, ICSOC-ServiceWave
2009, Stockholm, Sweden, November 24-27, 2009. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5900},
pages = {641--642},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-10383-4\_48},
doi = {10.1007/978-3-642-10383-4\_48},
timestamp = {Tue, 14 May 2019 10:00:36 +0200},
biburl = {https://dblp.org/rec/conf/icsoc/FosterMRU09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/SpeedMH09,
author = {Matt Speed and
Damian T. Murphy and
David M. Howard},
title = {Characteristics of two-dimensional finite difference techniques for
vocal tract analysis and voice synthesis},
booktitle = {10th Annual Conference of the International Speech Communication Association,
{INTERSPEECH} 2009, Brighton, United Kingdom, September 6-10, 2009},
pages = {768--771},
publisher = {{ISCA}},
year = {2009},
url = {https://doi.org/10.21437/Interspeech.2009-173},
doi = {10.21437/INTERSPEECH.2009-173},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/SpeedMH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwcls/HowardBL09,
author = {Gerard David Howard and
Larry Bull and
Pier Luca Lanzi},
editor = {Jaume Bacardit and
Will N. Browne and
Jan Drugowitsch and
Ester Bernad{\'{o}}{-}Mansilla and
Martin V. Butz},
title = {Use of a Connection-Selection Scheme in Neural {XCSF}},
booktitle = {Learning Classifier Systems - 11th International Workshop, {IWLCS}
2008, Atlanta, GA, USA, July 13, 2008, and 12th International Workshop,
{IWLCS} 2009, Montreal, QC, Canada, July 9, 2009, Revised Selected
Papers},
series = {Lecture Notes in Computer Science},
volume = {6471},
pages = {87--106},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-17508-4\_7},
doi = {10.1007/978-3-642-17508-4\_7},
timestamp = {Sun, 02 Jun 2019 21:10:39 +0200},
biburl = {https://dblp.org/rec/conf/iwcls/HowardBL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/maveba/HowardBD09,
author = {David M. Howard and
Jude Brereton and
Helena Daffern},
editor = {Claudia Manfredi},
title = {Case study of voice quality differences in a soprano singing in different
early music performance styles},
booktitle = {Sixth International Workshop on Models and Analysis of Vocal Emissions
for Biomedical Applications, {MAVEBA} 2009, Florence, Italy, December
12-14, 2009},
pages = {175--178},
publisher = {Firenze University Press / {ISCA}},
year = {2009},
url = {http://www.isca-speech.org/archive/maveba\_2009/mv09\_175.html},
timestamp = {Tue, 16 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/maveba/HowardBD09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rv/BarringerHRG09,
author = {Howard Barringer and
Klaus Havelund and
David E. Rydeheard and
Alex Groce},
editor = {Saddek Bensalem and
Doron A. Peled},
title = {Rule Systems for Runtime Verification: {A} Short Tutorial},
booktitle = {Runtime Verification, 9th International Workshop, {RV} 2009, Grenoble,
France, June 26-28, 2009. Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {5779},
pages = {1--24},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-04694-0\_1},
doi = {10.1007/978-3-642-04694-0\_1},
timestamp = {Tue, 14 May 2019 10:00:51 +0200},
biburl = {https://dblp.org/rec/conf/rv/BarringerHRG09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sccg/ChalmersHM09,
author = {Alan Chalmers and
David M. Howard and
Christopher Moir},
editor = {Helwig Hauser and
Stephen N. Spencer},
title = {Real virtuality: a step change from virtual reality},
booktitle = {Spring Conference on Computer Graphics, {SCCG} 2009, Budmerice, Slovakia,
April 23-25, 2009},
pages = {9--16},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1980462.1980466},
doi = {10.1145/1980462.1980466},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sccg/ChalmersHM09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/waspaa/SpeedMH09,
author = {Matt Speed and
Damian T. Murphy and
David M. Howard},
title = {Acoustic coupling in multi-dimensional finite difference schemes for
physically modeled voice synthesis},
booktitle = {{IEEE} Workshop on Applications of Signal Processing to Audio and
Acoustics, {WASPAA} '09, New Paltz, NY, USA, October 18-21, 2009},
pages = {5--8},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/ASPAA.2009.5346486},
doi = {10.1109/ASPAA.2009.5346486},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/waspaa/SpeedMH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:journals/corr/abs-1003-1682,
author = {Howard Barringer and
Alex Groce and
Klaus Havelund and
Margaret H. Smith},
editor = {Manuela{-}Luminita Bujorianu and
Michael Fisher},
title = {An Entry Point for Formal Methods: Specification and Analysis of Event
Logs},
booktitle = {Proceedings {FM-09} Workshop on Formal Methods for Aerospace, {FMA}
2009, Eindhoven, The Netherlands, 3rd November 2009},
series = {{EPTCS}},
volume = {20},
pages = {16--21},
year = {2009},
url = {https://doi.org/10.4204/EPTCS.20.2},
doi = {10.4204/EPTCS.20.2},
timestamp = {Tue, 21 Sep 2021 18:08:28 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1003-1682.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijkl/MillardDDGHTW08,
author = {David E. Millard and
Karl Doody and
Hugh C. Davis and
Lester Gilbert and
Yvonne Margaret Howard and
Feng (Barry) Tao and
Gary B. Wills},
title = {(Semantic web) services for e-learning},
journal = {Int. J. Knowl. Learn.},
volume = {4},
number = {2/3},
pages = {298--315},
year = {2008},
url = {https://doi.org/10.1504/IJKL.2008.020670},
doi = {10.1504/IJKL.2008.020670},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijkl/MillardDDGHTW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/intr/ChenC08,
author = {Yen{-}Hao Howard Chen and
David Corkindale},
title = {Towards an understanding of the behavioral intention to use online
news services: An exploratory study},
journal = {Internet Res.},
volume = {18},
number = {3},
pages = {286--312},
year = {2008},
url = {https://doi.org/10.1108/10662240810883326},
doi = {10.1108/10662240810883326},
timestamp = {Wed, 04 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/intr/ChenC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/FergusonHL08,
author = {Dave Ferguson and
Thomas M. Howard and
Maxim Likhachev},
title = {Motion planning in urban environments},
journal = {J. Field Robotics},
volume = {25},
number = {11-12},
pages = {939--960},
year = {2008},
url = {https://doi.org/10.1002/rob.20265},
doi = {10.1002/ROB.20265},
timestamp = {Mon, 23 Oct 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfr/FergusonHL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/HowardGKF08,
author = {Thomas M. Howard and
Colin J. Green and
Alonzo Kelly and
Dave Ferguson},
title = {State space sampling of feasible motions for high-performance mobile
robot navigation in complex environments},
journal = {J. Field Robotics},
volume = {25},
number = {6-7},
pages = {325--345},
year = {2008},
url = {https://doi.org/10.1002/rob.20244},
doi = {10.1002/ROB.20244},
timestamp = {Mon, 23 Oct 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfr/HowardGKF08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/UrmsonABBBCDDGGGHHHKKLMMPPRRSSSSSWWZBBDLNSZSTDF08,
author = {Chris Urmson and
Joshua Anhalt and
Drew Bagnell and
Christopher R. Baker and
Robert Bittner and
M. N. Clark and
John M. Dolan and
Dave Duggins and
Tugrul Galatali and
Christopher Geyer and
Michele Gittleman and
Sam Harbaugh and
Martial Hebert and
Thomas M. Howard and
Sascha Kolski and
Alonzo Kelly and
Maxim Likhachev and
Matthew McNaughton and
Nick Miller and
Kevin M. Peterson and
Brian Pilnick and
Raj Rajkumar and
Paul E. Rybski and
Bryan Salesky and
Young{-}Woo Seo and
Sanjiv Singh and
Jarrod M. Snider and
Anthony Stentz and
William Whittaker and
Ziv Wolkowicki and
Jason Ziglar and
Hong Bae and
Thomas Brown and
Daniel Demitrish and
Bakhtiar Litkouhi and
Jim Nickolaou and
Varsha Sadekar and
Wende Zhang and
Joshua Struble and
Michael Taylor and
Michael Darms and
Dave Ferguson},
title = {Autonomous driving in urban environments: Boss and the Urban Challenge},
journal = {J. Field Robotics},
volume = {25},
number = {8},
pages = {425--466},
year = {2008},
url = {https://doi.org/10.1002/rob.20255},
doi = {10.1002/ROB.20255},
timestamp = {Mon, 23 Oct 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfr/UrmsonABBBCDDGGGHHHKKLMMPPRRSSSSSWWZBBDLNSZSTDF08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/VangalHRDWTFSJJ08,
author = {Sriram R. Vangal and
Jason Howard and
Gregory Ruhl and
Saurabh Dighe and
Howard Wilson and
James W. Tschanz and
David Finan and
Arvind P. Singh and
Tiju Jacob and
Shailendra Jain and
Vasantha Erraguntla and
Clark Roberts and
Yatin Vasant Hoskote and
Nitin Borkar and
Shekhar Borkar},
title = {An 80-Tile Sub-100-W TeraFLOPS Processor in 65-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {43},
number = {1},
pages = {29--41},
year = {2008},
url = {https://doi.org/10.1109/JSSC.2007.910957},
doi = {10.1109/JSSC.2007.910957},
timestamp = {Wed, 20 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/VangalHRDWTFSJJ08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/UrowitzWAEDHPL08,
author = {Sara Urowitz and
David Wiljer and
Emma Apatu and
Gunther Eysenbach and
Claudette DeLenardo and
Tamara Harth and
Howard Pai and
Kevin J. Leonard},
title = {Is Canada ready for patient accessible electronic health records?
{A} national scan},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {8},
pages = {33},
year = {2008},
url = {https://doi.org/10.1186/1472-6947-8-33},
doi = {10.1186/1472-6947-8-33},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/UrowitzWAEDHPL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nrhm/MillardBBCDHW08,
author = {David E. Millard and
Chris Bailey and
Philip Boulain and
Swapna Chennupati and
Hugh C. Davis and
Yvonne Margaret Howard and
Gary B. Wills},
title = {Semantics on demand: Can a Semantic Wiki replace a knowledge base?},
journal = {New Rev. Hypermedia Multim.},
volume = {14},
number = {1},
pages = {95--120},
year = {2008},
url = {https://doi.org/10.1080/13614560802316111},
doi = {10.1080/13614560802316111},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nrhm/MillardBBCDHW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/order/HowardCCK08,
author = {David M. Howard and
Gab{-}Byung Chae and
Minseok Cheong and
Sang{-}Mok Kim},
title = {Irreducible Width 2 Posets of Linear Discrepancy 3},
journal = {Order},
volume = {25},
number = {2},
pages = {105--119},
year = {2008},
url = {https://doi.org/10.1007/s11083-008-9082-8},
doi = {10.1007/S11083-008-9082-8},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/order/HowardCCK08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pervasive/TresadernTKHG08,
author = {Philip A. Tresadern and
Sibylle B. Thies and
Laurence P. J. Kenney and
David Howard and
John Yannis Goulermas},
title = {Rapid Prototyping for Functional Electrical Stimulation Control},
journal = {{IEEE} Pervasive Comput.},
volume = {7},
number = {2},
pages = {62--69},
year = {2008},
url = {https://doi.org/10.1109/MPRV.2008.35},
doi = {10.1109/MPRV.2008.35},
timestamp = {Tue, 31 Mar 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pervasive/TresadernTKHG08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/McGuireWSAMCRCLWGMMCHSSTEMPTHM08,
author = {Patrick C. McGuire and
Michael J. Wolff and
Michael D. Smith and
Raymond E. Arvidson and
Scott L. Murchie and
R. Todd Clancy and
Ted L. Roush and
Selby C. Cull and
Kim A. Lichtenberg and
Sandra M. Wiseman and
Robert O. Green and
Terry Z. Martin and
Ralph E. Milliken and
Peter J. Cavender and
David C. Humm and
Frank P. Seelos and
Kim D. Seelos and
Howard W. Taylor and
Bethany L. Ehlmann and
John F. Mustard and
Shannon M. Pelkey and
Timothy N. Titus and
Christopher D. Hash and
Erick R. Malaret},
title = {{MRO/CRISM} Retrieval of Surface Lambert Albedos for Multispectral
Mapping of Mars With DISORT-Based Radiative Transfer Modeling: Phase
1 - Using Historical Climatology for Temperatures, Aerosol Optical
Depths, and Atmospheric Pressures},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {46},
number = {12},
pages = {4020--4040},
year = {2008},
url = {https://doi.org/10.1109/TGRS.2008.2000631},
doi = {10.1109/TGRS.2008.2000631},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/McGuireWSAMCRCLWGMMCHSSTEMPTHM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/GoulermasFNLZKTTH08,
author = {John Yannis Goulermas and
Andrew H. Findlow and
Christopher J. Nester and
Panos Liatsis and
Xiao{-}Jun Zeng and
Laurence P. J. Kenney and
Philip A. Tresadern and
Sibylle B. Thies and
David Howard},
title = {An Instance-Based Algorithm With Auxiliary Similarity Information
for the Estimation of Gait Kinematics From Wearable Sensors},
journal = {{IEEE} Trans. Neural Networks},
volume = {19},
number = {9},
pages = {1574--1582},
year = {2008},
url = {https://doi.org/10.1109/TNN.2008.2000808},
doi = {10.1109/TNN.2008.2000808},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tnn/GoulermasFNLZKTTH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/HowardB08,
author = {Gerard David Howard and
Larry Bull},
editor = {Conor Ryan and
Maarten Keijzer},
title = {On the effects of node duplication and connection-oriented constructivism
in neural {XCSF}},
booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2008, Proceedings,
Atlanta, GA, USA, July 12-16, 2008, Companion Material},
pages = {1977--1984},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1388969.1389010},
doi = {10.1145/1388969.1389010},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gecco/HowardB08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/HowardBL08,
author = {Gerard David Howard and
Larry Bull and
Pier Luca Lanzi},
editor = {Conor Ryan and
Maarten Keijzer},
title = {Self-adaptive constructivism in Neural {XCS} and {XCSF}},
booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2008, Proceedings,
Atlanta, GA, USA, July 12-16, 2008},
pages = {1389--1396},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1389095.1389364},
doi = {10.1145/1389095.1389364},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gecco/HowardBL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/ZhangMWHFGS08,
author = {Pei Zhang and
David E. Millard and
Gary B. Wills and
Yvonne Margaret Howard and
Sue J. Faulds and
Lester Gilbert and
Dan Sparks},
title = {A Mobile Toolkit for Placement Learning},
booktitle = {The 8th {IEEE} International Conference on Advanced Learning Technologies,
{ICALT} 2008, Santander, Cantabria, Spain, July 1-5, 2008},
pages = {92--96},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ICALT.2008.243},
doi = {10.1109/ICALT.2008.243},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icalt/ZhangMWHFGS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsoc/FosterMRU08,
author = {Howard Foster and
Arun Mukhija and
David S. Rosenblum and
Sebasti{\'{a}}n Uchitel},
editor = {Athman Bouguettaya and
Ingolf Kr{\"{u}}ger and
Tiziana Margaria},
title = {A Model-Driven Approach to Dynamic and Adaptive Service Brokering
Using Modes},
booktitle = {Service-Oriented Computing - {ICSOC} 2008, 6th International Conference,
Sydney, Australia, December 1-5, 2008. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5364},
pages = {558--564},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-89652-4\_46},
doi = {10.1007/978-3-540-89652-4\_46},
timestamp = {Sun, 02 Jun 2019 21:20:23 +0200},
biburl = {https://dblp.org/rec/conf/icsoc/FosterMRU08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icst/SimonsT08,
author = {Anthony J. H. Simons and
Christopher David Thomson},
title = {Benchmarking Effectiveness for Object-Oriented Unit Testing},
booktitle = {First International Conference on Software Testing Verification and
Validation, {ICST} 2008, Lillehammer, Norway, April 9-11, 2008, Workshops
Proceedings},
pages = {375--379},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ICSTW.2008.10},
doi = {10.1109/ICSTW.2008.10},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icst/SimonsT08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/FergusonHL08,
author = {Dave Ferguson and
Thomas M. Howard and
Maxim Likhachev},
title = {Motion planning in urban environments: Part {I}},
booktitle = {2008 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, September 22-26, 2008, Acropolis Convention Center, Nice,
France},
pages = {1063--1069},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/IROS.2008.4651120},
doi = {10.1109/IROS.2008.4651120},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/FergusonHL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/FergusonHL08a,
author = {Dave Ferguson and
Thomas M. Howard and
Maxim Likhachev},
title = {Motion planning in urban environments: Part {II}},
booktitle = {2008 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, September 22-26, 2008, Acropolis Convention Center, Nice,
France},
pages = {1070--1076},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/IROS.2008.4651124},
doi = {10.1109/IROS.2008.4651124},
timestamp = {Mon, 23 Oct 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iros/FergusonHL08a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isaim/BlairJIR08,
author = {Howard A. Blair and
David W. Jakel and
Robert J. Irwin and
Angel J. Rivera},
title = {Hybrid Programs: Symmetrically Combining Natively Discrete and Continuous
Truth-values},
booktitle = {International Symposium on Artificial Intelligence and Mathematics,
{ISAIM} 2008, Fort Lauderdale, Florida, USA, January 2-4, 2008},
year = {2008},
url = {http://isaim2008.unl.edu/PAPERS/SS1-AI+Logic/HBlair-ss1.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isaim/BlairJIR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/KwonMCM08,
author = {Jaerock Kwon and
David Mayerich and
Yoonsuck Choe and
Bruce H. McCormick},
title = {Automated lateral sectioning for Knife-Edge Scanning Microscopy},
booktitle = {Proceedings of the 2008 {IEEE} International Symposium on Biomedical
Imaging: From Nano to Macro, Paris, France, May 14-17, 2008},
pages = {1371--1374},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/ISBI.2008.4541260},
doi = {10.1109/ISBI.2008.4541260},
timestamp = {Wed, 04 Oct 2023 17:01:25 +0200},
biburl = {https://dblp.org/rec/conf/isbi/KwonMCM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iser/AndersonHAHK08,
author = {Dean M. Anderson and
Thomas M. Howard and
David Apfelbaum and
Herman Herman and
Alonzo Kelly},
editor = {Oussama Khatib and
Vijay Kumar and
George J. Pappas},
title = {Coordinated Control and Range Imaging for Mobile Manipulation},
booktitle = {Experimental Robotics, The Eleventh International Symposium, {ISER}
2008, July 13-16, 2008, Athens, Greece},
series = {Springer Tracts in Advanced Robotics},
volume = {54},
pages = {547--556},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-642-00196-3\_63},
doi = {10.1007/978-3-642-00196-3\_63},
timestamp = {Wed, 14 Nov 2018 10:58:59 +0100},
biburl = {https://dblp.org/rec/conf/iser/AndersonHAHK08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micro/ZhengLZGDZ08,
author = {Hongzhong Zheng and
Jiang Lin and
Zhao Zhang and
Eugene Gorbatov and
Howard David and
Zhichun Zhu},
title = {Mini-rank: Adaptive {DRAM} architecture for improving memory power
efficiency},
booktitle = {41st Annual {IEEE/ACM} International Symposium on Microarchitecture
{(MICRO-41} 2008), November 8-12, 2008, Lake Como, Italy},
pages = {210--221},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/MICRO.2008.4771792},
doi = {10.1109/MICRO.2008.4771792},
timestamp = {Tue, 31 May 2022 14:39:58 +0200},
biburl = {https://dblp.org/rec/conf/micro/ZhengLZGDZ08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmetrics/LinZZGDZ08,
author = {Jiang Lin and
Hongzhong Zheng and
Zhichun Zhu and
Eugene Gorbatov and
Howard David and
Zhao Zhang},
editor = {Zhen Liu and
Vishal Misra and
Prashant J. Shenoy},
title = {Software thermal management of dram memory for multicore systems},
booktitle = {Proceedings of the 2008 {ACM} {SIGMETRICS} International Conference
on Measurement and Modeling of Computer Systems, {SIGMETRICS} 2008,
Annapolis, MD, USA, June 2-6, 2008},
pages = {337--348},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1375457.1375496},
doi = {10.1145/1375457.1375496},
timestamp = {Mon, 02 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigmetrics/LinZZGDZ08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wikis/KousettiMH08,
author = {Chrysovalanto Kousetti and
David E. Millard and
Yvonne Margaret Howard},
editor = {Ademar Aguiar and
Mark Bernstein},
title = {A study of ontology convergence in a semantic Wiki},
booktitle = {Proceedings of the 2008 International Symposium on Wikis, 2008, Porto,
Portugal, September 8-10, 2008},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1822258.1822281},
doi = {10.1145/1822258.1822281},
timestamp = {Thu, 28 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wikis/KousettiMH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wikis/MillardLH08,
author = {David E. Millard and
Rebecca Lewis and
Yvonne Margaret Howard},
editor = {Ademar Aguiar and
Mark Bernstein},
title = {LBWiki: a location-based Wiki},
booktitle = {Proceedings of the 2008 International Symposium on Wikis, 2008, Porto,
Portugal, September 8-10, 2008},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1822258.1822270},
doi = {10.1145/1822258.1822270},
timestamp = {Thu, 28 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wikis/MillardLH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/ShrobeLBGWTHE07,
author = {Howard E. Shrobe and
Robert Laddaga and
Robert Balzer and
Neil M. Goldman and
David S. Wile and
Marcelo Tallis and
Tim Hollebeek and
Alexander Egyed},
title = {{AWDRAT:} {A} Cognitive Middleware System for Information Survivability},
journal = {{AI} Mag.},
volume = {28},
number = {3},
pages = {73--91},
year = {2007},
url = {https://doi.org/10.1609/aimag.v28i3.2056},
doi = {10.1609/AIMAG.V28I3.2056},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/ShrobeLBGWTHE07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cie/FoldenJPTWHJJLO07,
author = {Dwayne Folden and
Trent Jackson and
Michael Panique and
Rianon Tiensvold and
Richard S. Wolff and
Todd Howard and
Eric Julian and
Levi Junkert and
David L{\'{o}}pez and
Michael J. Oudshoorn},
title = {An aircraft cabin wireless system for games and video entertainment},
journal = {Comput. Entertain.},
volume = {5},
number = {1},
pages = {7},
year = {2007},
url = {https://doi.org/10.1145/1236224.1236235},
doi = {10.1145/1236224.1236235},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cie/FoldenJPTWHJJLO07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/BerridgeABBCDDKLMRSSSTRRRW07,
author = {Rex Berridge and
Robert M. Averill III and
Arnold E. Barish and
Michael A. Bowen and
Peter J. Camporese and
Jack DiLullo and
Peter E. Dudley and
Joachim Keinert and
David W. Lewis and
Robert D. Morel and
Thomas E. Rosser and
Nicole S. Schwartz and
Philip Shephard and
Howard H. Smith and
Dave Thomas and
Phillip J. Restle and
John R. Ripley and
Stephen L. Runyon and
Patrick M. Williams},
title = {{IBM} {POWER6} microprocessor physical design and design methodology},
journal = {{IBM} J. Res. Dev.},
volume = {51},
number = {6},
pages = {685--714},
year = {2007},
url = {https://doi.org/10.1147/rd.516.0685},
doi = {10.1147/RD.516.0685},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/BerridgeABBCDDKLMRSSSTRRRW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/BaschAISSLPYFBSMS07,
author = {Ethan Basch and
David Artz and
Alexia Iasonos and
John Speakman and
Kevin Shannon and
Kai Lin and
Charmaine Pun and
Henry Yong and
Paul Fearn and
Allison Barz and
Howard I. Scher and
Mary McCabe and
Deborah Schrag},
title = {Application of Information Technology: Evaluation of an Online Platform
for Cancer Patient Self-reporting of Chemotherapy Toxicities},
journal = {J. Am. Medical Informatics Assoc.},
volume = {14},
number = {3},
pages = {264--268},
year = {2007},
url = {https://doi.org/10.1197/jamia.M2177},
doi = {10.1197/JAMIA.M2177},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/BaschAISSLPYFBSMS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/SequistCHTSB07,
author = {Thomas D. Sequist and
Theresa Cullen and
Howard Hays and
Maile M. Taualii and
Steven R. Simon and
David W. Bates},
title = {Implementation and Use of an Electronic Health Record within the Indian
Health Service},
journal = {J. Am. Medical Informatics Assoc.},
volume = {14},
number = {2},
pages = {191--197},
year = {2007},
url = {https://doi.org/10.1197/jamia.M2234},
doi = {10.1197/JAMIA.M2234},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/SequistCHTSB07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/CannonSDDGGLMBBCMMPRWZ07,
author = {Howard N. Cannon and
Carol R. Stoker and
Stephen E. Dunagan and
Kiel Davis and
Javier G{\'{o}}mez{-}Elvira and
Brian J. Glass and
Lawrence G. Lemke and
David P. Miller and
Rosalba Bonaccorsi and
Mark Branson and
Scott Christa and
Jos{\'{e}} Antonio Rodr{\'{\i}}guez Manfredi and
Erik Mumm and
Gale Paulsen and
Matt Roman and
Alois Winterholler and
Jhony R. Zavaleta},
title = {{MARTE:} Technology development and lessons learned from a Mars drilling
mission simulation},
journal = {J. Field Robotics},
volume = {24},
number = {10},
pages = {877--905},
year = {2007},
url = {https://doi.org/10.1002/rob.20224},
doi = {10.1002/ROB.20224},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfr/CannonSDDGGLMBBCMMPRWZ07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/order/HowardKY07,
author = {David M. Howard and
Mitchel T. Keller and
Stephen J. Young},
title = {A Characterization of Partially Ordered Sets with Linear Discrepancy
Equal to 2},
journal = {Order},
volume = {24},
number = {3},
pages = {139--153},
year = {2007},
url = {https://doi.org/10.1007/s11083-007-9065-1},
doi = {10.1007/S11083-007-9065-1},
timestamp = {Thu, 08 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/order/HowardKY07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamsc/ElmanHSST07,
author = {Howard C. Elman and
Victoria E. Howle and
John N. Shadid and
David J. Silvester and
Ray S. Tuminaro},
title = {Least Squares Preconditioners for Stabilized Discretizations of the
Navier-Stokes Equations},
journal = {{SIAM} J. Sci. Comput.},
volume = {30},
number = {1},
pages = {290--311},
year = {2007},
url = {https://doi.org/10.1137/060655742},
doi = {10.1137/060655742},
timestamp = {Thu, 30 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamsc/ElmanHSST07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/MullenHM07,
author = {Jack Mullen and
David M. Howard and
Damian T. Murphy},
title = {Real-Time Dynamic Articulations in the 2-D Waveguide Mesh Vocal Tract
Model},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {15},
number = {2},
pages = {577--585},
year = {2007},
url = {https://doi.org/10.1109/TASL.2006.876751},
doi = {10.1109/TASL.2006.876751},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taslp/MullenHM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/toms/ElmanRS07,
author = {Howard C. Elman and
Alison Ramage and
David J. Silvester},
title = {Algorithm 866: IFISS, a Matlab toolbox for modelling incompressible
flow},
journal = {{ACM} Trans. Math. Softw.},
volume = {33},
number = {2},
pages = {14},
year = {2007},
url = {https://doi.org/10.1145/1236463.1236469},
doi = {10.1145/1236463.1236469},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/toms/ElmanRS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ton/ChenBSK07,
author = {Yan Chen and
David Bindel and
Han Hee Song and
Randy H. Katz},
title = {Algebra-based scalable overlay network monitoring: algorithms, evaluation,
and applications},
journal = {{IEEE/ACM} Trans. Netw.},
volume = {15},
number = {5},
pages = {1084--1097},
year = {2007},
url = {http://doi.acm.org/10.1145/1322413.1322422},
doi = {10.1145/1322413.1322422},
timestamp = {Fri, 20 Oct 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ton/ChenBSK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecows/MillardDHGWAW07,
author = {David E. Millard and
Hugh C. Davis and
Yvonne Margaret Howard and
Lester Gilbert and
Robert John Walters and
Noura Abbas and
Gary B. Wills},
title = {The Service Responsibility and Interaction Design Method: Using an
Agile Approach for Web Service Design},
booktitle = {Fifth {IEEE} European Conference on Web Services {(ECOWS} 2007), 26-28
November 2007, Halle (Saale), Germany},
pages = {235--244},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/ECOWS.2007.25},
doi = {10.1109/ECOWS.2007.25},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ecows/MillardDHGWAW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/HowardTC07,
author = {David M. Howard and
Andy M. Tyrrell and
Crispin H. V. Cooper},
editor = {Dirk Thierens},
title = {Evolution of adult male oral tract shapes for close and open vowels},
booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2007, Proceedings,
London, England, UK, July 7-11, 2007, Companion Material},
pages = {2751--2758},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1274000.1274072},
doi = {10.1145/1274000.1274072},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gecco/HowardTC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ht/WillsACCGHMWW07,
author = {Gary B. Wills and
Noura Abbas and
Rakhi Chandrasekharan and
Richard M. Crowder and
Lester Gilbert and
Yvonne Margaret Howard and
David E. Millard and
Sylvia C. Wong and
Robert John Walters},
editor = {Simon Harper and
Helen Ashman and
Mark Bernstein and
Alexandra I. Cristea and
Hugh C. Davis and
Paul De Bra and
Vicki L. Hanson and
David E. Millard},
title = {An agile hypertext design methodology},
booktitle = {{HYPERTEXT} 2007, Proceedings of the 18th {ACM} Conference on Hypertext
and Hypermedia, September 10-12, 2007, Manchester, {UK}},
pages = {181--184},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1286240.1286295},
doi = {10.1145/1286240.1286295},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ht/WillsACCGHMWW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/MillardFGHSSW07,
author = {David E. Millard and
Karen Fill and
Lester Gilbert and
Yvonne Margaret Howard and
Patrick A. S. Sinclair and
Damilola O. Senbanjo and
Gary B. Wills},
editor = {J. Michael Spector and
Demetrios G. Sampson and
Toshio Okamoto and
Kinshuk and
Stefano A. Cerri and
Maomi Ueno and
Akihiro Kashihara},
title = {Towards a Canonical View of Peer Assessment},
booktitle = {Proceedings of the 7th {IEEE} International Conference on Advanced
Learning Technologies, {ICALT} 2007, Niigata, Japan, July 18-20, 2007},
pages = {793--797},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/ICALT.2007.260},
doi = {10.1109/ICALT.2007.260},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icalt/MillardFGHSSW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/JanovySSM07,
author = {David L. Janovy and
Jay Smith and
Howard Jay Siegel and
Anthony A. Maciejewski},
title = {Models and Heuristics for Robust Resource Allocation in Parallel and
Distributed Computing Systems},
booktitle = {21th International Parallel and Distributed Processing Symposium {(IPDPS}
2007), Proceedings, 26-30 March 2007, Long Beach, California, {USA}},
pages = {1--5},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/IPDPS.2007.370517},
doi = {10.1109/IPDPS.2007.370517},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/JanovySSM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/SmithBMSRSLSJGADP07,
author = {Jay Smith and
Luis Diego Briceno and
Anthony A. Maciejewski and
Howard Jay Siegel and
Timothy Renner and
Vladimir Shestak and
Joshua Ladd and
Andrew M. Sutton and
David L. Janovy and
Sudha Govindasamy and
Amin Alqudah and
Rinku Dewri and
Puneet Prakash},
title = {Measuring the Robustness of Resource Allocations in a Stochastic Dynamic
Environment},
booktitle = {21th International Parallel and Distributed Processing Symposium {(IPDPS}
2007), Proceedings, 26-30 March 2007, Long Beach, California, {USA}},
pages = {1--10},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/IPDPS.2007.370315},
doi = {10.1109/IPDPS.2007.370315},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/SmithBMSRSLSJGADP07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/MayerichMK07,
author = {David Mayerich and
Bruce H. McCormick and
John Keyser},
title = {Noise and Artifact Removal in Knife-Edge Scanning Microscopy},
booktitle = {Proceedings of the 2007 {IEEE} International Symposium on Biomedical
Imaging: From Nano to Macro, Washington, DC, USA, April 12-16, 2007},
pages = {556--559},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/ISBI.2007.356912},
doi = {10.1109/ISBI.2007.356912},
timestamp = {Wed, 04 Oct 2023 17:01:25 +0200},
biburl = {https://dblp.org/rec/conf/isbi/MayerichMK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/LinZZDZ07,
author = {Jiang Lin and
Hongzhong Zheng and
Zhichun Zhu and
Howard David and
Zhao Zhang},
editor = {Dean M. Tullsen and
Brad Calder},
title = {Thermal modeling and management of {DRAM} memory systems},
booktitle = {34th International Symposium on Computer Architecture {(ISCA} 2007),
June 9-13, 2007, San Diego, California, {USA}},
pages = {312--322},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1250662.1250701},
doi = {10.1145/1250662.1250701},
timestamp = {Mon, 02 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isca/LinZZDZ07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispass/LinZZZD07,
author = {Jiang Lin and
Hongzhong Zheng and
Zhichun Zhu and
Zhao Zhang and
Howard David},
title = {DRAM-Level Prefetching for Fully-Buffered {DIMM:} Design, Performance
and Power Saving},
booktitle = {2007 {IEEE} International Symposium on Performance Analysis of Systems
and Software, April 25-27, 2007, San Jose, California, USA, Proceedings},
pages = {94--104},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/ISPASS.2007.363740},
doi = {10.1109/ISPASS.2007.363740},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ispass/LinZZZD07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/TschanzKDHRVNHWLSTSTFKBAD07,
author = {James W. Tschanz and
Nam{-}Sung Kim and
Saurabh Dighe and
Jason Howard and
Gregory Ruhl and
Sriram R. Vangal and
Siva G. Narendra and
Yatin Hoskote and
Howard Wilson and
Carol Lam and
Matthew Shuman and
Carlos Tokunaga and
Dinesh Somasekhar and
Stephen Tang and
David Finan and
Tanay Karnik and
Nitin Borkar and
Nasser A. Kurd and
Vivek De},
title = {Adaptive Frequency and Biasing Techniques for Tolerance to Dynamic
Temperature-Voltage Variations and Aging},
booktitle = {2007 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2007, Digest of Technical Papers, San Francisco, CA, USA, February
11-15, 2007},
pages = {292--604},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/ISSCC.2007.373409},
doi = {10.1109/ISSCC.2007.373409},
timestamp = {Mon, 28 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/TschanzKDHRVNHWLSTSTFKBAD07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/VangalHRDWTFISJJVHB07,
author = {Sriram R. Vangal and
Jason Howard and
Gregory Ruhl and
Saurabh Dighe and
Howard Wilson and
James W. Tschanz and
David Finan and
Priya Iyer and
Arvind P. Singh and
Tiju Jacob and
Shailendra Jain and
Sriram Venkataraman and
Yatin Hoskote and
Nitin Borkar},
title = {An 80-Tile 1.28TFLOPS Network-on-Chip in 65nm {CMOS}},
booktitle = {2007 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2007, Digest of Technical Papers, San Francisco, CA, USA, February
11-15, 2007},
pages = {98--589},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/ISSCC.2007.373606},
doi = {10.1109/ISSCC.2007.373606},
timestamp = {Wed, 15 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/VangalHRDWTFISJJVHB07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lfcs/BlairJIR07,
author = {Howard A. Blair and
David W. Jakel and
Robert J. Irwin and
Angel J. Rivera},
editor = {Sergei N. Art{\"{e}}mov and
Anil Nerode},
title = {Elementary Differential Calculus on Discrete and Hybrid Structures},
booktitle = {Logical Foundations of Computer Science, International Symposium,
{LFCS} 2007, New York, NY, USA, June 4-7, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4514},
pages = {41--53},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-72734-7\_4},
doi = {10.1007/978-3-540-72734-7\_4},
timestamp = {Mon, 29 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lfcs/BlairJIR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rv/BarringerGR07,
author = {Howard Barringer and
Dov M. Gabbay and
David E. Rydeheard},
editor = {Oleg Sokolsky and
Serdar Tasiran},
title = {From Runtime Verification to Evolvable Systems},
booktitle = {Runtime Verification, 7th International Workshop, {RV} 2007, Vancouver,
Canada, March 13, 2007, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {4839},
pages = {97--110},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-77395-5\_9},
doi = {10.1007/978-3-540-77395-5\_9},
timestamp = {Tue, 14 May 2019 10:00:51 +0200},
biburl = {https://dblp.org/rec/conf/rv/BarringerGR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rv/BarringerRH07,
author = {Howard Barringer and
David E. Rydeheard and
Klaus Havelund},
editor = {Oleg Sokolsky and
Serdar Tasiran},
title = {Rule Systems for Run-Time Monitoring: From Eagleto RuleR},
booktitle = {Runtime Verification, 7th International Workshop, {RV} 2007, Vancouver,
Canada, March 13, 2007, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {4839},
pages = {111--125},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-77395-5\_10},
doi = {10.1007/978-3-540-77395-5\_10},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/rv/BarringerRH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/saso/ShrobeLBGWTHE07,
author = {Howard E. Shrobe and
Robert Laddaga and
Robert Balzer and
Neil M. Goldman and
David S. Wile and
Marcelo Tallis and
Tim Hollebeek and
Alexander Egyed},
title = {Self-Adaptive Systems for Information Survivability: {PMOP} and {AWDRAT}},
booktitle = {Proceedings of the First International Conference on Self-Adaptive
and Self-Organizing Systems, {SASO} 2007, Boston, MA, USA, July 9-11,
2007},
pages = {332--335},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/SASO.2007.50},
doi = {10.1109/SASO.2007.50},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/saso/ShrobeLBGWTHE07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigsoft/FosterEKMRU07,
author = {Howard Foster and
Wolfgang Emmerich and
Jeff Kramer and
Jeff Magee and
David S. Rosenblum and
Sebasti{\'{a}}n Uchitel},
editor = {Ivica Crnkovic and
Antonia Bertolino},
title = {Model checking service compositions under resource constraints},
booktitle = {Proceedings of the 6th joint meeting of the European Software Engineering
Conference and the {ACM} {SIGSOFT} International Symposium on Foundations
of Software Engineering, 2007, Dubrovnik, Croatia, September 3-7,
2007},
pages = {225--234},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1287624.1287657},
doi = {10.1145/1287624.1287657},
timestamp = {Tue, 01 Feb 2022 10:45:16 +0100},
biburl = {https://dblp.org/rec/conf/sigsoft/FosterEKMRU07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/soda/ApplegateCJKLW07,
author = {David L. Applegate and
Gruia C{\u{a}}linescu and
David S. Johnson and
Howard J. Karloff and
Katrina Ligett and
Jia Wang},
editor = {Nikhil Bansal and
Kirk Pruhs and
Clifford Stein},
title = {Compressing rectilinear pictures and minimizing access control lists},
booktitle = {Proceedings of the Eighteenth Annual {ACM-SIAM} Symposium on Discrete
Algorithms, {SODA} 2007, New Orleans, Louisiana, USA, January 7-9,
2007},
pages = {1066--1075},
publisher = {{SIAM}},
year = {2007},
url = {http://dl.acm.org/citation.cfm?id=1283383.1283498},
timestamp = {Tue, 15 Feb 2022 07:54:27 +0100},
biburl = {https://dblp.org/rec/conf/soda/ApplegateCJKLW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tase/BarringerRG07,
author = {Howard Barringer and
David E. Rydeheard and
Dov M. Gabbay},
title = {A Logical Framework for Monitoring and Evolving Software Components},
booktitle = {First Joint {IEEE/IFIP} Symposium on Theoretical Aspects of Software
Engineering, {TASE} 2007, June 5-8, 2007, Shanghai, China},
pages = {273--282},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/TASE.2007.4},
doi = {10.1109/TASE.2007.4},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/tase/BarringerRG07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/ChuangXHCM07,
author = {James Chuang and
Ni Xin and
Howard Huang and
Simon Chiu and
David G. Michelson},
title = {{UWB} Radiowave Propagation within the Passenger Cabin of a Boeing
737-200 Aircraft},
booktitle = {Proceedings of the 65th {IEEE} Vehicular Technology Conference, {VTC}
Spring 2007, 22-25 April 2007, Dublin, Ireland},
pages = {496--500},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/VETECS.2007.113},
doi = {10.1109/VETECS.2007.113},
timestamp = {Mon, 25 Feb 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vtc/ChuangXHCM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iwsos/2007,
editor = {David Hutchison and
Randy H. Katz},
title = {Self-Organizing Systems, Second International Workshop, {IWSOS} 2007,
The Lake District, UK, September 11-13, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4725},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-74917-2},
doi = {10.1007/978-3-540-74917-2},
isbn = {978-3-540-74916-5},
timestamp = {Mon, 26 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iwsos/2007.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/ShoemakerBWBCCLDBJ06,
author = {William C. Shoemaker and
David S. Bayard and
Charles C. J. Wo and
Andreas Botnen and
Linda S. Chan and
Li{-}Chien Chien and
Kevin Lu and
Demetrios Demetriades and
Howard Belzberg and
Roger W. Jelliffe},
title = {Stochastic model for outcome prediction in acute illness},
journal = {Comput. Biol. Medicine},
volume = {36},
number = {6},
pages = {585--600},
year = {2006},
url = {https://doi.org/10.1016/j.compbiomed.2005.03.006},
doi = {10.1016/J.COMPBIOMED.2005.03.006},
timestamp = {Wed, 02 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cbm/ShoemakerBWBCCLDBJ06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cluster/KimHKSJILPPF06,
author = {Jong{-}Kook Kim and
Debra A. Hensgen and
Taylor Kidd and
Howard Jay Siegel and
David St. John and
Cynthia E. Irvine and
Timothy E. Levin and
N. Wayne Porter and
Viktor K. Prasanna and
Richard F. Freund},
title = {A flexible multi-dimensional QoS performance measure framework for
distributed heterogeneous systems},
journal = {Clust. Comput.},
volume = {9},
number = {3},
pages = {281--296},
year = {2006},
url = {https://doi.org/10.1007/s10586-006-9741-8},
doi = {10.1007/S10586-006-9741-8},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cluster/KimHKSJILPPF06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eor/French06,
author = {Simon French},
title = {Howard Raiffa, John Richardson and David Metcalfe, Editors, Negotiation
Analysis: The Science and Art of Collaborative Decision Making, Harvard
University Press, Cambridge, Mass {(2002)} {ISBN} 0-674-00890-1, p.
xiv+548 {GBP32.95}},
journal = {Eur. J. Oper. Res.},
volume = {168},
number = {2},
pages = {655--656},
year = {2006},
url = {https://doi.org/10.1016/j.ejor.2005.01.002},
doi = {10.1016/J.EJOR.2005.01.002},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eor/French06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/CooperMHT06,
author = {Crispin H. V. Cooper and
Damian T. Murphy and
David M. Howard and
Alexander Tyrrell},
title = {Singing synthesis with an evolved physical model},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {14},
number = {4},
pages = {1454--1461},
year = {2006},
url = {https://doi.org/10.1109/TSA.2005.860844},
doi = {10.1109/TSA.2005.860844},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taslp/CooperMHT06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/MullenHM06,
author = {Jack Mullen and
David M. Howard and
Damian T. Murphy},
title = {Waveguide physical modeling of vocal tract acoustics: flexible formant
bandwidth control from increased model dimensionality},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {14},
number = {3},
pages = {964--971},
year = {2006},
url = {https://doi.org/10.1109/TSA.2005.858052},
doi = {10.1109/TSA.2005.858052},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taslp/MullenHM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ShrobeLBGWTHE06,
author = {Howard E. Shrobe and
Robert Laddaga and
Robert Balzer and
Neil M. Goldman and
David S. Wile and
Marcelo Tallis and
Tim Hollebeek and
Alexander Egyed},
title = {{AWDRAT:} {A} Cognitive Middleware System for Information Survivability},
booktitle = {Proceedings, The Twenty-First National Conference on Artificial Intelligence
and the Eighteenth Innovative Applications of Artificial Intelligence
Conference, July 16-20, 2006, Boston, Massachusetts, {USA}},
pages = {1836--1843},
publisher = {{AAAI} Press},
year = {2006},
url = {http://www.aaai.org/Library/AAAI/2006/aaai06-303.php},
timestamp = {Tue, 05 Sep 2023 09:10:47 +0200},
biburl = {https://dblp.org/rec/conf/aaai/ShrobeLBGWTHE06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/MillerTL06,
author = {Haynes R. Miller and
David L. Trumper and
Kent H. Lundberg},
title = {A Brief Treatment of Generalized Functions for Use in Teaching the
Laplace Transform},
booktitle = {45th {IEEE} Conference on Decision and Control, {CDC} 2006, San Diego,
CA, USA, December 13-15, 2006},
pages = {3885--3889},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/CDC.2006.377468},
doi = {10.1109/CDC.2006.377468},
timestamp = {Fri, 04 Mar 2022 13:26:30 +0100},
biburl = {https://dblp.org/rec/conf/cdc/MillerTL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/ShiH06,
author = {Kaijian Shi and
David Howard},
editor = {Ellen Sentovich},
title = {Challenges in sleep transistor design and implementation in low-power
designs},
booktitle = {Proceedings of the 43rd Design Automation Conference, {DAC} 2006,
San Francisco, CA, USA, July 24-28, 2006},
pages = {113--116},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1146909.1146943},
doi = {10.1145/1146909.1146943},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dac/ShiH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecce/ManserHG06,
author = {Tanja Manser and
Steven K. Howard and
David M. Gaba},
editor = {Antonio Rizzo and
Gudela Grote and
William Wong},
title = {Self-regulation as a central mechanism to collaboratively manage unexpected
events in complex work environments},
booktitle = {Proceedings of the 13th Eurpoean conference on Cognitive ergonomics
- trust and control in complex socio-technical systems, {ECCE} '06,
Zurich, Switzerland, September 20-22, 2006},
pages = {162--169},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1274892.1274924},
doi = {10.1145/1274892.1274924},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ecce/ManserHG06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecows/MillardHCDJGW06,
author = {David E. Millard and
Yvonne Margaret Howard and
Swapna Chennupati and
Hugh C. Davis and
Ehtesham{-}Rasheed Jam and
Lester Gilbert and
Gary B. Wills},
title = {Design Patterns for Wrapping Similar Legacy Systems with Common Service
Interfaces},
booktitle = {Fourth {IEEE} European Conference on Web Services {(ECOWS} 2006),
4-6 December 2006, Z{\"{u}}rich, Switzerland},
pages = {191--200},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ECOWS.2006.14},
doi = {10.1109/ECOWS.2006.14},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ecows/MillardHCDJGW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/TresadernTKHG06,
author = {Philip A. Tresadern and
Sibylle B. Thies and
Laurence P. J. Kenney and
David Howard and
John Yannis Goulermas},
title = {Artificial Neural Network Prediction Using Accelerometers to Control
Upper Limb {FES} During Reaching and Grasping Following Stroke},
booktitle = {28th International Conference of the {IEEE} Engineering in Medicine
and Biology Society, {EMBC} 2006, New York City, NY, USA, August 30
- September 3, 2006, Main Volume},
pages = {2916--2919},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/IEMBS.2006.260447},
doi = {10.1109/IEMBS.2006.260447},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/TresadernTKHG06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/MillardBDGHW06,
author = {David E. Millard and
Christopher Bailey and
Hugh C. Davis and
Lester Gilbert and
Yvonne Margaret Howard and
Gary B. Wills},
title = {The e-Learning Assessment Landscape},
booktitle = {Proceedings of the 6th {IEEE} International Conference on Advanced
Learning Technologies, {ICALT} 2006, Kerkrade, The Netherlands, July
5-7, 2006},
pages = {964--966},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ICALT.2006.1652604},
doi = {10.1109/ICALT.2006.1652604},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icalt/MillardBDGHW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnn/MichelAR06,
author = {Howard E. Michel and
Abdul Ahad S. Awwal and
David Rancour},
title = {Artificial Neural Networks Using Complex Numbers and Phase Encoded
Weights - Electronic and Optical Implementations},
booktitle = {Proceedings of the International Joint Conference on Neural Networks,
{IJCNN} 2006, part of the {IEEE} World Congress on Computational Intelligence,
{WCCI} 2006, Vancouver, BC, Canada, 16-21 July 2006},
pages = {486--491},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/IJCNN.2006.246721},
doi = {10.1109/IJCNN.2006.246721},
timestamp = {Tue, 10 Aug 2021 14:29:47 +0200},
biburl = {https://dblp.org/rec/conf/ijcnn/MichelAR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/LiouHM06,
author = {Anthony E.{-}L. Liou and
Howard H.{-}H. Huang and
David G. Michelson},
title = {Issues in the Estimation of Ricean K-Factor from Correlated Samples},
booktitle = {Proceedings of the 64th {IEEE} Vehicular Technology Conference, {VTC}
Fall 2006, 25-28 September 2006, Montr{\'{e}}al, Qu{\'{e}}bec,
Canada},
pages = {1--4},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/VTCF.2006.28},
doi = {10.1109/VTCF.2006.28},
timestamp = {Sun, 21 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vtc/LiouHM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/woc/FoldenHJJJLPTOW06,
author = {Dwayne Folden and
Todd Howard and
Trent Jackson and
Eric Julian and
Levi Junkert and
David L{\'{o}}pez and
Michael Panique and
Rianon Tiensvold and
Michael J. Oudshoorn and
Richard S. Wolff},
editor = {Abraham O. Fapojuwo and
Bozena Kaminska},
title = {A Wireless Computer Games and Video Entertainment System for the Aircraft
Cabin Environment},
booktitle = {Sixth {IASTED} International Multi-Conference on Wireless and Optical
Communications: Conference on Communication Systems and Applications,
Conference on Optical Communication Systems and Networks, Conference
on Wireless Networks and Emerging Technologies, Conference on Wireless
{SENSOR} Networks, Banff, Alberta, Canada, July 3-5, 2006},
publisher = {{IASTED/ACTA} Press},
year = {2006},
timestamp = {Tue, 26 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/woc/FoldenHJJJLPTOW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/BeckVWSPCRSHVITFLLFKHGGJFBKRGGSHHE05,
author = {Richard A. Beck and
Robert K. Vincent and
Doyle W. Watts and
Marc A. Seibert and
David P. Pleva and
Michael A. Cauley and
Calvin T. Ramos and
Theresa M. Scott and
Dean W. Harter and
Mary Vickerman and
David Irmies and
Al Tucholski and
Brian Frantz and
Glenn Lindamood and
Isaac Lopez and
Gregory J. Follen and
Thaddeus J. Kollar and
Jay Horowitz and
Robert Griffin and
Raymond Gilstrap and
Marjory J. Johnson and
Kenneth Freeman and
Celeste Banaag and
Joseph Kosmo and
Amy Ross and
Kevin Groneman and
Jeffrey Graham and
Kim Shillcutt and
Robert Hirsh and
Nathan Howard and
Dean B. Eppler},
title = {A space-based end-to-end prototype geographic information network
for lunar and planetary exploration and emergency response {(2002}
and 2003 field experiments)},
journal = {Comput. Networks},
volume = {47},
number = {5},
pages = {765--783},
year = {2005},
url = {https://doi.org/10.1016/j.comnet.2004.08.010},
doi = {10.1016/J.COMNET.2004.08.010},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cn/BeckVWSPCRSHVITFLLFKHGGJFBKRGGSHHE05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/BuckeridgeBCHM05,
author = {David L. Buckeridge and
Howard S. Burkom and
Murray Campbell and
William R. Hogan and
Andrew W. Moore},
title = {Algorithms for rapid outbreak detection: a research synthesis},
journal = {J. Biomed. Informatics},
volume = {38},
number = {2},
pages = {99--113},
year = {2005},
url = {https://doi.org/10.1016/j.jbi.2004.11.007},
doi = {10.1016/J.JBI.2004.11.007},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/BuckeridgeBCHM05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/NguyenHH05,
author = {Thanh Ha Nguyen and
David E. Hibbs and
Si{\^{a}}n T. Howard},
title = {Conformations, energies, and intramolecular hydrogen bonds in dicarboxylic
acids: Implications for the design of synthetic dicarboxylic acid
receptors},
journal = {J. Comput. Chem.},
volume = {26},
number = {12},
pages = {1233--1241},
year = {2005},
url = {https://doi.org/10.1002/jcc.20259},
doi = {10.1002/JCC.20259},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcc/NguyenHH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jml/BlairBH05,
author = {David Blair and
Andreas Blass and
Paul E. Howard},
title = {Divisibility of Dedekind finite Sets},
journal = {J. Math. Log.},
volume = {5},
number = {1},
year = {2005},
url = {https://doi.org/10.1142/S0219061305000389},
doi = {10.1142/S0219061305000389},
timestamp = {Thu, 28 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jml/BlairBH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocn/JohnsonSKRALD05,
author = {Sterling C. Johnson and
Taylor W. Schmitz and
Tisha N. Kawahara{-}Baccus and
Howard A. Rowley and
Andrew L. Alexander and
Jonghoon Lee and
Richard J. Davidson},
title = {The Cerebral Response during Subjective Choice with and without Self-reference},
journal = {J. Cogn. Neurosci.},
volume = {17},
number = {12},
pages = {1897--1906},
year = {2005},
url = {https://doi.org/10.1162/089892905775008607},
doi = {10.1162/089892905775008607},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jocn/JohnsonSKRALD05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pc/ShivleSSMBCDKPPSSSSSV05,
author = {Sameer Shivle and
Prasanna Sugavanam and
Howard Jay Siegel and
Anthony A. Maciejewski and
Tarun Banka and
Kiran Chindam and
Steve Dussinger and
Andrew Kutruff and
Prashanth Penumarthy and
Prakash Pichumani and
Praveen Satyasekaran and
David Sendek and
Jay Smith and
J. Sousa and
Jayashree Sridharan and
Jose Velazco},
title = {Mapping subtasks with multiple versions on an ad hoc grid},
journal = {Parallel Comput.},
volume = {31},
number = {7},
pages = {671--690},
year = {2005},
url = {https://doi.org/10.1016/j.parco.2005.04.003},
doi = {10.1016/J.PARCO.2005.04.003},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pc/ShivleSSMBCDKPPSSSSSV05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/CamposH05,
author = {G. R. Campos and
David M. Howard},
title = {On the Computational Efficiency of Different Waveguide Mesh Topologies
for Room Acoustic Simulation},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {13},
number = {5-2},
pages = {1063--1072},
year = {2005},
url = {https://doi.org/10.1109/TSA.2005.852015},
doi = {10.1109/TSA.2005.852015},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taslp/CamposH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/GoulermasFNHB05,
author = {John Yannis Goulermas and
Andrew H. Findlow and
Christopher J. Nester and
David Howard and
Peter Bowker},
title = {Automated design of robust discriminant analysis classifier for foot
pressure lesions using kinematic data},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {52},
number = {9},
pages = {1549--1562},
year = {2005},
url = {https://doi.org/10.1109/TBME.2005.851519},
doi = {10.1109/TBME.2005.851519},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/GoulermasFNHB05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/BelvinEGGKMMNNT05,
author = {Robert S. Belvin and
Emil Ettelaie and
Sudeep Gandhe and
Panayiotis G. Georgiou and
Kevin Knight and
Daniel Marcu and
Scott Millward and
Shrikanth S. Narayanan and
Howard Neely and
David R. Traum},
editor = {Kevin Knight and
Hwee Tou Ng and
Kemal Oflazer},
title = {Transonics: {A} Practical Speech-to-Speech Translator for English-Farsi
Medical Dialogs},
booktitle = {{ACL} 2005, 43rd Annual Meeting of the Association for Computational
Linguistics, Proceedings of the Conference, 25-30 June 2005, University
of Michigan, {USA}},
pages = {89--92},
publisher = {The Association for Computer Linguistics},
year = {2005},
url = {https://aclanthology.org/P05-3023/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/BelvinEGGKMMNNT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/birthday/BarringerR05,
author = {Howard Barringer and
David E. Rydeheard},
editor = {Sergei N. Art{\"{e}}mov and
Howard Barringer and
Artur S. d'Avila Garcez and
Lu{\'{\i}}s C. Lamb and
John Woods},
title = {Modelling Evolvable Systems: {A} Temporal Logic View},
booktitle = {We Will Show Them! Essays in Honour of Dov Gabbay, Volume One},
pages = {195--228},
publisher = {College Publications},
year = {2005},
timestamp = {Thu, 09 Jul 2020 09:13:39 +0200},
biburl = {https://dblp.org/rec/conf/birthday/BarringerR05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clawar/KenneyTMBBHSHAHBHS05,
author = {Laurence P. J. Kenney and
Paul Taylor and
Geraldine Mann and
Gerrit Bultstra and
Hendrik Buschman and
Hermie J. Hermens and
Per J. Slycke and
John Hobby and
N. van der Aa and
Ben W. Heller and
A. Barker and
David Howard and
N. Sha},
editor = {Mohammad Osman Tokhi and
Gurvinder S. Virk and
M. Alamgir Hossain},
title = {Recent Developments in Implantable and Surface Based Dropped Foot
Functional Electrical Stimulators},
booktitle = {Climbing and Walking Robots - Proceedings of the 8th International
Conference on Climbing and Walking Robots and the Support Technologies
for Mobile Machines, {CLAWAR} 2005, London, UK, September 13-15, 2005},
pages = {89--96},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/3-540-26415-9\_10},
doi = {10.1007/3-540-26415-9\_10},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/clawar/KenneyTMBBHSHAHBHS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cpsn/MichelR05,
author = {Howard E. Michel and
David Rancour},
editor = {Hamid R. Arabnia},
title = {Using Heat Plumes in Controlled Breathing as Non-Contact Assistive
Technology},
booktitle = {Proceedings of The 2005 International Conference on Computers for
People with Special Needs, {CPSN} 2005, Las Vegas, Nevada, USA, June
20-23, 2005},
pages = {63--69},
publisher = {{CSREA} Press},
year = {2005},
timestamp = {Wed, 15 Feb 2006 12:44:30 +0100},
biburl = {https://dblp.org/rec/conf/cpsn/MichelR05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/JunyentFMCBF05,
author = {Francesc Junyent and
Stephen J. Frasier and
David J. McLaughlin and
Venkatachalam Chandrasekar and
Howard Bluestein and
Michael French},
title = {High resolution dual-polarization radar observation of tornados: implications
for radar development and tornado detection},
booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
{IGARSS} 2005, July 25-29, 2005, Seoul, Korea, Proceedings},
pages = {2034--2037},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/IGARSS.2005.1526414},
doi = {10.1109/IGARSS.2005.1526414},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/JunyentFMCBF05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejasp/HowardR04,
author = {David M. Howard and
Stuart Rimell},
title = {Real-Time Gesture-Controlled Physical Modelling Music Synthesis with
Tactile Feedback},
journal = {{EURASIP} J. Adv. Signal Process.},
volume = {2004},
number = {7},
pages = {1001--1006},
year = {2004},
url = {https://doi.org/10.1155/S1110865704311182},
doi = {10.1155/S1110865704311182},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ejasp/HowardR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/McCormickKCAKMMD04,
author = {Bruce H. McCormick and
Wonryull Koh and
Yoonsuck Choe and
Louise C. Abbott and
John Keyser and
David Mayerich and
Zeki Melek and
Purna Doddapaneni},
title = {Construction of anatomically correct models of mouse brain networks},
journal = {Neurocomputing},
volume = {58-60},
pages = {379--386},
year = {2004},
url = {https://doi.org/10.1016/j.neucom.2004.01.070},
doi = {10.1016/J.NEUCOM.2004.01.070},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/McCormickKCAKMMD04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaifs/NarayananABEGGG04,
author = {Shri Narayanan and
S. Ananthakrishnan and
Robert S. Belvin and
Emil Ettelaie and
Sudeep Gandhe and
Shadi Ganjavi and
Panayiotis G. Georgiou and
C. M. Hein and
S. Kadambe and
Kevin Knight and
Daniel Marcu and
Howard Neely and
Naveen Srinivasamurthy and
David R. Traum and
Dagen Wang},
title = {The Transonics Spoken Dialogue Translator: An Aid for English-Persian
Doctor-Patient Interviews},
booktitle = {Dialogue Systems for Health Communication, Papers from the 2004 {AAAI}
Fall Symposium. Arlington, VA, USA, October 22-24, 2004},
volume = {{FS-04-04}},
pages = {97--103},
publisher = {{AAAI} Press},
year = {2004},
url = {https://www.aaai.org/Library/Symposia/Fall/2004/fs04-04-015.php},
timestamp = {Fri, 04 Sep 2020 13:38:34 +0200},
biburl = {https://dblp.org/rec/conf/aaaifs/NarayananABEGGG04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asist/OConnorBWMMM04,
author = {Brian C. O'Connor and
David Blair and
Howard D. White and
Francis Miksa and
Jens{-}Erik Mai and
Shawne D. Miksa},
title = {Knowledge, information and behavior - {A} tribute to Patrick Wilson
{(SIG} HFIS, {CR)}},
booktitle = {Managing and Enhancing Information: Cultures and Conflicts - Proceedings
of the 67th ASIS{\&}T Annual Meeting, {ASIST} 2004, Providence,
Rhode Island, USA, November 12-17, 2004},
series = {Proc. Assoc. Inf. Sci. Technol.},
volume = {41},
number = {1},
pages = {554},
publisher = {Wiley},
year = {2004},
url = {https://doi.org/10.1002/meet.1450410170},
doi = {10.1002/MEET.1450410170},
timestamp = {Fri, 21 Jan 2022 13:55:35 +0100},
biburl = {https://dblp.org/rec/conf/asist/OConnorBWMMM04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bncod/CawseyDPWMM04,
author = {Alison Cawsey and
Euan W. Dempster and
Daniel Pacey and
M. Howard Williams and
David H. Marwick and
Lachlan M. MacKinnon},
editor = {M. Howard Williams and
Lachlan M. MacKinnon},
title = {Constraining {XML} Transformations for Personalised Information Presentation},
booktitle = {Key Technologies for Data Management, 21st British National Conference
on Databases, {BNCOD} 21, Edinburgh, UK, July 7-9, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3112},
pages = {136--143},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-27811-5\_13},
doi = {10.1007/978-3-540-27811-5\_13},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/bncod/CawseyDPWMM04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/FigueiraNCCDGHLMMT04,
author = {Silvia M. Figueira and
Sumit Naiksatam and
Howard J. Cohen and
Doug Cutrell and
Paul Daspit and
David Gutierrez and
Doan B. Hoang and
Tal Lavian and
Joe Mambretti and
Steve Merrill and
Franco Travostino},
title = {{DWDM-RAM:} enabling Grid services with dynamic optical networks},
booktitle = {4th {IEEE/ACM} International Symposium on Cluster Computing and the
Grid (CCGrid 2004), April 19-22, 2004, Chicago, Illinois, {USA}},
pages = {707--714},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/CCGrid.2004.1336702},
doi = {10.1109/CCGRID.2004.1336702},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ccgrid/FigueiraNCCDGHLMMT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/LavianMCCMDDMNFGHT04,
author = {Tal Lavian and
Joe Mambretti and
Doug Cutrell and
Howard J. Cohen and
Steve Merrill and
Ramesh Durairaj and
Paul Daspit and
Inder Monga and
Sumit Naiksatam and
Silvia M. Figueira and
David Gutierrez and
Doan B. Hoang and
Franco Travostino},
title = {{DWDM-RAM:} a data intensive Grid service architecture enabled by
dynamic optical networks},
booktitle = {4th {IEEE/ACM} International Symposium on Cluster Computing and the
Grid (CCGrid 2004), April 19-22, 2004, Chicago, Illinois, {USA}},
pages = {762--764},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/CCGrid.2004.1336710},
doi = {10.1109/CCGRID.2004.1336710},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ccgrid/LavianMCCMDDMNFGHT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csreaESA/MichelRI04,
author = {Howard E. Michel and
David Rancour and
Sushanth Iringentavida},
editor = {Hamid R. Arabnia and
Minyi Guo and
Laurence Tianruo Yang},
title = {{CMOS} Implementation of Phase-Encoded Complex-Valued Artificial Neural
Networks},
booktitle = {Proceedings of the International Conference on Embedded Systems and
Applications, {ESA} '04 {\&} Proceedings of the International
Conference on VLSI, {VLSI} '04, June 21-24, 2004, Las Vegas, Nevada,
{USA}},
pages = {551--557},
publisher = {{CSREA} Press},
year = {2004},
timestamp = {Fri, 04 Mar 2005 11:26:21 +0100},
biburl = {https://dblp.org/rec/conf/csreaESA/MichelRI04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/CooperHT04,
author = {Crispin H. V. Cooper and
David M. Howard and
Andrew M. Tyrrell},
editor = {G{\"{u}}nther R. Raidl and
Stefano Cagnoni and
J{\"{u}}rgen Branke and
David Corne and
Rolf Drechsler and
Yaochu Jin and
Colin G. Johnson and
Penousal Machado and
Elena Marchiori and
Franz Rothlauf and
George D. Smith and
Giovanni Squillero},
title = {Using GAs to Create a Waveguide Model of the Oral Vocal Tract},
booktitle = {Applications of Evolutionary Computing, EvoWorkshops 2004: EvoBIO,
EvoCOMNET, EvoHOT, EvoIASP, EvoMUSART, and EvoSTOC, Coimbra, Portugal,
April 5-7, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3005},
pages = {280--288},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-24653-4\_29},
doi = {10.1007/978-3-540-24653-4\_29},
timestamp = {Tue, 14 May 2019 10:00:37 +0200},
biburl = {https://dblp.org/rec/conf/evoW/CooperHT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/FalknerDHMMN04,
author = {Katrina Falkner and
Henry Detmold and
Diana Howard and
David S. Munro and
Ronald Morrison and
Stuart J. Norcross},
title = {Unifying Static and Dynamic Approaches to Evolution through the Compliant
Systems Architecture},
booktitle = {37th Hawaii International Conference on System Sciences {(HICSS-37}
2004), {CD-ROM} / Abstracts Proceedings, 5-8 January 2004, Big Island,
HI, {USA}},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/HICSS.2004.1265637},
doi = {10.1109/HICSS.2004.1265637},
timestamp = {Mon, 17 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hicss/FalknerDHMMN04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/MaoJRWK04,
author = {Zhuoqing Morley Mao and
David Johnson and
Jennifer Rexford and
Jia Wang and
Randy H. Katz},
title = {Scalable and Accurate Identification of AS-level Forwarding Paths},
booktitle = {Proceedings {IEEE} {INFOCOM} 2004, The 23rd Annual Joint Conference
of the {IEEE} Computer and Communications Societies, Hong Kong, China,
March 7-11, 2004},
pages = {1605--1615},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/INFCOM.2004.1354573},
doi = {10.1109/INFCOM.2004.1354573},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/infocom/MaoJRWK04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/ShivleCSMBCDPSSSSSSV04,
author = {Sameer Shivle and
Ralph H. Castain and
Howard Jay Siegel and
Anthony A. Maciejewski and
Tarun Banka and
Kiran Chindam and
Steve Dussinger and
Prakash Pichumani and
Praveen Satyasekaran and
William W. Saylor and
David Sendek and
J. Sousa and
Jayashree Sridharan and
Prasanna Sugavanam and
Jose Velazco},
title = {Static Mapping of Subtasks in a Heterogeneous Ad Hoc Grid Environment},
booktitle = {18th International Parallel and Distributed Processing Symposium {(IPDPS}
2004), {CD-ROM} / Abstracts Proceedings, 26-30 April 2004, Santa Fe,
New Mexico, {USA}},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/IPDPS.2004.1303062},
doi = {10.1109/IPDPS.2004.1303062},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/ShivleCSMBCDPSSSSSSV04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispdc/ShivleSMBCDKPPSSSSSV04,
author = {Sameer Shivle and
Howard Jay Siegel and
Anthony A. Maciejewski and
Tarun Banka and
Kiran Chindam and
Steve Dussinger and
Andrew Kutruff and
Prashanth Penumarthy and
Prakash Pichumani and
Praveen Satyasekaran and
David Sendek and
J. Sousa and
Jayashree Sridharan and
Prasanna Sugavanam and
Jose Velazco},
title = {Mapping of Subtasks with Multiple Versions in a Heterogeneous Ad Hoc
Grid Environment},
booktitle = {3rd International Symposium on Parallel and Distributed Computing
{(ISPDC} 2004), 3rd International Workshop on Algorithms, Models and
Tools for Parallel Computing on Heterogenous Networks (HeteroPar 2004),
5-7 July 2004, Cork, Ireland},
pages = {380--387},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/ISPDC.2004.34},
doi = {10.1109/ISPDC.2004.34},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ispdc/ShivleSMBCDKPPSSSSSV04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/para/BalleBLR04,
author = {Susanne M. Balle and
John L. Bishop and
David LaFrance{-}Linden and
Howard Rifkin},
editor = {Jack J. Dongarra and
Kaj Madsen and
Jerzy Wasniewski},
title = {Ygdrasil: Aggregator Network Toolkit for Large Scale Systems and the
Grid},
booktitle = {Applied Parallel Computing, State of the Art in Scientific Computing,
7th International Workshop, {PARA} 2004, Lyngby, Denmark, June 20-23,
2004, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {3732},
pages = {207--216},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/11558958\_24},
doi = {10.1007/11558958\_24},
timestamp = {Tue, 14 May 2019 10:00:40 +0200},
biburl = {https://dblp.org/rec/conf/para/BalleBLR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sab/PaytonEH04,
author = {David W. Payton and
Regina Estkowski and
Mike Howard},
editor = {Erol Sahin and
William M. Spears},
title = {Pheromone Robotics and the Logic of Virtual Pheromones},
booktitle = {Swarm Robotics, {SAB} 2004 International Workshop, Santa Monica, CA,
USA, July 17, 2004, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {3342},
pages = {45--57},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30552-1\_5},
doi = {10.1007/978-3-540-30552-1\_5},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/sab/PaytonEH04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/ChenBSK04,
author = {Yan Chen and
David Bindel and
Han Hee Song and
Randy H. Katz},
editor = {Raj Yavatkar and
Ellen W. Zegura and
Jennifer Rexford},
title = {An algebraic approach to practical and scalable overlay network monitoring},
booktitle = {Proceedings of the {ACM} {SIGCOMM} 2004 Conference on Applications,
Technologies, Architectures, and Protocols for Computer Communication,
August 30 - September 3, 2004, Portland, Oregon, {USA}},
pages = {55--66},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/1015467.1015475},
doi = {10.1145/1015467.1015475},
timestamp = {Wed, 21 Jul 2021 16:09:54 +0200},
biburl = {https://dblp.org/rec/conf/sigcomm/ChenBSK04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/visualization/McCormickDMMK04,
author = {Bruce H. McCormick and
Purna Doddapaneni and
David Mayerich and
Zeki Melek and
John Keyser},
title = {Compression, Segmentation, and Modeling of Large-Scale Filamentary
Volumetric Data},
booktitle = {15th {IEEE} Visualization Conference, {IEEE} Vis 2004, Austin, TX,
USA, October 10-15, 2004, Proceedings},
pages = {31},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/VISUAL.2004.16},
doi = {10.1109/VISUAL.2004.16},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/visualization/McCormickDMMK04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HoskoteBDEFHKNR03,
author = {Yatin Vasant Hoskote and
Bradley A. Bloechel and
Gregory E. Dermer and
Vasantha Erraguntla and
David Finan and
Jason Howard and
Dan Klowden and
Siva G. Narendra and
Greg Ruhl and
James W. Tschanz and
Sriram R. Vangal and
Venkat Veeramachaneni and
Howard Wilson and
Jianping Xu and
Nitin Borkar},
title = {A {TCP} offload accelerator for 10 Gb/s Ethernet in 90-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {38},
number = {11},
pages = {1866--1875},
year = {2003},
url = {https://doi.org/10.1109/JSSC.2003.818294},
doi = {10.1109/JSSC.2003.818294},
timestamp = {Wed, 20 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HoskoteBDEFHKNR03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qip/AbbottDCLBHFGBK03,
author = {Derek Abbott and
Charles R. Doering and
Carlton M. Caves and
Daniel M. Lidar and
Howard E. Brandt and
Alex R. Hamilton and
David K. Ferry and
Julio Gea{-}Banacloche and
Sergey M. Bezrukov and
Laszlo B. Kish},
title = {Dreams Versus Reality: Plenary Debate Session on Quantum Computing},
journal = {Quantum Inf. Process.},
volume = {2},
number = {6},
pages = {449--472},
year = {2003},
url = {https://doi.org/10.1023/B\%3AQINP.0000042203.24782.9a},
doi = {10.1023/B\%3AQINP.0000042203.24782.9A},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qip/AbbottDCLBHFGBK03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ras/PaytonEH03,
author = {David W. Payton and
Regina Estkowski and
Mike Howard},
title = {Compound behaviors in pheromone robotics},
journal = {Robotics Auton. Syst.},
volume = {44},
number = {3-4},
pages = {229--240},
year = {2003},
url = {https://doi.org/10.1016/S0921-8890(03)00073-3},
doi = {10.1016/S0921-8890(03)00073-3},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ras/PaytonEH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003},
url = {https://doi.org/10.1145/945546.945549},
doi = {10.1145/945546.945549},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/StrowHSMT03,
author = {Larrabee L. Strow and
Scott E. Hannon and
Sergio De Souza{-}Machado and
Howard E. Motteler and
David C. Tobin},
title = {An overview of the {AIRS} radiative transfer model},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {41},
number = {2},
pages = {303--313},
year = {2003},
url = {https://doi.org/10.1109/TGRS.2002.808244},
doi = {10.1109/TGRS.2002.808244},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/StrowHSMT03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/MavigliaSBK03,
author = {Saverio M. Maviglia and
Howard R. Strasberg and
David W. Bates and
Gilad J. Kuperman},
title = {KnowledgeLink Update: Just-in-time Context-sensitive Information Retrieval},
booktitle = {{AMIA} 2003, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 8-12, 2003},
publisher = {{AMIA}},
year = {2003},
url = {https://knowledge.amia.org/amia-55142-a2003a-1.616734/t-002-1.618748/f-001-1.618749/a-311-1.619153/a-312-1.619150},
timestamp = {Wed, 17 Apr 2024 11:48:28 +0200},
biburl = {https://dblp.org/rec/conf/amia/MavigliaSBK03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bncod/DempsterPWCMM03,
author = {Euan W. Dempster and
Daniel Pacey and
M. Howard Williams and
Alison Cawsey and
David H. Marwick and
Lachlan M. MacKinnon},
editor = {Anne E. James and
Brian Lings and
Muhammad Younas},
title = {Tools for Personalised Presentation of Information},
booktitle = {New Horizons in Information Management, 20th British National Conference
on Databases, {BNCOD} 20, Coventry, UK, July 15-17, 2003, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2712},
pages = {261--270},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/3-540-45073-4\_21},
doi = {10.1007/3-540-45073-4\_21},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/bncod/DempsterPWCMM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bncod/HowardDFM03,
author = {Diana Howard and
Henry Detmold and
Katrina Falkner and
David S. Munro},
editor = {Anne E. James and
Brian Lings and
Muhammad Younas},
title = {Using the Compliant Systems Architecture to Deliver Flexible Policies
within Two-Phase Commit},
booktitle = {New Horizons in Information Management, 20th British National Conference
on Databases, {BNCOD} 20, Coventry, UK, July 15-17, 2003, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2712},
pages = {245--252},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/3-540-45073-4\_19},
doi = {10.1007/3-540-45073-4\_19},
timestamp = {Mon, 17 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bncod/HowardDFM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eon/GoldbergMMQ03,
author = {Howard Goldberg and
Alfredo Morales and
David MacMillan and
Matthew Quinlan},
editor = {York Sure and
{\'{O}}scar Corcho},
title = {An Ontology-Driven Application to Improve the Prescription of Educational
Resources to Parents of Premature Infants},
booktitle = {EON2003, Evaluation of Ontology-based Tools, Proceedings of the 2nd
International Workshop on Evaluation of Ontology-based Tools held
at the 2nd International Semantic Web Conference {ISWC} 2003, 20th
October 2003 (Workshop day), Sundial Resort, Sanibel Island, Florida,
{USA}},
series = {{CEUR} Workshop Proceedings},
volume = {87},
publisher = {CEUR-WS.org},
year = {2003},
url = {https://ceur-ws.org/Vol-87/EON2003\_Quinlan.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:38 +0100},
biburl = {https://dblp.org/rec/conf/eon/GoldbergMMQ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/huc/KoileTDSD03,
author = {Kimberle Koile and
Konrad Tollmar and
David Demirdjian and
Howard E. Shrobe and
Trevor Darrell},
editor = {Anind K. Dey and
Albrecht Schmidt and
Joseph F. McCarthy},
title = {Activity Zones for Context-Aware Computing},
booktitle = {UbiComp 2003: Ubiquitous Computing, 5th International Conference,
Seattle, WA, USA, October 12-15, 2003, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2864},
pages = {90--106},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/978-3-540-39653-6\_7},
doi = {10.1007/978-3-540-39653-6\_7},
timestamp = {Tue, 14 May 2019 10:00:52 +0200},
biburl = {https://dblp.org/rec/conf/huc/KoileTDSD03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iadis/PaceyWDCMM03,
author = {Daniel Pacey and
M. Howard Williams and
Euan W. Dempster and
Alison Cawsey and
David H. Marwick and
Lachlan M. MacKinnon},
title = {Recreating Personalization Features of the Youngster Mobile Service
Platform with the Dip Toolkit},
booktitle = {Proceedings of the {IADIS} International Conference WWW/Internet 2003,
{ICWI} 2003, Algarve, Portugal, November 5-8, 2003},
pages = {1035--1038},
publisher = {{IADIS}},
year = {2003},
timestamp = {Thu, 18 Mar 2004 15:27:46 +0100},
biburl = {https://dblp.org/rec/conf/iadis/PaceyWDCMM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/imc/ChenBK03,
author = {Yan Chen and
David Bindel and
Randy H. Katz},
title = {Tomography-based overlay network monitoring},
booktitle = {Proceedings of the 3rd {ACM} {SIGCOMM} Internet Measurement Conference,
{IMC} 2003, Miami Beach, FL, USA, October 27-29, 2003},
pages = {216--231},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/948205.948233},
doi = {10.1145/948205.948233},
timestamp = {Mon, 08 Jul 2019 07:25:53 +0200},
biburl = {https://dblp.org/rec/conf/imc/ChenBK03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jcdl/McArthurGB03,
author = {David McArthur and
Sarah Giersch and
Howard Burrows},
title = {Sustainability Issues and Activities for the {NSDL}},
booktitle = {{ACM/IEEE} 2003 Joint Conference on Digital Libraries {(JCDL} 2003),
27-31 May 2003, Houston, Texas, USA, Proceedings},
pages = {395},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/JCDL.2003.1204914},
doi = {10.1109/JCDL.2003.1204914},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/jcdl/McArthurGB03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/maveba/HowardWBH03,
author = {David M. Howard and
Graham F. Welch and
Jude Brereton and
Evangelos Himonides},
editor = {Claudia Manfredi},
title = {Towards a novel real-time visual display for singing training},
booktitle = {Third International Workshop on Models and Analysis of Vocal Emissions
for Biomedical Applications, {MAVEBA} 2003, Florence, Italy, December
10-12, 2003},
pages = {179--182},
publisher = {Firenze University Press / {ISCA}},
year = {2003},
url = {http://www.isca-speech.org/archive/maveba\_2003/mv03\_179.html},
timestamp = {Tue, 16 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/maveba/HowardWBH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mss/DiamondBCM03,
author = {Howard J. Diamond and
John J. Bates and
David M. Clark and
Robert L. Mairs},
title = {Archive Management: The Missing Component},
booktitle = {20th IEEE/11th {NASA} Goddard Conference on Mass Storage Systems and
Technologies, {MSS} 2003, San Diego, California, USA, April 7-10,
2003},
pages = {40--48},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/MASS.2003.1194834},
doi = {10.1109/MASS.2003.1194834},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mss/DiamondBCM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nime/HowardRH03,
author = {David M. Howard and
Stuart Rimell and
Andy Hunt},
editor = {Fran{\c{c}}ois Thibault},
title = {Force Feedback Gesture Controlled Physical Modelling Synthesis},
booktitle = {New Interfaces for Musical Expression, NIME-03, Proceedings, Montr{\'{e}}al,
Canada, May 22-24, 2003},
pages = {95--98},
publisher = {Faculty of Music, McGill University},
year = {2003},
url = {https://doi.org/10.5281/zenodo.1176515},
doi = {10.5281/ZENODO.1176515},
timestamp = {Tue, 04 Apr 2023 16:52:05 +0200},
biburl = {https://dblp.org/rec/conf/nime/HowardRH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/webi/PaceyDWCMM03,
author = {Daniel Pacey and
Euan W. Dempster and
M. Howard Williams and
Alison Cawsey and
David H. Marwick and
Lachlan M. MacKinnon},
title = {A Toolkit for Creating Personalized Presentations},
booktitle = {2003 {IEEE} / {WIC} International Conference on Web Intelligence,
{(WI} 2003), 13-17 October 2003, Halifax, Canada},
pages = {550--553},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/WI.2003.1241264},
doi = {10.1109/WI.2003.1241264},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/webi/PaceyDWCMM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/daglib/0009529,
author = {David R. Westhead and
John Howard Parish and
Richard M. Twyman},
title = {Bioinformatics},
series = {Instant notes},
publisher = {{BIOS} Scientific Publishers},
year = {2002},
isbn = {978-1-85996-272-5},
timestamp = {Mon, 15 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/daglib/0009529.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/El-KhatibWMM02,
author = {Hazem Turki El Khatib and
M. Howard Williams and
David H. Marwick and
Lachlan M. MacKinnon},
title = {Using a Distributed Approach to Retrieve and Integrate Information
from Heterogeneous Distributed Databases},
journal = {Comput. J.},
volume = {45},
number = {4},
pages = {381--394},
year = {2002},
url = {https://doi.org/10.1093/comjnl/45.4.381},
doi = {10.1093/COMJNL/45.4.381},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cj/El-KhatibWMM02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cm/ClarkJRS02,
author = {David D. Clark and
Van Jacobson and
John Romkey and
Howard C. Salwen},
title = {An analysis of {TCP} processing overhead},
journal = {{IEEE} Commun. Mag.},
volume = {40},
number = {5},
pages = {94--101},
year = {2002},
url = {https://doi.org/10.1109/MCOM.2002.1006979},
doi = {10.1109/MCOM.2002.1006979},
timestamp = {Wed, 03 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cm/ClarkJRS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/CurranCWCNHLEHS02,
author = {Brian W. Curran and
Yuen H. Chan and
Philip T. Wu and
Peter J. Camporese and
Gregory A. Northrop and
Robert F. Hatch and
Lisa B. Lacey and
James P. Eckhardt and
David T. Hui and
Howard H. Smith},
title = {{IBM} eServer z900 high-frequency microprocessor technology, circuits,
and design methodology},
journal = {{IBM} J. Res. Dev.},
volume = {46},
number = {4-5},
pages = {631},
year = {2002},
url = {https://doi.org/10.1147/rd.464.0631},
doi = {10.1147/RD.464.0631},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/CurranCWCNHLEHS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GuoLCHKLCL02,
author = {Chun Bing Guo and
Chi{-}Wa Lo and
Yu{-}Wing Choi and
Issac Hsu and
Toby Kwok{-}Kei Kan and
David Leung and
Alan N. L. Chan and
Howard C. Luong},
title = {A fully integrated 900-MHz {CMOS} wireless receiver with on-chip {RF}
and {IF} filters and 79-dB image rejection},
journal = {{IEEE} J. Solid State Circuits},
volume = {37},
number = {8},
pages = {1084--1089},
year = {2002},
url = {https://doi.org/10.1109/JSSC.2002.800981},
doi = {10.1109/JSSC.2002.800981},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GuoLCHKLCL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nm/ElmanSW02,
author = {Howard C. Elman and
David J. Silvester and
Andrew J. Wathen},
title = {Performance and analysis of saddle point preconditioners for the discrete
steady-state Navier-Stokes equations},
journal = {Numerische Mathematik},
volume = {90},
number = {4},
pages = {665--688},
year = {2002},
url = {https://doi.org/10.1007/s002110100300},
doi = {10.1007/S002110100300},
timestamp = {Thu, 08 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nm/ElmanSW02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/KopcsayKWDRS02,
author = {Gerard V. Kopcsay and
Byron Krauter and
David Widiger and
Alina Deutsch and
Barry J. Rubin and
Howard H. Smith},
title = {A comprehensive 2-D inductance modeling approach for {VLSI} interconnects:
frequency-dependent extraction and compact circuit model synthesis},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {10},
number = {6},
pages = {695--711},
year = {2002},
url = {https://doi.org/10.1109/TVLSI.2002.801574},
doi = {10.1109/TVLSI.2002.801574},
timestamp = {Wed, 25 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvlsi/KopcsayKWDRS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ah/CawseyDBPWMM02,
author = {Alison Cawsey and
Euan W. Dempster and
Diana Bental and
Daniel Pacey and
M. Howard Williams and
Lachlan M. MacKinnon and
David H. Marwick},
editor = {Paul De Bra and
Peter Brusilovsky and
Ricardo Conejo},
title = {Preventing Misleading Presentations of {XML} Documents: Some Initial
Proposals},
booktitle = {Adaptive Hypermedia and Adaptive Web-Based Systems, Second International
Conference, {AH} 2002, Malaga, Spain, May 29-31, 2002, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2347},
pages = {492--496},
publisher = {Springer},
year = {2002},
url = {https://doi.org/10.1007/3-540-47952-X\_68},
doi = {10.1007/3-540-47952-X\_68},
timestamp = {Tue, 14 May 2019 10:00:42 +0200},
biburl = {https://dblp.org/rec/conf/ah/CawseyDBPWMM02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/MacEachrenHLHDG02,
author = {Alan M. MacEachren and
Mark Harrower and
Bonan Li and
David Howard and
Roger Downs and
Mark Gahegan},
title = {Supporting statistical, graphic/cartographic, and domain literacy
through onlinelearning activities: MapStats for Kids},
booktitle = {Proceedings of the 2002 Annual National Conference on Digital Government
Research, {DG.O} 2002, Los Angeles, CA, USA, 2002},
series = {{ACM} International Conference Proceeding Series},
publisher = {Digital Government Research Center},
year = {2002},
url = {http://dl.acm.org/citation.cfm?id=1123180},
timestamp = {Sat, 07 Jul 2018 14:13:59 +0200},
biburl = {https://dblp.org/rec/conf/dgo/MacEachrenHLHDG02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/RimellHTKH02,
author = {Stuart Rimell and
David M. Howard and
Andy M. Tyrrell and
Ross Kirk and
Andy Hunt},
title = {Cymatic. Restoring the Physical Manifestation of Digital Sound Using
Haptic Interfaces to Control a New Computer Based Musical Instrument},
booktitle = {Proceedings of the 2002 International Computer Music Conference, {ICMC}
2002, Gothenburg, Sweden, September 16-21, 2002},
publisher = {Michigan Publishing},
year = {2002},
url = {https://hdl.handle.net/2027/spo.bbp2372.2002.025},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/RimellHTKH02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/arobots/PaytonDEHL01,
author = {David W. Payton and
Mike Daily and
Regina Estkowski and
Mike Howard and
Craig Lee},
title = {Pheromone Robotic},
journal = {Auton. Robots},
volume = {11},
number = {3},
pages = {319--324},
year = {2001},
url = {https://doi.org/10.1023/A:1012411712038},
doi = {10.1023/A:1012411712038},
timestamp = {Wed, 14 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/arobots/PaytonDEHL01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ce/Vermeer01,
author = {Ross Vermeer},
title = {The Virtual University: The Internet and Resource-based Learning:
Steve Ryan, Bernard Scott, Howard Freeman and Daxa Patel, Kogan Page,
London, 2000, 204 pp, {ISBN} 0 7494 2508 3, The Changing Face of Learning
Technology Edited by David Squires, Gr{\'{a}}inne Conole and
Gabriel Jacobs, University of Wales Press, Cardiff, 182pp, {ISBN}
0 7083 1681 6, Integrating Technology in Learning and Teaching Pat
Maier and Adam Warren, Kogan Page, London, 2000, 162 pp, {ISBN} 0
7494 31806},
journal = {Comput. Educ.},
volume = {37},
number = {2},
pages = {179--182},
year = {2001},
url = {https://doi.org/10.1016/S0360-1315(01)00040-9},
doi = {10.1016/S0360-1315(01)00040-9},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ce/Vermeer01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/GribbleWBBCBCGHJKMRZ01,
author = {Steven D. Gribble and
Matt Welsh and
J. Robert von Behren and
Eric A. Brewer and
David E. Culler and
Nikita Borisov and
Steven E. Czerwinski and
Ramakrishna Gummadi and
Jon R. Hill and
Anthony D. Joseph and
Randy H. Katz and
Zhuoqing Morley Mao and
Steven J. Ross and
Ben Y. Zhao},
title = {The Ninja architecture for robust Internet-scale systems and services},
journal = {Comput. Networks},
volume = {35},
number = {4},
pages = {473--497},
year = {2001},
url = {https://doi.org/10.1016/S1389-1286(00)00179-1},
doi = {10.1016/S1389-1286(00)00179-1},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cn/GribbleWBBCBCGHJKMRZ01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/infsof/PuaWM01,
author = {Chai Seng Pua and
M. Howard Williams and
David H. Marwick},
title = {Data placement in a parallel {DBMS} with multiple disks},
journal = {Inf. Softw. Technol.},
volume = {43},
number = {1},
pages = {41--51},
year = {2001},
url = {https://doi.org/10.1016/S0950-5849(00)00135-X},
doi = {10.1016/S0950-5849(00)00135-X},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/infsof/PuaWM01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/robotica/LiuH01,
author = {Anmin Liu and
David Howard},
title = {Kinematic design of crab-like legged vehicles},
journal = {Robotica},
volume = {19},
number = {1},
pages = {67--77},
year = {2001},
url = {https://doi.org/10.1017/S0263574700002861},
doi = {10.1017/S0263574700002861},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/robotica/LiuH01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/WilliamsVVM01,
author = {M. Howard Williams and
Gavin Venters and
George Venters and
David H. Marwick},
title = {Developing a regional healthcare information network},
journal = {{IEEE} Trans. Inf. Technol. Biomed.},
volume = {5},
number = {2},
pages = {177--180},
year = {2001},
url = {https://doi.org/10.1109/4233.924809},
doi = {10.1109/4233.924809},
timestamp = {Wed, 13 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/titb/WilliamsVVM01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bcshci/BentalMWMPDC01,
author = {Diana Bental and
Lachlan M. MacKinnon and
M. Howard Williams and
David H. Marwick and
Daniel Pacey and
Euan W. Dempster and
Alison Cawsey},
editor = {Ann Blandford and
Jean Vanderdonckt and
Phil Gray},
title = {Dynamic Information Presentation through Web-based Personalisation
and Adaptation - An Initial Review},
booktitle = {People and Computers {XV} - Interaction without Frontiers, Joint Proceedings
of {HCI} 2001 and {IHM} 2001, Lille, France, September 10-14, 2001},
pages = {485--499},
publisher = {Springer},
year = {2001},
url = {https://doi.org/10.1007/978-1-4471-0353-0\_30},
doi = {10.1007/978-1-4471-0353-0\_30},
timestamp = {Mon, 16 Sep 2019 15:28:08 +0200},
biburl = {https://dblp.org/rec/conf/bcshci/BentalMWMPDC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/SmithDMWBDKK01,
author = {Howard H. Smith and
Aline Deutsch and
Sharad Mehrotra and
David Widiger and
Michael A. Bowen and
Allan H. Dansky and
Gerard V. Kopcsay and
Byron Krauter},
title = {R(f)L(f)C coupled noise evaluation of an {S/390} microprocessor chip},
booktitle = {Proceedings of the {IEEE} 2001 Custom Integrated Circuits Conference,
{CICC} 2001, San Diego, CA, USA, May 6-9, 2001},
pages = {237--240},
publisher = {{IEEE}},
year = {2001},
url = {https://doi.org/10.1109/CICC.2001.929763},
doi = {10.1109/CICC.2001.929763},
timestamp = {Mon, 10 Oct 2022 09:13:22 +0200},
biburl = {https://dblp.org/rec/conf/cicc/SmithDMWBDKK01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icics/ChenBBKK01,
author = {Yan Chen and
Adam W. Bargteil and
David Bindel and
Randy H. Katz and
John Kubiatowicz},
editor = {Sihan Qing and
Tatsuaki Okamoto and
Jianying Zhou},
title = {Quantifying Network Denial of Service: {A} Location Service Case Study},
booktitle = {Information and Communications Security, Third International Conference,
{ICICS} 2001, Xian, China, November 13-16, 2001},
series = {Lecture Notes in Computer Science},
volume = {2229},
pages = {340--351},
publisher = {Springer},
year = {2001},
url = {https://doi.org/10.1007/3-540-45600-7\_37},
doi = {10.1007/3-540-45600-7\_37},
timestamp = {Tue, 14 May 2019 10:00:37 +0200},
biburl = {https://dblp.org/rec/conf/icics/ChenBBKK01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/KimKSILHJPFP01,
author = {Jong{-}Kook Kim and
Taylor Kidd and
Howard Jay Siegel and
Cynthia E. Irvine and
Timothy E. Levin and
Debra A. Hensgen and
David St. John and
Viktor K. Prasanna and
Richard F. Freund and
N. Wayne Porter},
title = {Collective Value of QoS: {A} Performance Measure Framework for Distributed
Heterogeneous Networks},
booktitle = {Proceedings of the 15th International Parallel {\&} Distributed
Processing Symposium (IPDPS-01), San Francisco, CA, USA, April 23-27,
2001},
pages = {84},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/IPDPS.2001.925036},
doi = {10.1109/IPDPS.2001.925036},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/KimKSILHJPFP01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/maveba/Howard01,
author = {David M. Howard},
editor = {Claudia Manfredi and
Piero Bruscaglioni},
title = {The real and the non-real in speech measurements},
booktitle = {Second International Workshop on Models and Analysis of Vocal Emissions
for Biomedical Applications, {MAVEBA} 2001, Florence, Italy, September
13-15, 2001},
pages = {35--44},
publisher = {{ISCA}},
year = {2001},
url = {http://www.isca-speech.org/archive/maveba\_2001/mv01\_035.html},
timestamp = {Tue, 16 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/maveba/Howard01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csur/KaziCSL00,
author = {Iffat H. Kazi and
Howard H. Chen and
Berdenia Stanley and
David J. Lilja},
title = {Techniques for obtaining high performance in Java programs},
journal = {{ACM} Comput. Surv.},
volume = {32},
number = {3},
pages = {213--240},
year = {2000},
url = {https://doi.org/10.1145/367701.367714},
doi = {10.1145/367701.367714},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/csur/KaziCSL00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dlib/AtkinsLRRSSS00,
author = {Helen Atkins and
Catherine Lyons and
Howard Ratner and
Carol Risher and
Chris Shillum and
David Sidman and
Andrew Stevens},
title = {Reference Linking with DOIs: {A} Case Study},
journal = {D Lib Mag.},
volume = {6},
number = {2},
year = {2000},
url = {https://doi.org/10.1045/february2000-risher},
doi = {10.1045/FEBRUARY2000-RISHER},
timestamp = {Fri, 01 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dlib/AtkinsLRRSSS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmsj/DillenbergerBCDEGHOSJ00,
author = {Donna N. Dillenberger and
Rajesh Bordawekar and
Clarence W. Clark III and
Donald Durand and
David Emmes and
Osamu Gohda and
Sally Howard and
Michael F. Oliver and
Frank Samuel and
Robert W. St. John},
title = {Building a Java virtual machine for server applications: The Jvm on
{OS/390}},
journal = {{IBM} Syst. J.},
volume = {39},
number = {1},
pages = {194--210},
year = {2000},
url = {https://doi.org/10.1147/sj.391.0194},
doi = {10.1147/SJ.391.0194},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmsj/DillenbergerBCDEGHOSJ00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/infsof/El-KhatibWMM00,
author = {Hazem Turki El Khatib and
M. Howard Williams and
Lachlan M. MacKinnon and
David H. Marwick},
title = {A framework and test-suite for assessing approaches to resolving heterogeneity
in distributed databases},
journal = {Inf. Softw. Technol.},
volume = {42},
number = {7},
pages = {505--515},
year = {2000},
url = {https://doi.org/10.1016/S0950-5849(00)00094-X},
doi = {10.1016/S0950-5849(00)00094-X},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/infsof/El-KhatibWMM00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/ChunPCWKASBBCNHF00,
author = {Hon M. Chun and
Carlos E. Padilla and
Donovan N. Chin and
Masakatsu Watanabe and
Valeri I. Karlov and
Howard E. Alper and
Keto Soosaar and
Kim B. Blair and
Oren M. Becker and
Leo S. D. Caves and
Robert Nagle and
David N. Haney and
Barry L. Farmer},
title = {{MBO(N)D:} {A} multibody method for long-time molecular dynamics simulations},
journal = {J. Comput. Chem.},
volume = {21},
number = {3},
pages = {159--184},
year = {2000},
url = {https://doi.org/10.1002/(SICI)1096-987X(200002)21:3\<159::AID-JCC1\>3.0.CO;2-J},
doi = {10.1002/(SICI)1096-987X(200002)21:3\<159::AID-JCC1\>3.0.CO;2-J},
timestamp = {Wed, 01 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcc/ChunPCWKASBBCNHF00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mva/GracePTS00,
author = {A. E. Grace and
David Pycock and
Howard T. Tillotson and
Martin S. Snaith},
title = {Active shape from stereo for highway inspection},
journal = {Mach. Vis. Appl.},
volume = {12},
number = {1},
pages = {7--15},
year = {2000},
url = {https://doi.org/10.1007/s001380050119},
doi = {10.1007/S001380050119},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mva/GracePTS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pc/PuaWM00,
author = {Chai Seng Pua and
M. Howard Williams and
David H. Marwick},
title = {Modelling parallel databases with process algebra},
journal = {Parallel Comput.},
volume = {26},
number = {13-14},
pages = {1909--1924},
year = {2000},
url = {https://doi.org/10.1016/S0167-8191(00)00059-4},
doi = {10.1016/S0167-8191(00)00059-4},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pc/PuaWM00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/LytelDNS00,
author = {Rick Lytel and
Howard L. Davidson and
Nyles Nettleton and
Theresa Sze},
title = {Optical interconnections within modern high-performance computing
systems},
journal = {Proc. {IEEE}},
volume = {88},
number = {6},
pages = {758--763},
year = {2000},
url = {https://doi.org/10.1109/5.867689},
doi = {10.1109/5.867689},
timestamp = {Mon, 28 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pieee/LytelDNS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/robotica/MiaoH00,
author = {Shan Miao and
David Howard},
title = {Optimal tripod turning gait generation for hexapod walking machines},
journal = {Robotica},
volume = {18},
number = {6},
pages = {639--649},
year = {2000},
url = {https://doi.org/10.1017/s0263574700002642},
doi = {10.1017/S0263574700002642},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/robotica/MiaoH00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/MozerWGJK00,
author = {Michael C. Mozer and
Richard H. Wolniewicz and
David B. Grimes and
Eric Johnson and
Howard Kaushansky},
title = {Predicting subscriber dissatisfaction and improving retention in the
wireless telecommunications industry},
journal = {{IEEE} Trans. Neural Networks Learn. Syst.},
volume = {11},
number = {3},
pages = {690--696},
year = {2000},
url = {https://doi.org/10.1109/72.846740},
doi = {10.1109/72.846740},
timestamp = {Mon, 09 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tnn/MozerWGJK00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/RothschildUWEFB00,
author = {Jeffrey M. Rothschild and
Howard R. Underwood and
Jane Weeks and
Craig Earle and
Julie M. Fiskio and
David W. Bates},
title = {A Severity Adjustment System Using Electronic Data Sources for Predicting
Financial Outcomes for Oncology},
booktitle = {{AMIA} 2000, American Medical Informatics Association Annual Symposium,
Los Angeles, CA, USA, November 4-8, 2000},
publisher = {{AMIA}},
year = {2000},
url = {https://knowledge.amia.org/amia-55142-a2000a-1.606968/t-002-1.608710/f-001-1.608711/a-374-1.608844/a-375-1.608841},
timestamp = {Wed, 17 Apr 2024 11:48:44 +0200},
biburl = {https://dblp.org/rec/conf/amia/RothschildUWEFB00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/assets/JackBMATRBP00,
author = {David Jack and
Rares F. Boian and
Alma S. Merians and
Sergei V. Adamovich and
Marilyn Tremaine and
Michael Recce and
Grigore C. Burdea and
Howard Poizner},
editor = {Marilyn Tremaine and
Elliot Cole and
Elizabeth D. Mynatt},
title = {A virtual reality-based exercise program for stroke rehabilitation},
booktitle = {Proceedings of the {ACM} Conference on Assistive Technologies, {ASSETS}
2000, Arlington, Virginia, USA, November 13-15, 2000},
pages = {56--63},
publisher = {{ACM}},
year = {2000},
url = {https://doi.org/10.1145/354324.354340},
doi = {10.1145/354324.354340},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/assets/JackBMATRBP00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euromicro/BattyGHTW00,
author = {S. V. Batty and
Paul Edwin Garner and
David M. Howard and
P. Turner and
A. D. White},
title = {The Development of a Portable Real-Time Display of Voice Source Characteristics},
booktitle = {26th {EUROMICRO} 2000 Conference, Informatics: Inventing the Future,
5-7 September 2000, Maastricht, The Netherlands},
pages = {2419--2422},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/EURMIC.2000.874522},
doi = {10.1109/EURMIC.2000.874522},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/euromicro/BattyGHTW00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euromicro/CamposH00,
author = {Guilherme Campos and
David M. Howard},
title = {On the Computation Time of Three-Dimensional Digital Waveguide Mesh
Acoustic Models},
booktitle = {26th {EUROMICRO} 2000 Conference, Informatics: Inventing the Future,
5-7 September 2000, Maastricht, The Netherlands},
pages = {2332--2339},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/EURMIC.2000.874498},
doi = {10.1109/EURMIC.2000.874498},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/euromicro/CamposH00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euromicro/HuntHW00,
author = {Andy Hunt and
David M. Howard and
Jim Worsdall},
title = {Real-Time Interfaces for Speech and Singing},
booktitle = {26th {EUROMICRO} 2000 Conference, Informatics: Inventing the Future,
5-7 September 2000, Maastricht, The Netherlands},
pages = {2356},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/EURMIC.2000.874504},
doi = {10.1109/EURMIC.2000.874504},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/euromicro/HuntHW00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/PletcherBL00,
author = {Klaus{-}Peter Behr and
James A. Freer and
Howard Levine and
Timothy A. Pletcher and
Warren Russel and
David J. Treloar and
Dag von Lubitz and
William Wilkerson and
Eric Wolf},
title = {An Immersive Virtual Reality Platform for Medical Education: Introduction
to the Medical Readiness Trainer},
booktitle = {33rd Annual Hawaii International Conference on System Sciences (HICSS-33),
4-7 January, 2000, Maui, Hawaii, {USA}},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/HICSS.2000.926804},
doi = {10.1109/HICSS.2000.926804},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/PletcherBL00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mr/PaytonDHHL00,
author = {David W. Payton and
Michael J. Daily and
Bruce Hoff and
Michael D. Howard and
Craig Lee},
editor = {Howie Choset and
Douglas W. Gage and
Matthew R. Stein},
title = {Pheromone robotics},
booktitle = {Mobile Robots {XV} and Telemanipulator and Telepresence Technologies
VII, Boston, MA, USA, November 5, 2000},
series = {{SPIE} Proceedings},
volume = {4195},
pages = {67--75},
publisher = {{SPIE}},
year = {2000},
url = {https://doi.org/10.1117/12.417331},
doi = {10.1117/12.417331},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mr/PaytonDHHL00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pdp/KimHKSJILPPF00,
author = {Jong{-}Kook Kim and
Debra A. Hensgen and
Taylor Kidd and
Howard Jay Siegel and
David St. John and
Cynthia E. Irvine and
Timothy E. Levin and
N. Wayne Porter and
Viktor K. Prasanna and
Richard F. Freund},
title = {A QoS performance measure framework for distributed heterogeneous
networks},
booktitle = {Eight Euromicro Workshop on Parallel and Distributed Processing, {PDP}
2000, 19-12 January 2000, Rhodos, Greece},
pages = {18--27},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/EMPDP.2000.823388},
doi = {10.1109/EMPDP.2000.823388},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pdp/KimHKSJILPPF00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cc/BarringtonS99,
author = {David A. Mix Barrington and
Howard Straubing},
title = {Lower bounds for modular counting by circuits with modular gates},
journal = {Comput. Complex.},
volume = {8},
number = {3},
pages = {258--272},
year = {1999},
url = {https://doi.org/10.1007/s000370050030},
doi = {10.1007/S000370050030},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cc/BarringtonS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/comj/Wooten99,
author = {Arthur Wooten},
title = {David M. Howard and James Angus: Acoustics and Psychoacoustics},
journal = {Comput. Music. J.},
volume = {23},
number = {2},
pages = {99--100},
year = {1999},
url = {https://doi.org/10.1162/comj.1999.23.2.99a},
doi = {10.1162/COMJ.1999.23.2.99A},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/comj/Wooten99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dsp/HowardS99,
author = {David Howard and
Jim Schroeder},
title = {Multiscale Models for Target Detection and Background Discrimination
in Synthetic Aperture Radar Imagery},
journal = {Digit. Signal Process.},
volume = {9},
number = {3},
pages = {149--161},
year = {1999},
url = {https://doi.org/10.1006/dspr.1999.0338},
doi = {10.1006/DSPR.1999.0338},
timestamp = {Tue, 30 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dsp/HowardS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/AverillBBCDHHMMMMNSSWW99,
author = {Robert M. Averill III and
Keith G. Barkley and
Michael A. Bowen and
Peter J. Camporese and
Allan H. Dansky and
Robert F. Hatch and
Dale E. Hoffman and
Mark D. Mayo and
Scott A. McCabe and
Timothy G. McNamara and
Thomas J. McPherson and
Gregory A. Northrop and
Leon J. Sigal and
Howard H. Smith and
David A. Webber and
Patrick M. Williams},
title = {Chip integration methodology for the {IBM} {S/390} {G5} and {G6} custom
microprocessors},
journal = {{IBM} J. Res. Dev.},
volume = {43},
number = {5},
pages = {681--706},
year = {1999},
url = {https://doi.org/10.1147/rd.435.0681},
doi = {10.1147/RD.435.0681},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/AverillBBCDHHMMMMNSSWW99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/internet/EllisonFLLLM99,
author = {Robert J. Ellison and
David A. Fisher and
Richard C. Linger and
Howard F. Lipson and
Thomas A. Longstaff and
Nancy R. Mead},
title = {Survivability: Protecting Your Critical Systems},
journal = {{IEEE} Internet Comput.},
volume = {3},
number = {6},
pages = {55--63},
year = {1999},
url = {https://doi.org/10.1109/4236.807008},
doi = {10.1109/4236.807008},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/internet/EllisonFLLLM99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jss/HowardBJLKAC99,
author = {Geoffry S. Howard and
Thomas Bodnovich and
Thomas Janicki and
Jens Liegle and
Steven Klein and
Paul Albert and
David Cannon},
title = {The efficacy of matching information systems development methodologies
with application characteristics - an empirical study},
journal = {J. Syst. Softw.},
volume = {45},
number = {3},
pages = {177--195},
year = {1999},
url = {https://doi.org/10.1016/S0164-1212(98)10077-8},
doi = {10.1016/S0164-1212(98)10077-8},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jss/HowardBJLKAC99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pc/GiolmasWCHYS99,
author = {Nicholas Giolmas and
Daniel W. Watson and
David M. Chelberg and
Peter V. Henstock and
June{-}Ho Yi and
Howard Jay Siegel},
title = {Aspects of computational mode and data distribution for parallel range
image segmentation},
journal = {Parallel Comput.},
volume = {25},
number = {5},
pages = {499--523},
year = {1999},
url = {https://doi.org/10.1016/S0167-8191(99)00007-1},
doi = {10.1016/S0167-8191(99)00007-1},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pc/GiolmasWCHYS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euromicro/DasHS99,
author = {M. Das and
David M. Howard and
Stephen L. Smith},
title = {Motion Curves in Music: The Statistical Analysis of Midi Data},
booktitle = {25th {EUROMICRO} '99 Conference, Informatics: Theory and Practice
for the New Millenium, 8-10 September 1999, Milan, Italy},
pages = {2013--2019},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/EURMIC.1999.794756},
doi = {10.1109/EURMIC.1999.794756},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/euromicro/DasHS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euromicro/GarnerH99,
author = {Paul Edwin Garner and
David M. Howard},
title = {Distance Learning Support for Teaching Musical Temperament},
booktitle = {25th {EUROMICRO} '99 Conference, Informatics: Theory and Practice
for the New Millenium, 8-10 September 1999, Milan, Italy},
pages = {2042},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/EURMIC.1999.794760},
doi = {10.1109/EURMIC.1999.794760},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/euromicro/GarnerH99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euromicro/GibsonHT99,
author = {Ian S. Gibson and
David M. Howard and
Andrew M. Tyrrell},
title = {A Parallel Processing System for Polyphonic Singing Synthesis},
booktitle = {25th {EUROMICRO} '99 Conference, Informatics: Theory and Practice
for the New Millenium, 8-10 September 1999, Milan, Italy},
pages = {2070--2074},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/EURMIC.1999.794764},
doi = {10.1109/EURMIC.1999.794764},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/euromicro/GibsonHT99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euromicro/Howard99,
author = {David M. Howard},
title = {Workshop Chair Introduction: Music Technology and Audio Processing},
booktitle = {25th {EUROMICRO} '99 Conference, Informatics: Theory and Practice
for the New Millenium, 8-10 September 1999, Milan, Italy},
pages = {2004},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.ieeecomputersociety.org/10.1109/EUROMICRO.1999.10010},
doi = {10.1109/EUROMICRO.1999.10010},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/euromicro/Howard99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euromicro/Howard99a,
author = {David M. Howard},
title = {Digital Waveguide Modelling of Room Acoustics: Comparing Mesh Topologies},
booktitle = {25th {EUROMICRO} '99 Conference, Informatics: Theory and Practice
for the New Millenium, 8-10 September 1999, Milan, Italy},
pages = {2082},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/EURMIC.1999.794766},
doi = {10.1109/EURMIC.1999.794766},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/euromicro/Howard99a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hcw/HensgenKJSSBMAKILFKGDCKPBA99,
author = {Debra A. Hensgen and
Taylor Kidd and
David St. John and
Matthew C. Schnaidt and
Howard Jay Siegel and
Tracy D. Braun and
Muthucumaru Maheswaran and
Shoukat Ali and
Jong{-}Kook Kim and
Cynthia E. Irvine and
Timothy E. Levin and
Richard F. Freund and
Matt Kussow and
Michael W. Godfrey and
Alpay Duman and
Paul Carff and
Shirley Kidd and
Viktor K. Prasanna and
Prashanth B. Bhat and
Ammar H. Alhusaini},
title = {An Overview of {MSHN:} The Management System for Heterogeneous Networks},
booktitle = {8th Heterogeneous Computing Workshop, {HCW} 1999, San Juan, Puerto
Rico, April12, 1999},
pages = {184--198},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/HCW.1999.765132},
doi = {10.1109/HCW.1999.765132},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hcw/HensgenKJSSBMAKILFKGDCKPBA99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/FisherL99,
author = {David A. Fisher and
Howard F. Lipson},
title = {Emergent Algorithms - {A} New Method for Enhancing Survivability in
Unbounded Systems},
booktitle = {32nd Annual Hawaii International Conference on System Sciences (HICSS-32),
January 5-8, 1999, Maui, Hawaii, {USA}},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/HICSS.1999.772824},
doi = {10.1109/HICSS.1999.772824},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/FisherL99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/GibsonHT99,
author = {Ian S. Gibson and
David M. Howard and
Andrew M. Tyrrell},
title = {Composing With the York Polyphonic Real-Time Singing Synthesiser},
booktitle = {Proceedings of the 1999 International Computer Music Conference, {ICMC}
1999, Beijing, China, October 22-27, 1999},
publisher = {Michigan Publishing},
year = {1999},
url = {https://hdl.handle.net/2027/spo.bbp2372.1999.462},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/GibsonHT99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/MurphyH99,
author = {Damian T. Murphy and
David M. Howard},
title = {The WaveVerb Multi-Channel Room Acoustics Modelling System},
booktitle = {Proceedings of the 1999 International Computer Music Conference, {ICMC}
1999, Beijing, China, October 22-27, 1999},
publisher = {Michigan Publishing},
year = {1999},
url = {https://hdl.handle.net/2027/spo.bbp2372.1999.448},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/MurphyH99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interact/DunckleySH99,
author = {Lynne Dunckley and
Andy Smith and
David Howard},
editor = {M. Angela Sasse and
Chris W. Johnson},
title = {Designing for Shared Interfaces with Diverse User Groups},
booktitle = {Human-Computer Interaction {INTERACT} '99: {IFIP} {TC13} International
Conference on Human-Computer Interaction, Edinburgh, UK, 30th August-3rd
September 1999},
pages = {630--636},
publisher = {{IOS} Press},
year = {1999},
timestamp = {Mon, 19 Sep 2016 17:00:14 +0200},
biburl = {https://dblp.org/rec/conf/interact/DunckleySH99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ishpc/GobioffNG99,
author = {Howard Gobioff and
David Nagle and
Garth A. Gibson},
editor = {Constantine D. Polychronopoulos and
Kazuki Joe and
Akira Fukuda and
Shinji Tomita},
title = {Integrity and Performance in Network Attached Storage},
booktitle = {High Performance Computing, Second International Symposium, ISHPC'99,
Kyoto, Japan, May 26-28, 1999, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1615},
pages = {244--256},
publisher = {Springer},
year = {1999},
url = {https://doi.org/10.1007/BFb0094926},
doi = {10.1007/BFB0094926},
timestamp = {Tue, 14 May 2019 10:00:49 +0200},
biburl = {https://dblp.org/rec/conf/ishpc/GobioffNG99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mie/WilliamsVVM99,
author = {M. Howard Williams and
Gavin Venters and
George Venters and
David H. Marwick},
editor = {Peter Kokol and
Blaz Zupan and
Janez Stare and
Marjan Premik and
Rolf Engelbrecht},
title = {Developing a Health Care Information System for Scotland},
booktitle = {Medical Informatics Europe '99, Proceedings, Ljubljana, Slovenia},
series = {Studies in Health Technology and Informatics},
volume = {68},
pages = {125--128},
publisher = {{IOS} Press},
year = {1999},
url = {https://doi.org/10.3233/978-1-60750-912-7-125},
doi = {10.3233/978-1-60750-912-7-125},
timestamp = {Wed, 03 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mie/WilliamsVVM99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/MozerWGJK99,
author = {Michael Mozer and
Richard H. Wolniewicz and
David B. Grimes and
Eric Johnson and
Howard Kaushansky},
editor = {Sara A. Solla and
Todd K. Leen and
Klaus{-}Robert M{\"{u}}ller},
title = {Churn Reduction in the Wireless Industry},
booktitle = {Advances in Neural Information Processing Systems 12, {[NIPS} Conference,
Denver, Colorado, USA, November 29 - December 4, 1999]},
pages = {935--941},
publisher = {The {MIT} Press},
year = {1999},
url = {http://papers.nips.cc/paper/1749-churn-reduction-in-the-wireless-industry},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/MozerWGJK99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nspw/LipsonF99,
author = {Howard F. Lipson and
David A. Fisher},
editor = {Darrell M. Kienzle and
Mary Ellen Zurko and
Steven J. Greenwald and
Cristina Serbau},
title = {Survivability - a new technical and business perspective on security},
booktitle = {Proceedings of the 1999 Workshop on New Security Paradigms, Caledon
Hills, ON, Canada, September 22-24, 1999},
pages = {33--39},
publisher = {{ACM}},
year = {1999},
url = {https://doi.org/10.1145/335169.335187},
doi = {10.1145/335169.335187},
timestamp = {Tue, 06 Nov 2018 16:58:38 +0100},
biburl = {https://dblp.org/rec/conf/nspw/LipsonF99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pdp/PriceHLT99,
author = {Tony P. W. Price and
David M. Howard and
Alwyn V. Lewis and
Andrew M. Tyrrell},
title = {Adaptive microphone array beamforming for teleconferencing using {VHDL}
and parallel architectures},
booktitle = {Proceedings of the Seventh Euromicro Workshop on Parallel and Distributed
Processing. PDP'99, University of Madeira, Funchal, Portugal, February
3-5, 1999},
pages = {13--18},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/EMPDP.1999.746639},
doi = {10.1109/EMPDP.1999.746639},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pdp/PriceHLT99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:journals/sigcse/BlumS99,
author = {Howard Blum and
David A. Sachs},
editor = {Bruce J. Klein},
title = {An asynchronous distance-learning course in data communications and
networks},
booktitle = {Working Group Reports from ITiCSE on Innovation and Technology in
Computer Science Education, ITiCSE-WGR 1999, Cracow, Poland, June
27-30, 1999},
pages = {52--55},
publisher = {{ACM}},
year = {1999},
url = {https://doi.org/10.1145/349316.349397},
doi = {10.1145/349316.349397},
timestamp = {Tue, 31 May 2022 13:01:06 +0200},
biburl = {https://dblp.org/rec/journals/sigcse/BlumS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/99/BlairDJRS99,
author = {Howard A. Blair and
Fred Dushin and
David W. Jakel and
Angel J. Rivera and
T. Metin Sezgin},
editor = {Krzysztof R. Apt and
Victor W. Marek and
Mirek Truszczynski and
David Scott Warren},
title = {Continuous Models of Computation for Logic Programs: Importing Continuous
Mathematics into Logic Programming's Algorithmic Foundations},
booktitle = {The Logic Programming Paradigm - {A} 25-Year Perspective},
series = {Artificial Intelligence},
pages = {231--255},
publisher = {Springer},
year = {1999},
url = {https://doi.org/10.1007/978-3-642-60085-2\_10},
doi = {10.1007/978-3-642-60085-2\_10},
timestamp = {Wed, 15 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/sp/99/BlairDJRS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jiis/MacKinnonMW98,
author = {Lachlan M. MacKinnon and
David H. Marwick and
M. Howard Williams},
title = {A Model for Query Decomposition and Answer Construction in Heterogeneous
Distributed Database Systems},
journal = {J. Intell. Inf. Syst.},
volume = {11},
number = {1},
pages = {69--87},
year = {1998},
url = {https://doi.org/10.1023/A:1008630910890},
doi = {10.1023/A:1008630910890},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jiis/MacKinnonMW98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jirs/HowardZ98,
author = {David W. Howard and
Ali Zilouchian},
title = {Application of Fuzzy Logic for the Solution of Inverse Kinematics
and Hierarchical Controls of Robotic Manipulators},
journal = {J. Intell. Robotic Syst.},
volume = {23},
number = {2-4},
pages = {217--247},
year = {1998},
url = {https://doi.org/10.1023/A:1007907528825},
doi = {10.1023/A:1007907528825},
timestamp = {Tue, 07 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jirs/HowardZ98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mam/PriceHT98,
author = {Tony P. W. Price and
David M. Howard and
Andrew M. Tyrrell},
title = {Stereo output transputer interface board},
journal = {Microprocess. Microsystems},
volume = {22},
number = {2},
pages = {87--101},
year = {1998},
url = {https://doi.org/10.1016/S0141-9331(98)00067-2},
doi = {10.1016/S0141-9331(98)00067-2},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mam/PriceHT98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sLogica/BauerleACJ98,
author = {Frank A. B{\"{a}}uerle and
David W. Albrecht and
John N. Crossley and
John S. Jeavons},
title = {Curry-Howard Terms for Linear Logic},
journal = {Stud Logica},
volume = {61},
number = {2},
pages = {223--235},
year = {1998},
url = {https://doi.org/10.1023/A:1005025414656},
doi = {10.1023/A:1005025414656},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sLogica/BauerleACJ98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simpra/TyrrellHB98,
author = {Andrew M. Tyrrell and
David M. Howard and
Tim S. Brookes},
title = {Transputer-based human hearing simulation},
journal = {Simul. Pract. Theory},
volume = {6},
number = {5},
pages = {479--491},
year = {1998},
url = {https://doi.org/10.1016/S0928-4869(97)00036-0},
doi = {10.1016/S0928-4869(97)00036-0},
timestamp = {Mon, 18 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simpra/TyrrellHB98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/DinerBRBCKMADGGMMSPV98,
author = {David J. Diner and
Jewel C. Beckert and
Terrence H. Reilly and
Carol J. Bruegge and
James E. Conel and
Ralph A. Kahn and
John V. Martonchik and
Thomas P. Ackerman and
Roger Davies and
Siegfried A. W. Gerstl and
Howard R. Gordon and
Jan{-}Peter Muller and
Ranga B. Myneni and
Piers J. Sellers and
Bernard Pinty and
Michel M. Verstraete},
title = {Multi-angle Imaging SpectroRadiometer {(MISR)} instrument description
and experiment overview},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {36},
number = {4},
pages = {1072--1087},
year = {1998},
url = {https://doi.org/10.1109/36.700992},
doi = {10.1109/36.700992},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/DinerBRBCKMADGGMMSPV98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/MartonchikDKAVPG98,
author = {John V. Martonchik and
David J. Diner and
Ralph A. Kahn and
Thomas P. Ackerman and
Michel M. Verstraete and
Bernard Pinty and
Howard R. Gordon},
title = {Techniques for the retrieval of aerosol properties over land and ocean
using multiangle imaging},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {36},
number = {4},
pages = {1212--1227},
year = {1998},
url = {https://doi.org/10.1109/36.701027},
doi = {10.1109/36.701027},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/MartonchikDKAVPG98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/MartonchikDPVMKG98,
author = {John V. Martonchik and
David J. Diner and
Bernard Pinty and
Michel M. Verstraete and
Ranga B. Myneni and
Yuri Knyazikhin and
Howard R. Gordon},
title = {Determination of land and ocean reflective, radiative, and biophysical
properties using multiangle imaging},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {36},
number = {4},
pages = {1266--1281},
year = {1998},
url = {https://doi.org/10.1109/36.701077},
doi = {10.1109/36.701077},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/MartonchikDPVMKG98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/JonesSADGMNRRRS98,
author = {Peter C. Jones and
Barry G. Silverman and
M. Athanasoulis and
D. Drucker and
Howard Goldberg and
J. Marsh and
C. Nguyen and
D. Ravichandar and
L. Reis and
David M. Rind and
Charles Safran},
title = {Nationwide telecare for diabetics: a pilot implementation of the {HOLON}
architecture},
booktitle = {{AMIA} 1998, American Medical Informatics Association Annual Symposium,
Lake Buena Vista, FL, USA, November 7-11, 1998},
publisher = {{AMIA}},
year = {1998},
url = {https://knowledge.amia.org/amia-55142-a1998a-1.588514/t-001-1.590475/f-001-1.590476/a-064-1.590843/a-065-1.590840},
timestamp = {Wed, 17 Apr 2024 11:48:54 +0200},
biburl = {https://dblp.org/rec/conf/amia/JonesSADGMNRRRS98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/UnderwoodML98,
author = {Howard R. Underwood and
J. Lloyd Michener and
David F. Lobach},
title = {Providing a Clinical Practice Guideline for Asthma Electronically
at the Point of Use to Promote Regional Standardization of Care},
booktitle = {{AMIA} 1998, American Medical Informatics Association Annual Symposium,
Lake Buena Vista, FL, USA, November 7-11, 1998},
publisher = {{AMIA}},
year = {1998},
url = {https://knowledge.amia.org/amia-55142-a1998a-1.588514/t-002-1.590026/f-001-1.590027/a-312-1.590095/a-313-1.590092},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/UnderwoodML98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asplos/GibsonNABCGHRRZ98,
author = {Garth A. Gibson and
David Nagle and
Khalil Amiri and
Jeff Butler and
Fay W. Chang and
Howard Gobioff and
Charles Hardin and
Erik Riedel and
David Rochberg and
Jim Zelenka},
editor = {Dileep Bhandarkar and
Anant Agarwal},
title = {A Cost-Effective, High-Bandwidth Storage Architecture},
booktitle = {{ASPLOS-VIII} Proceedings of the 8th International Conference on Architectural
Support for Programming Languages and Operating Systems, San Jose,
California, USA, October 3-7, 1998},
pages = {92--103},
publisher = {{ACM} Press},
year = {1998},
url = {https://doi.org/10.1145/291069.291029},
doi = {10.1145/291069.291029},
timestamp = {Wed, 07 Jul 2021 13:23:08 +0200},
biburl = {https://dblp.org/rec/conf/asplos/GibsonNABCGHRRZ98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieaaie/ZilouchianHJ98,
author = {Ali Zilouchian and
David W. Howard and
Timothy Jordanides},
editor = {Angel P. del Pobil and
Jos{\'{e}} Mira and
Moonis Ali},
title = {An Adaptive Neuro-Fuzzy Inference System {(ANFIS)} Approach to Control
of Robotic Manipulators},
booktitle = {Tasks and Methods in Applied Artificial Intelligence, 11th International
Conference on Industrial and Engineering Applications of Artificial
In telligence and Expert Systems, IEA/AIE-98, Castell{\'{o}}n,
Spain, June 1-4, 1998, Proceedings, Volume {II}},
series = {Lecture Notes in Computer Science},
volume = {1416},
pages = {383--392},
publisher = {Springer},
year = {1998},
url = {https://doi.org/10.1007/3-540-64574-8\_424},
doi = {10.1007/3-540-64574-8\_424},
timestamp = {Tue, 29 Dec 2020 18:33:32 +0100},
biburl = {https://dblp.org/rec/conf/ieaaie/ZilouchianHJ98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bell/DorwardPPRTW97,
author = {Sean M. Dorward and
Rob Pike and
David L. Presotto and
Dennis M. Ritchie and
Howard W. Trickey and
Philip Winterbottom},
title = {The Inferno{\texttrademark} operating system},
journal = {Bell Labs Tech. J.},
volume = {2},
number = {1},
pages = {5--18},
year = {1997},
url = {https://doi.org/10.1002/bltj.2028},
doi = {10.1002/BLTJ.2028},
timestamp = {Thu, 27 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bell/DorwardPPRTW97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dss/ShawGT97,
author = {Michael J. Shaw and
David M. Gardner and
Howard Thomas},
title = {Research opportunities in electronic commerce},
journal = {Decis. Support Syst.},
volume = {21},
number = {3},
pages = {149--156},
year = {1997},
url = {https://doi.org/10.1016/S0167-9236(97)00025-0},
doi = {10.1016/S0167-9236(97)00025-0},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dss/ShawGT97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jdi/GurRKPFRK97,
author = {David Gur and
David A. Rubin and
Barry H. Kart and
Arleen M. Peterson and
Carl Fuhrman and
Howard E. Rockette and
Jill L. King},
title = {Forced choice and ordinal discrete rating assessment of image quality:
{A} comparison},
journal = {J. Digit. Imaging},
volume = {10},
number = {3},
pages = {103--107},
year = {1997},
url = {https://doi.org/10.1007/BF03168596},
doi = {10.1007/BF03168596},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jdi/GurRKPFRK97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsa/TyrrellBH97,
author = {Andrew M. Tyrrell and
Tim S. Brookes and
David M. Howard},
title = {{T9000} and {T800} transputers: {A} real-time application},
journal = {J. Syst. Archit.},
volume = {43},
number = {1-5},
pages = {341--344},
year = {1997},
timestamp = {Tue, 19 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsa/TyrrellBH97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WilliamsonECDSL97,
author = {William Williamson III and
Steven B. Enquist and
David H. Chow and
Howard L. Dunlap and
Suresh Subramaniam and
Peiming Lei and
Gary H. Bernstein and
Barry K. Gilbert},
title = {12 GHz clocked operation of ultralow power interband resonant tunneling
diode pipelined logic gates},
journal = {{IEEE} J. Solid State Circuits},
volume = {32},
number = {2},
pages = {222--231},
year = {1997},
url = {https://doi.org/10.1109/4.551914},
doi = {10.1109/4.551914},
timestamp = {Thu, 07 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WilliamsonECDSL97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/robotica/ZhangHSM97,
author = {Shu{-}jun Zhang and
David Howard and
D. John Sanger and
Shan Miao},
title = {Multi-legged walking machine body design},
journal = {Robotica},
volume = {15},
number = {6},
pages = {593--598},
year = {1997},
url = {https://doi.org/10.1017/s0263574797000714},
doi = {10.1017/S0263574797000714},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/robotica/ZhangHSM97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcs/AlbrechtCJ97,
author = {David W. Albrecht and
John N. Crossley and
John S. Jeavons},
title = {New Curry-Howard Terms for Full Linear Logic},
journal = {Theor. Comput. Sci.},
volume = {185},
number = {2},
pages = {217--235},
year = {1997},
url = {https://doi.org/10.1016/S0304-3975(97)00044-3},
doi = {10.1016/S0304-3975(97)00044-3},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcs/AlbrechtCJ97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/HoltzblattPRRH97,
author = {Lester J. Holtzblatt and
Richard L. Piazza and
Howard B. Reubenstein and
Susan N. Roberts and
David R. Harris},
title = {Design Recovery for Distributed Systems},
journal = {{IEEE} Trans. Software Eng.},
volume = {23},
number = {7},
pages = {461--472},
year = {1997},
url = {https://doi.org/10.1109/32.605763},
doi = {10.1109/32.605763},
timestamp = {Mon, 14 Aug 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tse/HoltzblattPRRH97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wc/BuchananFMPSX97,
author = {Ken Buchanan and
Rodger Fudge and
David McFarlane and
Tim Phillips and
Akio Sasaki and
Howard Xia},
title = {{IMT-2000:} service provider's perspective},
journal = {{IEEE} Wirel. Commun.},
volume = {4},
number = {4},
pages = {8--13},
year = {1997},
url = {https://doi.org/10.1109/98.612272},
doi = {10.1109/98.612272},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/wc/BuchananFMPSX97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compcon/DorwardPPRTW97,
author = {Sean Dorward and
Rob Pike and
David L. Presotto and
Dennis Ritchie and
Howard Trickey and
Phil Winterbottom},
title = {Inferno},
booktitle = {Proceedings {IEEE} {COMPCON} 97, San Jose, California, USA, February
23-26, 1997, Digest of Papers},
pages = {241--244},
publisher = {{IEEE} Computer Society},
year = {1997},
url = {https://doi.org/10.1109/CMPCON.1997.584718},
doi = {10.1109/CMPCON.1997.584718},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/compcon/DorwardPPRTW97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/ChenL97,
author = {Howard H. Chen and
David D. Ling},
editor = {Ellen J. Yoffa and
Giovanni De Micheli and
Jan M. Rabaey},
title = {Power Supply Noise Analysis Methodology for Deep-Submicron {VLSI}
Chip Design},
booktitle = {Proceedings of the 34st Conference on Design Automation, Anaheim,
California, USA, Anaheim Convention Center, June 9-13, 1997},
pages = {638--643},
publisher = {{ACM} Press},
year = {1997},
url = {https://doi.org/10.1145/266021.266307},
doi = {10.1145/266021.266307},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dac/ChenL97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hcw/MessinaBDGCES97,
author = {Paul Messina and
Sharon Brunett and
Dan M. Davis and
Thomas D. Gottschalk and
David W. Curkendall and
L. Ekroot and
Howard Jay Siegel},
title = {Distributed interactive simulation for synthetic forces},
booktitle = {6th Heterogeneous Computing Workshop, {HCW} 1997, Geneva, Switzerland,
April 1, 1997},
pages = {112},
publisher = {{IEEE} Computer Society},
year = {1997},
url = {https://doi.org/10.1109/HCW.1997.581414},
doi = {10.1109/HCW.1997.581414},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hcw/MessinaBDGCES97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnn/KhanBMC97,
author = {Imran Khan and
David C. Blight and
Robert D. McLeod and
Howard C. Card},
title = {Categorizing Web documents using competitive learning: an ingredient
of a personal adaptive agent},
booktitle = {Proceedings of International Conference on Neural Networks (ICNN'97),
Houston, TX, USA, June 9-12, 1997},
pages = {96--99},
publisher = {{IEEE}},
year = {1997},
url = {https://doi.org/10.1109/ICNN.1997.611644},
doi = {10.1109/ICNN.1997.611644},
timestamp = {Fri, 16 Aug 2019 17:38:27 +0200},
biburl = {https://dblp.org/rec/conf/icnn/KhanBMC97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/DrotningKWDHJKKLM97,
author = {William Drotning and
Howard Kimberly and
Walter Wapman and
David Darras and
Dan Homan and
Paul Johnson and
Brian Kast and
Joel Kuhlmann and
R. Charleene Lennox and
Carla Montoya},
title = {A sensor-based automation system for handling nuclear materials},
booktitle = {Proceedings of the 1997 {IEEE} International Conference on Robotics
and Automation, Albuquerque, New Mexico, USA, April 20-25, 1997},
pages = {352--358},
publisher = {{IEEE}},
year = {1997},
url = {https://doi.org/10.1109/ROBOT.1997.620063},
doi = {10.1109/ROBOT.1997.620063},
timestamp = {Fri, 13 Aug 2021 09:26:01 +0200},
biburl = {https://dblp.org/rec/conf/icra/DrotningKWDHJKKLM97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmetrics/GibsonNACFGLORRZ97,
author = {Garth A. Gibson and
David Nagle and
Khalil Amiri and
Fay W. Chang and
Eugene M. Feinberg and
Howard Gobioff and
Chen Lee and
Berend Ozceri and
Erik Riedel and
David Rochberg and
Jim Zelenka},
editor = {John Zahorjan and
Albert G. Greenberg and
Scott T. Leutenegger},
title = {File Server Scaling with Network-Attached Secure Disks},
booktitle = {Proceedings of the 1997 {ACM} {SIGMETRICS} international conference
on Measurement and modeling of computer systems, Seattle, Washington,
USA, June 15-18, 1997},
pages = {272--284},
publisher = {{ACM}},
year = {1997},
url = {https://doi.org/10.1145/258612.258696},
doi = {10.1145/258612.258696},
timestamp = {Fri, 30 Jul 2021 16:13:33 +0200},
biburl = {https://dblp.org/rec/conf/sigmetrics/GibsonNACFGLORRZ97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ase/HarrisYR96,
author = {David R. Harris and
Alexander S. Yeh and
Howard B. Reubenstein},
title = {Extracting Architectural Features from Source Code},
journal = {Autom. Softw. Eng.},
volume = {3},
number = {1/2},
pages = {109--138},
year = {1996},
url = {https://doi.org/10.1007/BF00126961},
doi = {10.1007/BF00126961},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ase/HarrisYR96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/robotica/ZhangHS96,
author = {Shu{-}jun Zhang and
David Howard and
D. John Sanger},
title = {Workspaces of a walking machine and their graphical representation.
Part {II:} static workspaces},
journal = {Robotica},
volume = {14},
number = {2},
pages = {219--226},
year = {1996},
url = {https://doi.org/10.1017/S0263574700019135},
doi = {10.1017/S0263574700019135},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/robotica/ZhangHS96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/robotica/ZhangSH96,
author = {Shu{-}jun Zhang and
D. John Sanger and
David Howard},
title = {Workspaces of a walking machine and their graphical representation.
Part {I:} kinematic workspaces},
journal = {Robotica},
volume = {14},
number = {1},
pages = {71--79},
year = {1996},
url = {https://doi.org/10.1017/S0263574700018956},
doi = {10.1017/S0263574700018956},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/robotica/ZhangSH96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamsc/ElmanS96,
author = {Howard C. Elman and
David J. Silvester},
title = {Fast Nonsymmetric Iterations and Preconditioning for Navier-Stokes
Equations},
journal = {{SIAM} J. Sci. Comput.},
volume = {17},
number = {1},
pages = {33--46},
year = {1996},
url = {https://doi.org/10.1137/0917004},
doi = {10.1137/0917004},
timestamp = {Thu, 30 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamsc/ElmanS96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sopr/NelsonNR96,
author = {Howard C. Nelson and
Tom Nute and
David J. Rodjak},
title = {Applying the spiral model: {A} case study in small project management},
journal = {Softw. Process. Improv. Pract.},
volume = {2},
number = {4},
pages = {239--251},
year = {1996},
url = {https://doi.org/10.1002/(SICI)1099-1670(199612)2:4\<239::AID-SPIP55\>3.0.CO;2-V},
doi = {10.1002/(SICI)1099-1670(199612)2:4\<239::AID-SPIP55\>3.0.CO;2-V},
timestamp = {Wed, 13 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sopr/NelsonNR96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wc/NarayanaswamySABBBBCFGHKLMR96,
author = {Shankar Narayanaswamy and
Srinivasan Seshan and
Elan Amir and
Eric A. Brewer and
Robert W. Brodersen and
Fred L. Burghardt and
Andrew J. Burstein and
Yuan{-}Chi Chang and
Armando Fox and
Jeffrey M. Gilbert and
Richard Han and
Randy H. Katz and
Allan Christian Long Jr. and
David G. Messerschmitt and
Jan M. Rabaey},
title = {A low-power, lightweight unit to provide ubiquitous information access
application and network support for InfoPad},
journal = {{IEEE} Wirel. Commun.},
volume = {3},
number = {2},
pages = {4--17},
year = {1996},
url = {https://doi.org/10.1109/98.490749},
doi = {10.1109/98.490749},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/wc/NarayanaswamySABBBBCFGHKLMR96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ht/BesserBBDHCRHSD96,
author = {Howard Besser and
Michael Bieber and
Paul De Bra and
Frank Dignum and
Gary Hill and
Les Carr and
David De Roure and
Wendy Hall and
Norbert A. Streitz and
Steven J. DeRoss},
editor = {David Stotts},
title = {World-Wide Web Authoring and Collaboration},
booktitle = {Hypertext '96, The Seventh {ACM} Conference on Hypertext, Washington,
DC, USA, March 16-20, 1996},
pages = {262},
publisher = {{ACM}},
year = {1996},
url = {https://doi.org/10.1145/234828.234859},
doi = {10.1145/234828.234859},
timestamp = {Tue, 30 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ht/BesserBBDHCRHSD96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/BrookesTH96,
author = {Tim S. Brookes and
Andy M. Tyrrell and
David M. Howard},
title = {Musical Analysis using a Real-Time Model of Peripheral Hearing},
booktitle = {Proceedings of the 1996 International Computer Music Conference, {ICMC}
1996, Hong Kong, August 19-24, 1996},
publisher = {Michigan Publishing},
year = {1996},
url = {https://hdl.handle.net/2027/spo.bbp2372.1996.022},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/BrookesTH96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/CreaseyHT96,
author = {David P. Creasey and
David M. Howard and
Andrew M. Tyrrell},
title = {The Timbral Object - An Alternative Route to the Control of Timbre
Space},
booktitle = {Proceedings of the 1996 International Computer Music Conference, {ICMC}
1996, Hong Kong, August 19-24, 1996},
publisher = {Michigan Publishing},
year = {1996},
url = {https://hdl.handle.net/2027/spo.bbp2372.1996.116},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/CreaseyHT96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/EvansH96,
author = {Michelle Evans and
David M. Howard},
title = {The Synthesis of Sung Vowels in Female Opera and Belt Qualities},
booktitle = {Proceedings of the 1996 International Computer Music Conference, {ICMC}
1996, Hong Kong, August 19-24, 1996},
publisher = {Michigan Publishing},
year = {1996},
url = {https://hdl.handle.net/2027/spo.bbp2372.1996.067},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/EvansH96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/PearsonH96,
author = {Mark Pearson and
David M. Howard},
title = {Recent Developments with the {TAO} Physical Modelling System},
booktitle = {Proceedings of the 1996 International Computer Music Conference, {ICMC}
1996, Hong Kong, August 19-24, 1996},
publisher = {Michigan Publishing},
year = {1996},
url = {https://hdl.handle.net/2027/spo.bbp2372.1996.027},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/PearsonH96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pdp/GarnerHBT96,
author = {Neil Garner and
David M. Howard and
P. A. Barrett and
Andrew M. Tyrrell},
title = {A Parallel Processing Environment for Speech Signal Processing Applications},
booktitle = {4th Euromicro Workshop on Parallel and Distributed Processing {(PDP}
'96), January 24-26, 1996, Portugal},
pages = {470--477},
publisher = {{IEEE} Computer Society},
year = {1996},
url = {https://doi.org/10.1109/EMPDP.1996.500621},
doi = {10.1109/EMPDP.1996.500621},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pdp/GarnerHBT96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ci/HamiltonF95,
author = {Howard J. Hamilton and
David R. Fudger},
title = {Estimating DBLEARN's Potential for Knowledge Discovery in Databases},
journal = {Comput. Intell.},
volume = {11},
pages = {280--296},
year = {1995},
url = {https://doi.org/10.1111/j.1467-8640.1995.tb00033.x},
doi = {10.1111/J.1467-8640.1995.TB00033.X},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ci/HamiltonF95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csys/PikePDFTT95,
author = {Rob Pike and
David L. Presotto and
Sean Dorward and
Bob Flandrena and
Ken Thompson and
Howard Trickey and
Phil Winterbottom},
title = {Plan 9 from Bell Labs},
journal = {Comput. Syst.},
volume = {8},
number = {2},
pages = {221--254},
year = {1995},
url = {http://www.usenix.org/publications/compsystems/1995/sum\_pike.pdf},
timestamp = {Sun, 10 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csys/PikePDFTT95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/hf/GabaHS95,
author = {David M. Gaba and
Steven K. Howard and
Stephen D. Small},
title = {Situation Awareness in Anesthesiology},
journal = {Hum. Factors},
volume = {37},
number = {1},
pages = {20--31},
year = {1995},
url = {https://doi.org/10.1518/001872095779049435},
doi = {10.1518/001872095779049435},
timestamp = {Thu, 04 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/hf/GabaHS95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/KoburgerCAABBBCDGHHHLLLMMNNSTWW95,
author = {Charles W. Koburger III and
William F. Clark and
James W. Adkisson and
Eric Adler and
Paul E. Bakeman and
Albert S. Bergendahl and
Alan B. Botula and
W. Chang and
Bijan Davari and
John H. Givens and
Howard H. Hansen and
Steven J. Holmes and
David V. Horak and
Chung Hon Lam and
Jerome B. Lasky and
Stephen E. Luce and
Randy W. Mann and
Glen L. Miles and
James S. Nakos and
Edward J. Nowak and
Ghavam G. Shahidi and
Yuan Taur and
Francis R. White and
Matthew R. Wordeman},
title = {A half-micron {CMOS} logic generation},
journal = {{IBM} J. Res. Dev.},
volume = {39},
number = {1-2},
pages = {215--228},
year = {1995},
url = {https://doi.org/10.1147/rd.391.0215},
doi = {10.1147/RD.391.0215},
timestamp = {Thu, 02 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ibmrd/KoburgerCAABBBCDGHHHLLLMMNNSTWW95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieeemm/AndersonBHRSW95,
author = {David B. Anderson and
John W. Barrus and
John H. Howard and
Charles Rich and
Chia Shen and
Richard C. Waters},
title = {Building Multiuser Interactive Multimedia Environments at {MERL}},
journal = {{IEEE} Multim.},
volume = {2},
number = {4},
pages = {77--82},
year = {1995},
url = {https://doi.org/10.1109/93.482298},
doi = {10.1109/93.482298},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieeemm/AndersonBHRSW95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcss/BarringtonS95,
author = {David A. Mix Barrington and
Howard Straubing},
title = {Superlinear Lower Bounds for Bounded-Width Branching Programs},
journal = {J. Comput. Syst. Sci.},
volume = {50},
number = {3},
pages = {374--381},
year = {1995},
url = {https://doi.org/10.1006/jcss.1995.1029},
doi = {10.1006/JCSS.1995.1029},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcss/BarringtonS95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/PanGDK95,
author = {Si{-}Ming Pan and
Howard A. Grant and
David E. Dodds and
Surinder Kumar},
title = {An offset-Z search strategy for spread spectrum systems},
journal = {{IEEE} Trans. Commun.},
volume = {43},
number = {12},
pages = {2900--2902},
year = {1995},
url = {https://doi.org/10.1109/26.477489},
doi = {10.1109/26.477489},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcom/PanGDK95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cav/DillW95,
author = {David L. Dill and
Howard Wong{-}Toi},
editor = {Pierre Wolper},
title = {Verification of Real-Time Systems by Successive Over and Under Approximation},
booktitle = {Computer Aided Verification, 7th International Conference, Li{\`{e}}ge,
Belgium, July, 3-5, 1995, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {939},
pages = {409--422},
publisher = {Springer},
year = {1995},
url = {https://doi.org/10.1007/3-540-60045-0\_66},
doi = {10.1007/3-540-60045-0\_66},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/cav/DillW95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/GibsonH95,
author = {Ian S. Gibson and
David M. Howard},
title = {Intuitive and Dynamic Control of Synthesized Sounds by Voice},
booktitle = {Proceedings of the 1995 International Computer Music Conference, {ICMC}
1995, Banff, AB, Canada, September 3-7, 1995},
publisher = {Michigan Publishing},
year = {1995},
url = {https://hdl.handle.net/2027/spo.bbp2372.1995.066},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/GibsonH95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/PearsonH95,
author = {Mark Pearson and
David M. Howard},
title = {A Musicians Approach to Physical Modeling},
booktitle = {Proceedings of the 1995 International Computer Music Conference, {ICMC}
1995, Banff, AB, Canada, September 3-7, 1995},
publisher = {Michigan Publishing},
year = {1995},
url = {https://hdl.handle.net/2027/spo.bbp2372.1995.165},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/PearsonH95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnn/GarnerBHT95,
author = {Neil Garner and
Andy Breen and
David M. Howard and
Andy M. Tyrrell},
title = {Neural network for syntactic categorisation of words},
booktitle = {Proceedings of International Conference on Neural Networks (ICNN'95),
Perth, WA, Australia, November 27 - December 1, 1995},
pages = {2863--2866},
publisher = {{IEEE}},
year = {1995},
url = {https://doi.org/10.1109/ICNN.1995.488188},
doi = {10.1109/ICNN.1995.488188},
timestamp = {Thu, 29 Aug 2019 08:54:05 +0200},
biburl = {https://dblp.org/rec/conf/icnn/GarnerBHT95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/HarrisRY95,
author = {David R. Harris and
Howard B. Reubenstein and
Alexander S. Yeh},
editor = {Dewayne E. Perry and
Ross Jeffery and
David Notkin},
title = {Reverse Engineering to the Architectural Level},
booktitle = {17th International Conference on Software Engineering, Seattle, Washington,
USA, April 23-30, 1995, Proceedings},
pages = {186--195},
publisher = {{ACM}},
year = {1995},
url = {https://doi.org/10.1145/225014.225032},
doi = {10.1145/225014.225032},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icse/HarrisRY95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/latin/BarringtonS95,
author = {David A. Mix Barrington and
Howard Straubing},
editor = {Ricardo A. Baeza{-}Yates and
Eric Goles Ch. and
Patricio V. Poblete},
title = {Lower Bounds for Modular Counting by Circuits with Modular Gates},
booktitle = {{LATIN} '95: Theoretical Informatics, Second Latin American Symposium,
Valpara{\'{\i}}so, Chile, April 3-7, 1995, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {911},
pages = {60--71},
publisher = {Springer},
year = {1995},
url = {https://doi.org/10.1007/3-540-59175-3\_81},
doi = {10.1007/3-540-59175-3\_81},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/latin/BarringtonS95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/ChervenakPK95,
author = {Ann L. Chervenak and
David A. Patterson and
Randy H. Katz},
editor = {Polle Zellweger},
title = {Choosing the Best Storage System for Video Service},
booktitle = {Proceedings of the Third {ACM} International Conference on Multimedia
'95, San Francisco, CA, USA, November 5-9, 1995},
pages = {109--119},
publisher = {{ACM} Press},
year = {1995},
url = {https://doi.org/10.1145/217279.215256},
doi = {10.1145/217279.215256},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mm/ChervenakPK95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mss/ChervenakPK95,
author = {Ann L. Chervenak and
David A. Patterson and
Randy H. Katz},
title = {Storage Systems for Movies-on-Demand Video Servers},
booktitle = {Proceedings of the Fourteenth {IEEE} Symposium on Mass Storage Systems,
{MSS} 1995: Storage - At the Forefront of Information Infrastructures,
Monterey, California, USA, September 11-14, 1995},
pages = {246--256},
publisher = {{IEEE} Computer Society},
year = {1995},
url = {https://doi.org/10.1109/MASS.1995.528234},
doi = {10.1109/MASS.1995.528234},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mss/ChervenakPK95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcre/HarrisYR95,
author = {David R. Harris and
Alexander S. Yeh and
Howard B. Reubenstein},
editor = {Linda M. Wills and
Philip Newcomb and
Elliot J. Chikofsky},
title = {Recognizers for Extracting Architectural Features from Source Code},
booktitle = {2nd Working Conference on Reverse Engineering, {WCRE} '95, Toronto,
Canada, July 14-16, 1995},
publisher = {{IEEE} Computer Society},
year = {1995},
url = {https://doi.org/10.1109/WCRE.1995.514713},
doi = {10.1109/WCRE.1995.514713},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wcre/HarrisYR95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcre/YehHR95,
author = {Alexander S. Yeh and
David R. Harris and
Howard B. Reubenstein},
editor = {Linda M. Wills and
Philip Newcomb and
Elliot J. Chikofsky},
title = {Recovering Abstract Data Types and Object Instances from a Conventional
Procedural Language},
booktitle = {2nd Working Conference on Reverse Engineering, {WCRE} '95, Toronto,
Canada, July 14-16, 1995},
pages = {227--236},
publisher = {{IEEE} Computer Society},
year = {1995},
url = {https://doi.org/10.1109/WCRE.1995.514711},
doi = {10.1109/WCRE.1995.514711},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wcre/YehHR95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/algorithmica/HellersteinGKKP94,
author = {Lisa Hellerstein and
Garth A. Gibson and
Richard M. Karp and
Randy H. Katz and
David A. Patterson},
title = {Coding Techniques for Handling Failures in Large Disk Arrays},
journal = {Algorithmica},
volume = {12},
number = {2/3},
pages = {182--208},
year = {1994},
url = {https://doi.org/10.1007/BF01185210},
doi = {10.1007/BF01185210},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/algorithmica/HellersteinGKKP94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cc/BarringtonS94,
author = {David A. Mix Barrington and
Howard Straubing},
title = {Complex Polynomials and Circuit Lower Bounds for Modular Counting},
journal = {Comput. Complex.},
volume = {4},
pages = {325--338},
year = {1994},
url = {https://doi.org/10.1007/BF01263421},
doi = {10.1007/BF01263421},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cc/BarringtonS94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csur/ChenLGKP94,
author = {Peter M. Chen and
Edward K. Lee and
Garth A. Gibson and
Randy H. Katz and
David A. Patterson},
title = {{RAID:} High-Performance, Reliable Secondary Storage},
journal = {{ACM} Comput. Surv.},
volume = {26},
number = {2},
pages = {145--185},
year = {1994},
url = {https://doi.org/10.1145/176979.176981},
doi = {10.1145/176979.176981},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csur/ChenLGKP94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dpd/ChenLDLMSSPK94,
author = {Peter M. Chen and
Edward K. Lee and
Ann L. Drapeau and
Ken Lutz and
Ethan L. Miller and
Srinivasan Seshan and
Ken Shirriff and
David A. Patterson and
Randy H. Katz},
title = {Performance and Design Evaluation of the {RAID-II} Storage Server},
journal = {Distributed Parallel Databases},
volume = {2},
number = {3},
pages = {243--260},
year = {1994},
url = {https://doi.org/10.1007/BF01266330},
doi = {10.1007/BF01266330},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dpd/ChenLDLMSSPK94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mam/SwanHT94,
author = {Chris Swan and
David M. Howard and
Andrew M. Tyrrell},
title = {Real-time transputer simulation of the human peripheral hearing system},
journal = {Microprocess. Microsystems},
volume = {18},
number = {4},
pages = {215--221},
year = {1994},
url = {https://doi.org/10.1016/0141-9331(94)90084-1},
doi = {10.1016/0141-9331(94)90084-1},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mam/SwanHT94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/enter/AustinHKMJMWW94,
author = {W. J. Austin and
E. K. Hutchinson and
John Kalmus and
Lachlan M. MacKinnon and
Keith G. Jeffery and
David H. Marwick and
M. Howard Williams and
Michael D. Wilson},
editor = {Walter Schertler and
Beat Schmid and
A Min Tjoa and
Hannes Werthner},
title = {Processing Travel Queries in a Multimedia Information System},
booktitle = {Proceedings of the International Conference on Information and Communications
Technologies in Tourism, {ENTER} 1994, Innsbruck, Austria, 1994},
pages = {64--71},
publisher = {Springer},
year = {1994},
url = {https://doi.org/10.1007/978-3-7091-9343-3\_11},
doi = {10.1007/978-3-7091-9343-3\_11},
timestamp = {Tue, 29 Dec 2020 18:40:12 +0100},
biburl = {https://dblp.org/rec/conf/enter/AustinHKMJMWW94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/RossiterH94,
author = {David Rossiter and
David M. Howard},
title = {A Graphical Environment for Electroacoustic Music Composition},
booktitle = {Proceedings of the 1994 International Computer Music Conference, {ICMC}
1994, Aarhus, Denmark, September 12-17, 1994},
publisher = {Michigan Publishing},
year = {1994},
url = {https://hdl.handle.net/2027/spo.bbp2372.1994.071},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/RossiterH94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/RossiterH94a,
author = {David Rossiter and
David M. Howard},
title = {Voice Source and Acoustic Output Qualities for Singing Synthesis},
booktitle = {Proceedings of the 1994 International Computer Music Conference, {ICMC}
1994, Aarhus, Denmark, September 12-17, 1994},
publisher = {Michigan Publishing},
year = {1994},
url = {https://hdl.handle.net/2027/spo.bbp2372.1994.123},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/RossiterH94a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/DrapeauSHMSKLPLCG94,
author = {Ann L. Drapeau and
Ken Shirriff and
John H. Hartman and
Ethan L. Miller and
Srinivasan Seshan and
Randy H. Katz and
Ken Lutz and
David A. Patterson and
Edward K. Lee and
Peter M. Chen and
Garth A. Gibson},
editor = {David A. Patterson},
title = {{RAID-II:} {A} High-Bandwidth Network File Server},
booktitle = {Proceedings of the 21st Annual International Symposium on Computer
Architecture. Chicago, IL, USA, April 1994},
pages = {234--244},
publisher = {{IEEE} Computer Society},
year = {1994},
url = {https://doi.org/10.1109/ISCA.1994.288146},
doi = {10.1109/ISCA.1994.288146},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isca/DrapeauSHMSKLPLCG94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mss/KeetonDPK94,
author = {Kimberly Keeton and
Ann L. Drapeau and
David A. Patterson and
Randy H. Katz},
title = {Storage alternatives for video service},
booktitle = {Proceedings of the 13th {IEEE} Symposium on Mass Storage Systems,
{MSS} 1994: Towards Distributed Storage and Data Management Systems,
L'Annecy, France, June 12-16, 1994},
pages = {100--105},
publisher = {{IEEE} Computer Society},
year = {1994},
url = {https://doi.org/10.1109/MASS.1994.373040},
doi = {10.1109/MASS.1994.373040},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mss/KeetonDPK94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/re/ShekaranGJMPR94,
author = {M. Chandra Shekaran and
David Garlan and
Michael Jackson and
Nancy R. Mead and
Colin Potts and
Howard B. Reubenstein},
title = {The role of software architecture in requirements engineering},
booktitle = {Proceedings of the First {IEEE} International Conference on Requirements
Engineering, {ICRE} '94, Colorado Springs, Colorado, USA, April 18-21,
1994},
pages = {239--245},
publisher = {{IEEE} Computer Society},
year = {1994},
url = {https://doi.org/10.1109/ICRE.1994.292379},
doi = {10.1109/ICRE.1994.292379},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/re/ShekaranGJMPR94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmetrics/DrapeauPK94,
author = {Ann L. Drapeau and
David A. Patterson and
Randy H. Katz},
editor = {Larry W. Dowdy and
Rick Bunt and
Blaine D. Gaither},
title = {Toward Workload Characterization of Video Server and Digital Library
Applications},
booktitle = {Proceedings of the 1994 {ACM} {SIGMETRICS} conference on Measurement
and modeling of computer systems, Vanderbilt University, Nashville,
Tennessee, USA, May 16-20, 1994},
pages = {274--275},
publisher = {{ACM}},
year = {1994},
url = {https://doi.org/10.1145/183018.183049},
doi = {10.1145/183018.183049},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigmetrics/DrapeauPK94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/GamperRCVAGSM93,
author = {Howard B. Gamper and
Michael W. Reed and
Thomas Cox and
Jeanne S. Virosco and
A. David Adams and
Alexander A. Gall and
John K. Scholler and
Rich B. Meyer Jr.},
title = {Facile preparation of nuclease resistant 3' modified oligodeoxynucleotides},
journal = {Nucleic Acids Res.},
volume = {21},
number = {1},
pages = {145--150},
year = {1993},
url = {https://doi.org/10.1093/nar/21.1.145},
doi = {10.1093/NAR/21.1.145},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/GamperRCVAGSM93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/robotica/MittelstadtPKZWPCKRM93,
author = {Brent D. Mittelstadt and
Howard A. Paul and
Peter Kazanzides and
Joel F. Zuhars and
Bill Williamson and
Robert Pettit and
Phillip Cain and
David Kloth and
Luke Rose and
Bela L. Musits},
title = {Development of a surgical robot for cementless total hip replacement},
journal = {Robotica},
volume = {11},
number = {6},
pages = {553--560},
year = {1993},
url = {https://doi.org/10.1017/S0263574700019408},
doi = {10.1017/S0263574700019408},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/robotica/MittelstadtPKZWPCKRM93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigops/PikePTTW93,
author = {Rob Pike and
David L. Presotto and
Ken Thompson and
Howard Trickey and
Phil Winterbottom},
title = {The Use of Name Spaces in Plan 9},
journal = {{ACM} {SIGOPS} Oper. Syst. Rev.},
volume = {27},
number = {2},
pages = {72--76},
year = {1993},
url = {https://doi.org/10.1145/155848.155861},
doi = {10.1145/155848.155861},
timestamp = {Tue, 14 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigops/PikePTTW93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/SwiftKC93,
author = {David C. Swift and
Howard Kaufman and
Steven T. Cummings},
title = {Direct Model Reference Adaptive Control of a Puma Manipulator},
booktitle = {Proceedings of the 1993 {IEEE} International Conference on Robotics
and Automation, Atlanta, Georgia, USA, May 1993},
pages = {346--351},
publisher = {{IEEE} Computer Society Press},
year = {1993},
url = {https://doi.org/10.1109/ROBOT.1993.292169},
doi = {10.1109/ROBOT.1993.292169},
timestamp = {Fri, 13 Aug 2021 09:26:01 +0200},
biburl = {https://dblp.org/rec/conf/icra/SwiftKC93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rsctc/FudgerH93,
author = {David R. Fudger and
Howard J. Hamilton},
editor = {Wojciech Ziarko},
title = {A Heuristic for Evaluating Databases for Knowledge Discovery with
{DBLEARN}},
booktitle = {Rough Sets, Fuzzy Sets and Knowledge Discovery, Proceedings of the
International Workshop on Rough Sets and Knowledge Discovery, {RSKD}
1993, Banff, Alberta, Canada, 12-15 October 1993},
series = {Workshops in Computing},
pages = {44--51},
publisher = {Springer},
year = {1993},
timestamp = {Thu, 08 Dec 2022 10:02:10 +0100},
biburl = {https://dblp.org/rec/conf/rsctc/FudgerH93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/el/93/WestHHMSB93,
author = {Adrian J. West and
T. L. J. Howard and
Roger J. Hubbold and
Alan Murta and
David N. Snowdon and
D. A. Butler},
editor = {Rae A. Earnshaw and
Michael A. Gigante and
Huw Jones},
title = {{AVIARY} - {A} Generic Virtual Reality Interface for Real Applications},
booktitle = {Virtual Reality Systems},
pages = {213--236},
publisher = {Elsevier},
year = {1993},
url = {https://doi.org/10.1016/b978-0-12-227748-1.50023-8},
doi = {10.1016/B978-0-12-227748-1.50023-8},
timestamp = {Mon, 29 Jun 2020 15:18:56 +0200},
biburl = {https://dblp.org/rec/books/el/93/WestHHMSB93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcss/BarringtonCST92,
author = {David A. Mix Barrington and
Kevin J. Compton and
Howard Straubing and
Denis Th{\'{e}}rien},
title = {Regular Languages in NC{\({^1}\)}},
journal = {J. Comput. Syst. Sci.},
volume = {44},
number = {3},
pages = {478--499},
year = {1992},
url = {https://doi.org/10.1016/0022-0000(92)90014-A},
doi = {10.1016/0022-0000(92)90014-A},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcss/BarringtonCST92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jct/BenderCRR92,
author = {Edward A. Bender and
Raymond Coley and
David P. Robbins and
Howard Rumsey Jr.},
title = {Enumeration of Subspaces by Dimension Sequence},
journal = {J. Comb. Theory {A}},
volume = {59},
number = {1},
pages = {1--11},
year = {1992},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jct/BenderCRR92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/SiegelABBCDDDFGHJJPSSSSTW92,
author = {Howard Jay Siegel and
Seth Abraham and
William L. Bain and
Kenneth E. Batcher and
Thomas L. Casavant and
Doug DeGroot and
Jack B. Dennis and
David C. Douglas and
Tse{-}Yun Feng and
James R. Goodman and
Alan Huang and
Harry F. Jordan and
J. Robert Jamp and
Yale N. Patt and
Alan Jay Smith and
James E. Smith and
Lawrence Snyder and
Harold S. Stone and
Russ Tuck and
Benjamin W. Wah},
title = {Report of the Purdue Workshop on Grand Challenges in Computer Architecture
for the Support of High Performance Computing},
journal = {J. Parallel Distributed Comput.},
volume = {16},
number = {3},
pages = {199--211},
year = {1992},
url = {https://doi.org/10.1016/0743-7315(92)90033-J},
doi = {10.1016/0743-7315(92)90033-J},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jpdc/SiegelABBCDDDFGHJJPSSSSTW92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsa/TyrrellHB92,
author = {Andrew M. Tyrrell and
David M. Howard and
Nicola A. Beasley},
title = {Transputer model of the human peripheral hearing system},
journal = {Microprocess. Microprogramming},
volume = {35},
number = {1-5},
pages = {619--624},
year = {1992},
url = {https://doi.org/10.1016/0165-6074(92)90377-J},
doi = {10.1016/0165-6074(92)90377-J},
timestamp = {Tue, 19 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsa/TyrrellHB92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/concur/AlurCHDW92,
author = {Rajeev Alur and
Costas Courcoubetis and
Nicolas Halbwachs and
David L. Dill and
Howard Wong{-}Toi},
editor = {Rance Cleaveland},
title = {Minimization of Timed Transition Systems},
booktitle = {{CONCUR} '92, Third International Conference on Concurrency Theory,
Stony Brook, NY, USA, August 24-27, 1992, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {630},
pages = {340--354},
publisher = {Springer},
year = {1992},
url = {https://doi.org/10.1007/BFb0084802},
doi = {10.1007/BFB0084802},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/concur/AlurCHDW92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/GiolmasWCS92,
author = {Nicholas Giolmas and
Daniel W. Watson and
David M. Chelberg and
Howard Jay Siegel},
editor = {Viktor K. Prasanna and
Larry H. Canter},
title = {A Parallel Approach to Hybrid Range Image Segmentation},
booktitle = {Proceedings of the 6th International Parallel Processing Symposium,
Beverly Hills, CA, USA, March 1992},
pages = {334--342},
publisher = {{IEEE} Computer Society},
year = {1992},
url = {https://doi.org/10.1109/IPPS.1992.223024},
doi = {10.1109/IPPS.1992.223024},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/GiolmasWCS92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/latin/BarringtonS92,
author = {David A. Mix Barrington and
Howard Straubing},
editor = {Imre Simon},
title = {Complex Polynomials and Circuit Lower Bounds for Modular Counting},
booktitle = {{LATIN} '92, 1st Latin American Symposium on Theoretical Informatics,
S{\~{a}}o Paulo, Brazil, April 6-10, 1992, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {583},
pages = {24--31},
publisher = {Springer},
year = {1992},
url = {https://doi.org/10.1007/BFb0023814},
doi = {10.1007/BFB0023814},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/latin/BarringtonS92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rtss/AlurCDHW92,
author = {Rajeev Alur and
Costas Courcoubetis and
David L. Dill and
Nicolas Halbwachs and
Howard Wong{-}Toi},
title = {An implementation of three algorithms for timing verification based
on automata emptiness},
booktitle = {Proceedings of the Real-Time Systems Symposium - 1992, Phoenix, Arizona,
USA, December 1992},
pages = {157--166},
publisher = {{IEEE} Computer Society},
year = {1992},
url = {https://doi.org/10.1109/REAL.1992.242667},
doi = {10.1109/REAL.1992.242667},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/rtss/AlurCDHW92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigopsE/PikePTTW92,
author = {Rob Pike and
David L. Presotto and
Ken Thompson and
Howard Trickey and
Phil Winterbottom},
editor = {Jean{-}Pierre Ban{\^{a}}tre},
title = {The use of name spaces in plan 9},
booktitle = {Proceedings of the 5th {ACM} {SIGOPS} European Workshop: Models and
Paradigms for Distributed Systems Structuring, 1992, Mont Saint-Michel,
France, September 21-23, 1992},
publisher = {{ACM}},
year = {1992},
url = {https://doi.org/10.1145/506378.506413},
doi = {10.1145/506378.506413},
timestamp = {Thu, 07 Nov 2019 10:24:25 +0100},
biburl = {https://dblp.org/rec/conf/sigopsE/PikePTTW92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cav/DillHW91,
author = {David L. Dill and
Alan J. Hu and
Howard Wong{-}Toi},
editor = {Kim Guldstrand Larsen and
Arne Skou},
title = {Checking for Language Inclusion Using Simulation Preorders},
booktitle = {Computer Aided Verification, 3rd International Workshop, {CAV} '91,
Aalborg, Denmark, July, 1-4, 1991, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {575},
pages = {255--265},
publisher = {Springer},
year = {1991},
url = {https://doi.org/10.1007/3-540-55179-4\_25},
doi = {10.1007/3-540-55179-4\_25},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/cav/DillHW91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coco/BarringtonS91,
author = {David A. Mix Barrington and
Howard Straubing},
title = {Superlinear Lower Bounds for Bounded-Width Branching Programs},
booktitle = {Proceedings of the Sixth Annual Structure in Complexity Theory Conference,
Chicago, Illinois, USA, June 30 - July 3, 1991},
pages = {305--313},
publisher = {{IEEE} Computer Society},
year = {1991},
url = {https://doi.org/10.1109/SCT.1991.160274},
doi = {10.1109/SCT.1991.160274},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/coco/BarringtonS91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/CroftTL91,
author = {W. Bruce Croft and
Howard R. Turtle and
David D. Lewis},
editor = {Abraham Bookstein and
Yves Chiaramella and
Gerard Salton and
Vijay V. Raghavan},
title = {The Use of Phrases and Structured Queries in Information Retrieval},
booktitle = {Proceedings of the 14th Annual International {ACM} {SIGIR} Conference
on Research and Development in Information Retrieval. Chicago, Illinois,
USA, October 13-16, 1991 (Special Issue of the {SIGIR} Forum)},
pages = {32--45},
publisher = {{ACM}},
year = {1991},
url = {https://doi.org/10.1145/122860.122864},
doi = {10.1145/122860.122864},
timestamp = {Tue, 06 Nov 2018 11:07:25 +0100},
biburl = {https://dblp.org/rec/conf/sigir/CroftTL91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/CharlapRR90,
author = {Leonard S. Charlap and
Howard D. Rees and
David P. Robbins},
title = {The asymptotic probability that a random biased matrix is invertible},
journal = {Discret. Math.},
volume = {82},
number = {2},
pages = {153--163},
year = {1990},
url = {https://doi.org/10.1016/0012-365X(90)90322-9},
doi = {10.1016/0012-365X(90)90322-9},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dm/CharlapRR90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dt/WoodGK90,
author = {David A. Wood and
Garth A. Gibson and
Randy H. Katz},
title = {Verifying a Multiprocessor Cache Controller Using Random Test Generation},
journal = {{IEEE} Des. Test Comput.},
volume = {7},
number = {4},
pages = {13--25},
year = {1990},
url = {https://doi.org/10.1109/54.57906},
doi = {10.1109/54.57906},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dt/WoodGK90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iandc/BarringtonST90,
author = {David A. Mix Barrington and
Howard Straubing and
Denis Th{\'{e}}rien},
title = {Non-Uniform Automata Over Groups},
journal = {Inf. Comput.},
volume = {89},
number = {2},
pages = {109--132},
year = {1990},
url = {https://doi.org/10.1016/0890-5401(90)90007-5},
doi = {10.1016/0890-5401(90)90007-5},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iandc/BarringtonST90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcss/BarringtonIS90,
author = {David A. Mix Barrington and
Neil Immerman and
Howard Straubing},
title = {On Uniformity within NC{\({^1}\)}},
journal = {J. Comput. Syst. Sci.},
volume = {41},
number = {3},
pages = {274--306},
year = {1990},
url = {https://doi.org/10.1016/0022-0000(90)90022-D},
doi = {10.1016/0022-0000(90)90022-D},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcss/BarringtonIS90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cav/Wong-ToiD90,
author = {Howard Wong{-}Toi and
David L. Dill},
editor = {Edmund M. Clarke and
Robert P. Kurshan},
title = {Synthesizing Processes and Schedulers from Temporal Specifications},
booktitle = {Computer Aided Verification, 2nd International Workshop, {CAV} '90,
New Brunswick, NJ, USA, June 18-21, 1990, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {531},
pages = {272--281},
publisher = {Springer},
year = {1990},
url = {https://doi.org/10.1007/BFb0023741},
doi = {10.1007/BFB0023741},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/cav/Wong-ToiD90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dimacs/Wong-ToiD90,
author = {Howard Wong{-}Toi and
David L. Dill},
editor = {Edmund M. Clarke and
Robert P. Kurshan},
title = {Synthesizing Processes and Schedulers from Temporal Specifications},
booktitle = {Computer-Aided Verification, Proceedings of a {DIMACS} Workshop 1990,
New Brunswick, New Jersey, USA, June 18-21, 1990},
series = {{DIMACS} Series in Discrete Mathematics and Theoretical Computer Science},
volume = {3},
pages = {177--186},
publisher = {{DIMACS/AMS}},
year = {1990},
url = {https://doi.org/10.1090/dimacs/003/13},
doi = {10.1090/DIMACS/003/13},
timestamp = {Mon, 22 May 2023 16:07:35 +0200},
biburl = {https://dblp.org/rec/conf/dimacs/Wong-ToiD90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/si3d/EllsworthGT90,
author = {David A. Ellsworth and
Howard Good and
Brice Tebbs},
editor = {Michael Zyda},
title = {Distributing display lists on a multicomputer},
booktitle = {Proceedings of the 1990 symposium on Interactive 3D graphics, {I3D}
'90, Snowbird, UT, USA, March 1990},
pages = {147--154},
publisher = {{ACM}},
year = {1990},
url = {https://doi.org/10.1145/91385.91437},
doi = {10.1145/91385.91437},
timestamp = {Thu, 07 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/si3d/EllsworthGT90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmetrics/ChenGKP90,
author = {Peter M. Chen and
Garth A. Gibson and
Randy H. Katz and
David A. Patterson},
editor = {Gary J. Nutt},
title = {An Evaluation of Redundant Arrays of Disks Using an Amdahl 5890},
booktitle = {Proceedings of the 1990 {ACM} {SIGMETRICS} conference on Measurement
and modeling of computer systems, University of Colorado, Boulder,
Colorado, USA, May 22-25, 1990},
pages = {74--85},
publisher = {{ACM}},
year = {1990},
url = {https://doi.org/10.1145/98457.98509},
doi = {10.1145/98457.98509},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigmetrics/ChenGKP90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cm/ClarkJRS89,
author = {David D. Clark and
Van Jacobson and
John Romkey and
Howard Salwen},
title = {An analysis of {TCP} processing overhead},
journal = {{IEEE} Commun. Mag.},
volume = {27},
number = {6},
pages = {23--29},
year = {1989},
url = {https://doi.org/10.1109/35.29545},
doi = {10.1109/35.29545},
timestamp = {Wed, 02 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cm/ClarkJRS89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/KatzGP89,
author = {Randy H. Katz and
Garth A. Gibson and
David A. Patterson},
title = {Disk system architectures for high performance computing},
journal = {Proc. {IEEE}},
volume = {77},
number = {12},
pages = {1842--1858},
year = {1989},
url = {https://doi.org/10.1109/5.48827},
doi = {10.1109/5.48827},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pieee/KatzGP89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spe/ChangGK89,
author = {Ellis E. Chang and
David Gedye and
Randy H. Katz},
title = {The Design and Implementation of a Version Server for Computer-aided
Design},
journal = {Softw. Pract. Exp.},
volume = {19},
number = {3},
pages = {199--222},
year = {1989},
url = {https://doi.org/10.1002/spe.4380190302},
doi = {10.1002/SPE.4380190302},
timestamp = {Thu, 09 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/spe/ChangGK89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asplos/GibsonHKKP89,
author = {Garth A. Gibson and
Lisa Hellerstein and
Richard M. Karp and
Randy H. Katz and
David A. Patterson},
editor = {Joel S. Emer and
John L. Hennessy},
title = {Failure Correction Techniques for Large Disk Arrays},
booktitle = {{ASPLOS-III} Proceedings - Third International Conference on Architectural
Support for Programming Languages and Operating Systems, Boston, Massachusetts,
USA, April 3-6, 1989},
pages = {123--132},
publisher = {{ACM} Press},
year = {1989},
url = {https://doi.org/10.1145/70082.68194},
doi = {10.1145/70082.68194},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asplos/GibsonHKKP89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compcon/PattersonCGK89,
author = {David A. Patterson and
Peter M. Chen and
Garth Gibson and
Randy H. Katz},
title = {Introduction to redundant arrays of inexpensive disks {(RAID)}},
booktitle = {Thirty-Fourth {IEEE} Computer Society International Conference: Intellectual
Leverage, {COMPCON} Spring 89, San Francisco, CA, USA, February 27
- March 3, 1989, Digest of Papers},
pages = {112--117},
publisher = {{IEEE} Computer Society},
year = {1989},
url = {https://doi.org/10.1109/CMPCON.1989.301912},
doi = {10.1109/CMPCON.1989.301912},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/compcon/PattersonCGK89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compcon/SchulzeKP89,
author = {Martin Schulze and
Garth Gibson and
Randy H. Katz and
David A. Patterson},
title = {How reliable is a RAID?},
booktitle = {Thirty-Fourth {IEEE} Computer Society International Conference: Intellectual
Leverage, {COMPCON} Spring 89, San Francisco, CA, USA, February 27
- March 3, 1989, Digest of Papers},
pages = {118--123},
publisher = {{IEEE} Computer Society},
year = {1989},
url = {https://doi.org/10.1109/CMPCON.1989.301913},
doi = {10.1109/CMPCON.1989.301913},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/compcon/SchulzeKP89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/SilvaGKN89,
author = {M{\'{a}}rio J. Silva and
David Gedye and
Randy H. Katz and
Richard Newton},
editor = {Donald E. Thomas},
title = {Protection and Versioning for {OCT}},
booktitle = {Proceedings of the 26th {ACM/IEEE} Design Automation Conference, Las
Vegas, Nevada, USA, June 25-29, 1989},
pages = {264--269},
publisher = {{ACM} Press},
year = {1989},
url = {https://doi.org/10.1145/74382.74427},
doi = {10.1145/74382.74427},
timestamp = {Thu, 07 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dac/SilvaGKN89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/HowardB89,
author = {David M. Howard and
Andrew P. Breen},
title = {Methods for dynamic excitation control in parallel formant speech
synthesis},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} '89, Glasgow, Scotland, May 23-26, 1989},
pages = {215--218},
publisher = {{IEEE}},
year = {1989},
url = {https://doi.org/10.1109/ICASSP.1989.266403},
doi = {10.1109/ICASSP.1989.266403},
timestamp = {Mon, 09 Aug 2021 14:54:02 +0200},
biburl = {https://dblp.org/rec/conf/icassp/HowardB89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/HowardW89a,
author = {David M. Howard and
Graham F. Welch},
title = {Visual feedback applied to the learning of conscious pitch control
in singing},
booktitle = {First European Conference on Speech Communication and Technology,
{EUROSPEECH} 1989, Paris, France, September 27-29, 1989},
pages = {2485--2488},
publisher = {{ISCA}},
year = {1989},
url = {https://doi.org/10.21437/Eurospeech.1989-289},
doi = {10.21437/EUROSPEECH.1989-289},
timestamp = {Sun, 02 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/HowardW89a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/WoodK89,
author = {David A. Wood and
Randy H. Katz},
editor = {Jean{-}Claude Syre},
title = {Supporting Reference and Dirty Bits in SPUR's Virtual Address Cache},
booktitle = {Proceedings of the 16th Annual International Symposium on Computer
Architecture. Jerusalem, Israel, June 1989},
pages = {122--130},
publisher = {{ACM}},
year = {1989},
url = {https://doi.org/10.1145/74925.74940},
doi = {10.1145/74925.74940},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isca/WoodK89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/debu/KatzOPS88,
author = {Randy H. Katz and
John K. Ousterhout and
David A. Patterson and
Michael Stonebraker},
title = {A Project on High Performance {I/O} Subsystems},
journal = {{IEEE} Data Eng. Bull.},
volume = {11},
number = {1},
pages = {40--47},
year = {1988},
url = {http://sites.computer.org/debull/88MAR-CD.pdf},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/debu/KatzOPS88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tocs/HowardKMNSSW88,
author = {John H. Howard and
Michael L. Kazar and
Sherri G. Menees and
David A. Nichols and
Mahadev Satyanarayanan and
Robert N. Sidebotham and
Michael J. West},
title = {Scale and Performance in a Distributed File System},
journal = {{ACM} Trans. Comput. Syst.},
volume = {6},
number = {1},
pages = {51--81},
year = {1988},
url = {https://doi.org/10.1145/35037.35059},
doi = {10.1145/35037.35059},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tocs/HowardKMNSSW88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsp/HowardL88,
author = {David M. Howard and
Geoffrey Lindsey},
title = {Conditioned variability in voicing offsets},
journal = {{IEEE} Trans. Acoust. Speech Signal Process.},
volume = {36},
number = {3},
pages = {406--407},
year = {1988},
url = {https://doi.org/10.1109/29.1538},
doi = {10.1109/29.1538},
timestamp = {Tue, 19 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsp/HowardL88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsp/WasemGDP88,
author = {Ondria J. Wasem and
David J. Goodman and
Charles A. Dvorak and
Howard G. Page},
title = {The effect of waveform substitution on the quality of {PCM} packet
communications},
journal = {{IEEE} Trans. Acoust. Speech Signal Process.},
volume = {36},
number = {3},
pages = {342--348},
year = {1988},
url = {https://doi.org/10.1109/29.1530},
doi = {10.1109/29.1530},
timestamp = {Tue, 19 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsp/WasemGDP88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coco/BarringtonIS88,
author = {David A. Mix Barrington and
Neil Immerman and
Howard Straubing},
title = {On uniformity within NC\({}^{\mbox{1}}\)},
booktitle = {Proceedings: Third Annual Structure in Complexity Theory Conference,
Georgetown University, Washington, D. C., USA, June 14-17, 1988},
pages = {47--59},
publisher = {{IEEE} Computer Society},
year = {1988},
url = {https://doi.org/10.1109/SCT.1988.5262},
doi = {10.1109/SCT.1988.5262},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/coco/BarringtonIS88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/GedyeK88,
author = {David Gedye and
Randy H. Katz},
editor = {Dennis W. Shaklee and
A. Richard Newton},
title = {Browsing in Chip Design Database},
booktitle = {Proceedings of the 25th {ACM/IEEE} Conference on Design Automation,
{DAC} '88, Anaheim, CA, USA, June 12-15, 1988},
pages = {269--274},
publisher = {{ACM}},
year = {1988},
url = {http://portal.acm.org/citation.cfm?id=285730.285774},
timestamp = {Fri, 12 Mar 2021 15:27:48 +0100},
biburl = {https://dblp.org/rec/conf/dac/GedyeK88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/StavridouBE88,
author = {Victoria Stavridou and
Howard Barringer and
David A. Edwards},
editor = {Dennis W. Shaklee and
A. Richard Newton},
title = {Formal Specification and Verification of Hardware: {A} Comparative
Case Study},
booktitle = {Proceedings of the 25th {ACM/IEEE} Conference on Design Automation,
{DAC} '88, Anaheim, CA, USA, June 12-15, 1988},
pages = {197--204},
publisher = {{ACM}},
year = {1988},
url = {http://portal.acm.org/citation.cfm?id=285730.285763},
timestamp = {Thu, 16 Mar 2017 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dac/StavridouBE88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lcn/ClarkRS88,
author = {David D. Clark and
John Romkey and
Howard C. Salwen},
title = {An analysis of {TCP} processing overhead},
booktitle = {Proceedings of the 13th Conference on Local Computer Networks, {LCN}
1988, October 10-12, 1988, Minneapolis, Minnesota, {USA}},
pages = {284--291},
publisher = {{IEEE} Computer Society},
year = {1988},
url = {https://doi.org/10.1109/LCN.1988.10239},
doi = {10.1109/LCN.1988.10239},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/lcn/ClarkRS88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scm/LeblangCS88,
author = {David B. Leblang and
Robert P. Chase Jr. and
Howard Spilke},
editor = {J{\"{u}}rgen F. H. Winkler},
title = {Increasing Productivity with a Parallel Configuration Manager},
booktitle = {Proceedings of the International Workshop on Software Version and
Configuration Control, January 27-29, 1988, Grassau, Germany},
series = {Berichte des German Chapter of the {ACM}},
volume = {30},
pages = {21--37},
publisher = {Teubner},
year = {1988},
timestamp = {Fri, 07 Mar 2003 10:38:57 +0100},
biburl = {https://dblp.org/rec/conf/scm/LeblangCS88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmod/PattersonGK88,
author = {David A. Patterson and
Garth A. Gibson and
Randy H. Katz},
editor = {Haran Boral and
Per{-}{\AA}ke Larson},
title = {A Case for Redundant Arrays of Inexpensive Disks {(RAID)}},
booktitle = {Proceedings of the 1988 {ACM} {SIGMOD} International Conference on
Management of Data, Chicago, Illinois, USA, June 1-3, 1988},
pages = {109--116},
publisher = {{ACM} Press},
year = {1988},
url = {https://doi.org/10.1145/50202.50214},
doi = {10.1145/50202.50214},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigmod/PattersonGK88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vldb/StonebrakerKPO88,
author = {Michael Stonebraker and
Randy H. Katz and
David A. Patterson and
John K. Ousterhout},
editor = {Fran{\c{c}}ois Bancilhon and
David J. DeWitt},
title = {The Design of {XPRS}},
booktitle = {Fourteenth International Conference on Very Large Data Bases, August
29 - September 1, 1988, Los Angeles, California, USA, Proceedings},
pages = {318--330},
publisher = {Morgan Kaufmann},
year = {1988},
url = {http://www.vldb.org/conf/1988/P318.PDF},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vldb/StonebrakerKPO88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/MillsRR87,
author = {W. H. Mills and
David P. Robbins and
Howard Rumsey Jr.},
title = {Enumeration of a symmetry class of plane partitions},
journal = {Discret. Math.},
volume = {67},
number = {1},
pages = {43--55},
year = {1987},
url = {https://doi.org/10.1016/0012-365X(87)90165-8},
doi = {10.1016/0012-365X(87)90165-8},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dm/MillsRR87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dt/KatzBCGT87,
author = {Randy H. Katz and
Rajiv Bhateja and
Ellis E. Chang and
David Gedye and
Vony Trijanto},
title = {Design Version Management},
journal = {{IEEE} Des. Test},
volume = {4},
number = {1},
pages = {12--22},
year = {1987},
url = {https://doi.org/10.1109/MDT.1987.295109},
doi = {10.1109/MDT.1987.295109},
timestamp = {Tue, 02 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dt/KatzBCGT87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jal/KarloffS87,
author = {Howard J. Karloff and
David B. Shmoys},
title = {Efficient Parallel Algorithms for Edge Coloring Problems},
journal = {J. Algorithms},
volume = {8},
number = {1},
pages = {39--52},
year = {1987},
url = {https://doi.org/10.1016/0196-6774(87)90026-5},
doi = {10.1016/0196-6774(87)90026-5},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jal/KarloffS87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mam/SiegelSMH87,
author = {Howard Jay Siegel and
Thomas Schwederski and
David G. Meyer and
William Tsun{-}Yuk Hsu},
title = {Large-scale parallel processing systems},
journal = {Microprocess. Microsystems},
volume = {11},
number = {1},
pages = {3--20},
year = {1987},
url = {https://doi.org/10.1016/0141-9331(87)90325-5},
doi = {10.1016/0141-9331(87)90325-5},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mam/SiegelSMH87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/WoodsPK87,
author = {John W. Woods and
David J. Potter and
Howard Kaufman},
title = {Parallel realizations of 2-D recursive Kalman filters},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} '87, Dallas, Texas, USA, April 6-9, 1987},
pages = {1657--1660},
publisher = {{IEEE}},
year = {1987},
url = {https://doi.org/10.1109/ICASSP.1987.1169505},
doi = {10.1109/ICASSP.1987.1169505},
timestamp = {Mon, 09 Aug 2021 14:54:02 +0200},
biburl = {https://dblp.org/rec/conf/icassp/WoodsPK87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/HowardFH87,
author = {David M. Howard and
Andrew Faulkner and
Ian S. Howard},
title = {Speech fundamental frequency estimation by multi-channel peak-picking},
booktitle = {European Conference on Speech Technology, {ECST} 1987, Edinburgh,
Scotland, UK, September 1987},
pages = {1318--1321},
publisher = {{ISCA}},
year = {1987},
url = {https://www.isca-speech.org/archive/ecst\_1987/howard87c\_ecst.html},
timestamp = {Sun, 02 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/HowardFH87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sosp/HowardKMNSSW87,
author = {John H. Howard and
Michael L. Kazar and
Sherri G. Menees and
David A. Nichols and
Mahadev Satyanarayanan and
Robert N. Sidebotham and
Michael J. West},
editor = {Les Belady},
title = {Scale and Performance in a Distributed File System (Extended Abstract)},
booktitle = {Proceedings of the Eleventh {ACM} Symposium on Operating System Principles,
{SOSP} 1987, Stouffer Austin Hotel, Austin, Texas, USA, November 8-11,
1987},
pages = {1--2},
publisher = {{ACM}},
year = {1987},
url = {https://doi.org/10.1145/41457.37500},
doi = {10.1145/41457.37500},
timestamp = {Tue, 06 Nov 2018 16:59:32 +0100},
biburl = {https://dblp.org/rec/conf/sosp/HowardKMNSSW87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/MorrisSCHRS86,
author = {James H. Morris and
Mahadev Satyanarayanan and
Michael H. Conner and
John H. Howard and
David S. H. Rosenthal and
F. Donelson Smith},
title = {Andrew: {A} Distributed Personal Computing Environment},
journal = {Commun. {ACM}},
volume = {29},
number = {3},
pages = {184--201},
year = {1986},
url = {https://doi.org/10.1145/5666.5671},
doi = {10.1145/5666.5671},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/MorrisSCHRS86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jct/MillsRR86,
author = {W. H. Mills and
David P. Robbins and
Howard Rumsey Jr.},
title = {Self-complementary totally symmetric plane partitions},
journal = {J. Comb. Theory {A}},
volume = {42},
number = {2},
pages = {277--292},
year = {1986},
url = {https://doi.org/10.1016/0097-3165(86)90098-1},
doi = {10.1016/0097-3165(86)90098-1},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jct/MillsRR86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/KernerLS86,
author = {Martin Kerner and
Howard L. Lemberg and
David M. Simmons},
title = {An Analysis of Alternative Architectures for the Interoffice Network},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {4},
number = {9},
pages = {1404--1413},
year = {1986},
url = {https://doi.org/10.1109/JSAC.1986.1146499},
doi = {10.1109/JSAC.1986.1146499},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/KernerLS86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/TuomenoksaS86,
author = {David Lee Tuomenoksa and
Howard Jay Siegel},
title = {Determining an Optimal Secondary Storage Service Rate for the {PASM}
Control System},
journal = {{IEEE} Trans. Computers},
volume = {35},
number = {1},
pages = {43--53},
year = {1986},
url = {https://doi.org/10.1109/TC.1986.1676656},
doi = {10.1109/TC.1986.1676656},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/TuomenoksaS86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/WoodEGHPRTKP86,
author = {David A. Wood and
Susan J. Eggers and
Garth A. Gibson and
Mark D. Hill and
Joan M. Pendleton and
Scott A. Ritchie and
George S. Taylor and
Randy H. Katz and
David A. Patterson},
editor = {Hideo Aiso},
title = {An In-Cache Address Translation Mechanism},
booktitle = {Proceedings of the 13th Annual Symposium on Computer Architecture,
Tokyo, Japan, June 1986},
pages = {358--365},
publisher = {{IEEE} Computer Society},
year = {1986},
url = {https://doi.org/10.1145/17356.17398},
doi = {10.1145/17356.17398},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isca/WoodEGHPRTKP86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/PisoniNG85,
author = {David B. Pisoni and
Howard C. Nusbaum and
Beth G. Greene},
title = {Perception of synthetic speech generated by rule},
journal = {Proc. {IEEE}},
volume = {73},
number = {11},
pages = {1665--1676},
year = {1985},
url = {https://doi.org/10.1109/PROC.1985.13346},
doi = {10.1109/PROC.1985.13346},
timestamp = {Tue, 30 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pieee/PisoniNG85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spe/ChouDKK85,
author = {Hong{-}Tai Chou and
David J. DeWitt and
Randy H. Katz and
Anthony C. Klug},
title = {Design and Implementation of the Wisconsin Storage System},
journal = {Softw. Pract. Exp.},
volume = {15},
number = {10},
pages = {943--962},
year = {1985},
url = {https://doi.org/10.1002/spe.4380151003},
doi = {10.1002/SPE.4380151003},
timestamp = {Thu, 09 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/spe/ChouDKK85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/speech/PisoniNLS85,
author = {David B. Pisoni and
Howard C. Nusbaum and
Paul A. Luce and
Louisa M. Slowiaczek},
title = {Speech perception, word recognition and the structure of the lexicon},
journal = {Speech Commun.},
volume = {4},
number = {1-3},
pages = {75--95},
year = {1985},
url = {https://doi.org/10.1016/0167-6393(85)90037-8},
doi = {10.1016/0167-6393(85)90037-8},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/speech/PisoniNLS85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/TuomenoksaS85,
author = {David Lee Tuomenoksa and
Howard Jay Siegel},
title = {Task Scheduling on the {PASM} Parallel Processing System},
journal = {{IEEE} Trans. Software Eng.},
volume = {11},
number = {2},
pages = {145--157},
year = {1985},
url = {https://doi.org/10.1109/TSE.1985.232189},
doi = {10.1109/TSE.1985.232189},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tse/TuomenoksaS85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compcon/MeyerSSDK85,
author = {David G. Meyer and
Howard Jay Siegel and
Thomas Schwederski and
Nathaniel J. Davis IV and
James T. Kuehn},
title = {The {PASM} Parallel System Prototype},
booktitle = {Spring COMPCON'85, Digest of Papers, Thirtieth {IEEE} Computer Society
International Conference, San Francisco, California, USA, February
25-28, 1985},
pages = {429},
publisher = {{IEEE} Computer Society},
year = {1985},
timestamp = {Wed, 28 Jun 2006 12:59:39 +0200},
biburl = {https://dblp.org/rec/conf/compcon/MeyerSSDK85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/PisoniBNY85,
author = {David B. Pisoni and
Robert H. Bernacki and
Howard C. Nusbaum and
Moshe Yuchtman},
title = {Some acoustic-phonetic correlates of speech produced in noise},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} '85, Tampa, Florida, USA, March 26-29, 1985},
pages = {1581--1584},
publisher = {{IEEE}},
year = {1985},
url = {https://doi.org/10.1109/ICASSP.1985.1168217},
doi = {10.1109/ICASSP.1985.1168217},
timestamp = {Mon, 29 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/PisoniBNY85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/KatzEWPS85,
author = {Randy H. Katz and
Susan J. Eggers and
David A. Wood and
Charles L. Perkins and
Robert G. Sheldon},
editor = {Thomas F. Gannon and
Tilak Agerwala and
Charles V. Freiman},
title = {Implementing {A} Cache Consistency Protocol},
booktitle = {Proceedings of the 12th Annual Symposium on Computer Architecture,
Boston, MA, USA, June 1985},
pages = {276--283},
publisher = {{IEEE} Computer Society},
year = {1985},
url = {https://doi.org/10.1145/327070.327237},
doi = {10.1145/327070.327237},
timestamp = {Tue, 31 Aug 2021 17:59:20 +0200},
biburl = {https://dblp.org/rec/conf/isca/KatzEWPS85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sosp/SatyanarayananHNSSW85,
author = {Mahadev Satyanarayanan and
John H. Howard and
David A. Nichols and
Robert N. Sidebotham and
Alfred Z. Spector and
Michael J. West},
editor = {Forest Baskett and
Andrew Birrell and
David R. Cheriton},
title = {The {ITC} Distributed File System: Principles and Design},
booktitle = {Proceedings of the Tenth {ACM} Symposium on Operating System Principles,
{SOSP} 1985, Orcas Island, Washington, USA, December 1-4, 1985},
pages = {35--50},
publisher = {{ACM}},
year = {1985},
url = {https://doi.org/10.1145/323647.323633},
doi = {10.1145/323647.323633},
timestamp = {Tue, 06 Nov 2018 16:59:32 +0100},
biburl = {https://dblp.org/rec/conf/sosp/SatyanarayananHNSSW85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigsoft/BarstowSSS84,
author = {David R. Barstow and
Howard E. Shrobe and
Erik Sandewall and
Stephen W. Smoliar},
title = {Interactive programming environments},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {9},
number = {4},
pages = {56--58},
year = {1984},
url = {https://doi.org/10.1145/1012339.1012342},
doi = {10.1145/1012339.1012342},
timestamp = {Tue, 15 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigsoft/BarstowSSS84.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/TuomenoksaS84,
author = {David Lee Tuomenoksa and
Howard Jay Siegel},
title = {Task Preloading Schemes for Reconfigurable Parallel Processing Systems},
journal = {{IEEE} Trans. Computers},
volume = {33},
number = {10},
pages = {895--905},
year = {1984},
url = {https://doi.org/10.1109/TC.1984.1676350},
doi = {10.1109/TC.1984.1676350},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/TuomenoksaS84.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmod/DeWittKOSSW84,
author = {David J. DeWitt and
Randy H. Katz and
Frank Olken and
Leonard D. Shapiro and
Michael Stonebraker and
David A. Wood},
editor = {Beatrice Yormark},
title = {Implementation Techniques for Main Memory Database Systems},
booktitle = {SIGMOD'84, Proceedings of Annual Meeting, Boston, Massachusetts, USA,
June 18-21, 1984},
pages = {1--8},
publisher = {{ACM} Press},
year = {1984},
url = {https://doi.org/10.1145/602259.602261},
doi = {10.1145/602259.602261},
timestamp = {Thu, 11 Mar 2021 15:20:15 +0100},
biburl = {https://dblp.org/rec/conf/sigmod/DeWittKOSSW84.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jct/MillsRR83,
author = {W. H. Mills and
David P. Robbins and
Howard Rumsey Jr.},
title = {Alternating Sign Matrices and Descending Plane Partitions},
journal = {J. Comb. Theory {A}},
volume = {34},
number = {3},
pages = {340--359},
year = {1983},
url = {https://doi.org/10.1016/0097-3165(83)90068-7},
doi = {10.1016/0097-3165(83)90068-7},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jct/MillsRR83.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/PisoniNLS83,
author = {David B. Pisoni and
Howard C. Nusbaum and
Paul A. Luce and
Eileen C. Schwab},
title = {Perceptual evaluation of synthetic speech: Some considerations of
the user/System interface},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} '83, Boston, Massachusetts, USA, April 14-16, 1983},
pages = {535--538},
publisher = {{IEEE}},
year = {1983},
url = {https://doi.org/10.1109/ICASSP.1983.1172267},
doi = {10.1109/ICASSP.1983.1172267},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icassp/PisoniNLS83.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/TuomenoksaS83,
author = {David Lee Tuomenoksa and
Howard Jay Siegel},
title = {Preloading Schemes for the {PASM} Parallel Memory System},
booktitle = {International Conference on Parallel Processing, ICPP'83, Columbus,
Ohio, USA, August 1983},
pages = {407--415},
publisher = {{IEEE} Computer Society},
year = {1983},
timestamp = {Wed, 04 Dec 2002 14:34:54 +0100},
biburl = {https://dblp.org/rec/conf/icpp/TuomenoksaS83.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/debu/Katz82a,
author = {Randy H. Katz},
title = {{DAVID:} Design Aids for {VLSI} using Inegrated Databases},
journal = {{IEEE} Database Eng. Bull.},
volume = {5},
number = {2},
pages = {29--32},
year = {1982},
url = {http://sites.computer.org/debull/82JUN-CD.pdf},
timestamp = {Tue, 10 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/debu/Katz82a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/ElliottCCS82,
author = {Howard Elliott and
David B. Cooper and
Fernand S. Cohen and
Peter F. Symosek},
title = {Implementation, Interpretation, and Analysis of a Suboptimal Boundary
Finding Algorithm},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {4},
number = {2},
pages = {167--182},
year = {1982},
url = {https://doi.org/10.1109/TPAMI.1982.4767224},
doi = {10.1109/TPAMI.1982.4767224},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pami/ElliottCCS82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigarch/FitzpatrickFKLP82,
author = {Daniel T. Fitzpatrick and
John K. Foderaro and
Manolis G. H. Katevenis and
Howard A. Landman and
David A. Patterson and
James B. Peek and
Zvi Peshkess and
Carlo H. S{\'{e}}quin and
Robert W. Sherburne and
Korbin S. Van Dyke},
title = {A RISCy approach to {VLSI}},
journal = {{SIGARCH} Comput. Archit. News},
volume = {10},
number = {1},
pages = {28--32},
year = {1982},
url = {https://doi.org/10.1145/859520.859524},
doi = {10.1145/859520.859524},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigarch/FitzpatrickFKLP82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmod/BoralDKK82,
author = {Haran Boral and
David J. DeWitt and
Randy H. Katz and
Anthony C. Klug},
title = {Database Research Activities at the University of Wisconsin},
journal = {{SIGMOD} Rec.},
volume = {12},
number = {3},
pages = {19--26},
year = {1982},
url = {https://doi.org/10.1145/984505.984507},
doi = {10.1145/984505.984507},
timestamp = {Fri, 06 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigmod/BoralDKK82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/PetersonB82,
author = {David E. Peterson and
J. Howard Botterill},
editor = {Jean A. Nichols and
Michael L. Schneider},
title = {{IBM} system/38 - an {IBM} usability experience},
booktitle = {Proceedings of the 1982 Conference on Human Factors in Computing Systems,
{CHI} 1982, Gaithersburg, Maryland, USA, March 15-17, 1982},
pages = {262--267},
publisher = {{ACM}},
year = {1982},
url = {https://doi.org/10.1145/800049.801791},
doi = {10.1145/800049.801791},
timestamp = {Tue, 20 Jul 2021 13:45:02 +0200},
biburl = {https://dblp.org/rec/conf/chi/PetersonB82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdcs/TuomenoksaS82,
author = {David Lee Tuomenoksa and
Howard Jay Siegel},
title = {Analysis of multiple-queue task scheduling algorithms for multiple-SIMD
machines},
booktitle = {Proceedings of the 3rd International Conference on Distributed Computing
Systems, Miami/Ft. Lauderdale, Florida, USA, October 18-22, 1982},
pages = {114--121},
publisher = {{IEEE} Computer Society},
year = {1982},
timestamp = {Wed, 21 Sep 2005 15:11:36 +0200},
biburl = {https://dblp.org/rec/conf/icdcs/TuomenoksaS82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/TuomenoksaS82,
author = {David Lee Tuomenoksa and
Howard Jay Siegel},
title = {Analysis of the {PASM} control system memory hierarchy},
booktitle = {International Conference on Parallel Processing, ICPP'82, August 24-27,
1982, Bellaire, Michigan, {USA}},
pages = {363--370},
publisher = {{IEEE} Computer Society},
year = {1982},
timestamp = {Sat, 06 Sep 2008 15:25:30 +0200},
biburl = {https://dblp.org/rec/conf/icpp/TuomenoksaS82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/LutherJRJT82,
author = {David Luther and
Irwin Jarett and
Jack Russell and
Howard Johnson and
John Thompson},
editor = {R. Daniel Bergeron},
title = {Business graphics(Panel Session): What is it?},
booktitle = {Proceedings of the 9th Annual Conference on Computer Graphics and
Interactive Techniques, {SIGGRAPH} 1982, Boston, Massachusetts, USA,
July 26-30, 1982},
pages = {275},
publisher = {{ACM}},
year = {1982},
url = {https://doi.org/10.1145/800064.801291},
doi = {10.1145/800064.801291},
timestamp = {Tue, 06 Nov 2018 16:59:18 +0100},
biburl = {https://dblp.org/rec/conf/siggraph/LutherJRJT82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/BarstowS81,
author = {David R. Barstow and
Howard E. Shrobe},
title = {Guest Editorial: Programming Environments},
journal = {{IEEE} Trans. Software Eng.},
volume = {7},
number = {5},
pages = {449--450},
year = {1981},
url = {https://doi.org/10.1109/TSE.1981.230852},
doi = {10.1109/TSE.1981.230852},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tse/BarstowS81.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sosp/1981,
editor = {John Howard and
David P. Reed},
title = {Proceedings of the Eighth Symposium on Operating System Principles,
{SOSP} 1981, Asilomar Conference Grounds, Pacific Grove, California,
USA, December 14-16, 1981},
publisher = {{ACM}},
year = {1981},
url = {https://doi.org/10.1145/800216},
doi = {10.1145/800216},
isbn = {0-89791-062-1},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sosp/1981.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/CohenCES80,
author = {Fernand S. Cohen and
David B. Cooper and
Howard Elliott and
Peter F. Symosek},
title = {Two-dimensional image boundary estimation by use of likelihood maximization
and Kalman filtering},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} '80, Denver, Colorado, USA, April 9-11, 1980},
pages = {410--413},
publisher = {{IEEE}},
year = {1980},
url = {https://doi.org/10.1109/ICASSP.1980.1170997},
doi = {10.1109/ICASSP.1980.1170997},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icassp/CohenCES80.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/ElmquistFGM79,
author = {K. A. Elmquist and
Howard Fullmer and
David B. Gustavson and
George Morrow},
title = {Standard Specification for {S-100} Bus Interface Devices},
journal = {Computer},
volume = {12},
number = {7},
pages = {28--52},
year = {1979},
url = {https://doi.org/10.1109/MC.1979.1658813},
doi = {10.1109/MC.1979.1658813},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/computer/ElmquistFGM79.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmsj/HolleyPSS79,
author = {L. Howard Holley and
Richard P. Parmelee and
Charles A. Salisbury and
David N. Saul},
title = {{VM/370} Asymmetric Multiprocessing},
journal = {{IBM} Syst. J.},
volume = {18},
number = {1},
pages = {47--70},
year = {1979},
url = {https://doi.org/10.1147/sj.181.0047},
doi = {10.1147/SJ.181.0047},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmsj/HolleyPSS79.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mam/Dunlop79,
author = {Dominic Dunlop},
title = {Microcomputer-analog converter software and hardware interfacing:
Johnathon {A} Titus, Christopher {A} Titus, Peter {R} Rony and David
{G} Larsen, Howard {W} Sams {\&} Co Inc., {(1979)} 288 pp, {\textdollar}9.50},
journal = {Microprocess. Microsystems},
volume = {3},
number = {6},
pages = {291},
year = {1979},
url = {https://doi.org/10.1016/0141-9331(79)90189-3},
doi = {10.1016/0141-9331(79)90189-3},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mam/Dunlop79.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/KeeneyRR79,
author = {David W. Rajala},
title = {Review of "Decisions with Multiple Objectives: Preferences and Value
Trade-Offs" by Ralph L. Keeney and Howard Raiffa},
journal = {{IEEE} Trans. Syst. Man Cybern.},
volume = {9},
number = {7},
pages = {403},
year = {1979},
url = {https://doi.org/10.1109/TSMC.1979.4310245},
doi = {10.1109/TSMC.1979.4310245},
timestamp = {Wed, 20 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsmc/KeeneyRR79.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/ProctorRVPT78,
author = {David J. Proctor and
Alan Robson and
Margaret A. Veal and
J. Howard Petrie and
William G. Town},
title = {Development of an exchange format for the European Environmental Chemical
Data and Information Network {(ECDIN)}},
journal = {Inf. Process. Manag.},
volume = {14},
number = {6},
pages = {429--443},
year = {1978},
url = {https://doi.org/10.1016/0306-4573(78)90007-9},
doi = {10.1016/0306-4573(78)90007-9},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ipm/ProctorRVPT78.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acm/ZelkowitzMMLDRH76,
author = {Marvin V. Zelkowitz and
Paul R. McMullin and
Keith R. Merkel and
Howard J. Larsen and
Frederick C. Druseikis and
G. David Ripley and
David R. Hanson and
Gary Lindstrom},
editor = {John A. Gosden and
Olin G. Johnson},
title = {SIGPLAN(Paper Session)},
booktitle = {Proceedings of the 1976 Annual Conference, Houston, Texas, USA, October
20-22, 1976},
pages = {390},
publisher = {{ACM}},
year = {1976},
url = {https://doi.org/10.1145/800191.805622},
doi = {10.1145/800191.805622},
timestamp = {Wed, 14 Apr 2021 11:40:49 +0200},
biburl = {https://dblp.org/rec/conf/acm/ZelkowitzMMLDRH76.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcpr/BryantA76,
author = {J. Howard Bryant and
David A. Ameen},
editor = {Roy Cottrell and
Linda Mills and
Theodore C. Willoughby},
title = {Use of personal history, activities, ability and attitude questionnaire
to predict success as a systems analyst},
booktitle = {Proceedings of the fourteenth annual computer personnel research conference,
{SIGCPR} 1976, USA, 1976},
pages = {133--143},
publisher = {{ACM}},
year = {1976},
url = {https://doi.org/10.1145/800282.811085},
doi = {10.1145/800282.811085},
timestamp = {Tue, 20 Jul 2021 13:50:37 +0200},
biburl = {https://dblp.org/rec/conf/sigcpr/BryantA76.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmsj/BitontiCFH65,
author = {Frank Bitonti and
DeWitt W. Cooper and
David N. Frayne and
Howard H. Hansen},
title = {An Experimental Program for Linkage Analysis},
journal = {{IBM} Syst. J.},
volume = {4},
number = {3},
pages = {200--223},
year = {1965},
url = {https://doi.org/10.1147/sj.43.0200},
doi = {10.1147/SJ.43.0200},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmsj/BitontiCFH65.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/BitontiCFH65,
author = {Frank Bitonti and
DeWitt W. Cooper and
David N. Frayne and
Howard H. Hansen},
title = {A computer-aided linkage analysis system},
booktitle = {Proceedings of the {SHARE} design automation project, {DAC} '65, Atlantic
City, NJ, USA, June 23-25, 1965},
publisher = {{ACM}},
year = {1965},
url = {https://doi.org/10.1145/800266.810769},
doi = {10.1145/800266.810769},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dac/BitontiCFH65.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-06-27 12:24 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
