Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "David Howard"
download as .bib file
@article{DBLP:journals/aisy/PinskierWLXKLH24,
author = {Joshua Pinskier and
Xing Wang and
Lois Liow and
Yue Xie and
Prabhat Kumar and
Matthijs Langelaar and
David Howard},
title = {Diversity-Based Topology Optimization of Soft Robotic Grippers},
journal = {Adv. Intell. Syst.},
volume = {6},
number = {4},
year = {2024}
}
@article{DBLP:journals/bspc/ZignoliSLZ24,
author = {Andrea Zignoli and
Kristina Skroce and
David J. Lipman and
Howard C. Zisser},
title = {Personalized nutrition and machine-learning: Exploring the scope of
continuous glucose monitoring in healthy individuals in uncontrolled
settings},
journal = {Biomed. Signal Process. Control.},
volume = {90},
pages = {105809},
year = {2024}
}
@article{DBLP:journals/ijim/SamalaMBHC24,
author = {Agariadne Dwinggo Samala and
David Mhlanga and
Ljubisa Bojic and
Natalie{-}Jane Howard and
Diogo Pereira Coelho},
title = {Blockchain Technology in Education: Opportunities, Challenges, and
Beyond},
journal = {Int. J. Interact. Mob. Technol.},
volume = {18},
number = {1},
pages = {20--42},
year = {2024}
}
@article{DBLP:journals/ijmi/LoTWACCZSJLCHVW24,
author = {Brian Lo and
Bemnet Teferi and
Howard W. Wong and
Alexxa Abi{-}Jaoud{\'{e}} and
Jasmine Chopra and
Rebecca Charow and
Melody Zhang and
Jenny Shi and
Andrew Johnson and
Andrea Levinson and
Kristin Cleverley and
Jo Henderson and
Aristotle N. Voineskos and
David Wiljer},
title = {Enhancing the value of digital health tools for mental health help-seeking
in Canadian transitional aged youth during the pandemic: Qualitative
study},
journal = {Int. J. Medical Informatics},
volume = {182},
pages = {105299},
year = {2024}
}
@article{DBLP:journals/pacmmod/ChuPLKLSCHH24,
author = {David C. Y. Chu and
Rithvik Panchapakesan and
Shadaj Laddad and
Lucky E. Katahanas and
Chris Liu and
Kaushik Shivakumar and
Natacha Crooks and
Joseph M. Hellerstein and
Heidi Howard},
title = {Optimizing Distributed Protocols with Query Rewrites},
journal = {Proc. {ACM} Manag. Data},
volume = {2},
number = {1},
pages = {2:1--2:25},
year = {2024}
}
@article{DBLP:journals/sensors/SkroceZFMLTRZ24,
author = {Kristina Skroce and
Andrea Zignoli and
Federico Y. Fontana and
Felipe M. Maturana and
David J. Lipman and
Andrea Tryfonos and
Michael C. Riddell and
Howard C. Zisser},
title = {Real World Interstitial Glucose Profiles of a Large Cohort of Physically
Active Men and Women},
journal = {Sensors},
volume = {24},
number = {3},
pages = {744},
year = {2024}
}
@inproceedings{DBLP:conf/biostec/StellCWWBHSA24,
author = {Anthony Stell and
Ernesto C. Caparo and
Zhe Wang and
Chenyang Wang and
David Berlowitz and
Mark Howard and
Richard O. Sinnott and
Uwe Aickelin},
title = {Identification of Patient Ventilator Asynchrony in Physiological Data
Through Integrating Machine-Learning},
booktitle = {{BIOSTEC} {(2)}},
pages = {436--443},
publisher = {{SCITEPRESS}},
year = {2024}
}
@inproceedings{DBLP:conf/eacl/KimWLLWQL24,
author = {Siun Kim and
Jung{-}Hyun Won and
David Seung U. Lee and
Renqian Luo and
Lijun Wu and
Tao Qin and
Howard Lee},
title = {CReSE: Benchmark Data and Automatic Evaluation Framework for Recommending
Eligibility Criteria from Clinical Trial Information},
booktitle = {{EACL} (Findings)},
pages = {2243--2273},
publisher = {Association for Computational Linguistics},
year = {2024}
}
@inproceedings{DBLP:conf/gecco/BishopJH24,
author = {Jordan T. Bishop and
Jason Jooste and
David Howard},
title = {Evolutionary Exploration of Triply Periodic Minimal Surfaces via Quality
Diversity},
booktitle = {{GECCO}},
publisher = {{ACM}},
year = {2024}
}
@inproceedings{DBLP:conf/papoc/ChuLCHH24,
author = {David C. Y. Chu and
Chris Liu and
Natacha Crooks and
Joseph M. Hellerstein and
Heidi Howard},
title = {Bigger, not Badder: Safely Scaling {BFT} Protocols},
booktitle = {PaPoC@EuroSys},
pages = {30--36},
publisher = {{ACM}},
year = {2024}
}
@inproceedings{DBLP:conf/robosoft/KannoNPHSK24,
author = {Ryo Kanno and
Pham H. Nguyen and
Joshua Pinskier and
David Howard and
Sukho Song and
Mirko Kovac},
title = {Hybrid Soft Electrostatic Metamaterial Gripper for Multi-surface,
Multi-object Adaptation},
booktitle = {RoboSoft},
pages = {851--857},
publisher = {{IEEE}},
year = {2024}
}
@inproceedings{DBLP:conf/robosoft/PinskierBH24,
author = {Joshua Pinskier and
James Brett and
David Howard},
title = {Towards Bespoke Soft Grippers through Voxel-Scale Metamaterial Topology
Optimisation},
booktitle = {RoboSoft},
pages = {291--298},
publisher = {{IEEE}},
year = {2024}
}
@inproceedings{DBLP:conf/robosoft/XieWIH24,
author = {Yue Xie and
Xing Wang and
Fumiya Iida and
David Howard},
title = {Fin-QD: {A} Computational Design Framework for Soft Grippers: Integrating
MAP-Elites and High-fidelity {FEM}},
booktitle = {RoboSoft},
pages = {692--697},
publisher = {{IEEE}},
year = {2024}
}
@article{DBLP:journals/corr/abs-2401-13903,
author = {Callum Bennie and
Bridget Casey and
C{\'{e}}cile Paris and
Dana Kulic and
Brendan Tidd and
Nicholas Lawrance and
Alex Pitt and
Fletcher Talbot and
Jason Williams and
David Howard and
Pavan Sikka and
Hashini Senaratne},
title = {Alternative Interfaces for Human-initiated Natural Language Communication
and Robot-initiated Haptic Feedback: Towards Better Situational Awareness
in Human-Robot Collaboration},
journal = {CoRR},
volume = {abs/2401.13903},
year = {2024}
}
@article{DBLP:journals/corr/abs-2403-06327,
author = {Ryo Kanno and
Pham H. Nguyen and
Joshua Pinskier and
David Howard and
Sukho Song and
Mirko Kovac},
title = {Hybrid Soft Electrostatic Metamaterial Gripper for Multi-surface,
Multi-object Adaptation},
journal = {CoRR},
volume = {abs/2403.06327},
year = {2024}
}
@article{DBLP:journals/corr/abs-2403-13793,
author = {Mary Phuong and
Matthew Aitchison and
Elliot Catt and
Sarah Cogan and
Alexandre Kaskasoli and
Victoria Krakovna and
David Lindner and
Matthew Rahtz and
Yannis Assael and
Sarah Hodkinson and
Heidi Howard and
Tom Lieberum and
Ramana Kumar and
Maria Abi Raad and
Albert Webson and
Lewis Ho and
Sharon Lin and
Sebastian Farquhar and
Marcus Hutter and
Gr{\'{e}}goire Del{\'{e}}tang and
Anian Ruoss and
Seliem El{-}Sayed and
Sasha Brown and
Anca D. Dragan and
Rohin Shah and
Allan Dafoe and
Toby Shevlane},
title = {Evaluating Frontier Models for Dangerous Capabilities},
journal = {CoRR},
volume = {abs/2403.13793},
year = {2024}
}
@article{DBLP:journals/corr/abs-2404-01593,
author = {David Chu and
Rithvik Panchapakesan and
Shadaj Laddad and
Lucky Katahanas and
Chris Liu and
Kaushik Shivakumar and
Natacha Crooks and
Joseph M. Hellerstein and
Heidi Howard},
title = {Optimizing Distributed Protocols with Query Rewrites [Technical Report]},
journal = {CoRR},
volume = {abs/2404.01593},
year = {2024}
}
@article{DBLP:journals/corr/abs-2405-05674,
author = {Meixu Chen and
Kai Wang and
Michael Dohopolski and
Howard E. Morgan and
David J. Sher and
Jing Wang},
title = {TransAnaNet: Transformer-based Anatomy Change Prediction Network for
Head and Neck Cancer Patient Radiotherapy},
journal = {CoRR},
volume = {abs/2405.05674},
year = {2024}
}
@article{DBLP:journals/corr/abs-2405-14440,
author = {Rafael Oliveira and
Dino Sejdinovic and
David Howard and
Edwin Bonilla},
title = {Bayesian Adaptive Calibration and Optimal Design},
journal = {CoRR},
volume = {abs/2405.14440},
year = {2024}
}
@article{DBLP:journals/aiethics/DouglasLH23,
author = {David M. Douglas and
Justine Lacey and
David Howard},
title = {Ethical risks of AI-designed products: bespoke surgical tools as a
case study},
journal = {{AI} Ethics},
volume = {3},
number = {4},
pages = {1117--1133},
year = {2023}
}
@article{DBLP:journals/bmcbi/HosseiniGeramiHCLEBB23,
author = {Layla Hosseini{-}Gerami and
Ixavier Alonzo Higgins and
David A. Collier and
Emma Laing and
David Evans and
Howard Broughton and
Andreas Bender},
title = {Benchmarking causal reasoning algorithms for gene expression-based
compound mechanism of action analysis},
journal = {{BMC} Bioinform.},
volume = {24},
number = {1},
pages = {154},
year = {2023}
}
@article{DBLP:journals/bmcbi/HosseiniGeramiHLBCB23,
author = {Layla Hosseini{-}Gerami and
Rosa D. Hernansaiz{-}Ballesteros and
Anika Liu and
Howard Broughton and
David A. Collier and
Andreas Bender},
title = {{MAVEN:} compound mechanism of action analysis and visualisation using
transcriptomics and compound structure data in R/Shiny},
journal = {{BMC} Bioinform.},
volume = {24},
number = {1},
pages = {344},
year = {2023}
}
@article{DBLP:journals/chb/MayshakHBKSHPSKH23,
author = {Richelle Mayshak and
Dominika Howard and
Michelle Benstead and
Anna Klas and
David Skvarc and
Travis Harries and
Brittany Patafio and
Abby Sleep and
Ross King and
Shannon Hyder},
title = {Dating in the dark: {A} qualitative examination of dating experiences
in Dark Tetrad personalities},
journal = {Comput. Hum. Behav.},
volume = {143},
pages = {107680},
year = {2023}
}
@article{DBLP:journals/jocn/VolfartMHZ23,
author = {Ang{\'{e}}lique Volfart and
Katie L. McMahon and
David Howard and
Greig I. de Zubicaray},
title = {Neural Correlates of Naturally Occurring Speech Errors during Picture
Naming in Healthy Participants},
journal = {J. Cogn. Neurosci.},
volume = {35},
number = {1},
pages = {111--127},
year = {2023}
}
@article{DBLP:journals/natmi/KarargyrisUSAGWPKZBMCGNRKXBCBEATS23,
author = {Alexandros Karargyris and
Renato Umeton and
Micah J. Sheller and
Alejandro Aristizabal and
Johnu George and
Anna Wuest and
Sarthak Pati and
Hasan Kassem and
Maximilian Zenk and
Ujjwal Baid and
Prakash Narayana Moorthy and
Alexander Chowdhury and
Junyi Guo and
Sahil S. Nalawade and
Jacob Rosenthal and
David Kanter and
Maria Xenochristou and
Daniel J. Beutel and
Verena Chung and
Timothy Bergquist and
James A. Eddy and
Abubakar Abid and
Lewis Tunstall and
Omar Sanseviero and
Dimitrios Dimitriadis and
Yiming Qian and
Xinxing Xu and
Yong Liu and
Rick Siow Mong Goh and
Srini Bala and
Victor Bittorf and
Sreekar Reddy Puchala and
Biagio Ricciuti and
Soujanya Samineni and
Eshna Sengupta and
Akshay Chaudhari and
Cody Coleman and
Bala Desinghu and
Gregory F. Diamos and
Debo Dutta and
Diane Feddema and
Grigori Fursin and
Xinyuan Huang and
Satyananda Kashyap and
Nicholas D. Lane and
Indranil Mallick and
Pietro Mascagni and
Virendra Mehta and
Cassiano Ferro Moraes and
Vivek Natarajan and
Nikola Nikolov and
Nicolas Padoy and
Gennady Pekhimenko and
Vijay Janapa Reddi and
G. Anthony Reina and
Pablo Ribalta and
Abhishek Singh and
Jayaraman J. Thiagarajan and
Jacob Albrecht and
Thomas Wolf and
Geralyn Miller and
Huazhu Fu and
Prashant Shah and
Daguang Xu and
Poonam Yadav and
David Talby and
Mark M. Awad and
Jeremy P. Howard and
Michael Rosenthal and
Luigi Marchionni and
Massimo Loda and
Jason M. Johnson and
Spyridon Bakas and
Peter Mattson},
title = {Federated benchmarking of medical artificial intelligence with MedPerf},
journal = {Nat. Mac. Intell.},
volume = {5},
number = {7},
pages = {799--810},
year = {2023}
}
@article{DBLP:journals/nature/JiangLNNWAERLPM23,
author = {Lavender Yao Jiang and
Xujin Chris Liu and
Nima Pour Nejatian and
Mustafa Nasir{-}Moin and
Duo Wang and
Anas Z. Abidin and
Kevin Eaton and
Howard Antony Riina and
Ilya Laufer and
Paawan Punjabi and
Madeline Miceli and
Nora C. Kim and
Cordelia Orillac and
Zane Schnurman and
Christopher Livia and
Hannah Weiss and
David Kurland and
Sean Neifert and
Yosef Dastagirzada and
Douglas Kondziolka and
Alexander T. M. Cheung and
Grace Yang and
Ming Cao and
Mona Flores and
Anthony B. Costa and
Yindalon Aphinyanaphongs and
Kyunghyun Cho and
Eric Karl Oermann},
title = {Health system-scale language models are all-purpose prediction engines},
journal = {Nat.},
volume = {619},
number = {7969},
pages = {357--362},
year = {2023}
}
@article{DBLP:journals/npjdm/EstevaFWHSDCSMS23,
author = {Andre Esteva and
Jean Feng and
Douwe van der Wal and
Shih{-}Cheng Huang and
Jeffry P. Simko and
Sandy Devries and
Emmalyn Chen and
Edward M. Schaeffer and
Todd M. Morgan and
Yilun Sun and
Amirata Ghorbani and
Nikhil Naik and
Dhruv Nathawani and
Richard Socher and
Jeff M. Michalski and
Mack Roach and
Thomas M. Pisansky and
Jedidiah M. Monson and
Farah Naz and
James Wallace and
Michelle J. Ferguson and
Jean{-}Paul Bahary and
James Zou and
Matthew P. Lungren and
Serena Yeung and
Ashley E. Ross and
Michael J. Kucharczyk and
Luis Souhami and
Leslie Ballas and
Christopher A. Peters and
Sandy Liu and
Alexander G. Balogh and
Pamela D. Randolph{-}Jackson and
David L. Schwartz and
Michael R. Girvigian and
Naoyuki G. Saito and
Adam Raben and
Rachel A. Rabinovitch and
Khalil Katato and
Howard M. Sandler and
Phuoc T. Tran and
Daniel E. Spratt and
Stephanie Pugh and
Felix Y. Feng and
Osama Mohamad},
title = {Author Correction: Prostate cancer therapy personalization via multi-modal
deep learning on randomized phase {III} clinical trials},
journal = {npj Digit. Medicine},
volume = {6},
year = {2023}
}
@article{DBLP:journals/tochi/HodgeFLBMC0M23,
author = {James Hodge and
Sarah Foley and
Daniel Lambton{-}Howard and
Laura Booi and
Kyle Montague and
Sandra Coulter and
David Kirk and
Kellie Morrissey},
title = {Exploring Participants' Representations and Shifting Sensitivities
in a Hackathon for Dementia},
journal = {{ACM} Trans. Comput. Hum. Interact.},
volume = {30},
number = {3},
pages = {46:1--46:35},
year = {2023}
}
@inproceedings{DBLP:conf/chil/KimWLLWXQL23,
author = {Siun Kim and
Jung{-}Hyun Won and
David Seung U. Lee and
Renqian Luo and
Lijun Wu and
Yingce Xia and
Tao Qin and
Howard Lee},
title = {Revisiting Machine-Learning based Drug Repurposing: Drug Indications
Are Not a Right Prediction Target},
booktitle = {{CHIL}},
series = {Proceedings of Machine Learning Research},
volume = {209},
pages = {100--116},
publisher = {{PMLR}},
year = {2023}
}
@inproceedings{DBLP:conf/iecon/PeakKNFKW23,
author = {Preston Peak and
Sai Kode and
David Nguyen and
O. Howard Frazier and
Nobuyuki Kurita and
Yaxin Wang},
title = {A Novel Design of an Elastance-Controlled Linear Motor-Driven Left
Ventricle Simulator},
booktitle = {{IECON}},
pages = {1--7},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/mobicom/FanPHST23,
author = {Xiaoran Fan and
David Pearl and
Richard E. Howard and
Longfei Shangguan and
Trausti Thormundsson},
title = {{APG:} Audioplethysmography for Cardiac Monitoring in Hearables},
booktitle = {MobiCom},
pages = {67:1--67:15},
publisher = {{ACM}},
year = {2023}
}
@inproceedings{DBLP:conf/nips/MazumderBYKRDDH23,
author = {Mark Mazumder and
Colby R. Banbury and
Xiaozhe Yao and
Bojan Karlas and
William Gaviria Rojas and
Sudnya Frederick Diamos and
Greg Diamos and
Lynn He and
Alicia Parrish and
Hannah Rose Kirk and
Jessica Quaye and
Charvi Rastogi and
Douwe Kiela and
David Jurado and
David Kanter and
Rafael Mosquera and
Will Cukierski and
Juan Ciro and
Lora Aroyo and
Bilge Acun and
Lingjiao Chen and
Mehul Raje and
Max Bartolo and
Evan Sabri Eyuboglu and
Amirata Ghorbani and
Emmett D. Goodman and
Addison Howard and
Oana Inel and
Tariq Kane and
Christine R. Kirkpatrick and
D. Sculley and
Tzu{-}Sheng Kuo and
Jonas W. Mueller and
Tristan Thrush and
Joaquin Vanschoren and
Margaret Warren and
Adina Williams and
Serena Yeung and
Newsha Ardalani and
Praveen K. Paritosh and
Ce Zhang and
James Y. Zou and
Carole{-}Jean Wu and
Cody Coleman and
Andrew Y. Ng and
Peter Mattson and
Vijay Janapa Reddi},
title = {DataPerf: Benchmarks for Data-Centric {AI} Development},
booktitle = {NeurIPS},
year = {2023}
}
@inproceedings{DBLP:conf/ozchi/JohansenSBMMCDD23,
author = {Stine S. Johansen and
Hashini Senaratne and
Alan Burden and
Melanie J. McGrath and
Claire Mason and
Glenda Amayo Caldwell and
Jared Donovan and
Andreas Duenser and
Matthias Guertler and
David Howard and
Yanrang Jiang and
C{\'{e}}cile Paris and
Markus Rittenbruch and
Jonathan Roberts},
title = {Empowering People in Human-Robot Collaboration: Why, How, When, and
for Whom},
booktitle = {{OZCHI}},
pages = {684--688},
publisher = {{ACM}},
year = {2023}
}
@inproceedings{DBLP:conf/ro-man/SenaratnePTMSHWKP23,
author = {Hashini Senaratne and
Alex Pitt and
Fletcher Talbot and
Peyman Moghadam and
Pavan Sikka and
David Howard and
Jason Williams and
Dana Kulic and
C{\'{e}}cile Paris},
title = {Measuring Situational Awareness Latency in Human-Robot Teaming Experiments},
booktitle = {{RO-MAN}},
pages = {2624--2631},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/robosoft/CoombeBMDH23,
author = {Cameron Coombe and
James Brett and
Raghav Mishra and
Gary W. Delaney and
David Howard},
title = {Active Vibration Fluidization for Granular Jamming Grippers},
booktitle = {RoboSoft},
pages = {1--8},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/robosoft/HowardOLJLBD23,
author = {David Howard and
Jack O'Connor and
Jordan Letchford and
Therese Joseph and
Sophia Lin and
Sarah Baldwin and
Gary W. Delaney},
title = {A Comprehensive Dataset of Grains for Granular Jamming in Soft Robotics:
Grip Strength and Shock Absorption},
booktitle = {RoboSoft},
pages = {1--8},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/robosoft/JosephBGBH23,
author = {Therese Joseph and
Sarah Baldwin and
Lillian Guan and
James Brett and
David Howard},
title = {The Jamming Donut: {A} Free-Space Gripper Based on Granular Jamming},
booktitle = {RoboSoft},
pages = {1--6},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/robosoft/PinskierKLH23,
author = {Joshua Pinskier and
Prabhat Kumar and
Matthijs Langelaar and
David Howard},
title = {Automated design of pneumatic soft grippers through design-dependent
multi-material topology optimization},
booktitle = {RoboSoft},
pages = {1--7},
publisher = {{IEEE}},
year = {2023}
}
@article{DBLP:journals/corr/abs-2301-12670,
author = {Peter Xiangyuan Ma and
Cherry Ng and
Leandro Rizk and
Steve Croft and
Andrew P. V. Siemion and
Bryan Brzycki and
Daniel Czech and
Jamie Drew and
Vishal Gajjar and
John Hoang and
Howard Isaacson and
Matt Lebofsky and
David MacMahon and
Imke de Pater and
Danny C. Price and
Sofia Z. Sheikh and
S. Pete Worden},
title = {A deep-learning search for technosignatures of 820 nearby stars},
journal = {CoRR},
volume = {abs/2301.12670},
year = {2023}
}
@article{DBLP:journals/corr/abs-2305-14384,
author = {Alicia Parrish and
Hannah Rose Kirk and
Jessica Quaye and
Charvi Rastogi and
Max Bartolo and
Oana Inel and
Juan Ciro and
Rafael Mosquera and
Addison Howard and
Will Cukierski and
D. Sculley and
Vijay Janapa Reddi and
Lora Aroyo},
title = {Adversarial Nibbler: {A} Data-Centric Challenge for Improving the
Safety of Text-to-Image Models},
journal = {CoRR},
volume = {abs/2305.14384},
year = {2023}
}
@article{DBLP:journals/corr/abs-2307-13485,
author = {Gratianus Wesley Putra Data and
Henry Howard{-}Jenkins and
David William Murray and
Victor Prisacariu},
title = {Cos {R-CNN} for Online Few-shot Object Detection},
journal = {CoRR},
volume = {abs/2307.13485},
year = {2023}
}
@article{DBLP:journals/corr/abs-2308-01758,
author = {Lois Liow and
James Brett and
Joshua Pinskier and
Lauren Hanson and
Louis Tidswell and
Navinda Kottege and
David Howard},
title = {A Compliant Robotic Leg Based on Fibre Jamming},
journal = {CoRR},
volume = {abs/2308.01758},
year = {2023}
}
@article{DBLP:journals/corr/abs-2310-10355,
author = {Prabhat Kumar and
Joshua Pinskier and
David Howard and
Matthijs Langelaar},
title = {Topology optimization of fluidic pressure-driven multi-material compliant
mechanisms},
journal = {CoRR},
volume = {abs/2310.10355},
year = {2023}
}
@article{DBLP:journals/corr/abs-2311-12477,
author = {Yue Xie and
Xing Wang and
Fumiya Iida and
David Howard},
title = {Fin-QD: {A} Computational Design Framework for Soft Grippers: Integrating
MAP-Elites and High-fidelity {FEM}},
journal = {CoRR},
volume = {abs/2311.12477},
year = {2023}
}
@article{DBLP:journals/access/XavierTZPHYLHYB22,
author = {Matheus S. Xavier and
Charbel Tawk and
Ali Zolfagharian and
Joshua Pinskier and
David Howard and
Taylor R. Young and
Jiewen Lai and
Simon M. Harrison and
Yuen Kuan Yong and
Mahdi Bodaghi and
Andrew J. Fleming},
title = {Soft Pneumatic Actuators: {A} Review of Design, Fabrication, Modeling,
Sensing, Control and Applications},
journal = {{IEEE} Access},
volume = {10},
pages = {59442--59485},
year = {2022}
}
@article{DBLP:journals/aisy/PinskierH22,
author = {Joshua Pinskier and
David Howard},
title = {From Bioinspiration to Computer Generation: Developments in Autonomous
Soft Robot Design},
journal = {Adv. Intell. Syst.},
volume = {4},
number = {1},
year = {2022}
}
@article{DBLP:journals/csl/MargeEWAABBCDDH22,
author = {Matthew Marge and
Carol Y. Espy{-}Wilson and
Nigel G. Ward and
Abeer Alwan and
Yoav Artzi and
Mohit Bansal and
Gilmer L. Blankenship and
Joyce Chai and
Hal Daum{\'{e}} III and
Debadeepta Dey and
Mary P. Harper and
Thomas Howard and
Casey Kennington and
Ivana Kruijff{-}Korbayov{\'{a}} and
Dinesh Manocha and
Cynthia Matuszek and
Ross Mead and
Raymond J. Mooney and
Roger K. Moore and
Mari Ostendorf and
Heather Pon{-}Barry and
Alexander I. Rudnicky and
Matthias Scheutz and
Robert St. Amant and
Tong Sun and
Stefanie Tellex and
David R. Traum and
Zhou Yu},
title = {Spoken language interaction with robots: Recommendations for future
research},
journal = {Comput. Speech Lang.},
volume = {71},
pages = {101255},
year = {2022}
}
@article{DBLP:journals/cssc/NgwaCCGLC22,
author = {Julius S. Ngwa and
Howard J. Cabral and
Debbie M. Cheng and
David R. Gagnon and
Michael P. Lavalley and
L. Adrienne Cupples},
title = {Generating survival times with time-varying covariates using the Lambert
{W} Function},
journal = {Commun. Stat. Simul. Comput.},
volume = {51},
number = {1},
pages = {135--153},
year = {2022}
}
@article{DBLP:journals/ethicsit/DouglasLH22,
author = {David M. Douglas and
Justine Lacey and
David Howard},
title = {Ethical responsibility and computational design: bespoke surgical
tools as an instructive case study},
journal = {Ethics Inf. Technol.},
volume = {24},
number = {1},
pages = {11},
year = {2022}
}
@article{DBLP:journals/firai/Howard22,
author = {David Howard},
title = {From the lab to the field with Evolutionary Field Robotics},
journal = {Frontiers Robotics {AI}},
volume = {9},
year = {2022}
}
@article{DBLP:journals/firai/HowardGC22,
author = {David Howard and
Kyrre Glette and
Nick Cheney},
title = {Editorial: Evolving Robotic Morphologies},
journal = {Frontiers Robotics {AI}},
volume = {9},
pages = {874853},
year = {2022}
}
@article{DBLP:journals/ijmi/ShabatSMJSKSTWA22,
author = {Niv Ben Shabat and
Gal Sharvit and
Ben Meimis and
Daniel Ben Joya and
Ariel Sloma and
David Kiderman and
Aviv Shabat and
Avishai M. Tsur and
Abdulla Watad and
Howard Amital},
title = {Assessing data gathering of chatbot based symptom checkers - a clinical
vignettes study},
journal = {Int. J. Medical Informatics},
volume = {168},
pages = {104897},
year = {2022}
}
@article{DBLP:journals/jamia/AlbinLHRGDHHBS22,
author = {John S. Albin and
Jacob E. Lazarus and
Kristen M. Hysell and
David M. Rubins and
Lindsay Germaine and
Caitlin M. Dugdale and
Howard M. Heller and
Elizabeth L. Hohmann and
Joshua J. Baugh and
Erica S. Shenoy},
title = {Development and implementation of a clinical decision support system
tool for the evaluation of suspected monkeypox infection},
journal = {J. Am. Medical Informatics Assoc.},
volume = {29},
number = {12},
pages = {2124--2127},
year = {2022}
}
@article{DBLP:journals/npjdm/EstevaFWHSDCSMS22,
author = {Andre Esteva and
Jean Feng and
Douwe van der Wal and
Shih{-}Cheng Huang and
Jeffry P. Simko and
Sandy Devries and
Emmalyn Chen and
Edward M. Schaeffer and
Todd M. Morgan and
Yilun Sun and
Amirata Ghorbani and
Nikhil Naik and
Dhruv Nathawani and
Richard Socher and
Jeff M. Michalski and
Mack Roach and
Thomas M. Pisansky and
Jedidiah M. Monson and
Farah Naz and
James Wallace and
Michelle J. Ferguson and
Jean{-}Paul Bahary and
James Zou and
Matthew P. Lungren and
Serena Yeung and
Ashley E. Ross and
Michael J. Kucharczyk and
Luis Souhami and
Leslie Ballas and
Christopher A. Peters and
Sandy Liu and
Alexander G. Balogh and
Pamela D. Randolph{-}Jackson and
David L. Schwartz and
Michael R. Girvigian and
Naoyuki G. Saito and
Adam Raben and
Rachel A. Rabinovitch and
Khalil Katato and
Howard M. Sandler and
Phuoc T. Tran and
Daniel E. Spratt and
Stephanie Pugh and
Felix Y. Feng and
Osama Mohamad},
title = {Prostate cancer therapy personalization via multi-modal deep learning
on randomized phase {III} clinical trials},
journal = {npj Digit. Medicine},
volume = {5},
year = {2022}
}
@article{DBLP:journals/percom/DopplerLMAKCHGK22,
author = {Klaus Doppler and
David L{\'{o}}pez{-}P{\'{e}}rez and
Swetha Muniraju and
Traian E. Abrudan and
Step{\'{a}}n Kucera and
Holger Claussen and
Howard Huang and
Haris Gacanin and
Veli{-}Matti Kolmonen and
Enrico Rantala},
title = {Future indoor network with a sixth sense: Requirements, challenges
and enabling technologies},
journal = {Pervasive Mob. Comput.},
volume = {83},
pages = {101571},
year = {2022}
}
@article{DBLP:journals/sensors/AhmedVRMCPWM22,
author = {Waseem Ahmed and
Aneesh Vincent Veluthandath and
David J. Rowe and
Jens Madsen and
Howard W. Clark and
Anthony D. Postle and
James S. Wilkinson and
Ganapathy Senthil Murugan},
title = {Prediction of Neonatal Respiratory Distress Biomarker Concentration
by Application of Machine Learning to Mid-Infrared Spectra},
journal = {Sensors},
volume = {22},
number = {5},
pages = {1744},
year = {2022}
}
@article{DBLP:journals/tai/NitschkeH22,
author = {Geoff Nitschke and
David Howard},
title = {AutoFac: The Perpetual Robot Machine},
journal = {{IEEE} Trans. Artif. Intell.},
volume = {3},
number = {1},
pages = {2--10},
year = {2022}
}
@article{DBLP:journals/tbe/WuHLJPHKY22,
author = {Chengyue Wu and
David A. Hormuth and
Guillermo Lorenzo and
Angela M. Jarrett and
Federico Pineda and
Frederick M. Howard and
Gregory S. Karczmar and
Thomas E. Yankeelov},
title = {Towards Patient-Specific Optimization of Neoadjuvant Treatment Protocols
for Breast Cancer Based on Image-Guided Fluid Dynamics},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {69},
number = {11},
pages = {3334--3344},
year = {2022}
}
@article{DBLP:journals/technometrics/Lipovetsky22,
author = {Stan Lipovetsky},
title = {Analyzing Spatial Models of Choice and Judgment, Second Edition: by
David A. Armstrong II, Ryan Bakker, Royce Carroll, Christopher Hare,
Keith T. Poole, and Howard Rosenthal. {CRC} Press. Taylor {\&}
Francis Group, Chapman and Hall, Boca Raton, FL, 2021, {ISBN} 978-1-138-71533-2,
320 pp., {\textdollar}63.96 (hbk)},
journal = {Technometrics},
volume = {64},
number = {1},
pages = {139--143},
year = {2022}
}
@article{DBLP:journals/tgis/OldelandEIS22,
author = {Jens Oldeland and
Pia Maria Eibes and
Severin David Howard Irl and
Ute Schmiedel},
title = {Do image resolution and classifier choice impact island biogeographical
parameters of terrestrial islands?},
journal = {Trans. {GIS}},
volume = {26},
number = {4},
pages = {2004--2022},
year = {2022}
}
@article{DBLP:journals/tits/WaibelLNHBB22,
author = {Gabriel G{\"{u}}nter Waibel and
Tobias L{\"{o}}w and
Mathieu Nass and
David Howard and
Tirthankar Bandyopadhyay and
Paulo Vinicius Koerich Borges},
title = {How Rough Is the Path? Terrain Traversability Estimation for Local
and Global Path Planning},
journal = {{IEEE} Trans. Intell. Transp. Syst.},
volume = {23},
number = {9},
pages = {16462--16473},
year = {2022}
}
@article{DBLP:journals/trob/RazjigaevPHRW22,
author = {Andrew Razjigaev and
Ajay K. Pandey and
David Howard and
Jonathan Roberts and
Liao Wu},
title = {End-to-End Design of Bespoke, Dexterous Snake-Like Surgical Robots:
{A} Case Study With the {RAVEN} {II}},
journal = {{IEEE} Trans. Robotics},
volume = {38},
number = {5},
pages = {2827--2840},
year = {2022}
}
@inproceedings{DBLP:conf/aime/GaoRABH22,
author = {Erdi Gao and
Goce Ristanoski and
Uwe Aickelin and
David Berlowitz and
Mark Howard},
title = {Early Detection and Classification of Patient-Ventilator Asynchrony
Using Machine Learning},
booktitle = {{AIME}},
series = {Lecture Notes in Computer Science},
volume = {13263},
pages = {238--248},
publisher = {Springer},
year = {2022}
}
@inproceedings{DBLP:conf/amia/TeferiLA0WW22,
author = {Bemnet Teferi and
Brian Lo and
Alexxa Abi{-}Jaoud{\'{e}} and
Andrew Johnson and
Howard W. Wong and
David Wiljer},
title = {Enhancing the Value of Digital Health Support for Mental Health Help-Seeking
in Transitional Aged Youth: What should we do next?},
booktitle = {{AMIA}},
publisher = {{AMIA}},
year = {2022}
}
@inproceedings{DBLP:conf/gecco/FitzgeraldDHM22,
author = {Seth G. Fitzgerald and
Gary W. Delaney and
David Howard and
Fr{\'{e}}d{\'{e}}ric Maire},
title = {Evolving polydisperse soft robotic jamming grippers},
booktitle = {{GECCO} Companion},
pages = {707--710},
publisher = {{ACM}},
year = {2022}
}
@inproceedings{DBLP:conf/gecco/HowardMDKR22,
author = {David Howard and
Humphrey Munn and
Davide Dolcetti and
Josh Kannemeyer and
Nicole L. Robinson},
title = {Assessing evolutionary terrain generation methods for curriculum reinforcement
learning},
booktitle = {{GECCO}},
pages = {377--384},
publisher = {{ACM}},
year = {2022}
}
@inproceedings{DBLP:conf/gecco/HuangWHS22,
author = {Zonghao Huang and
Quinn Wu and
David Howard and
Cynthia R. Sung},
title = {EvoRobogami: co-designing with humans in evolutionary robotics experiments},
booktitle = {{GECCO}},
pages = {168--176},
publisher = {{ACM}},
year = {2022}
}
@inproceedings{DBLP:conf/iros/KentNTH22,
author = {Nathan D. Kent and
David Neiman and
Matthew Travers and
Thomas M. Howard},
title = {Improved Performance of {CPG} Parameter Inference for Path-following
Control of Legged Robots},
booktitle = {{IROS}},
pages = {11963--11970},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/iros/PinskierBHSH22,
author = {Joshua Pinskier and
James Brett and
Lauren Hanson and
Katrina Lo Surdo and
David Howard},
title = {Jammkle: Fibre jamming 3D printed multi-material tendons and their
application in a robotic ankle},
booktitle = {{IROS}},
pages = {8507--8514},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/ozchi/JohansenSBHCDDG22,
author = {Stine S. Johansen and
Hashini Senaratne and
Alan Burden and
David Howard and
Glenda Amayo Caldwell and
Jared Donovan and
Andreas Duenser and
Matthias Guertler and
Melanie J. McGrath and
C{\'{e}}cile Paris and
Markus Rittenbruch and
Jonathan Roberts},
title = {Empowering People in Human-Robot Collaboration: Bringing Together
and Synthesising Perspectives},
booktitle = {{OZCHI}},
pages = {352--355},
publisher = {{ACM}},
year = {2022}
}
@inproceedings{DBLP:conf/robosoft/HowardOLBJLFD22,
author = {David Howard and
Jack O'Connor and
Jordan Letchford and
James Brett and
Therese Joseph and
Sophia Lin and
Daniel Furby and
Gary W. Delaney},
title = {Getting a Grip: in Materio Evolution of Membrane Morphology for Soft
Robotic Jamming Grippers},
booktitle = {RoboSoft},
pages = {531--538},
publisher = {{IEEE}},
year = {2022}
}
@misc{DBLP:data/10/LangermanQSSWH22,
author = {Jack Langerman and
Ziming Qiu and
G{\'{a}}bor S{\"{o}}r{\"{o}}s and
D{\'{a}}vid Sebok and
Yao Wang and
Howard Huang},
title = {Bell Labs robot garage for {DANCE:} Domain Adaptation of Networks
for Camera Pose Estimation},
publisher = {{IEEE} DataPort},
year = {2022},
month = jan,
howpublished = {\url{https://doi.org/10.21227/mjek-j791}},
note = {Accessed on YYYY-MM-DD.}
}
@article{DBLP:journals/corr/abs-2201-11846,
author = {Shane Walsh and
Alex Frost and
William Anderson and
Toby Digney and
Benjamin Dix{-}Matthews and
David R. Gozzard and
Charles T. Gravestock and
Lewis Howard and
Skevos F. E. Karpathakis and
Ayden McCann and
Sascha W. Schediwy},
title = {The Western Australian Optical Ground Station},
journal = {CoRR},
volume = {abs/2201.11846},
year = {2022}
}
@article{DBLP:journals/corr/abs-2203-15172,
author = {David Howard and
Josh Kannemeyer and
Davide Dolcetti and
Humphrey Munn and
Nicole L. Robinson},
title = {Assessing Evolutionary Terrain Generation Methods for Curriculum Reinforcement
Learning},
journal = {CoRR},
volume = {abs/2203.15172},
year = {2022}
}
@article{DBLP:journals/corr/abs-2205-08086,
author = {Zonghao Huang and
Quinn Wu and
David Howard and
Cynthia Sung},
title = {EvoRobogami: Co-designing with Humans in Evolutionary Robotics Experiments},
journal = {CoRR},
volume = {abs/2205.08086},
year = {2022}
}
@article{DBLP:journals/corr/abs-2211-13843,
author = {Joshua Pinskier and
Prabhat Kumar and
David Howard and
Matthijs Langelaar},
title = {Automated design of pneumatic soft grippers through design-dependent
multi-material topology optimization},
journal = {CoRR},
volume = {abs/2211.13843},
year = {2022}
}
@article{DBLP:journals/corr/abs-2212-05626,
author = {Nicole L. Robinson and
Jason Williams and
David Howard and
Brendan Tidd and
Fletcher Talbot and
Brett Wood and
Alex Pitt and
Navinda Kottege and
Dana Kulic},
title = {Human-Robot Team Performance Compared to Full Robot Autonomy in 16
Real-World Search and Rescue Missions: Adaptation of the {DARPA} Subterranean
Challenge},
journal = {CoRR},
volume = {abs/2212.05626},
year = {2022}
}
@article{DBLP:journals/corr/abs-2212-06485,
author = {Therese Joseph and
Sarah Baldwin and
Lillian Guan and
James Brett and
David Howard},
title = {The Jamming Donut: {A} Free-Space Gripper based on Granular Jamming},
journal = {CoRR},
volume = {abs/2212.06485},
year = {2022}
}
@article{DBLP:journals/corr/abs-2212-06498,
author = {Cameron Coombe and
James Brett and
Raghav Mishra and
Gary W. Delaney and
David Howard},
title = {Active Vibration Fluidization for Granular Jamming Grippers},
journal = {CoRR},
volume = {abs/2212.06498},
year = {2022}
}
@article{DBLP:journals/corr/abs-2212-06511,
author = {David Howard and
Jack O'Connor and
Jordan Letchford and
Therese Joseph and
Sophia Lin and
Sarah Baldwin and
Gary W. Delaney},
title = {A Comprehensive Dataset of Grains for Granular Jamming in Soft Robotics:
Grip Strength and Shock Absorption},
journal = {CoRR},
volume = {abs/2212.06511},
year = {2022}
}
@article{DBLP:journals/access/CollinsCVH21,
author = {Jack Collins and
Shelvin Chand and
Anthony Vanderkop and
David Howard},
title = {A Review of Physics Simulators for Robotic Applications},
journal = {{IEEE} Access},
volume = {9},
pages = {51416--51431},
year = {2021}
}
@article{DBLP:journals/aiethics/DouglasHL21,
author = {David M. Douglas and
David Howard and
Justine Lacey},
title = {Moral responsibility for computationally designed products},
journal = {{AI} Ethics},
volume = {1},
number = {3},
pages = {273--281},
year = {2021}
}
@article{DBLP:journals/csur/KolbAKC20,
author = {John Kolb and
Moustafa AbdelBaky and
Randy H. Katz and
David E. Culler},
title = {Core Concepts, Challenges, and Future Directions in Blockchain: {A}
Centralized Tutorial},
journal = {{ACM} Comput. Surv.},
volume = {53},
number = {1},
pages = {9:1--9:39},
year = {2021}
}
@article{DBLP:journals/ec/NygaardMHTG21,
author = {T{\o}nnes F. Nygaard and
Charles P. Martin and
David Howard and
Jim T{\o}rresen and
Kyrre Glette},
title = {Environmental Adaptation of Robot Morphology and Control Through Real-World
Evolution},
journal = {Evol. Comput.},
volume = {29},
number = {4},
pages = {441--461},
year = {2021}
}
@article{DBLP:journals/firai/ChandH21,
author = {Shelvin Chand and
David Howard},
title = {Multi-Level Evolution for Robotic Design},
journal = {Frontiers Robotics {AI}},
volume = {8},
pages = {684304},
year = {2021}
}
@article{DBLP:journals/jirs/OliveiraNHBCM21,
author = {Felipe G. Oliveira and
Armando Alves Neto and
David Howard and
Paulo V. K. Borges and
Mario F. M. Campos and
Douglas G. Macharet},
title = {Three-Dimensional Mapping with Augmented Navigation Cost through Deep
Learning},
journal = {J. Intell. Robotic Syst.},
volume = {101},
number = {3},
pages = {50},
year = {2021}
}
@article{DBLP:journals/mlst/YanxonZTMZ21,
author = {Howard Yanxon and
David Zagaceta and
Binh Tang and
David S. Matteson and
Qiang Zhu},
title = {PyXtal{\_}FF: a python library for automated force field generation},
journal = {Mach. Learn. Sci. Technol.},
volume = {2},
number = {2},
pages = {27001},
year = {2021}
}
@article{DBLP:journals/natmi/NygaardMTGH21,
author = {T{\o}nnes F. Nygaard and
Charles P. Martin and
Jim T{\o}rresen and
Kyrre Glette and
David Howard},
title = {Real-world embodied {AI} through a morphologically adaptive quadruped
robot},
journal = {Nat. Mach. Intell.},
volume = {3},
number = {5},
pages = {410--419},
year = {2021}
}
@article{DBLP:journals/ral/AhmadiNKHH21,
author = {Ahmadreza Ahmadi and
T{\o}nnes F. Nygaard and
Navinda Kottege and
David Howard and
Nicolas Hudson},
title = {Semi-Supervised Gated Recurrent Neural Networks for Robotic Terrain
Classification},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {6},
number = {2},
pages = {1848--1855},
year = {2021}
}
@article{DBLP:journals/spm/TookAYH21,
author = {Clive Cheong Took and
Stephen R. Alty and
Anush Yardim and
David M. Howard},
title = {Creativity First, Science Follows: Lessons in Digital Signal Processing
Education},
journal = {{IEEE} Signal Process. Mag.},
volume = {38},
number = {3},
pages = {51--61},
year = {2021}
}
@inproceedings{DBLP:conf/amia/LoSWAH0W21,
author = {Brian Lo and
Jenny Shi and
Howard W. Wong and
Alexxa Abi{-}Jaoud{\'{e}} and
Elisa Hollenberg and
Andrew Johnson and
David Wiljer},
title = {Engaging the disengaged: recommendations for partnering with transitional
aged youth to improve mental health help-seeking in the digital age},
booktitle = {{AMIA}},
publisher = {{AMIA}},
year = {2021}
}
@inproceedings{DBLP:conf/emnlp/LowellHLW21,
author = {David Lowell and
Brian E. Howard and
Zachary C. Lipton and
Byron C. Wallace},
title = {Unsupervised Data Augmentation with Naive Augmentation and without
Unlabeled Data},
booktitle = {{EMNLP} {(1)}},
pages = {4992--5001},
publisher = {Association for Computational Linguistics},
year = {2021}
}
@inproceedings{DBLP:conf/euspn/GuzmanZBD21,
author = {Jey Howard Escorcia Guzman and
Rohemi Alfredo Zuluaga{-}Ortiz and
David Andres Barrios{-}Miranda and
Enrique Jos{\'{e}} Delahoz{-}Dom{\'{\i}}nguez},
title = {Information and Communication Technologies {(ICT)} in the processes
of distribution and use of knowledge in Higher Education Institutions
(HEIs)},
booktitle = {{EUSPN/ICTH}},
series = {Procedia Computer Science},
volume = {198},
pages = {644--649},
publisher = {Elsevier},
year = {2021}
}
@inproceedings{DBLP:conf/gecco/FitzgeraldDHM21,
author = {Seth G. Fitzgerald and
Gary W. Delaney and
David Howard and
Fr{\'{e}}d{\'{e}}ric Maire},
title = {Evolving soft robotic jamming grippers},
booktitle = {{GECCO}},
pages = {102--110},
publisher = {{ACM}},
year = {2021}
}
@inproceedings{DBLP:conf/icra/DimitrovGHL21,
author = {Marin Dimitrov and
Keir Groves and
David Howard and
Barry Lennox},
title = {Model Identification of a Small Fully-Actuated Aquatic Surface Vehicle
Using a Long Short-Term Memory Neural Network},
booktitle = {{ICRA}},
pages = {5966--5972},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/igarss/SimonsBBDFJLLMO21,
author = {Mark Simons and
David Bekaert and
Adrian A. Borsa and
Andrea Donnellan and
Eric J. Fielding and
Cathleen E. Jones and
Rowena Lohman and
Zhong Lu and
Franz Meyer and
Susan Owen and
Paul A. Rosen and
Howard A. Zebker},
title = {Nisar Requirements and Validation Approach for Solid Earth Science},
booktitle = {{IGARSS}},
pages = {543--546},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/iros/RazjigaevPH0W21,
author = {Andrew Razjigaev and
Ajay K. Pandey and
David Howard and
Jonathan Roberts and
Liao Wu},
title = {SnakeRaven: Teleoperation of a 3D Printed Snake-like Manipulator Integrated
to the {RAVEN} {II} Surgical Robot},
booktitle = {{IROS}},
pages = {5282--5288},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/isscc/LaCroixCSNMMMLZ21,
author = {Marc{-}Andre LaCroix and
Euhan Chong and
Weilun Shen and
Ehud Nir and
Faisal Ahmed Musa and
Haitao Mei and
Mohammad{-}Mahdi Mohsenpour and
Semyon Lebedev and
Babak Zamanlooy and
Carlos Carvalho and
Qian Xin and
Dmitry Petrov and
Henry Wong and
Huong Ho and
Yang Xu and
Sina Naderi Shahi and
Peter Krotnev and
Chris Feist and
Howard Huang and
Davide Tonietto},
title = {8.4 {A} 116Gb/s DSP-Based Wireline Transceiver in 7nm {CMOS} Achieving
6pJ/b at 45dB Loss in PAM-4/Duo-PAM-4 and 52dB in {PAM-2}},
booktitle = {{ISSCC}},
pages = {132--134},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/nips/CachayRCBR21,
author = {Salva R{\"{u}}hling Cachay and
Venkatesh Ramesh and
Jason N. S. Cole and
Howard Barker and
David Rolnick},
title = {ClimART: {A} Benchmark Dataset for Emulating Atmospheric Radiative
Transfer in Weather and Climate Models},
booktitle = {NeurIPS Datasets and Benchmarks},
year = {2021}
}
@inproceedings{DBLP:conf/robosoft/HowardOBD21,
author = {David Howard and
Jack O'Connor and
James Brett and
Gary W. Delaney},
title = {Shape, Size, and Fabrication Effects in 3D Printed Granular Jamming
Grippers},
booktitle = {RoboSoft},
pages = {458--464},
publisher = {{IEEE}},
year = {2021}
}
@article{DBLP:journals/corr/abs-2104-04171,
author = {David Howard and
Jack O'Connor and
James Brett and
Gary W. Delaney},
title = {Shape, Size, and Fabrication Effects in 3D Printed Granular Jamming
Grippers},
journal = {CoRR},
volume = {abs/2104.04171},
year = {2021}
}
@article{DBLP:journals/corr/abs-2107-13465,
author = {Ti Bai and
Anjali Balagopal and
Michael Dohopolski and
Howard E. Morgan and
Rafe McBeth and
Jun Tan and
Mu{-}Han Lin and
David J. Sher and
Dan Nguyen and
Steve B. Jiang},
title = {A Proof-of-Concept Study of Artificial Intelligence Assisted Contour
Revision},
journal = {CoRR},
volume = {abs/2107.13465},
year = {2021}
}
@article{DBLP:journals/corr/abs-2109-04674,
author = {Jack Collins and
Ross Brown and
J{\"{u}}rgen Leitner and
David Howard},
title = {Follow the Gradient: Crossing the Reality Gap using Differentiable
Physics (RealityGrad)},
journal = {CoRR},
volume = {abs/2109.04674},
year = {2021}
}
@article{DBLP:journals/corr/abs-2109-04681,
author = {James Brett and
Katrina Lo Surdo and
Lauren Hanson and
Joshua Pinskier and
David Howard},
title = {Jammkle: Fibre jamming 3D printed multi-material tendons and their
application in a robotic ankle},
journal = {CoRR},
volume = {abs/2109.04681},
year = {2021}
}
@article{DBLP:journals/corr/abs-2109-10496,
author = {Raghav Mishra and
Tyson Philips and
Gary W. Delaney and
David Howard},
title = {Vibration Improves Performance in Granular Jamming Grippers},
journal = {CoRR},
volume = {abs/2109.10496},
year = {2021}
}
@article{DBLP:journals/corr/abs-2111-01952,
author = {David Howard and
Jack O'Connor and
Jordan Letchford and
James Brett and
Therese Joseph and
Sophia Lin and
Daniel Furby and
Gary W. Delaney},
title = {Getting a Grip: in Materio Evolution of Membrane Morphology for Soft
Robotic Jamming Grippers},
journal = {CoRR},
volume = {abs/2111.01952},
year = {2021}
}
@article{DBLP:journals/corr/abs-2111-14671,
author = {Salva R{\"{u}}hling Cachay and
Venkatesh Ramesh and
Jason N. S. Cole and
Howard Barker and
David Rolnick},
title = {ClimART: {A} Benchmark Dataset for Emulating Atmospheric Radiative
Transfer in Weather and Climate Models},
journal = {CoRR},
volume = {abs/2111.14671},
year = {2021}
}
@article{DBLP:journals/corr/abs-2111-14741,
author = {Jack Langerman and
Ziming Qiu and
G{\'{a}}bor S{\"{o}}r{\"{o}}s and
D{\'{a}}vid Sebok and
Yao Wang and
Howard Huang},
title = {Domain Adaptation of Networks for Camera Pose Estimation: Learning
Camera Pose Estimation Without Pose Labels},
journal = {CoRR},
volume = {abs/2111.14741},
year = {2021}
}
@article{DBLP:journals/concurrency/BernholdtBBVGNP20,
author = {David E. Bernholdt and
Swen Boehm and
George Bosilca and
Manjunath Gorentla Venkata and
Ryan E. Grant and
Thomas J. Naughton and
Howard Pritchard and
Martin Schulz and
Geoffroy R. Vall{\'{e}}e},
title = {A survey of {MPI} usage in the {US} exascale computing project},
journal = {Concurr. Comput. Pract. Exp.},
volume = {32},
number = {3},
year = {2020}
}
@article{DBLP:journals/ior/JohnsonBDDGHKRS20,
author = {David S. Johnson and
Lee Breslau and
Ilias Diakonikolas and
Nick Duffield and
Yu Gu and
MohammadTaghi Hajiaghayi and
Howard J. Karloff and
Mauricio G. C. Resende and
Subhabrata Sen},
title = {Near-Optimal Disjoint-Path Facility Location Through Set Cover by
Pairs},
journal = {Oper. Res.},
volume = {68},
number = {3},
pages = {896--926},
year = {2020}
}
@article{DBLP:journals/jocch/MillardPHH20,
author = {David E. Millard and
Heather S. Packer and
Yvonne Margaret Howard and
Charlie Hargood},
title = {The Balance of Attention: The Challenges of Creating Locative Cultural
Storytelling Experiences},
journal = {{ACM} Journal on Computing and Cultural Heritage},
volume = {13},
number = {4},
pages = {35:1--35:24},
year = {2020}
}
@article{DBLP:journals/micro/AmidBGGKLMMOPRS20,
author = {Alon Amid and
David Biancolin and
Abraham Gonzalez and
Daniel Grubb and
Sagar Karandikar and
Harrison Liew and
Albert Magyar and
Howard Mao and
Albert J. Ou and
Nathan Pemberton and
Paul Rigge and
Colin Schmidt and
John Charles Wright and
Jerry Zhao and
Yakun Sophia Shao and
Krste Asanovic and
Borivoje Nikolic},
title = {Chipyard: Integrated Design, Simulation, and Implementation Framework
for Custom SoCs},
journal = {{IEEE} Micro},
volume = {40},
number = {4},
pages = {10--21},
year = {2020}
}
@article{DBLP:journals/midm/TanDCRCMMJGMSAT20,
author = {Audrey Tan and
Mark Durbin and
Frank R. Chung and
Ada L. Rubin and
Allison M. Cuthel and
Jordan A. McQuilkin and
Aram S. Modrek and
Catherine T. Jamin and
Nicholas Gavin and
Devin M. Mann and
Jordan L. Swartz and
Jonathan S. Austrian and
Paul A. Testa and
Jacob D. Hill and
Corita R. Grudzen and
Benjamin Abella and
David Allard and
M. Fernanda Bellolio and
Michael Blum and
Todd Burstain and
Jeffrey Caterino and
Julie Cooper and
Bruce Darrow and
Marie{-}Carmelle Elie and
Ahmed Elsayem and
John Frenzel and
Howard Goldberg and
Iris Herrera and
John Howell and
Allen Hsaio and
Eric Isaacs and
Karen Jubanyik and
Ken Kawamoto and
Sangeeta Lamba and
Troy Madsen and
Joseph Miller and
Kei Ouchi and
Rajesh Patel and
Rajiv Pramanik and
Lynne Richardson and
Milisa Rizer and
Elizabeth Schoenfeld and
Timothy Shiuh and
Ashley Shreves and
Robert Swor and
Arvind Venkat and
Kendall Webb and
Howard Weeks and
Robert White and
Decker Wyatt and
Matthew Zimmie and
Erin Zimny},
title = {Design and implementation of a clinical decision support tool for
primary palliative Care for Emergency Medicine {(PRIM-ER)}},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {20},
number = {1},
pages = {13},
year = {2020}
}
@article{DBLP:journals/natmi/RichRJFWSDOBLPT20,
author = {Alexander S. Rich and
Cynthia Rudin and
David M. P. Jacoby and
Robin Freeman and
Oliver R. Wearn and
Henry Shevlin and
Kanta Dihal and
Se{\'{a}}n S. {\'{O}}h{\'{E}}igeartaigh and
James Butcher and
Marco Lippi and
Przemyslaw Palka and
Paolo Torroni and
Shannon Wongvibulsin and
Edmon Begoli and
Gisbert Schneider and
Stephen Cave and
Mona Sloane and
Emanuel Moss and
Iyad Rahwan and
Ken Goldberg and
David Howard and
Luciano Floridi and
Jack Stilgoe},
title = {{AI} reflections in 2019},
journal = {Nat. Mach. Intell.},
volume = {2},
number = {1},
pages = {2--9},
year = {2020}
}
@article{DBLP:journals/nature/TurroAMGGSASFTS20,
author = {Ernest Turro and
William J. Astle and
Karyn Megy and
Stefan Gr{\"{a}}f and
Daniel Greene and
Olga Shamardina and
Hana Lango Allen and
Alba Sanchis{-}Juan and
Mattia Frontini and
Chantal Thys and
Jonathan Stephens and
Rutendo Mapeta and
Oliver S. Burren and
Kate Downes and
Matthias Haimel and
Salih Tuna and
Sri V. V. Deevi and
Timothy J. Aitman and
David L. H. Bennett and
Paul Calleja and
Keren Carss and
Mark J. Caulfield and
Patrick F. Chinnery and
Peter H. Dixon and
Daniel P. Gale and
Roger James and
Ania Koziell and
Michael A. Laffan and
Adam P. Levine and
Eamonn R. Maher and
Hugh S. Markus and
Joannella Morales and
Nicholas W. Morrell and
Andrew D. Mumford and
Elizabeth Ormondroyd and
Stuart Rankin and
Augusto Rendon and
Sylvia Richardson and
Irene Roberts and
Noemi B. A. Roy and
Moin A. Saleem and
Kenneth G. C. Smith and
Hannah Stark and
Rhea Y. Y. Tan and
Andreas C. Themistocleous and
Adrian J. Thrasher and
Hugh Watkins and
Andrew R. Webster and
Martin R. Wilkins and
Catherine Williamson and
James Whitworth and
Sean Humphray and
David R. Bentley and
Stephen Abbs and
Lara Abulhoul and
Julian Adlard and
Munaza Ahmed and
Hana Alachkar and
David J. Allsup and
Jeff Almeida{-}King and
Philip Ancliff and
Richard Antrobus and
Ruth Armstrong and
Gavin Arno and
Sofie Ashford and
Anthony Attwood and
Paul Aurora and
Christian Babbs and
Chiara Bacchelli and
Tamam Bakchoul and
Siddharth Banka and
Tadbir Bariana and
Julian Barwell and
Joana Batista and
Helen E. Baxendale and
Phil L. Beales and
Agnieszka Bierzynska and
Tina Biss and
Maria A. K. Bitner{-}Glindzicz and
Graeme C. M. Black and
Marta Bleda and
Iulia Blesneac and
Detlef Bockenhauer and
Harm Bogaard and
Christian J. Bourne and
Sara Boyce and
John R. Bradley and
Eugene Bragin and
Gerome Breen and
Paul Brennan and
Carole Brewer and
Matthew Brown and
Andrew C. Browning and
Michael J. Browning and
Rachel J. Buchan and
Matthew S. Buckland and
Teofila Bueser and
Carmen Bugarin Diz and
John Burn and
Siobhan O. Burns and
Nigel Burrows and
Carolyn Campbell and
Gerald Carr{-}White and
Ruth Casey and
Jenny Chambers and
John Chambers and
Melanie M. Y. Chan and
Calvin Cheah and
Floria Cheng and
Manali Chitre and
Martin T. Christian and
Colin Church and
Jill Clayton{-}Smith and
Maureen Cleary and
Naomi Clements Brod and
Gerry Coghlan and
Elizabeth Colby and
Trevor R. P. Cole and
Janine Collins and
Peter W. Collins and
Camilla Colombo and
Cecilia J. Compton and
Robin Condliffe and
Stuart A. Cook and
H. Terence Cook and
Nichola Cooper and
Paul A. Corris and
Abigail Furnell and
Fiona Cunningham and
Nicola S. Curry and
Antony J. Cutler and
Matthew J. Daniels and
Mehul Dattani and
Louise C. Daugherty and
John Davis and
Anthony De Soyza and
Timothy Dent and
Charu Deshpande and
Eleanor F. Dewhurst and
Sofia Douzgou and
Anna M. Drazyk and
Elizabeth Drewe and
Daniel Duarte and
Tina Dutt and
J. David M. Edgar and
Karen Edwards and
William Egner and
Melanie N. Ekani and
Perry Elliott and
Wendy N. Erber and
Marie Erwood and
Maria C. Estiu and
Dafydd Gareth Evans and
Gillian Evans and
Tamara Everington and
M{\'{e}}lanie Eyries and
Hiva Fassihi and
Remi Favier and
Jack Findhammer and
Debra Fletcher and
Frances A. Flinter and
R. Andres Floto and
Tom Fowler and
James Fox and
Amy J. Frary and
Courtney E. French and
Kathleen Freson and
Henning Gall and
Vijeya Ganesan and
Michael Gattens and
Claire Geoghegan and
Terence S. A. Gerighty and
Ali G. Gharavi and
Stefano Ghio and
Hossein{-}Ardeschir Ghofrani and
J. Simon R. Gibbs and
Kate Gibson and
Kimberly C. Gilmour and
Barbara Girerd and
Nicholas S. Gleadall and
Sarah Goddard and
David B. Goldstein and
Keith Gomez and
Pavels Gordins and
David Gosal and
Jodie Graham and
Luigi Grassi and
Lynn Greenhalgh and
Andreas Greinacher and
Paolo Gresele and
Philip Griffiths and
Sofia Grigoriadou and
Russell J. Grocock and
Detelina Grozeva and
Mark Gurnell and
Scott Hackett and
Charaka Hadinnapola and
William M. Hague and
Rosie Hague and
Matthew Hall and
Helen L. Hanson and
Eshika Haque and
Kirsty Harkness and
Andrew R. Harper and
Claire L. Harris and
Daniel Hart and
Ahamad Hassan and
Grant Hayman and
Alex Henderson and
Archana Herwadkar and
Jonathan Hoffman and
Simon Holden and
Rita Horvath and
Henry Houlden and
Arjan C. Houweling and
Luke S. G. E. Howard and
Fengyuan Hu and
Gavin Hudson and
Joseph Hughes and
Aarnoud P. Huissoon and
Marc Humbert and
Sarah Hunter and
Matthew E. Hurles and
Melita Irving and
Louise Izatt and
Sally A. Johnson and
Stephen Jolles and
Jennifer Jolley and
Dragana Josifova and
Neringa Jurkute and
Tim Karten and
Johannes Karten and
Mary A. Kasanicki and
Hanadi Kazkaz and
Rashid Kazmi and
Peter Kelleher and
Anne M. Kelly and
Wilf Kelsall and
Carly Kempster and
David G. Kiely and
Nathalie Kingston and
Robert Klima and
Nils Koelling and
Myrto Kostadima and
Gabor Kovacs and
Roman Kreuzhuber and
Taco W. Kuijpers and
Ajith Kumar and
Dinakantha Kumararatne and
Manju A. Kurian and
Fiona Lalloo and
Michele Lambert and
Allan Lawrie and
D. Mark Layton and
Nick Lench and
Claire Lentaigne and
Tracy Lester and
Rachel Linger and
Hilary Longhurst and
Lorena E. Lorenzo and
Eleni Louka and
Paul A. Lyons and
Rajiv D. Machado and
Robert V. MacKenzie Ross and
Bella Madan and
Jesmeen Maimaris and
Samantha Malka and
Sarah Mangles and
Kevin J. Marchbank and
Stephen Marks and
Hanns{-}Ulrich Marschall and
Andrew G. Marshall and
Jennifer Martin and
Mary Mathias and
Emma Matthews and
Heather Maxwell and
Paul McAlinden and
Mark I. McCarthy and
Harriet McKinney and
Aoife McMahon and
Stuart Meacham and
Adam J. Mead and
Ignacio Medina Castello and
Sarju G. Mehta and
Michel Michaelides and
Carolyn Millar and
Shehla N. Mohammed and
Shahin Moledina and
David Montani and
Anthony T. Moore and
Monika Mozere and
Keith W. Muir and
Andrea H. Nemeth and
William G. Newman and
Michael Newnham and
Sadia Noorani and
Paquita Nurden and
Jennifer O'Sullivan and
Samya Obaji and
Chris Odhams and
Steven Okoli and
Andrea Olschewski and
Horst Olschewski and
Kai Ren Ong and
S. Helen Oram and
Willem H. Ouwehand and
Claire Palles and
Sofia Papadia and
Soo{-}Mi Park and
David Parry and
Smita Patel and
Joan Paterson and
Andrew Peacock and
Simon H. Pearce and
John Peden and
Kathelijne Peerlinck and
Christopher J. Penkett and
Joanna Pepke{-}Zaba and
Romina Petersen and
Clarissa Pilkington and
Kenneth E. S. Poole and
Radhika Prathalingam and
Bethan Psaila and
Angela Pyle and
Richard Quinton and
Shamima Rahman and
Anupama Rao and
F. Lucy Raymond and
Paula J. Rayner{-}Matthews and
Christine Rees and
Tara Renton and
Christopher J. Rhodes and
Andrew S. C. Rice and
Alex Richter and
Leema Robert and
Anthony Rogers and
Sarah J. Rose and
Robert Ross{-}Russell and
Catherine Roughley and
Deborah M. Ruddy and
Omid Sadeghi{-}Alavijeh and
Nilesh J. Samani and
Crina Samarghitean and
Ravishankar B. Sargur and
Robert N. Sarkany and
Simon Satchell and
Sinisa Savic and
John A. Sayer and
Genevieve Sayer and
Laura Scelsi and
Andrew M. Schaefer and
Sol Schulman and
Richard Scott and
Marie Scully and
Claire Searle and
Werner Seeger and
Arjune Sen and
W. A. Carrock Sewell and
Denis Seyres and
Neil Shah and
Susan E. Shapiro and
Adam C. Shaw and
Patrick J. Short and
Keith Sibson and
Lucy Side and
Ilenia Simeoni and
Michael A. Simpson and
Matthew C. Sims and
Suthesh Sivapalaratnam and
Damian Smedley and
Katherine R. Smith and
Katie Snape and
Nicole Soranzo and
Florent Soubrier and
Laura Southgate and
Olivera Spasic{-}Boskovic and
Simon Staines and
Emily Staples and
Charles A. Steward and
Kathleen E. Stirrups and
Alex Stuckey and
Jay Suntharalingam and
Emilia M. Swietlik and
Petros Syrris and
R. Campbell Tait and
Kate Talks and
Katie Tate and
John M. Taylor and
Jenny C. Taylor and
James E. Thaventhiran and
Ellen Thomas and
David Thomas and
Moira J. Thomas and
Patrick Thomas and
Kate Thomson and
Glen Threadgold and
Tobias Tilly and
Marc Tischkowitz and
Catherine Titterton and
John A. Todd and
Cheng{-}Hock Toh and
Bas Tolhuis and
Ian P. Tomlinson and
Mark Toshner and
Matthew Traylor and
Carmen Treacy and
Paul Treadaway and
Richard Trembath and
Wojciech Turek and
Philip Twiss and
Tom Vale and
Chris Van Geet and
Natalie van Zuydam and
Maarten Vandekuilen and
Anthony M. Vandersteen and
Marta Vazquez{-}Lopez and
Julie von Ziegenweidt and
Anton Vonk{-}Noordegraaf and
Annette Wagner and
Quinten Waisfisz and
Suellen M. Walker and
Neil Walker and
Klaudia Walter and
James S. Ware and
Christopher Watt and
Lucy Wedderburn and
Wei Wei and
Steven B. Welch and
Julie Wessels and
Sarah K. Westbury and
John{-}Paul Westwood and
John Wharton and
Deborah Whitehorn and
Andrew O. M. Wilkie and
Brian T. Wilson and
Edwin K. S. Wong and
Nicholas W. Wood and
Yvette Wood and
Christopher Geoffrey Woods and
Emma R. Woodward and
Stephen J. Wort and
Austen Worth and
Michael Wright and
Katherine Yates and
Patrick F. K. Yong and
Timothy Young and
Ping Yu and
Patrick Yu{-}Wai{-}Man and
Eliska Zlamalova},
title = {Whole-genome sequencing of patients with rare diseases in a national
health system},
journal = {Nat.},
volume = {583},
number = {7814},
pages = {96--102},
year = {2020}
}
@article{DBLP:journals/ral/CollinsMWBHL20,
author = {Jack Collins and
Jessie McVicar and
David Wedlock and
Ross Brown and
David Howard and
J{\"{u}}rgen Leitner},
title = {Benchmarking Simulated Robotic Manipulation Through a Real World Dataset},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {5},
number = {1},
pages = {250--257},
year = {2020}
}
@article{DBLP:journals/remotesensing/MushkinGABHTTB20,
author = {Amit Mushkin and
Alan R. Gillespie and
Elsa A. Abbott and
Jigjidsurengiin Batbaatar and
Glynn C. Hulley and
Howard Tan and
David M. Tratt and
Kerry N. Buckland},
title = {Validation of {ASTER} Emissivity Retrieval Using the Mako Airborne
{TIR} Imaging Spectrometer at the Algodones Dune Field in Southern
California, {USA}},
journal = {Remote. Sens.},
volume = {12},
number = {5},
pages = {815},
year = {2020}
}
@article{DBLP:journals/siamco/KerimkulovSS20,
author = {Bekzhan Kerimkulov and
David Siska and
Lukasz Szpruch},
title = {Exponential Convergence and Stability of Howard's Policy Improvement
Algorithm for Controlled Diffusions},
journal = {{SIAM} J. Control. Optim.},
volume = {58},
number = {3},
pages = {1314--1340},
year = {2020}
}
@article{DBLP:journals/tnn/SaltHIS20,
author = {Llewyn Salt and
David Howard and
Giacomo Indiveri and
Yulia Sandamirskaya},
title = {Parameter Optimization and Learning in a Spiking Neural Network for
{UAV} Obstacle Avoidance Targeting Neuromorphic Processors},
journal = {{IEEE} Trans. Neural Networks Learn. Syst.},
volume = {31},
number = {9},
pages = {3305--3318},
year = {2020}
}
@inproceedings{DBLP:conf/dac/AmidBGGKLMMOPR020,
author = {Alon Amid and
David Biancolin and
Abraham Gonzalez and
Daniel Grubb and
Sagar Karandikar and
Harrison Liew and
Albert Magyar and
Howard Mao and
Albert J. Ou and
Nathan Pemberton and
Paul Rigge and
Colin Schmidt and
John Charles Wright and
Jerry Zhao and
Jonathan Bachrach and
Yakun Sophia Shao and
Borivoje Nikolic and
Krste Asanovic},
title = {Invited: Chipyard - An Integrated SoC Research and Implementation
Environment},
booktitle = {{DAC}},
pages = {1--6},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/gecco/ChandH20,
author = {Shelvin Chand and
David Howard},
title = {Path towards multilevel evolution of robots},
booktitle = {{GECCO} Companion},
pages = {1381--1382},
publisher = {{ACM}},
year = {2020}
}
@inproceedings{DBLP:conf/gecco/DelaneyH20,
author = {Gary W. Delaney and
Gerard David Howard},
title = {Multi-objective exploration of a granular matter design space},
booktitle = {{GECCO} Companion},
pages = {263--264},
publisher = {{ACM}},
year = {2020}
}
@inproceedings{DBLP:conf/gecco/HowardLG20,
author = {Gerard David Howard and
Thomas Lowe and
Wade Geles},
title = {Diversity-based design assist for large legged robots},
booktitle = {{GECCO} Companion},
pages = {81--82},
publisher = {{ACM}},
year = {2020}
}
@inproceedings{DBLP:conf/gecco/NygaardHG20,
author = {T{\o}nnes F. Nygaard and
David Howard and
Kyrre Glette},
title = {Real world morphological evolution is feasible},
booktitle = {{GECCO} Companion},
pages = {1392--1394},
publisher = {{ACM}},
year = {2020}
}
@inproceedings{DBLP:conf/gecco/QiuGHA20,
author = {Huanneng Qiu and
Matthew Garratt and
David Howard and
Sreenatha G. Anavatti},
title = {Towards crossing the reality gap with evolved plastic neurocontrollers},
booktitle = {{GECCO}},
pages = {130--138},
publisher = {{ACM}},
year = {2020}
}
@inproceedings{DBLP:conf/icics/TangeHSPFD20,
author = {Koen Tange and
David Howard and
Travis Shanahan and
Stefano Pepe and
Xenofon Fafoutis and
Nicola Dragoni},
title = {rTLS: Lightweight {TLS} Session Resumption for Constrained IoT Devices},
booktitle = {{ICICS}},
series = {Lecture Notes in Computer Science},
volume = {12282},
pages = {243--258},
publisher = {Springer},
year = {2020}
}
@inproceedings{DBLP:conf/igarss/ChenISMTJST20,
author = {Yong Chen and
Flavio Iturbide{-}Sanchez and
Larrabee L. Strow and
Howard E. Motteler and
Dave Tobin and
David Johnson and
Lawrence Suwinski and
Denis Tremblay},
title = {Derivation of {JPSS-2} {CRIS} Pre-Launch Spectral Calibration Parameters
from the Thermal Vacuum Test Data},
booktitle = {{IGARSS}},
pages = {6043--6046},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/plans/DouglassMJCB20,
author = {Samuel Paul Douglass and
Scott M. Martin and
Andrew Jennings and
Howard Chen and
David M. Bevly},
title = {Deep Learned Multi-Modal Traffic Agent Predictions for Truck Platooning
Cut-Ins},
booktitle = {{PLANS}},
pages = {688--697},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/ssci/QiuGHA20,
author = {Huanneng Qiu and
Matthew Garratt and
David Howard and
Sreenatha G. Anavatti},
title = {Evolving Spiking Neurocontrollers for UAVs},
booktitle = {{SSCI}},
pages = {1928--1935},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/tei/ChenHZDSCWAO20,
author = {Christopher Chen and
David Howard and
Steven L. Zhang and
Youngwook Do and
Sienna Xin Sun and
Tingyu Cheng and
Zhong Lin Wang and
Gregory D. Abowd and
HyunJoo Oh},
title = {{SPIN} (Self-powered Paper Interfaces): Bridging Triboelectric Nanogenerator
with Folding Paper Creases},
booktitle = {{TEI}},
pages = {431--442},
publisher = {{ACM}},
year = {2020}
}
@article{DBLP:journals/corr/abs-2002-09854,
author = {Huanneng Qiu and
Matthew Garratt and
David Howard and
Sreenatha G. Anavatti},
title = {Crossing the Reality Gap with Evolved Plastic Neurocontrollers},
journal = {CoRR},
volume = {abs/2002.09854},
year = {2020}
}
@article{DBLP:journals/corr/abs-2003-01369,
author = {Jack Collins and
Ross Brown and
J{\"{u}}rgen Leitner and
David Howard},
title = {Traversing the Reality Gap via Simulator Tuning},
journal = {CoRR},
volume = {abs/2003.01369},
year = {2020}
}
@article{DBLP:journals/corr/abs-2003-13254,
author = {T{\o}nnes F. Nygaard and
Charles P. Martin and
David Howard and
Jim T{\o}rresen and
Kyrre Glette},
title = {Environmental Adaptation of Robot Morphology and Control through Real-world
Evolution},
journal = {CoRR},
volume = {abs/2003.13254},
year = {2020}
}
@article{DBLP:journals/corr/abs-2004-08057,
author = {David Howard and
Thomas Lowe and
Wade Geles},
title = {Diversity-based Design Assist for Large Legged Robots},
journal = {CoRR},
volume = {abs/2004.08057},
year = {2020}
}
@article{DBLP:journals/corr/abs-2005-09288,
author = {T{\o}nnes F. Nygaard and
David Howard and
Kyrre Glette},
title = {Real World Morphological Evolution is Feasible},
journal = {CoRR},
volume = {abs/2005.09288},
year = {2020}
}
@article{DBLP:journals/corr/abs-2006-03266,
author = {Shelvin Chand and
David Howard},
title = {Path Towards Multilevel Evolution of Robots},
journal = {CoRR},
volume = {abs/2006.03266},
year = {2020}
}
@article{DBLP:journals/corr/abs-2008-05994,
author = {Lars A. Bratholm and
Will Gerrard and
Brandon M. Anderson and
Shaojie Bai and
Sunghwan Choi and
Lam Dang and
Pavel Hanchar and
Addison Howard and
Guillaume Huard and
Sanghoon Kim and
J. Zico Kolter and
Risi Kondor and
Mordechai Kornbluth and
Youhan Lee and
Youngsoo Lee and
Jonathan P. Mailoa and
Thanh Tu Nguyen and
Milos Popovic and
Goran Rakocevic and
Walter Reade and
Wonho Song and
Luka Stojanovic and
Erik H. Thiede and
Nebojsa Tijanic and
Andres Torrubia and
Devin Willmott and
Craig P. Butts and
David R. Glowacki and
Kaggle participants},
title = {A community-powered search of machine learning strategy space to find
{NMR} property prediction models},
journal = {CoRR},
volume = {abs/2008.05994},
year = {2020}
}
@article{DBLP:journals/corr/abs-2008-07653,
author = {David B. Huberman and
Brian J. Reich and
Howard D. Bondell},
title = {Nonparametric Conditional Density Estimation In {A} Deep Learning
Framework For Short-Term Forecasting},
journal = {CoRR},
volume = {abs/2008.07653},
year = {2020}
}
@article{DBLP:journals/corr/abs-2010-11966,
author = {David Lowell and
Brian E. Howard and
Zachary C. Lipton and
Byron C. Wallace},
title = {Unsupervised Data Augmentation with Naive Augmentation and without
Unlabeled Data},
journal = {CoRR},
volume = {abs/2010.11966},
year = {2020}
}
@article{DBLP:journals/corr/abs-2011-11913,
author = {Ahmadreza Ahmadi and
T{\o}nnes F. Nygaard and
Navinda Kottege and
David Howard and
Nicolas Hudson},
title = {Semi-supervised Gated Recurrent Neural Networks for Robotic Terrain
Classification},
journal = {CoRR},
volume = {abs/2011.11913},
year = {2020}
}
@article{DBLP:journals/ejc/AharoniBCHS19,
author = {Ron Aharoni and
Eli Berger and
Maria Chudnovsky and
David M. Howard and
Paul D. Seymour},
title = {Large rainbow matchings in general graphs},
journal = {Eur. J. Comb.},
volume = {79},
pages = {222--227},
year = {2019}
}
@article{DBLP:journals/ejc/DuffusHL19,
author = {Dwight Duffus and
David M. Howard and
Imre Leader},
title = {The width of downsets},
journal = {Eur. J. Comb.},
volume = {79},
pages = {46--59},
year = {2019}
}
@article{DBLP:journals/esticas/AlyamkinABBCCCF19,
author = {Sergei Alyamkin and
Matthew Ardi and
Alexander C. Berg and
Achille Brighton and
Bo Chen and
Yiran Chen and
Hsin{-}Pai Cheng and
Zichen Fan and
Chen Feng and
Bo Fu and
Kent Gauen and
Abhinav Goel and
Alexander Goncharenko and
Xuyang Guo and
Soonhoi Ha and
Andrew Howard and
Xiao Hu and
Yuanjun Huang and
Donghyun Kang and
Jaeyoun Kim and
Jong{-}gook Ko and
Alexander Kondratyev and
Junhyeok Lee and
Seungjae Lee and
Suwoong Lee and
Zichao Li and
Zhiyu Liang and
Juzheng Liu and
Xin Liu and
Yang Lu and
Yung{-}Hsiang Lu and
Deeptanshu Malik and
Hong Hanh Nguyen and
Eunbyung Park and
Denis Repin and
Liang Shen and
Tao Sheng and
Fei Sun and
David Svitov and
George K. Thiruvathukal and
Baiwu Zhang and
Jingchi Zhang and
Xiaopeng Zhang and
Shaojie Zhuo},
title = {Low-Power Computer Vision: Status, Challenges, and Opportunities},
journal = {{IEEE} J. Emerg. Sel. Topics Circuits Syst.},
volume = {9},
number = {2},
pages = {411--421},
year = {2019}
}
@article{DBLP:journals/evi/HowardE19,
author = {Gerard David Howard and
Alberto Elfes},
title = {A staged approach to evolving real-world {UAV} controllers},
journal = {Evol. Intell.},
volume = {12},
number = {3},
pages = {491--502},
year = {2019}
}
@article{DBLP:journals/jct/HowardSTWW19,
author = {David M. Howard and
Noah Streib and
William T. Trotter and
Bartosz Walczak and
Ruidong Wang},
title = {Dimension of posets with planar cover graphs excluding two long incomparable
chains},
journal = {J. Comb. Theory {A}},
volume = {164},
pages = {1--23},
year = {2019}
}
@article{DBLP:journals/jitm/ChallenerVHPJ19,
author = {David C. Challener and
Maria E. Vachino and
James P. Howard II and
Christina K. Pikas and
Anil John},
title = {Blockchain Basics and Suitability: {A} Primer for Program Managers},
journal = {J. Inf. Technol. Manag.},
volume = {30},
number = {3},
pages = {33--44},
year = {2019}
}
@article{DBLP:journals/jpdc/RegierFPNRLHGSM19,
author = {Jeffrey Regier and
Keno Fischer and
Kiran Pamnany and
Andreas Noack and
Jarrett Revels and
Maximilian Lam and
Steve Howard and
Ryan Giordano and
David Schlegel and
Jon McAuliffe and
Rollin C. Thomas and
Prabhat},
title = {Cataloging the visible universe through Bayesian inference in Julia
at petascale},
journal = {J. Parallel Distributed Comput.},
volume = {127},
pages = {89--104},
year = {2019}
}
@article{DBLP:journals/micro/KarandikarMKBAL19,
author = {Sagar Karandikar and
Howard Mao and
Donggyu Kim and
David Biancolin and
Alon Amid and
Dayeol Lee and
Nathan Pemberton and
Emmanuel Amaro and
Colin Schmidt and
Aditya Chopra and
Qijing Huang and
Kyle Kovacs and
Borivoje Nikolic and
Randy Howard Katz and
Jonathan Bachrach and
Krste Asanovic},
title = {FireSim: FPGA-Accelerated Cycle-Exact Scale-Out System Simulation
in the Public Cloud},
journal = {{IEEE} Micro},
volume = {39},
number = {3},
pages = {56--65},
year = {2019}
}
@article{DBLP:journals/natmi/HowardEKMVW19,
author = {David Howard and
{\'{A}}goston E. Eiben and
Danielle Frances Kennedy and
Jean{-}Baptiste Mouret and
Philip Valencia and
David A. Winkler},
title = {Evolving embodied intelligence from materials to machines},
journal = {Nat. Mach. Intell.},
volume = {1},
number = {1},
pages = {12--19},
year = {2019}
}
@article{DBLP:journals/nature/HarrisMHWCBBCCC19,
author = {Julie A. Harris and
Stefan Mihalas and
Karla E. Hirokawa and
Jennifer D. Whitesell and
Hannah Choi and
Amy Bernard and
Phillip Bohn and
Shiella Caldejon and
Linzy Casal and
Andrew Cho and
Aaron Feiner and
David Feng and
Nathalie Gaudreault and
Charles R. Gerfen and
Nile Graddis and
Peter A. Groblewski and
Alex M. Henry and
Anh Ho and
Robert Howard and
Joseph E. Knox and
Leonard Kuan and
Xiuli Kuang and
J{\'{e}}r{\^{o}}me A. Lecoq and
Phil Lesnar and
Yaoyao Li and
Jennifer Luviano and
Stephen McConoughey and
Marty T. Mortrud and
Maitham Naeemi and
Lydia Ng and
Seung{-}Wook Oh and
Benjamin Ouellette and
Elise Shen and
Staci A. Sorensen and
Wayne Wakeman and
Quanxin Wang and
Yun Wang and
Ali Williford and
John W. Phillips and
Allan R. Jones and
Christof Koch and
Hongkui Zeng},
title = {Hierarchical organization of cortical and thalamic connectivity},
journal = {Nat.},
volume = {575},
number = {7781},
pages = {195--202},
year = {2019}
}
@article{DBLP:journals/nature/HoogenGRFTWGAAA19,
author = {Johan van den Hoogen and
Stefan Geisen and
Devin Routh and
Howard Ferris and
Walter Traunspurger and
David A. Wardle and
Ron G. M. de Goede and
Byron J. Adams and
Wasim Ahmad and
Walter S. Andriuzzi and
Richard D. Bardgett and
Michael Bonkowski and
Raquel Campos{-}Herrera and
Juvenil E. Cares and
Tancredi Caruso and
Larissa de Brito Caixeta and
Xiaoyun Chen and
Sofia R. Costa and
Rachel Creamer and
Jos{\'{e}} Mauro da Cunha Castro and
Marie Dam and
Djibril Djigal and
Miguel Escuer and
Bryan S. Griffiths and
Carmen Guti{\'{e}}rrez and
Karin Hohberg and
Daria Kalinkina and
Paul Kardol and
Alan Kergunteuil and
Gerard Korthals and
Valentyna Krashevska and
Alexey A. Kudrin and
Qi Li and
Wenju Liang and
Matthew Magilton and
Mariette Marais and
Jos{\'{e}} Antonio Rodr{\'{\i}}guez Mart{\'{\i}}n and
Elizaveta Matveeva and
El Hassan Mayad and
Christian Mulder and
Peter Mullin and
Roy Neilson and
T. A. Duong Nguyen and
Uffe N. Nielsen and
Hiroaki Okada and
Juan Emilio Palomares Rius and
Kaiwen Pan and
Vlada Peneva and
Lo{\"{\i}}c Pellissier and
Julio Carlos Pereira da Silva and
Camille Pitteloud and
Thomas O. Powers and
Kirsten Powers and
Casper W. Quist and
Sergio Rasmann and
Sara S{\'{a}}nchez Moreno and
Stefan Scheu and
Heikki Set{\"{a}}l{\"{a}} and
Anna Sushchuk and
Alexei V. Tiunov and
Jean Trap and
Wim H. van der Putten and
Mette Vesterg{\aa}rd and
Cecile Villenave and
Lieven Waeyenberge and
Diana H. Wall and
Rutger Wilschut and
Daniel G. Wright and
Jiue{-}in Yang and
Thomas Ward Crowther},
title = {Soil nematode abundance and functional group composition at a global
scale},
journal = {Nat.},
volume = {572},
number = {7768},
pages = {194--198},
year = {2019}
}
@article{DBLP:journals/npjdm/ChitnisGGHSSDPT19,
author = {Tanuja Chitnis and
Bonnie I. Glanz and
Cindy Gonzalez and
Brian C. Healy and
Taylor J. Saraceno and
Neda Sattarnezhad and
Camilo Diaz{-}Cruz and
Mariann Polgar{-}Turcsanyi and
Subhash Tummala and
Rohit Bakshi and
Vikram Bajaj and
David Ben Shimol and
Nikhil Bikhchandani and
Alexander W. Blocker and
Joshua Burkart and
Raphael Cendrillon and
Michael P. Cusack and
Emre Demiralp and
Sarel Kobus Jooste and
Alaa Kharbouch and
Amy A. Lee and
Joseph Lehar and
Manway Liu and
Swaminathan Mahadevan and
Mark Murphy and
Linda C. Norton and
Tushar Anil Parlikar and
Anupam Pathak and
Ali Shoeb and
Erin Soderberg and
Philip Stephens and
Aaron H. Stoertz and
Florence Thng and
Kashyap R. Tumkur and
Hongsheng Wang and
Jane Rhodes and
Richard A. Rudick and
Richard M. Ransohoff and
Glenn A. Phillips and
Effie Bruzik and
William J. Marks and
Howard L. Weiner and
Thomas M. Snyder},
title = {Quantifying neurologic disease using biosensor measurements in-clinic
and in free-living settings in multiple sclerosis},
journal = {npj Digit. Medicine},
volume = {2},
year = {2019}
}
@inproceedings{DBLP:conf/cec/CollinsCH19,
author = {Jack Collins and
Ben Cottier and
David Howard},
title = {Comparing Direct and Indirect Representations for Environment-Specific
Robot Component Design},
booktitle = {{CEC}},
pages = {2705--2712},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/hci/JuhlinMSSSOYMAA19,
author = {David Juhlin and
Chris Morris and
Peter Schmaltz and
Howard Shane and
Ralf Schlosser and
Amanda O'Brien and
Christina Yu and
Drew Mancini and
Anna Allen and
Jennifer Abramson},
title = {The {PTC} and Boston Children's Hospital Collaborative {AR} Experience
for Children with Autism Spectrum Disorder},
booktitle = {{HCI} {(8)}},
series = {Lecture Notes in Computer Science},
volume = {11573},
pages = {116--122},
publisher = {Springer},
year = {2019}
}
@inproceedings{DBLP:conf/hpca/WuBNHKLLMSAPJ19,
author = {Lisa Wu and
David Bruns{-}Smith and
Frank A. Nothaft and
Qijing Huang and
Sagar Karandikar and
Johnny Le and
Andrew Lin and
Howard Mao and
Brendan Sweeney and
Krste Asanovic and
David A. Patterson and
Anthony D. Joseph},
title = {{FPGA} Accelerated {INDEL} Realignment in the Cloud},
booktitle = {{HPCA}},
pages = {277--290},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/icmla/DelaneyHN19,
author = {Gary W. Delaney and
David Howard and
Krystal De Napoli},
title = {Utilising Evolutionary Algorithms to Design Granular Materials for
Industrial Applications},
booktitle = {{ICMLA}},
pages = {1897--1902},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/icra/CollinsHL19,
author = {Jack Collins and
David Howard and
J{\"{u}}rgen Leitner},
title = {Quantifying the Reality Gap in Robotic Manipulation Tasks},
booktitle = {{ICRA}},
pages = {6706--6712},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/iscas/KayyilRYAY19,
author = {Ajmal Vadakkan Kayyil and
Pavan Kumar Ramakrishna and
OnnLim Yong and
David J. Allstot and
Howard C. Yang},
title = {A Two-Stage {CMOS} {OTA} with Load-Pole Cancellation},
booktitle = {{ISCAS}},
pages = {1--5},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/sc/KarlinPSWSBBCCC19,
author = {Ian Karlin and
Yoonho Park and
Bronis R. de Supinski and
Peng Wang and
Bert Still and
David Beckingsale and
Robert Blake and
Tong Chen and
Guojing Cong and
Carlos H. A. Costa and
Johann Dahm and
Giacomo Domeniconi and
Thomas Epperly and
Aaron Fisher and
Sara Kokkila Schumacher and
Steven H. Langer and
Hai Le and
Eun Kyung Lee and
Naoya Maruyama and
Xinyu Que and
David F. Richards and
Bj{\"{o}}rn Sj{\"{o}}green and
Jonathan Wong and
Carol S. Woodward and
Ulrike Meier Yang and
Xiaohua Zhang and
Bob Anderson and
David Appelhans and
Levi Barnes and
Peter D. Barnes Jr. and
Sorin Bastea and
David B{\"{o}}hme and
Jamie A. Bramwell and
James M. Brase and
Jos{\'{e}} R. Brunheroto and
Barry Chen and
Charway R. Cooper and
Tony Degroot and
Robert D. Falgout and
Todd Gamblin and
David J. Gardner and
James N. Glosli and
John A. Gunnels and
Max P. Katz and
Tzanio V. Kolev and
I{-}Feng W. Kuo and
Matthew P. LeGendre and
Ruipeng Li and
Pei{-}Hung Lin and
Shelby Lockhart and
Kathleen McCandless and
Claudia Misale and
Jaime H. Moreno and
Rob Neely and
Jarom Nelson and
Rao Nimmakayala and
Kathryn M. O'Brien and
Kevin O'Brien and
Ramesh Pankajakshan and
Roger Pearce and
Slaven Peles and
Phil Regier and
Steven C. Rennich and
Martin Schulz and
Howard Scott and
James C. Sexton and
Kathleen Shoga and
Shiv Sundram and
Guillaume Thomas{-}Collignon and
Brian Van Essen and
Alexey Voronin and
Bob Walkup and
Lu Wang and
Chris Ward and
Hui{-}Fang Wen and
Daniel A. White and
Christopher Young and
Cyril Zeller and
Edward Zywicz},
title = {Preparation and optimization of a diverse workload for a large-scale
heterogeneous system},
booktitle = {{SC}},
pages = {32:1--32:17},
publisher = {{ACM}},
year = {2019}
}
@incollection{DBLP:books/sp/19/HowardBCGA19,
author = {Gerard David Howard and
Larry Bull and
Ben de Lacy Costello and
Ella Gale and
Andrew Adamatzky},
title = {Evolving Memristive Neural Networks},
booktitle = {Handbook of Memristor Networks},
pages = {661--690},
publisher = {Springer},
year = {2019}
}
@article{DBLP:journals/corr/abs-1901-05704,
author = {David Howard and
{\'{A}}goston E. Eiben and
Danielle Frances Kennedy and
Jean{-}Baptiste Mouret and
Philip Valencia and
David A. Winkler},
title = {Evolving embodied intelligence from materials to machines},
journal = {CoRR},
volume = {abs/1901.05704},
year = {2019}
}
@article{DBLP:journals/corr/abs-1901-06775,
author = {Jack Collins and
Ben Cottier and
David Howard},
title = {Comparing Direct and Indirect Representations for Environment-Specific
Robot Component Design},
journal = {CoRR},
volume = {abs/1901.06775},
year = {2019}
}
@article{DBLP:journals/corr/abs-1903-01180,
author = {Huanneng Qiu and
Matthew Garratt and
David Howard and
Sreenatha G. Anavatti},
title = {Evolving Spiking Neural Networks for Nonlinear Control Problems},
journal = {CoRR},
volume = {abs/1903.01180},
year = {2019}
}
@article{DBLP:journals/corr/abs-1904-07714,
author = {Sergei Alyamkin and
Matthew Ardi and
Alexander C. Berg and
Achille Brighton and
Bo Chen and
Yiran Chen and
Hsin{-}Pai Cheng and
Zichen Fan and
Chen Feng and
Bo Fu and
Kent Gauen and
Abhinav Goel and
Alexander Goncharenko and
Xuyang Guo and
Soonhoi Ha and
Andrew Howard and
Xiao Hu and
Yuanjun Huang and
Donghyun Kang and
Jaeyoun Kim and
Jong{-}gook Ko and
Alexander Kondratyev and
Junhyeok Lee and
Seungjae Lee and
Suwoong Lee and
Zichao Li and
Zhiyu Liang and
Juzheng Liu and
Xin Liu and
Yang Lu and
Yung{-}Hsiang Lu and
Deeptanshu Malik and
Hong Hanh Nguyen and
Eunbyung Park and
Denis Repin and
Liang Shen and
Tao Sheng and
Fei Sun and
David Svitov and
George K. Thiruvathukal and
Baiwu Zhang and
Jingchi Zhang and
Xiaopeng Zhang and
Shaojie Zhuo},
title = {Low-Power Computer Vision: Status, Challenges, Opportunities},
journal = {CoRR},
volume = {abs/1904.07714},
year = {2019}
}
@article{DBLP:journals/corr/abs-1905-10762,
author = {Gerard David Howard and
Alberto Elfes},
title = {A Staged Approach to Evolving Real-world {UAV} Controllers},
journal = {CoRR},
volume = {abs/1905.10762},
year = {2019}
}
@article{DBLP:journals/corr/abs-1910-07960,
author = {Llewyn Salt and
David Howard and
Giacomo Indiveri and
Yulia Sandamirskaya},
title = {Parameter Optimization and Learning in a Spiking Neural Network for
{UAV} Obstacle Avoidance targeting Neuromorphic Processors},
journal = {CoRR},
volume = {abs/1910.07960},
year = {2019}
}
@article{DBLP:journals/corr/abs-1911-01557,
author = {Jack Collins and
Jessie McVicar and
David Wedlock and
Ross Brown and
David Howard and
J{\"{u}}rgen Leitner},
title = {Benchmarking Simulated Robotic Manipulation through a Real World Dataset},
journal = {CoRR},
volume = {abs/1911.01557},
year = {2019}
}
@article{DBLP:journals/aim/0001BBCFGGGJKKK18,
author = {Bruno Bouchard and
Kevin Bouchard and
Noam Brown and
Niyati Chhaya and
Eitan Farchi and
S{\'{e}}bastien Gaboury and
Christopher W. Geib and
Amelie Gyrard and
Kokil Jaidka and
Sarah Keren and
Roni Khardon and
Parisa Kordjamshidi and
David R. Martinez and
Nicholas Mattei and
Martin Michalowski and
Reuth Mirsky and
Joseph C. Osborn and
Cem Sahin and
Onn Shehory and
Arash Shaban{-}Nejad and
Amit P. Sheth and
Ilan Shimshoni and
Howard E. Shrobe and
Arunesh Sinha and
Atanu R. Sinha and
Biplav Srivastava and
William W. Streilein and
Georgios Theocharous and
Kristen Brent Venable and
Neal Wagner and
Anna Zamansky},
title = {Reports of the Workshops of the 32nd {AAAI} Conference on Artificial
Intelligence},
journal = {{AI} Mag.},
volume = {39},
number = {4},
pages = {45--56},
year = {2018}
}
@article{DBLP:journals/eis/CorkindaleRC18,
author = {David Corkindale and
Jiwat Ram and
Howard Chen},
title = {The adoption of Firm-Hosted Online Communities: an empirical investigation
into the role of service quality and social interactions},
journal = {Enterp. Inf. Syst.},
volume = {12},
number = {2},
pages = {173--195},
year = {2018}
}
@article{DBLP:journals/fini/MohaddesDASBCHT18,
author = {Zia Mohaddes and
Samir Das and
Rida Abou{-}Haidar and
Mouna Safi{-}Harb and
David Blader and
Jessica Callegaro and
Charlie Henri{-}Bellemare and
Jingla{-}Fri Tunteng and
Leigh Evans and
Tara Campbell and
Derek Lo and
Pierre{-}Emmanuel Morin and
Victor Whitehead and
Howard Chertkow and
Alan C. Evans},
title = {National Neuroinformatics Framework for Canadian Consortium on Neurodegeneration
in Aging {(CCNA)}},
journal = {Frontiers Neuroinformatics},
volume = {12},
pages = {85},
year = {2018}
}
@article{DBLP:journals/siamsc/ElmanS18,
author = {Howard C. Elman and
David J. Silvester},
title = {Collocation Methods for Exploring Perturbations in Linear Stability
Analysis},
journal = {{SIAM} J. Sci. Comput.},
volume = {40},
number = {4},
pages = {A2667--A2693},
year = {2018}
}
@article{DBLP:journals/tosn/AndersenKCFCK18,
author = {Michael P. Andersen and
John Kolb and
Kaifei Chen and
Gabe Fierro and
David E. Culler and
Randy H. Katz},
title = {Democratizing Authority in the Built Environment},
journal = {{ACM} Trans. Sens. Networks},
volume = {14},
number = {3-4},
pages = {17:1--17:26},
year = {2018}
}
@inproceedings{DBLP:conf/amia/BellBLBWMLHKLSH18,
author = {Douglas S. Bell and
Kevin M. Baldwin and
Christoph U. Lehmann and
Elijah J. Bell and
Emily C. Webber and
Vishnu Mohan and
Michael G. Leu and
Jeffrey Hoffman and
David C. Kaelber and
Adam B. Landman and
Howard D. Silverman and
Jonathan D. Hron and
Bruce P. Levy and
Anthony A. Luberti and
John T. Finnell and
Charles Safran and
Jonathan P. Palma and
Peter L. Elkin and
Bruce Forman and
Eric G. Poon and
James P. Killeen and
David E. Avrin and
Michael A. Pfeffer},
title = {Characteristics of the National Applicant Pool for Clinical Informatics
Fellowships {(2016-2017)}},
booktitle = {{AMIA}},
publisher = {{AMIA}},
year = {2018}
}
@inproceedings{DBLP:conf/gecco/CollinsGHM18,
author = {Jack Collins and
Wade Geles and
David Howard and
Fr{\'{e}}d{\'{e}}ric Maire},
title = {Towards the targeted environment-specific evolution of robot components},
booktitle = {{GECCO}},
pages = {61--68},
publisher = {{ACM}},
year = {2018}
}
@inproceedings{DBLP:conf/hpca/GongKLSDE18,
author = {Seong{-}Lyong Gong and
Jungrae Kim and
Sangkug Lym and
Michael B. Sullivan and
Howard David and
Mattan Erez},
title = {{DUO:} Exposing On-Chip Redundancy to Rank-Level {ECC} for High Reliability},
booktitle = {{HPCA}},
pages = {683--695},
publisher = {{IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/ipps/RegierPFNLRHGSM18,
author = {Jeffrey Regier and
Kiran Pamnany and
Keno Fischer and
Andreas Noack and
Maximilian Lam and
Jarrett Revels and
Steve Howard and
Ryan Giordano and
David Schlegel and
Jon McAuliffe and
Rollin C. Thomas and
Prabhat},
title = {Cataloging the Visible Universe Through Bayesian Inference at Petascale},
booktitle = {{IPDPS}},
pages = {44--53},
publisher = {{IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/isca/KarandikarMKBAL18,
author = {Sagar Karandikar and
Howard Mao and
Donggyu Kim and
David Biancolin and
Alon Amid and
Dayeol Lee and
Nathan Pemberton and
Emmanuel Amaro and
Colin Schmidt and
Aditya Chopra and
Qijing Huang and
Kyle Kovacs and
Borivoje Nikolic and
Randy H. Katz and
Jonathan Bachrach and
Krste Asanovic},
title = {FireSim: FPGA-Accelerated Cycle-Exact Scale-Out System Simulation
in the Public Cloud},
booktitle = {{ISCA}},
pages = {29--42},
publisher = {{IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/sensys/ChenLKCK18,
author = {Kaifei Chen and
Tong Li and
Hyung{-}Sin Kim and
David E. Culler and
Randy H. Katz},
title = {{MARVEL:} Enabling Mobile Augmented Reality with Low Energy and Low
Latency},
booktitle = {SenSys},
pages = {292--304},
publisher = {{ACM}},
year = {2018}
}
@inproceedings{DBLP:conf/ssci/QiuGHA18,
author = {Huanneng Qiu and
Matthew Garratt and
David Howard and
Sreenatha G. Anavatti},
title = {Evolving Spiking Neural Networks for Nonlinear Control Problems},
booktitle = {{SSCI}},
pages = {1367--1373},
publisher = {{IEEE}},
year = {2018}
}
@article{DBLP:journals/corr/abs-1801-10277,
author = {Jeffrey Regier and
Kiran Pamnany and
Keno Fischer and
Andreas Noack and
Maximilian Lam and
Jarrett Revels and
Steve Howard and
Ryan Giordano and
David Schlegel and
Jon McAuliffe and
Rollin C. Thomas and
Prabhat},
title = {Cataloging the Visible Universe through Bayesian Inference at Petascale},
journal = {CoRR},
volume = {abs/1801.10277},
year = {2018}
}
@article{DBLP:journals/corr/abs-1810-01732,
author = {Sergei Alyamkin and
Matthew Ardi and
Achille Brighton and
Alexander C. Berg and
Yiran Chen and
Hsin{-}Pai Cheng and
Bo Chen and
Zichen Fan and
Chen Feng and
Bo Fu and
Kent Gauen and
Jongkook Go and
Alexander Goncharenko and
Xuyang Guo and
Hong Hanh Nguyen and
Andrew Howard and
Yuanjun Huang and
Donghyun Kang and
Jaeyoun Kim and
Alexander Kondratyev and
Seungjae Lee and
Suwoong Lee and
Junhyeok Lee and
Zhiyu Liang and
Xin Liu and
Juzheng Liu and
Zichao Li and
Yang Lu and
Yung{-}Hsiang Lu and
Deeptanshu Malik and
Eunbyung Park and
Denis Repin and
Tao Sheng and
Liang Shen and
Fei Sun and
David Svitov and
George K. Thiruvathukal and
Baiwu Zhang and
Jingchi Zhang and
Xiaopeng Zhang and
Shaojie Zhuo},
title = {2018 Low-Power Image Recognition Challenge},
journal = {CoRR},
volume = {abs/1810.01732},
year = {2018}
}
@article{DBLP:journals/corr/abs-1810-04735,
author = {Jack Collins and
Wade Geles and
David Howard and
Fr{\'{e}}d{\'{e}}ric Maire},
title = {Towards the Targeted Environment-Specific Evolution of Robot Components},
journal = {CoRR},
volume = {abs/1810.04735},
year = {2018}
}
@article{DBLP:journals/corr/abs-1811-01484,
author = {Jack Collins and
David Howard and
J{\"{u}}rgen Leitner},
title = {Quantifying the Reality Gap in Robotic Manipulation Tasks},
journal = {CoRR},
volume = {abs/1811.01484},
year = {2018}
}
@article{DBLP:journals/cogcom/BergmannFGHH17,
author = {Jeroen H. M. Bergmann and
Joan Fei and
David A. Green and
Amir Hussain and
Newton Howard},
title = {A Bayesian Assessment of Real-World Behavior During Multitasking},
journal = {Cogn. Comput.},
volume = {9},
number = {6},
pages = {749--757},
year = {2017}
}
@article{DBLP:journals/cpc/AharoniH17,
author = {Ron Aharoni and
David M. Howard},
title = {A Rainbow r-Partite Version of the Erd{\H{o}}s-Ko-Rado Theorem},
journal = {Comb. Probab. Comput.},
volume = {26},
number = {3},
pages = {321--337},
year = {2017}
}
@article{DBLP:journals/envsoft/GongLPMFSMKK17,
author = {Min Gong and
Robert Lempert and
Andrew R. Parker and
Lauren A. Mayer and
Jordan Fischbach and
Matthew Sisco and
Zhimin Mao and
David H. Krantz and
Howard Kunreuther},
title = {Testing the scenario hypothesis: An experimental comparison of scenarios
and forecasts for decision support in a complex decision environment},
journal = {Environ. Model. Softw.},
volume = {91},
pages = {135--155},
year = {2017}
}
@article{DBLP:journals/ijsg/CoovertWBH17,
author = {Michael D. Coovert and
Jennifer Winner and
Winston Bennett and
David J. Howard},
title = {Serious Games are a Serious Tool for Team Research},
journal = {Int. J. Serious Games},
volume = {4},
number = {1},
year = {2017}
}
@article{DBLP:journals/imwut/ChenFKKJCK17,
author = {Kaifei Chen and
Jonathan F{\"{u}}rst and
John Kolb and
Hyung{-}Sin Kim and
Xin Jin and
David E. Culler and
Randy H. Katz},
title = {SnapLink: Fast and Accurate Vision-Based Appliance Control in Large
Commercial Buildings},
journal = {Proc. {ACM} Interact. Mob. Wearable Ubiquitous Technol.},
volume = {1},
number = {4},
pages = {129:1--129:27},
year = {2017}
}
@article{DBLP:journals/jbi/KukharevaSNMWSW17,
author = {Polina V. Kukhareva and
Catherine J. Staes and
Kevin Noonan and
Heather Mueller and
Phillip B. Warner and
David Shields and
Howard Weeks and
Kensaku Kawamoto},
title = {Single-reviewer electronic phenotyping validation in operational settings:
Comparison of strategies and recommendations},
journal = {J. Biomed. Informatics},
volume = {66},
pages = {1--10},
year = {2017}
}
@article{DBLP:journals/jct/AharoniH17,
author = {Ron Aharoni and
David M. Howard},
title = {Cross-intersecting pairs of hypergraphs},
journal = {J. Comb. Theory {A}},
volume = {148},
pages = {15--26},
year = {2017}
}
@article{DBLP:journals/siamsc/BuiEM17,
author = {Quan M. Bui and
Howard C. Elman and
J. David Moulton},
title = {Algebraic Multigrid Preconditioners for Multiphase Flow in Porous
Media},
journal = {{SIAM} J. Sci. Comput.},
volume = {39},
number = {5},
year = {2017}
}
@article{DBLP:journals/superfri/NoajeDLSLOCLTPK17,
author = {Gabriel Noaje and
Alan Davis and
Jonathan Low and
Lim Seng and
Tan Geok Lian and
Lukasz Orlowski and
Dominic Chien and
Sing{-}Wu Liou and
Tin Wee Tan and
Yves Poppe and
Kenneth Ban Hon Kim and
Andrew Howard and
David Southwell and
Jason Gunthorpe and
Marek T. Michalewicz},
title = {InfiniCortex - From Proof-of-concept to Production},
journal = {Supercomput. Front. Innov.},
volume = {4},
number = {2},
pages = {87--102},
year = {2017}
}
@article{DBLP:journals/tec/Howard17,
author = {David Howard},
title = {A Platform That Directly Evolves Multirotor Controllers},
journal = {{IEEE} Trans. Evol. Comput.},
volume = {21},
number = {6},
pages = {943--955},
year = {2017}
}
@inproceedings{DBLP:conf/egItaly/TanasiMGSK17,
author = {Davide Tanasi and
Filippo Luigi Maria Milotta and
Ilenia Gradante and
Filippo Stanco and
Howard Kaplan},
title = {A Digital Approach for the Study of Roman Signacula From Syracuse,
Sicily},
booktitle = {{STAG}},
pages = {63--69},
publisher = {Eurographics Association},
year = {2017}
}
@inproceedings{DBLP:conf/gecco/Howard17,
author = {Gerard David Howard},
title = {On self-adaptive rate restarts for evolutionary robotics with real
rotorcraft},
booktitle = {{GECCO}},
pages = {123--130},
publisher = {{ACM}},
year = {2017}
}
@inproceedings{DBLP:conf/icids/PackerHHPM17,
author = {Heather S. Packer and
Charlie Hargood and
Yvonne Margaret Howard and
Petros Papadopoulos and
David E. Millard},
title = {Developing a Writer's Toolkit for Interactive Locative Storytelling},
booktitle = {{ICIDS}},
series = {Lecture Notes in Computer Science},
volume = {10690},
pages = {63--74},
publisher = {Springer},
year = {2017}
}
@inproceedings{DBLP:conf/icra/HeijnenHK17,
author = {Huub Heijnen and
David Howard and
Navinda Kottege},
title = {A testbed that evolves hexapod controllers in hardware},
booktitle = {{ICRA}},
pages = {1065--1071},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/sensys/AndersenKCCK17,
author = {Michael P. Andersen and
John Kolb and
Kaifei Chen and
David E. Culler and
Randy H. Katz},
title = {Democratizing authority in the built environment},
booktitle = {BuildSys@SenSys},
pages = {23:1--23:10},
publisher = {{ACM}},
year = {2017}
}
@article{DBLP:journals/corr/Howard17,
author = {Gerard David Howard},
title = {On Self-Adaptive Mutation Restarts for Evolutionary Robotics with
Real Rotorcraft},
journal = {CoRR},
volume = {abs/1703.10754},
year = {2017}
}
@article{DBLP:journals/corr/SaltH17,
author = {Llewyn Salt and
David Howard and
Giacomo Indiveri and
Yulia Sandamirskaya},
title = {Differential Evolution and Bayesian Optimisation for Hyper-Parameter
Selection in Mixed-Signal Neuromorphic Circuits Applied to {UAV} Obstacle
Avoidance},
journal = {CoRR},
volume = {abs/1704.04853},
year = {2017}
}
@article{DBLP:journals/corr/abs-1712-05855,
author = {Ion Stoica and
Dawn Song and
Raluca Ada Popa and
David A. Patterson and
Michael W. Mahoney and
Randy H. Katz and
Anthony D. Joseph and
Michael I. Jordan and
Joseph M. Hellerstein and
Joseph E. Gonzalez and
Ken Goldberg and
Ali Ghodsi and
David E. Culler and
Pieter Abbeel},
title = {A Berkeley View of Systems Challenges for {AI}},
journal = {CoRR},
volume = {abs/1712.05855},
year = {2017}
}
@article{DBLP:journals/da/Bell16,
author = {David Bell},
title = {The Legacy of Howard Raiffa},
journal = {Decis. Anal.},
volume = {13},
number = {3},
pages = {219--220},
year = {2016}
}
@article{DBLP:journals/firai/LivingstonBLSSB16,
author = {Nicholas Livingston and
Anton Bernatskiy and
Kenneth R. Livingston and
Marc L. Smith and
Jodi Schwarz and
Josh C. Bongard and
David Wallach and
John H. Long Jr.},
title = {Modularity and Sparsity: Evolution of Neural Net Controllers in Physically
Embodied Robots},
journal = {Frontiers Robotics {AI}},
volume = {3},
pages = {75},
year = {2016}
}
@article{DBLP:journals/ijhpca/LagunaRGSSMP16,
author = {Ignacio Laguna and
David F. Richards and
Todd Gamblin and
Martin Schulz and
Bronis R. de Supinski and
Kathryn M. Mohror and
Howard Pritchard},
title = {Evaluating and extending user-level fault tolerance in {MPI} applications},
journal = {Int. J. High Perform. Comput. Appl.},
volume = {30},
number = {3},
pages = {305--319},
year = {2016}
}
@article{DBLP:journals/ited/KopcsoSG16,
author = {David P. Kopcso and
Howard Simon and
Annie Gao},
title = {Case Article - Idiopathic Pulmonary Fibrosis},
journal = {{INFORMS} Trans. Educ.},
volume = {16},
number = {3},
pages = {104--106},
year = {2016}
}
@article{DBLP:journals/ited/KopcsoSG16a,
author = {David P. Kopcso and
Howard Simon and
Annie Gao},
title = {Case - Idiopathic Pulmonary Fibrosis},
journal = {{INFORMS} Trans. Educ.},
volume = {16},
number = {3},
pages = {107--109},
year = {2016}
}
@article{DBLP:journals/jpdc/SalehiSMSCABRSL16,
author = {Mohsen Amini Salehi and
Jay Smith and
Anthony A. Maciejewski and
Howard Jay Siegel and
Edwin K. P. Chong and
Jonathan Apodaca and
Luis Diego Briceno and
Timothy Renner and
Vladimir Shestak and
Joshua Ladd and
Andrew M. Sutton and
David L. Janovy and
Sudha Govindasamy and
Amin Alqudah and
Rinku Dewri and
Puneet Prakash},
title = {Stochastic-based robust dynamic resource allocation for independent
tasks in a heterogeneous computing system},
journal = {J. Parallel Distributed Comput.},
volume = {97},
pages = {96--111},
year = {2016}
}
@article{DBLP:journals/jssc/MyersSGHPF16,
author = {James Myers and
Anand Savanth and
Rohan Gaddh and
David Howard and
Pranay Prabhat and
David Flynn},
title = {A Subthreshold {ARM} Cortex-M0+ Subsystem in 65 nm {CMOS} for {WSN}
Applications with 14 Power Domains, 10T SRAM, and Integrated Voltage
Regulator},
journal = {{IEEE} J. Solid State Circuits},
volume = {51},
number = {1},
pages = {31--44},
year = {2016}
}
@article{DBLP:journals/neuroimage/KeshavanPBZPSSA16,
author = {Anisha Keshavan and
Friedemann Paul and
Mona K. Beyer and
Alyssa H. Zhu and
Nico Papinutto and
Russell T. Shinohara and
William Stern and
Michael Amann and
Rohit Bakshi and
Antje Bischof and
Alessandro Carriero and
Manuel Comabella and
Jason C. Crane and
Sandra D'Alfonso and
Philippe Demaerel and
Benedicte Dubois and
Massimo Filippi and
Vinzenz Fleischer and
Bertrand Fontaine and
Laura Gaetano and
An Goris and
Christiane Graetz and
Adriane Gr{\"{o}}ger and
Sergiu Groppa and
David A. Hafler and
Hanne F. Harbo and
Bernhard Hemmer and
Kesshi Jordan and
Ludwig Kappos and
Gina Kirkish and
Sara Llufriu and
Stefano Magon and
Filippo Martinelli{-}Boneschi and
Jacob L. McCauley and
Xavier Montalban and
Mark M{\"{u}}hlau and
Daniel Pelletier and
Pradip M. Pattany and
Margaret A. Pericak{-}Vance and
Isabelle Cournu{-}Rebeix and
Maria Assunta Rocca and
Alex Rovira and
Regina Schlaeger and
Albert Saiz and
Till Sprenger and
Alessandro Stecco and
Bernard M. J. Uitdehaag and
Pablo Villoslada and
Mike P. Wattjes and
Howard L. Weiner and
Jens Wuerfel and
Claus Zimmer and
Frauke Zipp and
Stephen L. Hauser and
Jorge R. Oksenberg and
Roland G. Henry},
title = {Power estimation for non-standardized multisite studies},
journal = {NeuroImage},
volume = {134},
pages = {281--294},
year = {2016}
}
@article{DBLP:journals/npl/HowardBL16,
author = {Gerard David Howard and
Larry Bull and
Pier Luca Lanzi},
title = {A Cognitive Architecture Based on a Learning Classifier System with
Spiking Classifiers},
journal = {Neural Process. Lett.},
volume = {44},
number = {1},
pages = {125--147},
year = {2016}
}
@article{DBLP:journals/see/JohnsonE16,
author = {David R. Johnson and
Elaine Howard Ecklund},
title = {Ethical Ambiguity in Science},
journal = {Sci. Eng. Ethics},
volume = {22},
number = {4},
pages = {989--1005},
year = {2016}
}
@article{DBLP:journals/tjs/DauweJFPMBS16,
author = {Daniel Dauwe and
Eric Jonardi and
Ryan D. Friese and
Sudeep Pasricha and
Anthony A. Maciejewski and
David A. Bader and
Howard Jay Siegel},
title = {{HPC} node performance and energy modeling with the co-location of
applications},
journal = {J. Supercomput.},
volume = {72},
number = {12},
pages = {4771--4809},
year = {2016}
}
@inproceedings{DBLP:conf/acal/HowardK16,
author = {David Howard and
Farid Kendoul},
title = {Towards Evolved Time to Contact Neurocontrollers for Quadcopters},
booktitle = {{ACALCI}},
series = {Lecture Notes in Computer Science},
volume = {9592},
pages = {336--347},
publisher = {Springer},
year = {2016}
}
@inproceedings{DBLP:conf/amia/JrMSNSM16,
author = {David P. McCallie Jr. and
Joshua C. Mandel and
Howard R. Strasberg and
Scott P. Narus and
Kevin Shekleton and
Peregrin Marshall},
title = {Beyond {SMART:} Remote decision support with {CDS} Hooks},
booktitle = {{AMIA}},
publisher = {{AMIA}},
year = {2016}
}
@inproceedings{DBLP:conf/amia/KawamotoAABLMFS16,
author = {Kensaku Kawamoto and
Kevin J. Anstrom and
John B. Anderson and
Hayden B. Bosworth and
David F. Lobach and
Carrie McAdam{-}Marx and
Jeffrey M. Ferranti and
Howard Shang and
Kimberly S. Hawblitzel Yarnall},
title = {Long-Term Impact of an Electronic Health Record-Enabled, Team-Based,
and Scalable Population Health Strategy Based on the Chronic Care
Model},
booktitle = {{AMIA}},
publisher = {{AMIA}},
year = {2016}
}
@inproceedings{DBLP:conf/cd/MichalewiczLSLS16,
author = {Marek T. Michalewicz and
Tan Geok Lian and
Lim Seng and
Jonathan Low and
David Southwell and
Jason Gunthorpe and
Gabriel Noaje and
Dominic Chien and
Yves Poppe and
Jakub Chrzeszczyk and
Andrew Howard and
Tin Wee Tan and
Sing{-}Wu Liou},
title = {InfiniCortex: present and future invited paper},
booktitle = {Conf. Computing Frontiers},
pages = {267--273},
publisher = {{ACM}},
year = {2016}
}
@inproceedings{DBLP:conf/cikm/SchubotzVC16,
author = {Moritz Schubotz and
David Veenhuis and
Howard S. Cohl},
title = {Getting the units right},
booktitle = {FM4M/MathUI/ThEdu/DP/WIP@CIKM},
series = {{CEUR} Workshop Proceedings},
volume = {1785},
pages = {146--156},
publisher = {CEUR-WS.org},
year = {2016}
}
@inproceedings{DBLP:conf/cogsci/LivingstonBLSSB16,
author = {Nicholas Livingston and
Anton Bernatskiy and
Kenneth R. Livingston and
Marc L. Smith and
Jodi Schwarz and
Joshua Clifford Bongard and
David Wallach and
Evan Altiero and
John H. Long Jr.},
title = {Embodiment Effects in Evolutionary Robotics},
booktitle = {CogSci},
publisher = {cognitivesciencesociety.org},
year = {2016}
}
@inproceedings{DBLP:conf/icrc/BalynskyGCKKKDF16,
author = {Michael Balynsky and
David Gutierrez and
Howard Chiang and
Alexander Khitun and
Alexander Kozhevnikov and
Yuri Khivintsev and
Galina Dudko and
Yuri Filimonov},
title = {Parallel data processing with Magnonic Holographic Co-Processor},
booktitle = {{ICRC}},
pages = {1--4},
publisher = {{IEEE} Computer Society},
year = {2016}
}
@inproceedings{DBLP:conf/itsc/WuSKKCPHB16,
author = {Cathy Wu and
Kalyanaraman Shankari and
Ece Kamar and
Randy H. Katz and
David E. Culler and
Christos H. Papadimitriou and
Eric Horvitz and
Alexandre M. Bayen},
title = {Optimizing the diamond lane: {A} more tractable carpool problem and
algorithms},
booktitle = {{ITSC}},
pages = {1389--1396},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/ud/BevanPCCCSGA16,
author = {Mark Bevan and
Helen Petrie and
Howard Cambridge and
Steve Cinderby and
Karen Croucher and
David Swallow and
Rose Gilroy and
Katia Attuyer},
title = {Co-Motion: Mobility and Wellbeing in Later Life},
booktitle = {{UD}},
series = {Studies in Health Technology and Informatics},
volume = {229},
pages = {627--628},
publisher = {{IOS} Press},
year = {2016}
}
@article{DBLP:journals/corr/0002STWW16,
author = {David M. Howard and
Noah Streib and
William T. Trotter and
Bartosz Walczak and
Ruidong Wang},
title = {The dimension of posets with planar cover graphs excluding two long
incomparable chains},
journal = {CoRR},
volume = {abs/1608.08843},
year = {2016}
}
@article{DBLP:journals/corr/BuiEM16,
author = {Quan M. Bui and
Howard C. Elman and
J. David Moulton},
title = {Algebraic Multigrid Preconditioners for Multiphase Flow in Porous
Media},
journal = {CoRR},
volume = {abs/1611.00127},
year = {2016}
}
@article{DBLP:journals/corr/JohnsonBDD0HKRS16,
author = {David S. Johnson and
Lee Breslau and
Ilias Diakonikolas and
Nick G. Duffield and
Yu Gu and
MohammadTaghi Hajiaghayi and
Howard J. Karloff and
Mauricio G. C. Resende and
Subhabrata Sen},
title = {Near-Optimal Disjoint-Path Facility Location Through Set Cover by
Pairs},
journal = {CoRR},
volume = {abs/1611.01210},
year = {2016}
}
@article{DBLP:journals/bioinformatics/AimoLHNGGKDGRBX15,
author = {Lucila Aimo and
Robin Liechti and
Nevila Hyka{-}Nouspikel and
Anne Niknejad and
Anne Gleizes and
Lou G{\"{o}}tz and
Dmitry Kuznetsov and
Fabrice P. A. David and
F. Gisou van der Goot and
Howard Riezman and
Lydie Bougueleret and
Ioannis Xenarios and
Alan J. Bridge},
title = {The SwissLipids knowledgebase for lipid biology},
journal = {Bioinform.},
volume = {31},
number = {17},
pages = {2860--2866},
year = {2015}
}
@article{DBLP:journals/chb/CoovertHCN15,
author = {Sally A. Coovert and
David J. Howard and
Michael D. Coovert and
Robert M. Nelson},
title = {An evaluation of medical residents utilization of tablet computers},
journal = {Comput. Hum. Behav.},
volume = {53},
pages = {289--293},
year = {2015}
}
@article{DBLP:journals/cmmm/McGrathHB15,
author = {Michael McGrath and
David Howard and
Richard Baker},
title = {A Forward Dynamic Modelling Investigation of Cause-and-Effect Relationships
in Single Support Phase of Human Walking},
journal = {Comput. Math. Methods Medicine},
volume = {2015},
pages = {383705:1--383705:9},
year = {2015}
}
@article{DBLP:journals/combinatorics/AharoniHHS15,
author = {Ron Aharoni and
Ron Holzman and
David M. Howard and
Philipp Spr{\"{u}}ssel},
title = {Cooperative Colorings and Independent Systems of Representatives},
journal = {Electron. J. Comb.},
volume = {22},
number = {2},
pages = {2},
year = {2015}
}
@article{DBLP:journals/connection/HowardBC15,
author = {Gerard David Howard and
Larry Bull and
Ben de Lacy Costello},
title = {Evolving unipolar memristor spiking neural networks},
journal = {Connect. Sci.},
volume = {27},
number = {4},
pages = {397--416},
year = {2015}
}
@article{DBLP:journals/isem/AndersonGWZ15,
author = {David Anderson and
Bruce L. Golden and
Edward A. Wasil and
Hao Howard Zhang},
title = {Predicting prostate cancer risk using magnetic resonance imaging data},
journal = {Inf. Syst. {E} Bus. Manag.},
volume = {13},
number = {4},
pages = {599--608},
year = {2015}
}
@article{DBLP:journals/jfr/RadfordSHMVDHSN15,
author = {Nicolaus A. Radford and
Philip Strawser and
Kimberly A. Hambuchen and
Joshua S. Mehling and
William K. Verdeyen and
A. Stuart Donnan and
James Holley and
Jairo Sanchez and
Vienny Nguyen and
Lyndon B. Bridgwater and
Reginald Berka and
Robert O. Ambrose and
Mason Myles Markee and
N. J. Fraser{-}Chanpong and
Christopher McQuin and
John D. Yamokoski and
Stephen Hart and
Raymond Guo and
Adam Parsons and
Brian Wightman and
Paul Dinh and
Barrett Ames and
Charles Blakely and
Courtney Edmondson and
Brett Sommers and
Rochelle Rea and
Chad Tobler and
Heather Bibby and
Brice Howard and
Lei Niu and
Andrew Lee and
Michael Conover and
Lily Truong and
Ryan Reed and
David Chesney and
Robert Platt Jr. and
Gwendolyn Johnson and
Chien{-}Liang Fok and
Nicholas Paine and
Luis Sentis and
Eric A. Cousineau and
Ryan W. Sinnet and
Jordan Lack and
Matthew J. Powell and
Benjamin Morris and
Aaron D. Ames and
Jide Akinyode},
title = {Valkyrie: NASA's First Bipedal Humanoid Robot},
journal = {J. Field Robotics},
volume = {32},
number = {3},
pages = {397--419},
year = {2015}
}
@article{DBLP:journals/jgt/AharoniCH15,
author = {Ron Aharoni and
Pierre Charbit and
David M. Howard},
title = {On a Generalization of the Ryser-Brualdi-Stein Conjecture},
journal = {J. Graph Theory},
volume = {78},
number = {2},
pages = {143--156},
year = {2015}
}
@article{DBLP:journals/jpdc/Aartsen15,
author = {Mark G. Aartsen and
Rasha U. Abbasi and
Markus Ackermann and
Jenni Adams and
Juan Antonio Aguilar S{\'{a}}nchez and
Markus Ahlers and
David Altmann and
Carlos A. Arg{\"{u}}elles Delgado and
Jan Auffenberg and
Xinhua Bai and
Michael F. Baker and
Steven W. Barwick and
Volker Baum and
Ryan Bay and
James J. Beatty and
Julia K. Becker Tjus and
Karl{-}Heinz Becker and
Segev BenZvi and
Patrick Berghaus and
David Berley and
Elisa Bernardini and
Anna Bernhard and
David Z. Besson and
G. Binder and
Daniel Bindig and
Martin Bissok and
Erik Blaufuss and
Jan Blumenthal and
David J. Boersma and
Christian Bohm and
Debanjan Bose and
Sebastian B{\"{o}}ser and
Olga Botner and
Lionel Brayeur and
Hans{-}Peter Bretz and
Anthony M. Brown and
Ronald Bruijn and
James Casey and
Martin Casier and
Dmitry Chirkin and
Asen Christov and
Brian John Christy and
Ken Clark and
Lew Classen and
Fabian Clevermann and
Stefan Coenders and
Shirit Cohen and
Doug F. Cowen and
Angel H. Cruz Silva and
Matthias Danninger and
Jacob Daughhetee and
James C. Davis and
Melanie Day and
Catherine De Clercq and
Sam De Ridder and
Paolo Desiati and
Krijn D. de Vries and
Meike de With and
Tyce DeYoung and
Juan Carlos D{\'{\i}}az{-}V{\'{e}}lez and
Matthew Dunkman and
Ryan Eagan and
Benjamin Eberhardt and
Bj{\"{o}}rn Eichmann and
Jonathan Eisch and
Sebastian Euler and
Paul A. Evenson and
Oladipo O. Fadiran and
Ali R. Fazely and
Anatoli Fedynitch and
Jacob Feintzeig and
Tom Feusels and
Kirill Filimonov and
Chad Finley and
Tobias Fischer{-}Wasels and
Samuel Flis and
Anna Franckowiak and
Katharina Frantzen and
Tomasz Fuchs and
Thomas K. Gaisser and
Joseph S. Gallagher and
Lisa Marie Gerhardt and
Laura E. Gladstone and
Thorsten Gl{\"{u}}senkamp and
Azriel Goldschmidt and
Geraldina Golup and
Javier G. Gonz{\'{a}}lez and
Jordan A. Goodman and
Dariusz G{\'{o}}ra and
Dylan T. Grandmont and
Darren Grant and
Pavel Gretskov and
John C. Groh and
Andreas Gro{\ss} and
Chang Hyon Ha and
Abd Al Karim Haj Ismail and
Patrick Hallen and
Allan Hallgren and
Francis Halzen and
Kael D. Hanson and
Dustin Hebecker and
David Heereman and
Dirk Heinen and
Klaus Helbing and
Robert Eugene Hellauer III and
Stephanie Virginia Hickford and
Gary C. Hill and
Kara D. Hoffman and
Ruth Hoffmann and
Andreas Homeier and
Kotoyo Hoshina and
Feifei Huang and
Warren Huelsnitz and
Per Olof Hulth and
Klas Hultqvist and
Shahid Hussain and
Aya Ishihara and
Emanuel Jacobi and
John E. Jacobsen and
Kai Jagielski and
George S. Japaridze and
Kyle Jero and
Ola Jlelati and
Basho Kaminsky and
Alexander Kappes and
Timo Karg and
Albrecht Karle and
Matthew Kauer and
John Lawrence Kelley and
Joanna Kiryluk and
J. Kl{\"{a}}s and
Spencer R. Klein and
Jan{-}Hendrik K{\"{o}}hne and
Georges Kohnen and
Hermann Kolanoski and
Lutz K{\"{o}}pke and
Claudio Kopper and
Sandro Kopper and
D. Jason Koskinen and
Marek Kowalski and
Mark Krasberg and
Anna Kriesten and
Kai Michael Krings and
G{\"{o}}sta Kroll and
Jan Kunnen and
Naoko Kurahashi and
Takao Kuwabara and
Mathieu L. M. Labare and
Hagar Landsman and
Michael James Larson and
Mariola Lesiak{-}Bzdak and
Martin Leuermann and
Julia Leute and
Jan L{\"{u}}nemann and
Oscar A. Mac{\'{\i}}as{-}Ram{\'{\i}}rez and
James Madsen and
Giuliano Maggi and
Reina Maruyama and
Keiichi Mase and
Howard S. Matis and
Frank McNally and
Kevin James Meagher and
Martin Merck and
Gonzalo Merino Ar{\'{e}}valo and
Thomas Meures and
Sandra Miarecki and
Eike Middell and
Natalie Milke and
John Lester Miller and
Lars Mohrmann and
Teresa Montaruli and
Robert M. Morse and
Rolf Nahnhauer and
Uwe Naumann and
Hans Niederhausen and
Sarah C. Nowicki and
David R. Nygren and
Anna Obertacke and
Sirin Odrowski and
Alex Olivas and
Ahmad Omairat and
Aongus Starbuck {\'{O}} Murchadha and
Larissa Paul and
Joshua A. Pepper and
Carlos P{\'{e}}rez de los Heros and
Carl Pfendner and
Damian Pieloth and
Elisa Pinat and
Jonas Posselt and
P. Buford Price and
Gerald T. Przybylski and
Melissa Quinnan and
Leif R{\"{a}}del and
Ian Rae and
Mohamed Rameez and
Katherine Rawlins and
Peter Christian Redl and
Ren{\'{e}} Reimann and
Elisa Resconi and
Wolfgang Rhode and
Mathieu Ribordy and
Michael Richman and
Benedikt Riedel and
J. P. Rodrigues and
Carsten Rott and
Tim Ruhe and
Bakhtiyar Ruzybayev and
Dirk Ryckbosch and
Sabine M. Saba and
Heinz{-}Georg Sander and
Juan Marcos Santander and
Subir Sarkar and
Kai Schatto and
Florian Scheriau and
Torsten Schmidt and
Martin Schmitz and
Sebastian Schoenen and
Sebastian Sch{\"{o}}neberg and
Arne Sch{\"{o}}nwald and
Anne Schukraft and
Lukas Schulte and
David Schultz and
Olaf Schulz and
David Seckel and
Yolanda Sestayo de la Cerra and
Surujhdeo Seunarine and
Rezo Shanidze and
Chris Sheremata and
Miles W. E. Smith and
Dennis Soldin and
Glenn M. Spiczak and
Christian Spiering and
Michael Stamatikos and
Todor Stanev and
Nick A. Stanisha and
Alexander Stasik and
Thorsten Stezelberger and
Robert G. Stokstad and
Achim St{\"{o}}{\ss}l and
Erik A. Strahler and
Rickard Str{\"{o}}m and
Nora Linn Strotjohann and
Gregory W. Sullivan and
Henric Taavola and
Ignacio J. Taboada and
Alessio Tamburro and
Andreas Tepe and
Samvel Ter{-}Antonyan and
Gordana Tesic and
Serap Tilav and
Patrick A. Toale and
Moriah Natasha Tobin and
Simona Toscano and
Maria Tselengidou and
Elisabeth Unger and
Marcel Usner and
Sofia Vallecorsa and
Nick van Eijndhoven and
Arne Van Overloop and
Jakob van Santen and
Markus Vehring and
Markus Voge and
Matthias Vraeghe and
Christian Walck and
Tilo Waldenmaier and
Marius Wallraff and
Christopher N. Weaver and
Mark T. Wellons and
Christopher H. Wendt and
Stefan Westerhoff and
Nathan Whitehorn and
Klaus Wiebe and
Christopher Wiebusch and
Dawn R. Williams and
Henrike Wissing and
Martin Wolf and
Terri R. Wood and
Kurt Woschnagg and
Donglian Xu and
Xianwu Xu and
Juan Pablo Y{\'{a}}{\~{n}}ez Garza and
Gaurang B. Yodh and
Shigeru Yoshida and
Pavel Zarzhitsky and
Jan Ziemann and
Simon Zierke and
Marcel Zoll},
title = {The IceProd framework: Distributed data processing for the IceCube
neutrino observatory},
journal = {J. Parallel Distributed Comput.},
volume = {75},
pages = {198--211},
year = {2015}
}
@article{DBLP:journals/sigsoft/RegerBR15,
author = {Giles Reger and
Howard Barringer and
David E. Rydeheard},
title = {Automata-based Pattern Mining from Imperfect Traces},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {40},
number = {1},
pages = {1--8},
year = {2015}
}
@inproceedings{DBLP:conf/acal/HowardBC15,
author = {Gerard David Howard and
Larry Bull and
Ben de Lacy Costello},
title = {Evolving Unipolar Memristor Spiking Neural Networks},
booktitle = {{ACALCI}},
series = {Lecture Notes in Computer Science},
volume = {8955},
pages = {258--272},
publisher = {Springer},
year = {2015}
}
@inproceedings{DBLP:conf/biocas/CourellisPPCI15,
author = {Hristos S. Courellis and
David A. Peterson and
Howard Poizner and
Gert Cauwenberghs and
John R. Iversen},
title = {{EEG} based inference of causal cortical network dynamics in reward-based
decision making},
booktitle = {BioCAS},
pages = {1--4},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/birthday/HowardR15,
author = {Emily Howard and
David De Roure},
title = {Turning numbers into notes},
booktitle = {Ada Lovelace Symposium},
pages = {13},
publisher = {{ACM}},
year = {2015}
}
@inproceedings{DBLP:conf/chi/AndersonKJEHV15,
author = {Bonnie Brinton Anderson and
C. Brock Kirwan and
Jeffrey L. Jenkins and
David Eargle and
Seth Howard and
Anthony Vance},
title = {How Polymorphic Warnings Reduce Habituation in the Brain: Insights
from an fMRI Study},
booktitle = {{CHI}},
pages = {2883--2892},
publisher = {{ACM}},
year = {2015}
}
@inproceedings{DBLP:conf/cloud/ZatsIAAKSV15,
author = {David Zats and
Anand Padmanabha Iyer and
Ganesh Ananthanarayanan and
Rachit Agarwal and
Randy H. Katz and
Ion Stoica and
Amin Vahdat},
title = {FastLane: making short flows shorter with agile drop notification},
booktitle = {SoCC},
pages = {84--96},
publisher = {{ACM}},
year = {2015}
}
@inproceedings{DBLP:conf/cloudcom/FoxMRW15,
author = {Geoffrey C. Fox and
Siddharth Maini and
Howard Rosenbaum and
David J. Wild},
title = {Data Science and Online Education},
booktitle = {CloudCom},
pages = {582--587},
publisher = {{IEEE} Computer Society},
year = {2015}
}
@inproceedings{DBLP:conf/globecom/FulpGJMTZ15,
author = {Errin W. Fulp and
H. Donald Gage and
David J. John and
Matthew R. McNiece and
William H. Turkett Jr. and
Xin Zhou},
title = {An Evolutionary Strategy for Resilient Cyber Defense},
booktitle = {{GLOBECOM}},
pages = {1--6},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/hoti/GrunHSGRPS15,
author = {Paul Grun and
Sean Hefty and
Sayantan Sur and
David Goodell and
Robert D. Russell and
Howard Pritchard and
Jeffrey M. Squyres},
title = {A Brief Introduction to the OpenFabrics Interfaces - {A} New Network
{API} for Maximizing High Performance Application Efficiency},
booktitle = {Hot Interconnects},
pages = {34--39},
publisher = {{IEEE} Computer Society},
year = {2015}
}
@inproceedings{DBLP:conf/icad/HindeET015,
author = {Alistair F. Hinde and
Michael Evans and
Anthony I. Tew and
David M. Howard},
title = {Onset asynchrony in spoken menus},
booktitle = {{ICAD}},
pages = {86--93},
publisher = {Institute of Electronic Music and Acoustics (IEM), University of Music
and Performing Arts Graz (KUG), Austria},
year = {2015}
}
@inproceedings{DBLP:conf/ipps/DauweJFPMBS15,
author = {Daniel Dauwe and
Eric Jonardi and
Ryan D. Friese and
Sudeep Pasricha and
Anthony A. Maciejewski and
David A. Bader and
Howard Jay Siegel},
title = {A Methodology for Co-Location Aware Application Performance Modeling
in Multicore Computing},
booktitle = {{IPDPS} Workshops},
pages = {434--443},
publisher = {{IEEE} Computer Society},
year = {2015}
}
@inproceedings{DBLP:conf/iros/HowardM15,
author = {David Howard and
Torsten Merz},
title = {A platform for the direct hardware evolution of quadcopter controllers},
booktitle = {{IROS}},
pages = {4614--4619},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/isscc/MyersSHGPF15,
author = {James Myers and
Anand Savanth and
David Howard and
Rohan Gaddh and
Pranay Prabhat and
David Flynn},
title = {8.1 An 80nW retention 11.7pJ/cycle active subthreshold {ARM} Cortex-M0+
subsystem in 65nm {CMOS} for {WSN} applications},
booktitle = {{ISSCC}},
pages = {1--3},
publisher = {{IEEE}},
year = {2015}
}
@inproceedings{DBLP:conf/mobisys/ChenHCKKC15,
author = {Kaifei Chen and
Siyuan He and
Bei Di Chen and
John Kolb and
Randy H. Katz and
David E. Culler},
title = {BearLoc: {A} Composable Distributed Framework for Indoor Localization
Systems},
booktitle = {IoT-Sys@MobiSys},
pages = {7--12},
publisher = {{ACM}},
year = {2015}
}
@inproceedings{DBLP:conf/percom/ShankariYCK15,
author = {Kalyanaraman Shankari and
Mogeng Yin and
David E. Culler and
Randy H. Katz},
title = {E-mission: Automated transportation emission calculation using smartphones},
booktitle = {PerCom Workshops},
pages = {268--271},
publisher = {{IEEE} Computer Society},
year = {2015}
}
@article{DBLP:journals/corr/GlynnTBH15,
author = {Chris Glynn and
Surya T. Tokdar and
David L. Banks and
Brian Howard},
title = {Bayesian Analysis of Dynamic Linear Topic Models},
journal = {CoRR},
volume = {abs/1511.03947},
year = {2015}
}
@article{DBLP:journals/corr/HowardBC15,
author = {Gerard David Howard and
Larry Bull and
Ben de Lacy Costello},
title = {Evolving Unipolar Memristor Spiking Neural Networks},
journal = {CoRR},
volume = {abs/1509.00105},
year = {2015}
}
@article{DBLP:journals/corr/HowardBCAG15,
author = {Gerard David Howard and
Larry Bull and
Ben de Lacy Costello and
Andrew Adamatzky and
Ella Gale},
title = {Evolving Spiking Networks with Variable Resistive Memories},
journal = {CoRR},
volume = {abs/1505.04357},
year = {2015}
}
@article{DBLP:journals/corr/HowardBL15,
author = {Gerard David Howard and
Larry Bull and
Pier Luca Lanzi},
title = {A Cognitive Architecture Based on a Learning Classifier System with
Spiking Classifiers},
journal = {CoRR},
volume = {abs/1508.07700},
year = {2015}
}
@article{DBLP:journals/corr/PattenBJI15,
author = {Daniel R. Patten and
Howard A. Blair and
David W. Jakel and
Robert J. Irwin},
title = {Differential Calculus on Cayley Graphs},
journal = {CoRR},
volume = {abs/1504.08013},
year = {2015}
}
@phdthesis{DBLP:phd/basesearch/Millis14,
author = {David Howard Millis},
title = {Multiple Kernel Learning for Gene Prioritization, Clustering, and
Functional Enrichment Analysis},
school = {George Mason University, Fairfax, Virginia, {USA}},
year = {2014}
}
@article{DBLP:journals/dsj/ChuangLPH14,
author = {Howard Hao{-}Chun Chuang and
Guanyi Lu and
David Xiaosong Peng and
Gregory R. Heim},
title = {Impact of Value-Added Service Features in e-Retailing Processes: An
Econometric Analysis of Web Site Functions},
journal = {Decis. Sci.},
volume = {45},
number = {6},
pages = {1159--1186},
year = {2014}
}
@article{DBLP:journals/ec/HowardBCGA14,
author = {Gerard David Howard and
Larry Bull and
Ben de Lacy Costello and
Ella Gale and
Andrew Adamatzky},
title = {Evolving Spiking Networks with Variable Resistive Memories},
journal = {Evol. Comput.},
volume = {22},
number = {1},
pages = {79--103},
year = {2014}
}
@article{DBLP:journals/ecoi/WarrenAOISJ14,
author = {Steven D. Warren and
Martin Helmut Alt and
Keith D. Olson and
Severin David Howard Irl and
Manuel J. Steinbauer and
Anke Jentsch},
title = {The relationship between the spectral diversity of satellite imagery,
habitat heterogeneity, and plant species richness},
journal = {Ecol. Informatics},
volume = {24},
pages = {160--168},
year = {2014}
}
@article{DBLP:journals/jssc/WarnockCHCSMPZJSDGBMCMRSSSWMSPW14,
author = {James D. Warnock and
Yuen H. Chan and
Hubert Harrer and
Sean M. Carey and
Gerard Salem and
Doug Malone and
Ruchir Puri and
Jeffrey A. Zitz and
Adam Jatkowski and
Gerald Strevig and
Ayan Datta and
Anne Gattiker and
Aditya Bansal and
Guenter Mayer and
Yiu{-}Hing Chan and
Mark D. Mayo and
David L. Rude and
Leon J. Sigal and
Thomas Strach and
Howard H. Smith and
Huajun Wen and
Pak{-}kin Mak and
Chung{-}Lung Kevin Shum and
Donald W. Plass and
Charles F. Webb},
title = {Circuit and Physical Design of the zEnterprise{\texttrademark} {EC12}
Microprocessor Chips and Multi-Chip Module},
journal = {{IEEE} J. Solid State Circuits},
volume = {49},
number = {1},
pages = {9--18},
year = {2014}
}
@article{DBLP:journals/ress/HansenBBBCGHHHJLLMMMPRSSSW14,
author = {Clifford W. Hansen and
Jens T. Birkholzer and
J. Blink and
C. R. Bryan and
Y. Chen and
M. B. Gross and
E. Hardin and
James E. Houseworth and
Robert L. Howard and
R. Jarek and
K. P. Lee and
B. Lester and
P. Mariner and
P. D. Mattie and
S. Mehta and
F. V. Perry and
Bruce A. Robinson and
D. Sassani and
S. David Sevougian and
Joshua S. Stein and
M. Wasiolek},
title = {Overview of total system model used for the 2008 performance assessment
for the proposed high-level radioactive waste repository at Yucca
Mountain, Nevada},
journal = {Reliab. Eng. Syst. Saf.},
volume = {122},
pages = {249--266},
year = {2014}
}
@article{DBLP:journals/ress/SwiftHHHKMMS14,
author = {Peter N. Swift and
Clifford W. Hansen and
Jon C. Helton and
Robert L. Howard and
M. Kathryn Knowles and
Robert J. MacKinnon and
Jerry A. McNeish and
S. David Sevougian},
title = {Summary discussion of the 2008 performance assessment for the proposed
high-level radioactive waste repository at Yucca Mountain, Nevada},
journal = {Reliab. Eng. Syst. Saf.},
volume = {122},
pages = {449--456},
year = {2014}
}
@article{DBLP:journals/siamrev/ElmanRS14,
author = {Howard C. Elman and
Alison Ramage and
David J. Silvester},
title = {{IFISS:} {A} Computational Laboratory for Investigating Incompressible
Flow Problems},
journal = {{SIAM} Rev.},
volume = {56},
number = {2},
pages = {261--273},
year = {2014}
}
@article{DBLP:journals/taslp/SpeedMH14,
author = {Matt Speed and
Damian T. Murphy and
David M. Howard},
title = {Modeling the Vocal Tract Transfer Function Using a 3D Digital Waveguide
Mesh},
journal = {{IEEE} {ACM} Trans. Audio Speech Lang. Process.},
volume = {22},
number = {2},
pages = {453--464},
year = {2014}
}
@article{DBLP:journals/tbcas/FreedmanCDKH14,
author = {David S. Freedman and
Howard I. Cohen and
Socrates Deligeorges and
Christian Karl and
Allyn E. Hubbard},
title = {An Analog {VLSI} Implementation of the Inner Hair Cell and Auditory
Nerve Using a Dual {AGC} Model},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {8},
number = {2},
pages = {240--256},
year = {2014}
}
@article{DBLP:journals/tcs/Howard14,
author = {David M. Howard},
title = {Determining membership with 2 simultaneous queries},
journal = {Theor. Comput. Sci.},
volume = {543},
pages = {112--119},
year = {2014}
}
@inproceedings{DBLP:conf/alife/HowardE14,
author = {Gerard David Howard and
Alberto Elfes},
title = {Evolving Spiking Networks for Turbulence-Tolerant Quadrotor Control},
booktitle = {{ALIFE}},
pages = {431--438},
publisher = {{MIT} Press},
year = {2014}
}
@inproceedings{DBLP:conf/birthday/BarringerRG14,
author = {Howard Barringer and
David E. Rydeheard and
Dov M. Gabbay},
title = {Reactivity and Grammars: An Exploration},
booktitle = {Language, Culture, Computation {(1)}},
series = {Lecture Notes in Computer Science},
volume = {8001},
pages = {103--155},
publisher = {Springer},
year = {2014}
}
@inproceedings{DBLP:conf/chinasip/RugchatjaroenH14,
author = {Anocha Rugchatjaroen and
David M. Howard},
title = {Flexibility of cosine impedance function in 2-D Digital Waveguide
Mesh for plosive synthesis},
booktitle = {ChinaSIP},
pages = {32--36},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/icis/AndersonVKEH14,
author = {Bonnie Brinton Anderson and
Tony Vance and
C. Brock Kirwan and
David Eargle and
Seth Howard},
title = {Users Aren't (Necessarily) Lazy: Using NeuroIS to Explain Habituation
to Security Warnings},
booktitle = {{ICIS}},
publisher = {Association for Information Systems},
year = {2014}
}
@inproceedings{DBLP:conf/icmc/CullimoreHG14,
author = {Jason Cullimore and
Howard Hamilton and
David Gerhard},
title = {Directed Transitional Composition for Gaming and Adaptive Music Using
Q-Learning},
booktitle = {{ICMC}},
publisher = {Michigan Publishing},
year = {2014}
}
@inproceedings{DBLP:conf/ondm/SamadiCWB14,
author = {Payman Samadi and
David M. Calhoun and
Howard Wang and
Keren Bergman},
title = {Accelerating cast traffic delivery in data centers leveraging physical
layer optics and {SDN}},
booktitle = {{ONDM}},
pages = {73--77},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/sigcse/BurgeGCHSVWA14,
author = {Janet E. Burge and
Gerald C. Gannod and
Mike Carter and
Alanna Howard and
Brian Schultz and
Mladen A. Vouk and
David Wright and
Paul V. Anderson},
title = {Developing {CS/SE} students' communication abilities through a program-wide
framework},
booktitle = {{SIGCSE}},
pages = {579--584},
publisher = {{ACM}},
year = {2014}
}
@incollection{DBLP:conf/birthday/KwiatkowskaPQU14,
author = {Marta Z. Kwiatkowska and
David Parker and
Hongyang Qu and
Mateusz Ujma},
title = {On Incremental Quantitative Verification for Probabilistic Systems},
booktitle = {{HOWARD-60}},
series = {EPiC Series in Computing},
volume = {42},
pages = {245--257},
publisher = {EasyChair},
year = {2014}
}
@incollection{DBLP:conf/birthday/RydeheardS14,
author = {David E. Rydeheard and
Jes{\'{u}}s H{\'{e}}ctor Dom{\'{\i}}nguez S{\'{a}}nchez},
title = {A note on first-order reasoning for minimum models},
booktitle = {{HOWARD-60}},
series = {EPiC Series in Computing},
volume = {42},
pages = {289--305},
publisher = {EasyChair},
year = {2014}
}
@article{DBLP:journals/ce/MillardBHMH13,
author = {David E. Millard and
Kate Borthwick and
Yvonne Margaret Howard and
Patrick McSweeney and
Charlie Hargood},
title = {The HumBox: Changing educational practice around a learning resource
repository},
journal = {Comput. Educ.},
volume = {69},
pages = {287--302},
year = {2013}
}
@article{DBLP:journals/ijbc/HowardBCAE13,
author = {Gerard David Howard and
Larry Bull and
Ben de Lacy Costello and
Andrew Adamatzky and
Victor Erokhin},
title = {A {SPICE} Model of the PEO-Pani memristor},
journal = {Int. J. Bifurc. Chaos},
volume = {23},
number = {6},
year = {2013}
}
@article{DBLP:journals/jam/RenHJ13,
author = {Lei Ren and
David Howard and
Richard K. Jones},
title = {Mathematical Modelling of Biomechanical Interactions between Backpack
and Bearer during Load Carriage},
journal = {J. Appl. Math.},
volume = {2013},
pages = {349638:1--349638:12},
year = {2013}
}
@article{DBLP:journals/jamia/GeAUGC13,
author = {Yaorong Ge and
David K. Ahn and
Bhagyashree Unde and
H. Donald Gage and
John Jeffrey Carr},
title = {Patient-controlled sharing of medical imaging data across unaffiliated
healthcare organizations},
journal = {J. Am. Medical Informatics Assoc.},
volume = {20},
number = {1},
pages = {157--163},
year = {2013}
}
@article{DBLP:journals/jbi/SheehanNDKBABGHOMSTTVJB13,
author = {Barbara Sheehan and
Lise E. Nigrovic and
Peter S. Dayan and
Nathan Kuppermann and
Dustin W. Ballard and
Evaline Alessandrini and
Lalit Bajaj and
Howard Goldberg and
Jeffrey Hoffman and
Steven R. Offerman and
Dustin G. Mark and
Marguerite Swietlik and
Eric Tham and
Leah Tzimenatos and
David R. Vinson and
Grant S. Jones and
Suzanne Bakken},
title = {Informing the design of clinical decision support services for evaluation
of children with minor blunt head trauma in the emergency department:
{A} sociotechnical analysis},
journal = {J. Biomed. Informatics},
volume = {46},
number = {5},
pages = {905--913},
year = {2013}
}
@article{DBLP:journals/jeric/RabkinRKP13,
author = {Ariel Rabkin and
Charles Reiss and
Randy H. Katz and
David A. Patterson},
title = {Using clouds for MapReduce measurement assignments},
journal = {{ACM} Trans. Comput. Educ.},
volume = {13},
number = {1},
pages = {2:1--2:18},
year = {2013}
}
@article{DBLP:journals/nar/YangSGELFBBSTRFHSBMG13,
author = {Wanjuan Yang and
Jorge Soares and
Patricia Greninger and
Elena J. Edelman and
Howard Lightfoot and
Simon A. Forbes and
Nidhi Bindal and
David Beare and
James A. Smith and
I. Richard Thompson and
Sridhar Ramaswamy and
P. Andrew Futreal and
Daniel A. Haber and
Michael R. Stratton and
Cyril Benes and
Ultan McDermott and
Mathew Garnett},
title = {Genomics of Drug Sensitivity in Cancer {(GDSC):} a resource for therapeutic
biomarker discovery in cancer cells},
journal = {Nucleic Acids Res.},
volume = {41},
number = {Database-Issue},
pages = {955--961},
year = {2013}
}
@article{DBLP:journals/neuroimage/KiranABCHFMT13,
author = {Swathi Kiran and
Ana In{\'{e}}s Ansaldo and
Roelien Bastiaanse and
Leora R. Cherney and
David Howard and
Yasmeen Faroqi{-}Shah and
Marcus Meinzer and
Cynthia K. Thompson},
title = {Neuroimaging in aphasia treatment research: Standards for establishing
the effects of treatment},
journal = {NeuroImage},
volume = {76},
pages = {428--435},
year = {2013}
}
@article{DBLP:journals/taslp/SpeedMH13,
author = {Matt Speed and
Damian T. Murphy and
David M. Howard},
title = {Three-Dimensional Digital Waveguide Mesh Simulation of Cylindrical
Vocal Tract Analogs},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {21},
number = {2},
pages = {449--455},
year = {2013}
}
@article{DBLP:journals/trob/HowardBV13,
author = {Matthew Howard and
David J. Braun and
Sethu Vijayakumar},
title = {Transferring Human Impedance Behavior to Heterogeneous Variable Impedance
Actuators},
journal = {{IEEE} Trans. Robotics},
volume = {29},
number = {4},
pages = {847--862},
year = {2013}
}
@inproceedings{DBLP:conf/aiide/ThueBH13,
author = {David Thue and
Vadim Bulitko and
Howard J. Hamilton},
title = {Implementation Cost and Efficiency for {AI} Experience Managers},
booktitle = {Intelligent Narrative Technologies},
series = {{AAAI} Technical Report},
volume = {{WS-13-21}},
publisher = {{AAAI}},
year = {2013}
}
@inproceedings{DBLP:conf/amia/KawamotoHBRMPNLMSSCSPSBHKVLMPLSR13,
author = {Kensaku Kawamoto and
Tonya Hongsermeier and
Aziz A. Boxwala and
Bryn Rhodes and
Alicia A. Morton and
Jamie Parker and
Claude J. Nanjo and
Victor C. Lee and
Bernadette K. Minton and
Davide Sottara and
Howard R. Strasberg and
Stephen Claypool and
Julie A. Scherer and
Matthew D. Pfeffer and
David Shields and
Keith W. Boone and
Peter J. Haug and
Thomson M. Kuhn and
Merideth C. Vida and
Anna Langhans and
Cem Mangir and
Erik Pupo and
Robert F. Lario and
David S. Shevlin and
Jacob Reider},
title = {Health eDecisions (HeD): a Public-Private Partnership to Develop and
Validate Standards to Enable Clinical Decision Support at Scale},
booktitle = {{AMIA}},
publisher = {{AMIA}},
year = {2013}
}
@inproceedings{DBLP:conf/ccece/GrantSD13,
author = {Howard A. Grant and
Eric Salt and
David E. Dodds},
title = {Geolocation of communications satellite interference},
booktitle = {{CCECE}},
pages = {1--4},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/flairs/HowardJCCB13,
author = {Ayanna M. Howard and
David Johnson and
Cristina Conati and
Frederick W. Chen and
Nikolaj S. Bj{\o}rner},
title = {Invited Talk Abstracts},
booktitle = {{FLAIRS}},
publisher = {{AAAI} Press},
year = {2013}
}
@inproceedings{DBLP:conf/hci/KirchhubelSH13,
author = {Christin Kirchh{\"{u}}bel and
Alex W. Stedmon and
David M. Howard},
title = {Analyzing Deceptive Speech},
booktitle = {{HCI} {(16)}},
series = {Lecture Notes in Computer Science},
volume = {8019},
pages = {134--141},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/hci/WatsonBHSBABHMGCK13,
author = {Benjamin Watson and
David Berube and
Nickolay Hristov and
Carol Strohecker and
Scott Betz and
Louise Allen and
Matthew Burczyk and
Amber Howard and
William Anthony McGee and
Matthew Gymer and
Daniel A. Ca{\~{n}}as and
Mark Kirstner},
title = {{VIA} - Visualizing Individual Actions to Develop a Sustainable Community
Culture through Cycling},
booktitle = {{HCI} {(25)}},
series = {Lecture Notes in Computer Science},
volume = {8028},
pages = {316--325},
publisher = {Springer},
year = {2013}
}
@inproceedings{DBLP:conf/hpca/CarterABCDDFGGKLMMPTTVVX13,
author = {Nicholas P. Carter and
Aditya Agrawal and
Shekhar Borkar and
Romain Cledat and
Howard David and
Dave Dunning and
Joshua B. Fryman and
Ivan Ganev and
Roger A. Golliver and
Rob C. Knauerhase and
Richard Lethin and
Beno{\^{\i}}t Meister and
Asit K. Mishra and
Wilfred R. Pinfold and
Justin Teller and
Josep Torrellas and
Nicolas Vasilache and
Ganesh Venkatesh and
Jianping Xu},
title = {Runnemede: An architecture for Ubiquitous High-Performance Computing},
booktitle = {{HPCA}},
pages = {198--209},
publisher = {{IEEE} Computer Society},
year = {2013}
}
@inproceedings{DBLP:conf/kbse/RegerBR13,
author = {Giles Reger and
Howard Barringer and
David E. Rydeheard},
title = {A pattern-based approach to parametric specification mining},
booktitle = {{ASE}},
pages = {658--663},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/sigcomm/BarkaiKFM13,
author = {Sharon Barkai and
Randy H. Katz and
Dino Farinacci and
David Meyer},
title = {Software defined flow-mapping for scaling virtualized network functions},
booktitle = {HotSDN},
pages = {149--150},
publisher = {{ACM}},
year = {2013}
}
@inproceedings{DBLP:conf/socialcom/RajasekarSLCCKCKZ13,
author = {Arcot Rajasekar and
Sharlini Sankaran and
Howard Lander and
Thomas M. Carsey and
Jonathan David Crabtree and
Hye{-}Chung Kum and
Merc{\`{e}} Crosas and
Gary King and
Justin Zhan},
title = {Sociometric Methods for Relevancy Analysis of Long Tail Science Data},
booktitle = {SocialCom},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2013}
}
@inproceedings{DBLP:conf/uss/RotsosHSMMCC13,
author = {Charalampos Rotsos and
Heidi Howard and
David Sheets and
Richard Mortier and
Anil Madhavapeddy and
Amir Chaudhry and
Jon Crowcroft},
title = {Lost in the Edge: Finding Your Way with {DNSSEC} Signposts},
booktitle = {{FOCI}},
publisher = {{USENIX} Association},
year = {2013}
}
@article{DBLP:journals/corr/AartsenA13,
author = {Mark G. Aartsen and
Rasha U. Abbasi and
Markus Ackermann and
Jenni Adams and
Juan Antonio Aguilar S{\'{a}}nchez and
Markus Ahlers and
David Altmann and
Carlos A. Arg{\"{u}}elles Delgado and
Jan Auffenberg and
Xinhua Bai and
Michael F. Baker and
Steven W. Barwick and
Volker Baum and
Ryan Bay and
James J. Beatty and
Julia K. Becker Tjus and
Karl{-}Heinz Becker and
Segev BenZvi and
Patrick Berghaus and
David Berley and
Elisa Bernardini and
Anna Bernhard and
David Z. Besson and
G. Binder and
Daniel Bindig and
Martin Bissok and
Erik Blaufuss and
Jan Blumenthal and
David J. Boersma and
Christian Bohm and
Debanjan Bose and
Sebastian B{\"{o}}ser and
Olga Botner and
Lionel Brayeur and
Hans{-}Peter Bretz and
Anthony M. Brown and
Ronald Bruijn and
James Casey and
Martin Casier and
Dmitry Chirkin and
Asen Christov and
Brian John Christy and
Ken Clark and
Lew Classen and
Fabian Clevermann and
Stefan Coenders and
Shirit Cohen and
Doug F. Cowen and
Angel H. Cruz Silva and
Matthias Danninger and
Jacob Daughhetee and
James C. Davis and
Melanie Day and
Catherine De Clercq and
Sam De Ridder and
Paolo Desiati and
Krijn D. de Vries and
Meike de With and
Tyce DeYoung and
Juan Carlos D{\'{\i}}az{-}V{\'{e}}lez and
Matthew Dunkman and
Ryan Eagan and
Benjamin Eberhardt and
Bj{\"{o}}rn Eichmann and
Jonathan Eisch and
Sebastian Euler and
Paul A. Evenson and
Oladipo O. Fadiran and
Ali R. Fazely and
Anatoli Fedynitch and
Jacob Feintzeig and
Tom Feusels and
Kirill Filimonov and
Chad Finley and
Tobias Fischer{-}Wasels and
Samuel Flis and
Anna Franckowiak and
Katharina Frantzen and
Tomasz Fuchs and
Thomas K. Gaisser and
Joseph S. Gallagher and
Lisa Marie Gerhardt and
Laura E. Gladstone and
Thorsten Gl{\"{u}}senkamp and
Azriel Goldschmidt and
Geraldina Golup and
Javier G. Gonz{\'{a}}lez and
Jordan A. Goodman and
Dariusz G{\'{o}}ra and
Dylan T. Grandmont and
Darren Grant and
Pavel Gretskov and
John C. Groh and
Andreas Gro{\ss} and
Chang Hyon Ha and
Abd Al Karim Haj Ismail and
Patrick Hallen and
Allan Hallgren and
Francis Halzen and
Kael D. Hanson and
Dustin Hebecker and
David Heereman and
Dirk Heinen and
Klaus Helbing and
Robert Eugene Hellauer III and
Stephanie Virginia Hickford and
Gary C. Hill and
Kara D. Hoffman and
Ruth Hoffmann and
Andreas Homeier and
Kotoyo Hoshina and
Feifei Huang and
Warren Huelsnitz and
Per Olof Hulth and
Klas Hultqvist and
Shahid Hussain and
Aya Ishihara and
Emanuel Jacobi and
John E. Jacobsen and
Kai Jagielski and
George S. Japaridze and
Kyle Jero and
Ola Jlelati and
Basho Kaminsky and
Alexander Kappes and
Timo Karg and
Albrecht Karle and
Matthew Kauer and
John Lawrence Kelley and
Joanna Kiryluk and
J. Kl{\"{a}}s and
Spencer R. Klein and
Jan{-}Hendrik K{\"{o}}hne and
Georges Kohnen and
Hermann Kolanoski and
Lutz K{\"{o}}pke and
Claudio Kopper and
Sandro Kopper and
D. Jason Koskinen and
Marek Kowalski and
Mark Krasberg and
Anna Kriesten and
Kai Michael Krings and
G{\"{o}}sta Kroll and
Jan Kunnen and
Naoko Kurahashi and
Takao Kuwabara and
Mathieu L. M. Labare and
Hagar Landsman and
Michael James Larson and
Mariola Lesiak{-}Bzdak and
Martin Leuermann and
Julia Leute and
Jan L{\"{u}}nemann and
Oscar A. Mac{\'{\i}}as{-}Ram{\'{\i}}rez and
James Madsen and
Giuliano Maggi and
Reina Maruyama and
Keiichi Mase and
Howard S. Matis and
Frank McNally and
Kevin James Meagher and
Martin Merck and
Gonzalo Merino Ar{\'{e}}valo and
Thomas Meures and
Sandra Miarecki and
Eike Middell and
Natalie Milke and
John Lester Miller and
Lars Mohrmann and
Teresa Montaruli and
Robert M. Morse and
Rolf Nahnhauer and
Uwe Naumann and
Hans Niederhausen and
Sarah C. Nowicki and
David R. Nygren and
Anna Obertacke and
Sirin Odrowski and
Alex Olivas and
Ahmad Omairat and
Aongus Starbuck {\'{O}} Murchadha and
Larissa Paul and
Joshua A. Pepper and
Carlos P{\'{e}}rez de los Heros and
Carl Pfendner and
Damian Pieloth and
Elisa Pinat and
Jonas Posselt and
P. Buford Price and
Gerald T. Przybylski and
Melissa Quinnan and
Leif R{\"{a}}del and
Ian Rae and
Mohamed Rameez and
Katherine Rawlins and
Peter Christian Redl and
Ren{\'{e}} Reimann and
Elisa Resconi and
Wolfgang Rhode and
Mathieu Ribordy and
Michael Richman and
Benedikt Riedel and
J. P. Rodrigues and
Carsten Rott and
Tim Ruhe and
Bakhtiyar Ruzybayev and
Dirk Ryckbosch and
Sabine M. Saba and
Heinz{-}Georg Sander and
Juan Marcos Santander and
Subir Sarkar and
Kai Schatto and
Florian Scheriau and
Torsten Schmidt and
Martin Schmitz and
Sebastian Schoenen and
Sebastian Sch{\"{o}}neberg and
Arne Sch{\"{o}}nwald and
Anne Schukraft and
Lukas Schulte and
David Schultz and
Olaf Schulz and
David Seckel and
Yolanda Sestayo de la Cerra and
Surujhdeo Seunarine and
Rezo Shanidze and
Chris Sheremata and
Miles W. E. Smith and
Dennis Soldin and
Glenn M. Spiczak and
Christian Spiering and
Michael Stamatikos and
Todor Stanev and
Nick A. Stanisha and
Alexander Stasik and
Thorsten Stezelberger and
Robert G. Stokstad and
Achim St{\"{o}}{\ss}l and
Erik A. Strahler and
Rickard Str{\"{o}}m and
Nora Linn Strotjohann and
Gregory W. Sullivan and
Henric Taavola and
Ignacio J. Taboada and
Alessio Tamburro and
Andreas Tepe and
Samvel Ter{-}Antonyan and
Gordana Tesic and
Serap Tilav and
Patrick A. Toale and
Moriah Natasha Tobin and
Simona Toscano and
Maria Tselengidou and
Elisabeth Unger and
Marcel Usner and
Sofia Vallecorsa and
Nick van Eijndhoven and
Arne Van Overloop and
Jakob van Santen and
Markus Vehring and
Markus Voge and
Matthias Vraeghe and
Christian Walck and
Tilo Waldenmaier and
Marius Wallraff and
Christopher N. Weaver and
Mark T. Wellons and
Christopher H. Wendt and
Stefan Westerhoff and
Nathan Whitehorn and
Klaus Wiebe and
Christopher Wiebusch and
Dawn R. Williams and
Henrike Wissing and
Martin Wolf and
Terri R. Wood and
Kurt Woschnagg and
Donglian Xu and
Xianwu Xu and
Juan Pablo Y{\'{a}}{\~{n}}ez Garza and
Gaurang B. Yodh and
Shigeru Yoshida and
Pavel Zarzhitsky and
Jan Ziemann and
Simon Zierke and
Marcel Zoll},
title = {The IceProd Framework: Distributed Data Processing for the IceCube
Neutrino Observatory},
journal = {CoRR},
volume = {abs/1311.5904},
year = {2013}
}
@article{DBLP:journals/corr/abs-1305-6164,
author = {Ron Aharoni and
Pierre Charbit and
David M. Howard},
title = {On a Generalization of the Ryser-Brualdi-Stein Conjecture},
journal = {CoRR},
volume = {abs/1305.6164},
year = {2013}
}
@article{DBLP:journals/arobots/BraunHV12,
author = {David J. Braun and
Matthew Howard and
Sethu Vijayakumar},
title = {Optimal variable stiffness control: formulation and application to
explosive movement tasks},
journal = {Auton. Robots},
volume = {33},
number = {3},
pages = {237--253},
year = {2012}
}
@article{DBLP:journals/bioinformatics/TengIPWMCKFEEL12,
author = {Mingxiang Teng and
Shoji Ichikawa and
Leah R. Padgett and
Yadong Wang and
Matthew E. Mort and
David N. Cooper and
Daniel L. Koller and
Tatiana Foroud and
Howard J. Edenberg and
Michael J. Econs and
Yunlong Liu},
title = {regSNPs: a strategy for prioritizing regulatory single nucleotide
substitutions},
journal = {Bioinform.},
volume = {28},
number = {14},
pages = {1879--1886},
year = {2012}
}
@article{DBLP:journals/bspc/HowardDB12,
author = {David M. Howard and
Helena Daffern and
Jude Brereton},
title = {Quantitative voice quality analyses of a soprano singing early music
in three different performance styles},
journal = {Biomed. Signal Process. Control.},
volume = {7},
number = {1},
pages = {58--64},
year = {2012}
}
@article{DBLP:journals/cgf/HulusicHDTWHC12,
author = {Vedad Hulusic and
Carlo Harvey and
Kurt Debattista and
Nicolas Tsingos and
Steve Walker and
David M. Howard and
Alan Chalmers},
title = {Acoustic Rendering and Auditory-Visual Cross-Modal Perception and
Interaction},
journal = {Comput. Graph. Forum},
volume = {31},
number = {1},
pages = {102--131},
year = {2012}
}
@article{DBLP:journals/cse/HowardPMJ12,
author = {Jessica Howard and
Omar Padron and
Patricia Morreale and
David A. Joiner},
title = {Applications of Computational Science: Data-Intensive Computing for
Student Projects},
journal = {Comput. Sci. Eng.},
volume = {14},
number = {2},
pages = {84--89},
year = {2012}
}
@article{DBLP:journals/dm/HowardS12,
author = {David M. Howard and
Clifford D. Smyth},
title = {Revolutionaries and Spies},
journal = {Discret. Math.},
volume = {312},
number = {22},
pages = {3384--3391},
year = {2012}
}
@article{DBLP:journals/dt/Dawson-HaggertyOTCK12,
author = {Stephen Dawson{-}Haggerty and
Jorge Ortiz and
Jason Trager and
David E. Culler and
Randy H. Katz},
title = {Energy Savings and the "Software-Defined" Building},
journal = {{IEEE} Des. Test Comput.},
volume = {29},
number = {4},
pages = {56--57},
year = {2012}
}
@article{DBLP:journals/gac/SnodgrassDLFMBH12,
author = {Jeffrey G. Snodgrass and
H. J. Fran{\c{c}}ois Dengah II and
Michael G. Lacy and
Jesse Fagan and
David Most and
Michael Blank and
Lahoma Howard and
Chad R. Kershner and
Gregory Krambeer and
Alissa Leavitt{-}Reynolds and
Adam Reynolds and
Jessica Vyvial{-}Larson and
Josh Whaley and
Benjamin Wintersteen},
title = {Restorative Magical Adventure or Warcrack? Motivated {MMO} Play and
the Pleasures and Perils of Online Experience},
journal = {Games Cult.},
volume = {7},
number = {1},
pages = {3--28},
year = {2012}
}
@article{DBLP:journals/ijbc/ErokhinHA12,
author = {Victor Erokhin and
Gerard David Howard and
Andrew Adamatzky},
title = {Organic memristor Devices for Logic Elements with Memory},
journal = {Int. J. Bifurc. Chaos},
volume = {22},
number = {11},
year = {2012}
}
@article{DBLP:journals/jssc/WarnockCCWMGSCDBPRPSMMNRH12,
author = {James D. Warnock and
Yiu{-}Hing Chan and
Sean M. Carey and
Huajun Wen and
Patrick J. Meaney and
Guenter Gerwig and
Howard H. Smith and
Yuen H. Chan and
John Davis and
Paul Bunce and
Antonio Pelella and
Daniel Rodko and
Pradip Patel and
Thomas Strach and
Doug Malone and
Frank Malgioglio and
Jos{\'{e}} Neves and
David L. Rude and
William V. Huott},
title = {Circuit and Physical Design Implementation of the Microprocessor Chip
for the zEnterprise System},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {1},
pages = {151--163},
year = {2012}
}
@article{DBLP:journals/neuroimage/HowardP12,
author = {Mary F. Howard and
David Poeppel},
title = {The neuromagnetic response to spoken sentences: Co-modulation of theta
band amplitude and phase},
journal = {NeuroImage},
volume = {60},
number = {4},
pages = {2118--2127},
year = {2012}
}
@article{DBLP:journals/ploscb/RichardsGMMSH12,
author = {David M. Richards and
Emma Greer and
Azahara C. Martin and
Graham Moore and
Peter J. Shaw and
Martin Howard},
title = {Quantitative Dynamics of Telomere Bouquet Formation},
journal = {PLoS Comput. Biol.},
volume = {8},
number = {12},
year = {2012}
}
@article{DBLP:journals/ploscb/RichardsHFBH12,
author = {David M. Richards and
Antje M. Hempel and
Klas Fl{\"{a}}rdh and
Mark J. Buttner and
Martin Howard},
title = {Mechanistic Basis of Branch-Site Selection in Filamentous Bacteria},
journal = {PLoS Comput. Biol.},
volume = {8},
number = {3},
year = {2012}
}
@article{DBLP:journals/speech/HowardAF12,
author = {David M. Howard and
Evelyn Abberton and
Adrian Fourcin},
title = {Disordered voice measurement and auditory analysis},
journal = {Speech Commun.},
volume = {54},
number = {5},
pages = {611--621},
year = {2012}
}
@article{DBLP:journals/speech/HowardAF12a,
author = {David M. Howard and
Evelyn Abberton and
Adrian Fourcin},
title = {Erratum to "Disordered voice measurement and auditory analysis" [Speech
Comm. 54(2012) 611-621]},
journal = {Speech Commun.},
volume = {54},
number = {6},
pages = {844},
year = {2012}
}
@article{DBLP:journals/tec/HowardGBCA12,
author = {Gerard David Howard and
Ella Gale and
Larry Bull and
Ben de Lacy Costello and
Andy Adamatzky},
title = {Evolution of Plastic Learning in Spiking Networks via Memristive Connections},
journal = {{IEEE} Trans. Evol. Comput.},
volume = {16},
number = {5},
pages = {711--729},
year = {2012}
}
@article{DBLP:journals/usenix-login/ChenGZJK12,
author = {Yanpei Chen and
Rean Griffith and
David Zats and
Anthony D. Joseph and
Randy H. Katz},
title = {Understanding {TCP} Incast and Its Implications for Big Data Workloads},
journal = {login Usenix Mag.},
volume = {37},
number = {3},
year = {2012}
}
@inproceedings{DBLP:conf/amia/KawamotoJWHPFSSHLJRCFAC12,
author = {Kensaku Kawamoto and
Jason R. Jacobs and
Brandon M. Welch and
Vojtech Huser and
Marilyn D. Paterno and
Guilherme Del Fiol and
David Shields and
Howard R. Strasberg and
Peter J. Haug and
Zhijing Liu and
Robert A. Jenders and
David Rowed and
Daryl Chertcoff and
Karsten Fehre and
Klaus{-}Peter Adlassnig and
Arthur Curtis},
title = {Clinical Information System Services and Capabilities Desired for
Scalable, Standards-Based, Service-oriented Decision Support: Consensus
Assessment of the Health Level 7 Clinical Decision Support Work Group},
booktitle = {{AMIA}},
publisher = {{AMIA}},
year = {2012}
}
@inproceedings{DBLP:conf/eisic/JohnsonH12,
author = {David E. A. Johnson and
Newton Howard},
title = {Network Intelligence: An Emerging Discipline},
booktitle = {{EISIC}},
pages = {287--288},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/eurogp/HowardBA12,
author = {Gerard David Howard and
Larry Bull and
Andrew Adamatzky},
title = {Cartesian Genetic Programming for Memristive Logic Circuits},
booktitle = {EuroGP},
series = {Lecture Notes in Computer Science},
volume = {7244},
pages = {37--48},
publisher = {Springer},
year = {2012}
}
@inproceedings{DBLP:conf/fm/BarringerFHRR12,
author = {Howard Barringer and
Yli{\`{e}}s Falcone and
Klaus Havelund and
Giles Reger and
David E. Rydeheard},
title = {Quantified Event Automata: Towards Expressive and Efficient Runtime
Monitors},
booktitle = {{FM}},
series = {Lecture Notes in Computer Science},
volume = {7436},
pages = {68--84},
publisher = {Springer},
year = {2012}
}
@inproceedings{DBLP:conf/grapp/PettiferHBEL12,
author = {Steve Pettifer and
Toby Howard and
Benjamin James Blundell and
David Edwards and
Ilan Lieberman},
title = {An Immersive Virtual Environment for Phantom Limb Pain Rehabilitation},
booktitle = {{GRAPP/IVAPP}},
pages = {426--433},
publisher = {SciTePress},
year = {2012}
}
@inproceedings{DBLP:conf/iccps/TanejaKC12,
author = {Jay Taneja and
Randy H. Katz and
David E. Culler},
title = {Defining {CPS} Challenges in a Sustainable Electricity Grid},
booktitle = {{ICCPS}},
pages = {119--128},
publisher = {{IEEE} Computer Society},
year = {2012}
}
@inproceedings{DBLP:conf/iceac/ErcanGD12,
author = {Furkan Ercan and
Neven Abou Gazala and
Howard David},
title = {An integrated approach to system-level {CPU} and memory energy efficiency
on computing systems},
booktitle = {{ICEAC}},
pages = {1--6},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/milcom/DuboisGLV12,
author = {David Dubois and
Howard Gans and
Terence Lei and
Rolando Ventura},
title = {Front End Mission Modeling},
booktitle = {{MILCOM}},
pages = {1--6},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/milcom/SwainFM12,
author = {Darcy Swain and
David Fritz and
Howard McDonald},
title = {A phased approach to policy-based Spectrum operations},
booktitle = {{MILCOM}},
pages = {1--6},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/ni/SheehanNDKBABGHOMSTTV12,
author = {Barbara Sheehan and
Lise E. Nigrovic and
Peter S. Dayan and
Nathan Kuppermann and
Dustin W. Ballard and
Evaline Alessandrini and
Lalit Bajaj and
Howard Goldberg and
Jeffrey Hoffman and
Steven R. Offerman and
Dustin G. Mark and
Marguerite Swietlik and
Eric Tham and
Leah Tzimenatos and
David R. Vinson},
title = {An Activity Theory Based Analysis of Work Activities in the Emergency
Department},
booktitle = {Nursing Informatics},
series = {Studies in Health Technology and Informatics},
volume = {201},
publisher = {{IOS} Press},
year = {2012}
}
@inproceedings{DBLP:conf/scipy/PrasadHKF12,
author = {Aakash Prasad and
David Howard and
Shoaib Kamil and
Armando Fox},
title = {Parallel High Performance Bootstrapping in Python},
booktitle = {SciPy},
pages = {1--5},
publisher = {scipy.org},
year = {2012}
}
@inproceedings{DBLP:conf/sigcomm/ZatsDMBK12,
author = {David Zats and
Tathagata Das and
Prashanth Mohan and
Dhruba Borthakur and
Randy H. Katz},
title = {DeTail: reducing the flow completion time tail in datacenter networks},
booktitle = {{SIGCOMM}},
pages = {139--150},
publisher = {{ACM}},
year = {2012}
}
@inproceedings{DBLP:conf/sigcse/RabkinRKP12,
author = {Ariel Rabkin and
Charles Reiss and
Randy H. Katz and
David A. Patterson},
title = {Experiences teaching MapReduce in the cloud},
booktitle = {{SIGCSE}},
pages = {601--606},
publisher = {{ACM}},
year = {2012}
}
@article{DBLP:journals/corr/abs-1201-3249,
author = {Gerard David Howard and
Larry Bull and
Pier Luca Lanzi},
title = {A Spiking Neural Learning Classifier System},
journal = {CoRR},
volume = {abs/1201.3249},
year = {2012}
}
@article{DBLP:journals/corr/abs-1212-3425,
author = {Victor Erokhin and
Gerard David Howard and
Andrew Adamatzky},
title = {Organic Memristor Devices for Logic Elements with Memory},
journal = {CoRR},
volume = {abs/1212.3425},
year = {2012}
}
@article{DBLP:journals/corr/abs-1212-3441,
author = {Gerard David Howard and
Ella Gale and
Larry Bull and
Ben de Lacy Costello and
Andy Adamatzky},
title = {Evolution of Plastic Learning in Spiking Networks via Memristive Connections},
journal = {CoRR},
volume = {abs/1212.3441},
year = {2012}
}
@phdthesis{DBLP:phd/ethos/Howard11,
author = {Gerard David Howard},
title = {Constructivist and spiking neural learning classifier systems},
school = {University of the West of England, Bristol, {UK}},
year = {2011}
}
@article{DBLP:journals/ccr/KrioukovMAKCK11,
author = {Andrew Krioukov and
Prashanth Mohan and
Sara Alspaugh and
Laura Keys and
David E. Culler and
Randy H. Katz},
title = {NapSAC: design and implementation of a power-proportional web cluster},
journal = {Comput. Commun. Rev.},
volume = {41},
number = {1},
pages = {102--108},
year = {2011}
}
@article{DBLP:journals/da/CaswellHP11,
author = {David J. Caswell and
Ronald A. Howard and
Marie{-}Elisabeth Pat{\'{e}}{-}Cornell},
title = {Analysis of National Strategies to Counter a Country's Nuclear Weapons
Program},
journal = {Decis. Anal.},
volume = {8},
number = {1},
pages = {30--45},
year = {2011}
}
@article{DBLP:journals/debu/KrioukovGACCK11,
author = {Andrew Krioukov and
Christoph Goebel and
Sara Alspaugh and
Yanpei Chen and
David E. Culler and
Randy H. Katz},
title = {Integrating Renewable Energy Using Data Analytics Systems: Challenges
and Opportunities},
journal = {{IEEE} Data Eng. Bull.},
volume = {34},
number = {1},
pages = {3--11},
year = {2011}
}
@article{DBLP:journals/dm/HowardY11,
author = {David M. Howard and
Stephen J. Young},
title = {When linear and weak discrepancy are equal},
journal = {Discret. Math.},
volume = {311},
number = {4},
pages = {252--257},
year = {2011}
}
@article{DBLP:journals/dsp/PalmerPSMSH11,
author = {James Palmer and
Simon Palumbo and
Ashley Summers and
David Merrett and
Stephen J. Searle and
Stephen D. Howard},
title = {An overview of an illuminator of opportunity passive radar research
project and its signal processing research directions},
journal = {Digit. Signal Process.},
volume = {21},
number = {5},
pages = {593--599},
year = {2011}
}
@article{DBLP:journals/ijpop/StedmonHK11,
author = {Alex W. Stedmon and
David M. Howard and
Christin Kirchh{\"{u}}bel},
title = {Developing Speech Input for Virtual Applications: {A} Human Factors
Perspective},
journal = {Int. J. People Oriented Program.},
volume = {1},
number = {2},
pages = {50--65},
year = {2011}
}
@article{DBLP:journals/jcamd/HowardTM11,
author = {Brittany L. Howard and
Philip E. Thompson and
David T. Manallack},
title = {Active site similarity between human and Plasmodium falciparum phosphodiesterases:
considerations for antimalarial drug design},
journal = {J. Comput. Aided Mol. Des.},
volume = {25},
number = {8},
pages = {753--762},
year = {2011}
}
@article{DBLP:journals/jcphy/ElmanMS11,
author = {Howard C. Elman and
Milan D. Mihajlovic and
David J. Silvester},
title = {Fast iterative solvers for buoyancy driven flow problems},
journal = {J. Comput. Phys.},
volume = {230},
number = {10},
pages = {3900--3914},
year = {2011}
}
@article{DBLP:journals/jfr/HuntsbergerAHT11,
author = {Terry Huntsberger and
Hrand Aghazarian and
Andrew Howard and
David C. Trotz},
title = {Stereo vision-based navigation for autonomous surface vessels},
journal = {J. Field Robotics},
volume = {28},
number = {1},
pages = {3--18},
year = {2011}
}
@article{DBLP:journals/neuroimage/PetersonLHSP11,
author = {David A. Peterson and
Daniel T. Lotz and
Eric Halgren and
Terrence J. Sejnowski and
Howard Poizner},
title = {Choice modulates the neural dynamics of prediction error processing
during rewarded learning},
journal = {NeuroImage},
volume = {54},
number = {2},
pages = {1385--1394},
year = {2011}
}
@article{DBLP:journals/siamsc/TuminaroBCDEFJKKKLMMSW11,
author = {Ray Tuminaro and
Michele Benzi and
Xiao{-}Chuan Cai and
Iain Duff and
Howard C. Elman and
Roland Freund and
Kirk E. Jordan and
Tim Kelley and
David E. Keyes and
Misha Elena Kilmer and
Sven Leyffer and
Tom Manteuffel and
Steve F. McCormick and
David J. Silvester and
Homer F. Walker},
title = {Special Section: 2010 Copper Mountain Conference},
journal = {{SIAM} J. Sci. Comput.},
volume = {33},
number = {5},
pages = {2685},
year = {2011}
}
@article{DBLP:journals/suscom/KatzCSACDDHJKKL11,
author = {Randy H. Katz and
David E. Culler and
Seth Sanders and
Sara Alspaugh and
Yanpei Chen and
Stephen Dawson{-}Haggerty and
Prabal Dutta and
Mike He and
Xiaofan Jiang and
Laura Keys and
Andrew Krioukov and
Ken Lutz and
Jorge Ortiz and
Prashanth Mohan and
Evan Reutzel and
Jay Taneja and
Jeff Hsu and
Sushant Shankar},
title = {An information-centric energy infrastructure: The Berkeley view},
journal = {Sustain. Comput. Informatics Syst.},
volume = {1},
number = {1},
pages = {7--22},
year = {2011}
}
@inproceedings{DBLP:conf/aaaiss/GrahnDH11,
author = {Dennis A. Grahn and
Howard L. Davidson and
H. Craig Heller},
title = {Incorporating Variable Vascular Heat Exchangers Into Models Of Human
Thermoregulation},
booktitle = {{AAAI} Spring Symposium: Computational Physiology},
publisher = {{AAAI}},
year = {2011}
}
@inproceedings{DBLP:conf/alenex/BreslauDDGHJKRS11,
author = {Lee Breslau and
Ilias Diakonikolas and
Nick G. Duffield and
Yu Gu and
Mohammad Taghi Hajiaghayi and
David S. Johnson and
Howard J. Karloff and
Mauricio G. C. Resende and
Subhabrata Sen},
title = {Disjoint-Path Facility Location: Theory and Practice},
booktitle = {{ALENEX}},
pages = {60--74},
publisher = {{SIAM}},
year = {2011}
}
@inproceedings{DBLP:conf/ats/GrayKWB11,
author = {Carl Gray and
David C. Keezer and
Howard Wang and
Keren Bergman},
title = {Burst-Mode Transmission and Data Recovery for Multi-GHz Optical Packet
Switching Network Testing},
booktitle = {Asian Test Symposium},
pages = {545--551},
publisher = {{IEEE} Computer Society},
year = {2011}
}
@inproceedings{DBLP:conf/eurographics/HulusicHTDWHC11,
author = {Vedad Hulusic and
Carlo Harvey and
Nicolas Tsingos and
Kurt Debattista and
Steve Walker and
David M. Howard and
Alan Chalmers},
title = {Acoustic Rendering and Auditory-Visual Cross-Modal Perception and
Interaction},
booktitle = {Eurographics (State of the Art Reports)},
pages = {151--184},
publisher = {Eurographics Association},
year = {2011}
}
@inproceedings{DBLP:conf/gecco/HowardGBCA11,
author = {Gerard David Howard and
Ella Gale and
Larry Bull and
Benjamin de Lacy Costello and
Andrew Adamatzky},
title = {Evolving spiking networks with variable memristors},
booktitle = {{GECCO}},
pages = {1275--1282},
publisher = {{ACM}},
year = {2011}
}
@inproceedings{DBLP:conf/hci/HowardK11,
author = {David M. Howard and
Christin Kirchh{\"{u}}bel},
title = {Acoustic Correlates of Deceptive Speech - An Exploratory Study},
booktitle = {{HCI} {(21)}},
series = {Lecture Notes in Computer Science},
volume = {6781},
pages = {28--37},
publisher = {Springer},
year = {2011}
}
@inproceedings{DBLP:conf/icac/DavidFGHM11,
author = {Howard David and
Chris Fallin and
Eugene Gorbatov and
Ulf R. Hanebutte and
Onur Mutlu},
title = {Memory power management via dynamic voltage/frequency scaling},
booktitle = {{ICAC}},
pages = {31--40},
publisher = {{ACM}},
year = {2011}
}
@inproceedings{DBLP:conf/icphs/Kirchhubel011,
author = {Christin Kirchh{\"{u}}bel and
David M. Howard},
title = {Investigating the Acoustic Characteristics of Deceptive Speech},
booktitle = {ICPhS},
pages = {1094--1097},
year = {2011}
}
@inproceedings{DBLP:conf/icra/HowardBV11,
author = {Matthew Howard and
David J. Braun and
Sethu Vijayakumar},
title = {Constraint-based equilibrium and stiffness control of variable stiffness
actuators},
booktitle = {{ICRA}},
pages = {5554--5560},
publisher = {{IEEE}},
year = {2011}
}
@inproceedings{DBLP:conf/ictai/ManfredottiFHZ11,
author = {Cristina E. Manfredotti and
David J. Fleet and
Howard J. Hamilton and
Sandra Zilles},
title = {Simultaneous Tracking and Activity Recognition},
booktitle = {{ICTAI}},
pages = {189--196},
publisher = {{IEEE} Computer Society},
year = {2011}
}
@inproceedings{DBLP:conf/ieeealife/HowardGBCA11,
author = {Gerard David Howard and
Ella Gale and
Larry Bull and
Benjamin de Lacy Costello and
Andy Adamatzky},
title = {Towards evolving spiking networks with memristive synapses},
booktitle = {{ALIFE}},
pages = {14--21},
publisher = {{IEEE}},
year = {2011}
}
@inproceedings{DBLP:conf/infocom/DuYWLLDH11,
author = {Hongwei Du and
Qiang Ye and
Weili Wu and
Wonjun Lee and
Deying Li and
Ding{-}Zhu Du and
Stephen Howard},
title = {Constant approximation for virtual backbone construction with Guaranteed
Routing Cost in wireless sensor networks},
booktitle = {{INFOCOM}},
pages = {1737--1744},
publisher = {{IEEE}},
year = {2011}
}
@inproceedings{DBLP:conf/isscc/WarnockCHCFWSMMPCMMSRAWSSCSEMWMMW11,
author = {James D. Warnock and
Y. Chan and
William V. Huott and
Sean M. Carey and
Michael F. Fee and
Huajun Wen and
Mary Jo Saccamango and
Frank Malgioglio and
Patrick J. Meaney and
Donald W. Plass and
Yuen H. Chan and
Mark D. Mayo and
Guenter Mayer and
Leon J. Sigal and
David L. Rude and
Robert M. Averill III and
Michael H. Wood and
Thomas Strach and
Howard H. Smith and
Brian W. Curran and
Eric M. Schwarz and
Lee Eisen and
Doug Malone and
Steve Weitzel and
Pak{-}kin Mak and
Thomas J. McPherson and
Charles F. Webb},
title = {A 5.2GHz microprocessor chip for the {IBM} zEnterprise{\texttrademark}
system},
booktitle = {{ISSCC}},
pages = {70--72},
publisher = {{IEEE}},
year = {2011}
}
@inproceedings{DBLP:conf/pvm/HurseyGBBPS11,
author = {Joshua Hursey and
Richard L. Graham and
Greg Bronevetsky and
Darius Buntinas and
Howard Pritchard and
David G. Solt},
title = {Run-Through Stabilization: An {MPI} Proposal for Process Fault Tolerance},
booktitle = {EuroMPI},
series = {Lecture Notes in Computer Science},
volume = {6960},
pages = {329--332},
publisher = {Springer},
year = {2011}
}
@inproceedings{DBLP:conf/rss/BraunHV11,
author = {David J. Braun and
Matthew Howard and
Sethu Vijayakumar},
title = {Exploiting Variable Stiffness in Explosive Movement Tasks},
booktitle = {Robotics: Science and Systems},
year = {2011}
}
@inproceedings{DBLP:conf/smc/KoziolLHCHH11,
author = {Scott Koziol and
David Lenz and
Sebastian Hilsenbeck and
Smriti Chopra and
Paul E. Hasler and
Ayanna M. Howard},
title = {Using floating-gate based programmable analog arrays for real-time
control of a game-playing robot},
booktitle = {{SMC}},
pages = {3566--3571},
publisher = {{IEEE}},
year = {2011}
}
@incollection{DBLP:books/sp/sensoria2011/FosterMRU11,
author = {Howard Foster and
Arun Mukhija and
David S. Rosenblum and
Sebasti{\'{a}}n Uchitel},
title = {Specification and Analysis of Dynamically-Reconfigurable Service Architectures},
booktitle = {Results of the {SENSORIA} Project},
series = {Lecture Notes in Computer Science},
volume = {6582},
pages = {428--446},
publisher = {Springer},
year = {2011}
}
@incollection{DBLP:books/sp/sensoria2011/MukhijaRFU11,
author = {Arun Mukhija and
David S. Rosenblum and
Howard Foster and
Sebasti{\'{a}}n Uchitel},
title = {Runtime Support for Dynamic and Adaptive Service Composition},
booktitle = {Results of the {SENSORIA} Project},
series = {Lecture Notes in Computer Science},
volume = {6582},
pages = {585--603},
publisher = {Springer},
year = {2011}
}
@incollection{DBLP:books/wi/Smith11/HowardTC11,
author = {David M. Howard and
Andy M. Tyrrell and
Crispin H. V. Cooper},
title = {Towards an Alternative to Magnetic Resonance Imaging for Vocal Tract
Shape Measurement using the Principles of Evolution},
booktitle = {Genetic and Evolutionary Computation: Medical Applications},
publisher = {Wiley},
year = {2011}
}
@article{DBLP:journals/corr/KorpelaABCHLSKW11,
author = {Eric Korpela and
David P. Anderson and
Robert Bankay and
Jeff Cobb and
Andrew Howard and
Matt Lebofsky and
Andrew P. V. Siemion and
Joshua Von Korff and
Dan Werthimer},
title = {Status of the UC-Berkeley {SETI} Efforts},
journal = {CoRR},
volume = {abs/1108.3134},
year = {2011}
}
@article{DBLP:journals/cacm/ArmbrustFGJKKLPRSZ10,
author = {Michael Armbrust and
Armando Fox and
Rean Griffith and
Anthony D. Joseph and
Randy H. Katz and
Andy Konwinski and
Gunho Lee and
David A. Patterson and
Ariel Rabkin and
Ion Stoica and
Matei Zaharia},
title = {A view of cloud computing},
journal = {Commun. {ACM}},
volume = {53},
number = {4},
pages = {50--58},
year = {2010}
}
@article{DBLP:journals/dam/HowardT10,
author = {David M. Howard and
Ann N. Trenk},
title = {The t-discrepancy of a poset},
journal = {Discret. Appl. Math.},
volume = {158},
number = {16},
pages = {1789--1798},
year = {2010}
}
@article{DBLP:journals/dm/HowardSST10,
author = {David M. Howard and
Randy Shull and
Noah Streib and
Ann N. Trenk},
title = {The total linear discrepancy of an ordered set},
journal = {Discret. Math.},
volume = {310},
number = {5},
pages = {1022--1025},
year = {2010}
}
@article{DBLP:journals/dm/HowardT10,
author = {David M. Howard and
William T. Trotter},
title = {On the size of maximal antichains and the number of pairwise disjoint
maximal chains},
journal = {Discret. Math.},
volume = {310},
number = {21},
pages = {2890--2894},
year = {2010}
}
@article{DBLP:journals/ijdsn/EidsonEGHHLPSWW10,
author = {Gene W. Eidson and
Sam T. Esswein and
Jill B. Gemmill and
Jason O. Hallstrom and
T. R. Howard and
J. K. Lawrence and
Christopher J. Post and
C. B. Sawyer and
Kuang{-}Ching Wang and
David L. White},
title = {The South Carolina Digital Watershed: End-to-End Support for Real-Time
Management of Water Resources},
journal = {Int. J. Distributed Sens. Networks},
volume = {6},
number = {1},
year = {2010}
}
@article{DBLP:journals/jacic/BarringerGHS10,
author = {Howard Barringer and
Alex Groce and
Klaus Havelund and
Margaret H. Smith},
title = {Formal Analysis of Log Files},
journal = {J. Aerosp. Comput. Inf. Commun.},
volume = {7},
number = {11},
pages = {365--390},
year = {2010}
}
@article{DBLP:journals/jct/BiroHKTY10,
author = {Csaba Bir{\'{o}} and
David M. Howard and
Mitchel T. Keller and
William T. Trotter and
Stephen J. Young},
title = {Interval partitions and Stanley depth},
journal = {J. Comb. Theory {A}},
volume = {117},
number = {4},
pages = {475--482},
year = {2010}
}
@article{DBLP:journals/jfr/WolfAKHAZLTH10,
author = {Michael T. Wolf and
Christopher Assad and
Yoshiaki Kuwata and
Andrew Howard and
Hrand Aghazarian and
David Zhu and
Thomas Lu and
Ashitey Trebi{-}Ollennu and
Terry Huntsberger},
title = {360-degree visual detection and target tracking on an autonomous surface
vehicle},
journal = {J. Field Robotics},
volume = {27},
number = {6},
pages = {819--833},
year = {2010}
}
@article{DBLP:journals/jsac/GesbertHHSSY10,
author = {David Gesbert and
Stephen V. Hanly and
Howard C. Huang and
Shlomo Shamai and
Osvaldo Simeone and
Wei Yu},
title = {Multi-Cell {MIMO} Cooperative Networks: {A} New Look at Interference},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {28},
number = {9},
pages = {1380--1408},
year = {2010}
}
@article{DBLP:journals/jsac/GesbertHHSYP10,
author = {David Gesbert and
Stephen V. Hanly and
Howard C. Huang and
Shlomo Shamai and
Wei Yu and
Michael B. Pursley},
title = {Guest Editorial Cooperative Communications in {MIMO} Cellular Networks},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {28},
number = {9},
pages = {1377--1379},
year = {2010}
}
@article{DBLP:journals/logcom/BarringerRH10,
author = {Howard Barringer and
David E. Rydeheard and
Klaus Havelund},
title = {Rule Systems for Run-time Monitoring: from Eagle to RuleR},
journal = {J. Log. Comput.},
volume = {20},
number = {3},
pages = {675--706},
year = {2010}
}
@article{DBLP:journals/ram/SmithDHPACDGHORSSSSTCJS10,
author = {Ryan N. Smith and
Jnaneshwar Das and
Hordur Kristinn Heidarsson and
Arvind Pereira and
Filippo Arrichiello and
Ivona Cetnic and
Lindsay Darjany and
Marie{-}Eve Garneau and
Meredith Howard and
Carl Oberg and
Matthew Ragan and
Erica Seubert and
Ellen C. Smith and
Beth Stauffer and
Astrid Schnetzer and
Gerardo Toro{-}Farmer and
David A. Caron and
Burton H. Jones and
Gaurav S. Sukhatme},
title = {{USC} {CINAPS} Builds Bridges},
journal = {{IEEE} Robotics Autom. Mag.},
volume = {17},
number = {1},
pages = {20--30},
year = {2010}
}
@article{DBLP:journals/tlt/DavisCHHMMW10,
author = {Hugh C. Davis and
Leslie Carr and
Jessie M. N. Hey and
Yvonne Margaret Howard and
David E. Millard and
Debra Morris and
Su White},
title = {Bootstrapping a Culture of Sharing to Facilitate Open Educational
Resources},
journal = {{IEEE} Trans. Learn. Technol.},
volume = {3},
number = {2},
pages = {96--109},
year = {2010}
}
@inproceedings{DBLP:conf/biostec/PaulLPSP10,
author = {Padma Polash Paul and
Howard Leung and
David A. Peterson and
Terrence J. Sejnowski and
Howard Poizner},
title = {Combining Temporal and Frequency based Prediction for {EEG} Signals},
booktitle = {{BIOSIGNALS}},
pages = {29--36},
publisher = {{INSTICC} Press},
year = {2010}
}
@inproceedings{DBLP:conf/cade/AfifiRB10,
author = {Djihed Afifi and
David E. Rydeheard and
Howard Barringer},
title = {Automated Reasoning in the Simulation of Evolvable Systems},
booktitle = {PAAR@IJCAR},
series = {EPiC Series in Computing},
volume = {9},
pages = {11--21},
publisher = {EasyChair},
year = {2010}
}
@inproceedings{DBLP:conf/cec/HowardBL10,
author = {Gerard David Howard and
Larry Bull and
Pier Luca Lanzi},
title = {A spiking neural representation for {XCSF}},
booktitle = {{IEEE} Congress on Evolutionary Computation},
pages = {1--8},
publisher = {{IEEE}},
year = {2010}
}
@inproceedings{DBLP:conf/ectel/MillardH10,
author = {David E. Millard and
Yvonne Margaret Howard},
title = {Towards an Ergonomics of Knowledge Systems: Improving the Design of
Technology Enhanced Learning},
booktitle = {{EC-TEL}},
series = {Lecture Notes in Computer Science},
volume = {6383},
pages = {566--571},
publisher = {Springer},
year = {2010}
}
@inproceedings{DBLP:conf/icai/HowardDPCS10,
author = {Mike Howard and
Mike Daily and
David W. Payton and
Yang Chen and
Rashmi Sundareswara},
title = {Further Explorations of a Minimal Polychronous Memory},
booktitle = {{IC-AI}},
pages = {325--330},
publisher = {{CSREA} Press},
year = {2010}
}
@inproceedings{DBLP:conf/icde/GanapathiCFKP10,
author = {Archana Ganapathi and
Yanpei Chen and
Armando Fox and
Randy H. Katz and
David A. Patterson},
title = {Statistics-driven workload modeling for the Cloud},
booktitle = {{ICDE} Workshops},
pages = {87--92},
publisher = {{IEEE} Computer Society},
year = {2010}
}
@inproceedings{DBLP:conf/icra/WoodenMBHRR10,
author = {David Wooden and
Matthew Malchano and
Kevin Blankespoor and
Andrew Howard and
Alfred A. Rizzi and
Marc H. Raibert},
title = {Autonomous navigation for BigDog},
booktitle = {{ICRA}},
pages = {4736--4741},
publisher = {{IEEE}},
year = {2010}
}
@inproceedings{DBLP:conf/islped/DavidGHKL10,
author = {Howard David and
Eugene Gorbatov and
Ulf R. Hanebutte and
Rahul Khanna and
Christian Le},
title = {{RAPL:} memory power estimation and capping},
booktitle = {{ISLPED}},
pages = {189--194},
publisher = {{ACM}},
year = {2010}
}
@inproceedings{DBLP:conf/isscc/HowardDHVFRJWBSPJJYMSEKRDLGAHLSBDWM10,
author = {Jason Howard and
Saurabh Dighe and
Yatin Vasant Hoskote and
Sriram R. Vangal and
David Finan and
Gregory Ruhl and
David Jenkins and
Howard Wilson and
Nitin Borkar and
Gerhard Schrom and
Fabric Pailet and
Shailendra Jain and
Tiju Jacob and
Satish Yada and
Sraven Marella and
Praveen Salihundam and
Vasantha Erraguntla and
Michael Konow and
Michael Riepen and
Guido Droege and
Joerg Lindemann and
Matthias Gries and
Thomas Apel and
Kersten Henriss and
Tor Lund{-}Larsen and
Sebastian Steibl and
Shekhar Borkar and
Vivek De and
Rob F. Van der Wijngaart and
Timothy G. Mattson},
title = {A 48-Core {IA-32} message-passing processor with {DVFS} in 45nm {CMOS}},
booktitle = {{ISSCC}},
pages = {108--109},
publisher = {{IEEE}},
year = {2010}
}
@inproceedings{DBLP:conf/osdi/RabkinXWFPK10,
author = {Ariel Rabkin and
Wei Xu and
Avani Wildani and
Armando Fox and
David A. Patterson and
Randy H. Katz},
title = {A Graphical Representation for Identifier Structure in Logs},
booktitle = {{SLAML}},
publisher = {{USENIX} Association},
year = {2010}
}
@inproceedings{DBLP:conf/rv/AfifiRB10,
author = {Djihed Afifi and
David E. Rydeheard and
Howard Barringer},
title = {{ESAT:} {A} Tool for Animating Logic-Based Specifications of Evolvable
Component Systems},
booktitle = {{RV}},
series = {Lecture Notes in Computer Science},
volume = {6418},
pages = {469--474},
publisher = {Springer},
year = {2010}
}
@inproceedings{DBLP:conf/sigcomm/KrioukovMAKCK10,
author = {Andrew Krioukov and
Prashanth Mohan and
Sara Alspaugh and
Laura Keys and
David E. Culler and
Randy H. Katz},
title = {NapSAC: design and implementation of a power-proportional web cluster},
booktitle = {Green Networking},
pages = {15--22},
publisher = {{ACM}},
year = {2010}
}
@article{DBLP:journals/ife/MillardHADGWW09,
author = {David E. Millard and
Yvonne Margaret Howard and
Noura Abbas and
Hugh C. Davis and
Lester Gilbert and
Gary B. Wills and
Robert John Walters},
title = {Pragmatic web service design: An agile approach with the service responsibility
and interaction design method},
journal = {Comput. Sci. Res. Dev.},
volume = {24},
number = {4},
pages = {173--184},
year = {2009}
}
@article{DBLP:journals/igpl/BarringerGR09,
author = {Howard Barringer and
Dov M. Gabbay and
David E. Rydeheard},
title = {Modelling evolvable component systems: Part {I:} {A} logical framework},
journal = {Log. J. {IGPL}},
volume = {17},
number = {6},
pages = {631--696},
year = {2009}
}
@article{DBLP:journals/jssc/RohamCDRHHGM09,
author = {Masoud Roham and
Daniel P. Covey and
David P. Daberkow and
Eric S. Ramsson and
Christopher D. Howard and
Byron A. Heidenreich and
Paul A. Garris and
Pedram Mohseni},
title = {A Wireless {IC} for Time-Share Chemical and Electrical Neural Recording},
journal = {{IEEE} J. Solid State Circuits},
volume = {44},
number = {12},
pages = {3645--3658},
year = {2009}
}
@article{DBLP:journals/neuroimage/NeemaGGHGHWHHAB09,
author = {Mohit Neema and
Daniel Goldberg{-}Zimring and
Zachary D. Guss and
Brian C. Healy and
Charles R. G. Guttmann and
Maria K. Houtchens and
Howard L. Weiner and
Mark A. Horsfield and
David B. Hackney and
David C. Alsop and
Rohit Bakshi},
title = {3 {T} {MRI} relaxometry detects {T2} prolongation in the cerebral
normal-appearing white matter in multiple sclerosis},
journal = {NeuroImage},
volume = {46},
number = {3},
pages = {633--641},
year = {2009}
}
@article{DBLP:journals/order/BiroH09,
author = {Csaba Bir{\'{o}} and
David M. Howard},
title = {The First Three Levels of an Order Preserving Hamiltonian Path in
the Subset Lattice},
journal = {Order},
volume = {26},
number = {2},
pages = {101--107},
year = {2009}
}
@article{DBLP:journals/tbe/PreeceGKH09,
author = {Stephen J. Preece and
John Yannis Goulermas and
Laurence P. J. Kenney and
David Howard},
title = {A Comparison of Feature Extraction Methods for the Classification
of Dynamic Activities From Accelerometer Data},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {56},
number = {3},
pages = {871--879},
year = {2009}
}
@inproceedings{DBLP:conf/candc/BusseBHDFL09,
author = {Daniela K. Busse and
Eli Blevis and
Catherine Howard and
Brinda Dalal and
David Fore and
Lara Lee},
title = {Designing for a sustainable future},
booktitle = {Creativity {\&} Cognition},
pages = {493--494},
publisher = {{ACM}},
year = {2009}
}
@inproceedings{DBLP:conf/darpa/FergusonHL09,
author = {Dave Ferguson and
Thomas M. Howard and
Maxim Likhachev},
title = {Motion Planning in Urban Environments},
booktitle = {The {DARPA} Urban Challenge},
series = {Springer Tracts in Advanced Robotics},
volume = {56},
pages = {61--89},
publisher = {Springer},
year = {2009}
}
@inproceedings{DBLP:conf/darpa/UrmsonABBBCDDGGGHHHKKLMMPPRRSSSSSWWZBBDLNSZSTDF09,
author = {Chris Urmson and
Joshua Anhalt and
Drew Bagnell and
Christopher R. Baker and
Robert Bittner and
M. N. Clark and
John M. Dolan and
Dave Duggins and
Tugrul Galatali and
Christopher Geyer and
Michele Gittleman and
Sam Harbaugh and
Martial Hebert and
Thomas M. Howard and
Sascha Kolski and
Alonzo Kelly and
Maxim Likhachev and
Matthew McNaughton and
Nick Miller and
Kevin M. Peterson and
Brian Pilnick and
Raj Rajkumar and
Paul E. Rybski and
Bryan Salesky and
Young{-}Woo Seo and
Sanjiv Singh and
Jarrod M. Snider and
Anthony Stentz and
William Whittaker and
Ziv Wolkowicki and
Jason Ziglar and
Hong Bae and
Thomas Brown and
Daniel Demitrish and
Bakhtiar Litkouhi and
Jim Nickolaou and
Varsha Sadekar and
Wende Zhang and
Joshua Struble and
Michael Taylor and
Michael Darms and
Dave Ferguson},
title = {Autonomous Driving in Urban Environments: Boss and the Urban Challenge},
booktitle = {The {DARPA} Urban Challenge},
series = {Springer Tracts in Advanced Robotics},
volume = {56},
pages = {1--59},
publisher = {Springer},
year = {2009}
}
@inproceedings{DBLP:conf/ectel/MillardHMABV09,
author = {David E. Millard and
Yvonne Margaret Howard and
Patrick McSweeney and
Miguel Arrebola and
Kate Borthwick and
Stavroula Varella},
title = {Phantom Tasks and Invisible Rubric: The Challenges of Remixing Learning
Objects in the Wild},
booktitle = {{EC-TEL}},
series = {Lecture Notes in Computer Science},
volume = {5794},
pages = {127--139},
publisher = {Springer},
year = {2009}
}
@inproceedings{DBLP:conf/fsr/FurlongHW09,
author = {P. Michael Furlong and
Thomas M. Howard and
David Wettergreen},
title = {Model Predictive Control for Mobile Robots with Actively Reconfigurable
Chassis},
booktitle = {{FSR}},
series = {Springer Tracts in Advanced Robotics},
volume = {62},
pages = {469--478},
publisher = {Springer},
year = {2009}
}
@inproceedings{DBLP:conf/gecco/HowardBL09,
author = {Gerard David Howard and
Larry Bull and
Pier Luca Lanzi},
title = {Towards continuous actions in continuous space and time using self-adaptive
constructivism in neural {XCSF}},
booktitle = {{GECCO}},
pages = {1219--1226},
publisher = {{ACM}},
year = {2009}
}
@inproceedings{DBLP:conf/icalt/MillardHMABW09,
author = {David E. Millard and
Yvonne Margaret Howard and
Patrick McSweeney and
Miguel Arrebola and
Kate Borthwick and
Julie Watson},
title = {The Language Box: Re-imagining Teaching and Learning Repositories},
booktitle = {{ICALT}},
pages = {619--623},
publisher = {{IEEE} Computer Society},
year = {2009}
}
@inproceedings{DBLP:conf/icsoc/FosterMRU09,
author = {Howard Foster and
Arun Mukhija and
David S. Rosenblum and
Sebasti{\'{a}}n Uchitel},
title = {Engage: Engineering Service Modes with WS-Engineer and Dino},
booktitle = {ICSOC/ServiceWave},
series = {Lecture Notes in Computer Science},
volume = {5900},
pages = {641--642},
year = {2009}
}
@inproceedings{DBLP:conf/interspeech/SpeedMH09,
author = {Matt Speed and
Damian T. Murphy and
David M. Howard},
title = {Characteristics of two-dimensional finite difference techniques for
vocal tract analysis and voice synthesis},
booktitle = {{INTERSPEECH}},
pages = {768--771},
publisher = {{ISCA}},
year = {2009}
}
@inproceedings{DBLP:conf/iwcls/HowardBL09,
author = {Gerard David Howard and
Larry Bull and
Pier Luca Lanzi},
title = {Use of a Connection-Selection Scheme in Neural {XCSF}},
booktitle = {{IWLCS}},
series = {Lecture Notes in Computer Science},
volume = {6471},
pages = {87--106},
publisher = {Springer},
year = {2009}
}
@inproceedings{DBLP:conf/maveba/HowardBD09,
author = {David M. Howard and
Jude Brereton and
Helena Daffern},
title = {Case study of voice quality differences in a soprano singing in different
early music performance styles},
booktitle = {{MAVEBA}},
pages = {175--178},
publisher = {Firenze University Press / {ISCA}},
year = {2009}
}
@inproceedings{DBLP:conf/rv/BarringerHRG09,
author = {Howard Barringer and
Klaus Havelund and
David E. Rydeheard and
Alex Groce},
title = {Rule Systems for Runtime Verification: {A} Short Tutorial},
booktitle = {{RV}},
series = {Lecture Notes in Computer Science},
volume = {5779},
pages = {1--24},
publisher = {Springer},
year = {2009}
}
@inproceedings{DBLP:conf/sccg/ChalmersHM09,
author = {Alan Chalmers and
David M. Howard and
Christopher Moir},
title = {Real virtuality: a step change from virtual reality},
booktitle = {{SCCG}},
pages = {9--16},
publisher = {{ACM}},
year = {2009}
}
@inproceedings{DBLP:conf/waspaa/SpeedMH09,
author = {Matt Speed and
Damian T. Murphy and
David M. Howard},
title = {Acoustic coupling in multi-dimensional finite difference schemes for
physically modeled voice synthesis},
booktitle = {{WASPAA}},
pages = {5--8},
publisher = {{IEEE}},
year = {2009}
}
@inproceedings{DBLP:journals/corr/abs-1003-1682,
author = {Howard Barringer and
Alex Groce and
Klaus Havelund and
Margaret H. Smith},
title = {An Entry Point for Formal Methods: Specification and Analysis of Event
Logs},
booktitle = {{FMA}},
series = {{EPTCS}},
volume = {20},
pages = {16--21},
year = {2009}
}
@article{DBLP:journals/ijkl/MillardDDGHTW08,
author = {David E. Millard and
Karl Doody and
Hugh C. Davis and
Lester Gilbert and
Yvonne Margaret Howard and
Feng (Barry) Tao and
Gary B. Wills},
title = {(Semantic web) services for e-learning},
journal = {Int. J. Knowl. Learn.},
volume = {4},
number = {2/3},
pages = {298--315},
year = {2008}
}
@article{DBLP:journals/intr/ChenC08,
author = {Yen{-}Hao Howard Chen and
David Corkindale},
title = {Towards an understanding of the behavioral intention to use online
news services: An exploratory study},
journal = {Internet Res.},
volume = {18},
number = {3},
pages = {286--312},
year = {2008}
}
@article{DBLP:journals/jfr/FergusonHL08,
author = {Dave Ferguson and
Thomas M. Howard and
Maxim Likhachev},
title = {Motion planning in urban environments},
journal = {J. Field Robotics},
volume = {25},
number = {11-12},
pages = {939--960},
year = {2008}
}
@article{DBLP:journals/jfr/HowardGKF08,
author = {Thomas M. Howard and
Colin J. Green and
Alonzo Kelly and
Dave Ferguson},
title = {State space sampling of feasible motions for high-performance mobile
robot navigation in complex environments},
journal = {J. Field Robotics},
volume = {25},
number = {6-7},
pages = {325--345},
year = {2008}
}
@article{DBLP:journals/jfr/UrmsonABBBCDDGGGHHHKKLMMPPRRSSSSSWWZBBDLNSZSTDF08,
author = {Chris Urmson and
Joshua Anhalt and
Drew Bagnell and
Christopher R. Baker and
Robert Bittner and
M. N. Clark and
John M. Dolan and
Dave Duggins and
Tugrul Galatali and
Christopher Geyer and
Michele Gittleman and
Sam Harbaugh and
Martial Hebert and
Thomas M. Howard and
Sascha Kolski and
Alonzo Kelly and
Maxim Likhachev and
Matthew McNaughton and
Nick Miller and
Kevin M. Peterson and
Brian Pilnick and
Raj Rajkumar and
Paul E. Rybski and
Bryan Salesky and
Young{-}Woo Seo and
Sanjiv Singh and
Jarrod M. Snider and
Anthony Stentz and
William Whittaker and
Ziv Wolkowicki and
Jason Ziglar and
Hong Bae and
Thomas Brown and
Daniel Demitrish and
Bakhtiar Litkouhi and
Jim Nickolaou and
Varsha Sadekar and
Wende Zhang and
Joshua Struble and
Michael Taylor and
Michael Darms and
Dave Ferguson},
title = {Autonomous driving in urban environments: Boss and the Urban Challenge},
journal = {J. Field Robotics},
volume = {25},
number = {8},
pages = {425--466},
year = {2008}
}
@article{DBLP:journals/jssc/VangalHRDWTFSJJ08,
author = {Sriram R. Vangal and
Jason Howard and
Gregory Ruhl and
Saurabh Dighe and
Howard Wilson and
James W. Tschanz and
David Finan and
Arvind P. Singh and
Tiju Jacob and
Shailendra Jain and
Vasantha Erraguntla and
Clark Roberts and
Yatin Vasant Hoskote and
Nitin Borkar and
Shekhar Borkar},
title = {An 80-Tile Sub-100-W TeraFLOPS Processor in 65-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {43},
number = {1},
pages = {29--41},
year = {2008}
}
@article{DBLP:journals/midm/UrowitzWAEDHPL08,
author = {Sara Urowitz and
David Wiljer and
Emma Apatu and
Gunther Eysenbach and
Claudette DeLenardo and
Tamara Harth and
Howard Pai and
Kevin J. Leonard},
title = {Is Canada ready for patient accessible electronic health records?
{A} national scan},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {8},
pages = {33},
year = {2008}
}
@article{DBLP:journals/nrhm/MillardBBCDHW08,
author = {David E. Millard and
Chris Bailey and
Philip Boulain and
Swapna Chennupati and
Hugh C. Davis and
Yvonne Margaret Howard and
Gary B. Wills},
title = {Semantics on demand: Can a Semantic Wiki replace a knowledge base?},
journal = {New Rev. Hypermedia Multim.},
volume = {14},
number = {1},
pages = {95--120},
year = {2008}
}
@article{DBLP:journals/order/HowardCCK08,
author = {David M. Howard and
Gab{-}Byung Chae and
Minseok Cheong and
Sang{-}Mok Kim},
title = {Irreducible Width 2 Posets of Linear Discrepancy 3},
journal = {Order},
volume = {25},
number = {2},
pages = {105--119},
year = {2008}
}
@article{DBLP:journals/pervasive/TresadernTKHG08,
author = {Philip A. Tresadern and
Sibylle B. Thies and
Laurence P. J. Kenney and
David Howard and
John Yannis Goulermas},
title = {Rapid Prototyping for Functional Electrical Stimulation Control},
journal = {{IEEE} Pervasive Comput.},
volume = {7},
number = {2},
pages = {62--69},
year = {2008}
}
@article{DBLP:journals/tgrs/McGuireWSAMCRCLWGMMCHSSTEMPTHM08,
author = {Patrick C. McGuire and
Michael J. Wolff and
Michael D. Smith and
Raymond E. Arvidson and
Scott L. Murchie and
R. Todd Clancy and
Ted L. Roush and
Selby C. Cull and
Kim A. Lichtenberg and
Sandra M. Wiseman and
Robert O. Green and
Terry Z. Martin and
Ralph E. Milliken and
Peter J. Cavender and
David C. Humm and
Frank P. Seelos and
Kim D. Seelos and
Howard W. Taylor and
Bethany L. Ehlmann and
John F. Mustard and
Shannon M. Pelkey and
Timothy N. Titus and
Christopher D. Hash and
Erick R. Malaret},
title = {{MRO/CRISM} Retrieval of Surface Lambert Albedos for Multispectral
Mapping of Mars With DISORT-Based Radiative Transfer Modeling: Phase
1 - Using Historical Climatology for Temperatures, Aerosol Optical
Depths, and Atmospheric Pressures},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {46},
number = {12},
pages = {4020--4040},
year = {2008}
}
@article{DBLP:journals/tnn/GoulermasFNLZKTTH08,
author = {John Yannis Goulermas and
Andrew H. Findlow and
Christopher J. Nester and
Panos Liatsis and
Xiao{-}Jun Zeng and
Laurence P. J. Kenney and
Philip A. Tresadern and
Sibylle B. Thies and
David Howard},
title = {An Instance-Based Algorithm With Auxiliary Similarity Information
for the Estimation of Gait Kinematics From Wearable Sensors},
journal = {{IEEE} Trans. Neural Networks},
volume = {19},
number = {9},
pages = {1574--1582},
year = {2008}
}
@inproceedings{DBLP:conf/gecco/HowardB08,
author = {Gerard David Howard and
Larry Bull},
title = {On the effects of node duplication and connection-oriented constructivism
in neural {XCSF}},
booktitle = {{GECCO} (Companion)},
pages = {1977--1984},
publisher = {{ACM}},
year = {2008}
}
@inproceedings{DBLP:conf/gecco/HowardBL08,
author = {Gerard David Howard and
Larry Bull and
Pier Luca Lanzi},
title = {Self-adaptive constructivism in Neural {XCS} and {XCSF}},
booktitle = {{GECCO}},
pages = {1389--1396},
publisher = {{ACM}},
year = {2008}
}
@inproceedings{DBLP:conf/icalt/ZhangMWHFGS08,
author = {Pei Zhang and
David E. Millard and
Gary B. Wills and
Yvonne Margaret Howard and
Sue J. Faulds and
Lester Gilbert and
Dan Sparks},
title = {A Mobile Toolkit for Placement Learning},
booktitle = {{ICALT}},
pages = {92--96},
publisher = {{IEEE} Computer Society},
year = {2008}
}
@inproceedings{DBLP:conf/icsoc/FosterMRU08,
author = {Howard Foster and
Arun Mukhija and
David S. Rosenblum and
Sebasti{\'{a}}n Uchitel},
title = {A Model-Driven Approach to Dynamic and Adaptive Service Brokering
Using Modes},
booktitle = {{ICSOC}},
series = {Lecture Notes in Computer Science},
volume = {5364},
pages = {558--564},
year = {2008}
}
@inproceedings{DBLP:conf/icst/SimonsT08,
author = {Anthony J. H. Simons and
Christopher David Thomson},
title = {Benchmarking Effectiveness for Object-Oriented Unit Testing},
booktitle = {{ICST} Workshops},
pages = {375--379},
publisher = {{IEEE} Computer Society},
year = {2008}
}
@inproceedings{DBLP:conf/iros/FergusonHL08,
author = {Dave Ferguson and
Thomas M. Howard and
Maxim Likhachev},
title = {Motion planning in urban environments: Part {I}},
booktitle = {{IROS}},
pages = {1063--1069},
publisher = {{IEEE}},
year = {2008}
}
@inproceedings{DBLP:conf/iros/FergusonHL08a,
author = {Dave Ferguson and
Thomas M. Howard and
Maxim Likhachev},
title = {Motion planning in urban environments: Part {II}},
booktitle = {{IROS}},
pages = {1070--1076},
publisher = {{IEEE}},
year = {2008}
}
@inproceedings{DBLP:conf/isaim/BlairJIR08,
author = {Howard A. Blair and
David W. Jakel and
Robert J. Irwin and
Angel J. Rivera},
title = {Hybrid Programs: Symmetrically Combining Natively Discrete and Continuous
Truth-values},
booktitle = {{ISAIM}},
year = {2008}
}
@inproceedings{DBLP:conf/isbi/KwonMCM08,
author = {Jaerock Kwon and
David Mayerich and
Yoonsuck Choe and
Bruce H. McCormick},
title = {Automated lateral sectioning for Knife-Edge Scanning Microscopy},
booktitle = {{ISBI}},
pages = {1371--1374},
publisher = {{IEEE}},
year = {2008}
}
@inproceedings{DBLP:conf/iser/AndersonHAHK08,
author = {Dean M. Anderson and
Thomas M. Howard and
David Apfelbaum and
Herman Herman and
Alonzo Kelly},
title = {Coordinated Control and Range Imaging for Mobile Manipulation},
booktitle = {{ISER}},
series = {Springer Tracts in Advanced Robotics},
volume = {54},
pages = {547--556},
publisher = {Springer},
year = {2008}
}
@inproceedings{DBLP:conf/micro/ZhengLZGDZ08,
author = {Hongzhong Zheng and
Jiang Lin and
Zhao Zhang and
Eugene Gorbatov and
Howard David and
Zhichun Zhu},
title = {Mini-rank: Adaptive {DRAM} architecture for improving memory power
efficiency},
booktitle = {{MICRO}},
pages = {210--221},
publisher = {{IEEE} Computer Society},
year = {2008}
}
@inproceedings{DBLP:conf/sigmetrics/LinZZGDZ08,
author = {Jiang Lin and
Hongzhong Zheng and
Zhichun Zhu and
Eugene Gorbatov and
Howard David and
Zhao Zhang},
title = {Software thermal management of dram memory for multicore systems},
booktitle = {{SIGMETRICS}},
pages = {337--348},
publisher = {{ACM}},
year = {2008}
}
@inproceedings{DBLP:conf/wikis/KousettiMH08,
author = {Chrysovalanto Kousetti and
David E. Millard and
Yvonne Margaret Howard},
title = {A study of ontology convergence in a semantic Wiki},
booktitle = {Int. Sym. Wikis},
publisher = {{ACM}},
year = {2008}
}
@inproceedings{DBLP:conf/wikis/MillardLH08,
author = {David E. Millard and
Rebecca Lewis and
Yvonne Margaret Howard},
title = {LBWiki: a location-based Wiki},
booktitle = {Int. Sym. Wikis},
publisher = {{ACM}},
year = {2008}
}
@article{DBLP:journals/aim/ShrobeLBGWTHE07,
author = {Howard E. Shrobe and
Robert Laddaga and
Robert Balzer and
Neil M. Goldman and
David S. Wile and
Marcelo Tallis and
Tim Hollebeek and
Alexander Egyed},
title = {{AWDRAT:} {A} Cognitive Middleware System for Information Survivability},
journal = {{AI} Mag.},
volume = {28},
number = {3},
pages = {73--91},
year = {2007}
}
@article{DBLP:journals/cie/FoldenJPTWHJJLO07,
author = {Dwayne Folden and
Trent Jackson and
Michael Panique and
Rianon Tiensvold and
Richard S. Wolff and
Todd Howard and
Eric Julian and
Levi Junkert and
David L{\'{o}}pez and
Michael J. Oudshoorn},
title = {An aircraft cabin wireless system for games and video entertainment},
journal = {Comput. Entertain.},
volume = {5},
number = {1},
pages = {7},
year = {2007}
}
@article{DBLP:journals/ibmrd/BerridgeABBCDDKLMRSSSTRRRW07,
author = {Rex Berridge and
Robert M. Averill III and
Arnold E. Barish and
Michael A. Bowen and
Peter J. Camporese and
Jack DiLullo and
Peter E. Dudley and
Joachim Keinert and
David W. Lewis and
Robert D. Morel and
Thomas E. Rosser and
Nicole S. Schwartz and
Philip Shephard and
Howard H. Smith and
Dave Thomas and
Phillip J. Restle and
John R. Ripley and
Stephen L. Runyon and
Patrick M. Williams},
title = {{IBM} {POWER6} microprocessor physical design and design methodology},
journal = {{IBM} J. Res. Dev.},
volume = {51},
number = {6},
pages = {685--714},
year = {2007}
}
@article{DBLP:journals/jamia/BaschAISSLPYFBSMS07,
author = {Ethan Basch and
David Artz and
Alexia Iasonos and
John Speakman and
Kevin Shannon and
Kai Lin and
Charmaine Pun and
Henry Yong and
Paul Fearn and
Allison Barz and
Howard I. Scher and
Mary McCabe and
Deborah Schrag},
title = {Application of Information Technology: Evaluation of an Online Platform
for Cancer Patient Self-reporting of Chemotherapy Toxicities},
journal = {J. Am. Medical Informatics Assoc.},
volume = {14},
number = {3},
pages = {264--268},
year = {2007}
}
@article{DBLP:journals/jamia/SequistCHTSB07,
author = {Thomas D. Sequist and
Theresa Cullen and
Howard Hays and
Maile M. Taualii and
Steven R. Simon and
David W. Bates},
title = {Implementation and Use of an Electronic Health Record within the Indian
Health Service},
journal = {J. Am. Medical Informatics Assoc.},
volume = {14},
number = {2},
pages = {191--197},
year = {2007}
}
@article{DBLP:journals/jfr/CannonSDDGGLMBBCMMPRWZ07,
author = {Howard N. Cannon and
Carol R. Stoker and
Stephen E. Dunagan and
Kiel Davis and
Javier G{\'{o}}mez{-}Elvira and
Brian J. Glass and
Lawrence G. Lemke and
David P. Miller and
Rosalba Bonaccorsi and
Mark Branson and
Scott Christa and
Jos{\'{e}} Antonio Rodr{\'{\i}}guez Manfredi and
Erik Mumm and
Gale Paulsen and
Matt Roman and
Alois Winterholler and
Jhony R. Zavaleta},
title = {{MARTE:} Technology development and lessons learned from a Mars drilling
mission simulation},
journal = {J. Field Robotics},
volume = {24},
number = {10},
pages = {877--905},
year = {2007}
}
@article{DBLP:journals/order/HowardKY07,
author = {David M. Howard and
Mitchel T. Keller and
Stephen J. Young},
title = {A Characterization of Partially Ordered Sets with Linear Discrepancy
Equal to 2},
journal = {Order},
volume = {24},
number = {3},
pages = {139--153},
year = {2007}
}
@article{DBLP:journals/siamsc/ElmanHSST07,
author = {Howard C. Elman and
Victoria E. Howle and
John N. Shadid and
David J. Silvester and
Ray S. Tuminaro},
title = {Least Squares Preconditioners for Stabilized Discretizations of the
Navier-Stokes Equations},
journal = {{SIAM} J. Sci. Comput.},
volume = {30},
number = {1},
pages = {290--311},
year = {2007}
}
@article{DBLP:journals/taslp/MullenHM07,
author = {Jack Mullen and
David M. Howard and
Damian T. Murphy},
title = {Real-Time Dynamic Articulations in the 2-D Waveguide Mesh Vocal Tract
Model},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {15},
number = {2},
pages = {577--585},
year = {2007}
}
@article{DBLP:journals/toms/ElmanRS07,
author = {Howard C. Elman and
Alison Ramage and
David J. Silvester},
title = {Algorithm 866: IFISS, a Matlab toolbox for modelling incompressible
flow},
journal = {{ACM} Trans. Math. Softw.},
volume = {33},
number = {2},
pages = {14},
year = {2007}
}
@article{DBLP:journals/ton/ChenBSK07,
author = {Yan Chen and
David Bindel and
Han Hee Song and
Randy H. Katz},
title = {Algebra-based scalable overlay network monitoring: algorithms, evaluation,
and applications},
journal = {{IEEE/ACM} Trans. Netw.},
volume = {15},
number = {5},
pages = {1084--1097},
year = {2007}
}
@inproceedings{DBLP:conf/ecows/MillardDHGWAW07,
author = {David E. Millard and
Hugh C. Davis and
Yvonne Margaret Howard and
Lester Gilbert and
Robert John Walters and
Noura Abbas and
Gary B. Wills},
title = {The Service Responsibility and Interaction Design Method: Using an
Agile Approach for Web Service Design},
booktitle = {{ECOWS}},
pages = {235--244},
publisher = {{IEEE} Computer Society},
year = {2007}
}
@inproceedings{DBLP:conf/gecco/HowardTC07,
author = {David M. Howard and
Andy M. Tyrrell and
Crispin H. V. Cooper},
title = {Evolution of adult male oral tract shapes for close and open vowels},
booktitle = {{GECCO} (Companion)},
pages = {2751--2758},
publisher = {{ACM}},
year = {2007}
}
@inproceedings{DBLP:conf/ht/WillsACCGHMWW07,
author = {Gary B. Wills and
Noura Abbas and
Rakhi Chandrasekharan and
Richard M. Crowder and
Lester Gilbert and
Yvonne Margaret Howard and
David E. Millard and
Sylvia C. Wong and
Robert John Walters},
title = {An agile hypertext design methodology},
booktitle = {Hypertext},
pages = {181--184},
publisher = {{ACM}},
year = {2007}
}
@inproceedings{DBLP:conf/icalt/MillardFGHSSW07,
author = {David E. Millard and
Karen Fill and
Lester Gilbert and
Yvonne Margaret Howard and
Patrick A. S. Sinclair and
Damilola O. Senbanjo and
Gary B. Wills},
title = {Towards a Canonical View of Peer Assessment},
booktitle = {{ICALT}},
pages = {793--797},
publisher = {{IEEE} Computer Society},
year = {2007}
}
@inproceedings{DBLP:conf/ipps/JanovySSM07,
author = {David L. Janovy and
Jay Smith and
Howard Jay Siegel and
Anthony A. Maciejewski},
title = {Models and Heuristics for Robust Resource Allocation in Parallel and
Distributed Computing Systems},
booktitle = {{IPDPS}},
pages = {1--5},
publisher = {{IEEE}},
year = {2007}
}
@inproceedings{DBLP:conf/ipps/SmithBMSRSLSJGADP07,
author = {Jay Smith and
Luis Diego Briceno and
Anthony A. Maciejewski and
Howard Jay Siegel and
Timothy Renner and
Vladimir Shestak and
Joshua Ladd and
Andrew M. Sutton and
David L. Janovy and
Sudha Govindasamy and
Amin Alqudah and
Rinku Dewri and
Puneet Prakash},
title = {Measuring the Robustness of Resource Allocations in a Stochastic Dynamic
Environment},
booktitle = {{IPDPS}},
pages = {1--10},
publisher = {{IEEE}},
year = {2007}
}
@inproceedings{DBLP:conf/isbi/MayerichMK07,
author = {David Mayerich and
Bruce H. McCormick and
John Keyser},
title = {Noise and Artifact Removal in Knife-Edge Scanning Microscopy},
booktitle = {{ISBI}},
pages = {556--559},
publisher = {{IEEE}},
year = {2007}
}
@inproceedings{DBLP:conf/isca/LinZZDZ07,
author = {Jiang Lin and
Hongzhong Zheng and
Zhichun Zhu and
Howard David and
Zhao Zhang},
title = {Thermal modeling and management of {DRAM} memory systems},
booktitle = {{ISCA}},
pages = {312--322},
publisher = {{ACM}},
year = {2007}
}
@inproceedings{DBLP:conf/ispass/LinZZZD07,
author = {Jiang Lin and
Hongzhong Zheng and
Zhichun Zhu and
Zhao Zhang and
Howard David},
title = {DRAM-Level Prefetching for Fully-Buffered {DIMM:} Design, Performance
and Power Saving},
booktitle = {{ISPASS}},
pages = {94--104},
publisher = {{IEEE} Computer Society},
year = {2007}
}
@inproceedings{DBLP:conf/isscc/TschanzKDHRVNHWLSTSTFKBAD07,
author = {James W. Tschanz and
Nam{-}Sung Kim and
Saurabh Dighe and
Jason Howard and
Gregory Ruhl and
Sriram R. Vangal and
Siva G. Narendra and
Yatin Hoskote and
Howard Wilson and
Carol Lam and
Matthew Shuman and
Carlos Tokunaga and
Dinesh Somasekhar and
Stephen Tang and
David Finan and
Tanay Karnik and
Nitin Borkar and
Nasser A. Kurd and
Vivek De},
title = {Adaptive Frequency and Biasing Techniques for Tolerance to Dynamic
Temperature-Voltage Variations and Aging},
booktitle = {{ISSCC}},
pages = {292--604},
publisher = {{IEEE}},
year = {2007}
}
@inproceedings{DBLP:conf/isscc/VangalHRDWTFISJJVHB07,
author = {Sriram R. Vangal and
Jason Howard and
Gregory Ruhl and
Saurabh Dighe and
Howard Wilson and
James W. Tschanz and
David Finan and
Priya Iyer and
Arvind P. Singh and
Tiju Jacob and
Shailendra Jain and
Sriram Venkataraman and
Yatin Hoskote and
Nitin Borkar},
title = {An 80-Tile 1.28TFLOPS Network-on-Chip in 65nm {CMOS}},
booktitle = {{ISSCC}},
pages = {98--589},
publisher = {{IEEE}},
year = {2007}
}
@inproceedings{DBLP:conf/lfcs/BlairJIR07,
author = {Howard A. Blair and
David W. Jakel and
Robert J. Irwin and
Angel J. Rivera},
title = {Elementary Differential Calculus on Discrete and Hybrid Structures},
booktitle = {{LFCS}},
series = {Lecture Notes in Computer Science},
volume = {4514},
pages = {41--53},
publisher = {Springer},
year = {2007}
}
@inproceedings{DBLP:conf/rv/BarringerGR07,
author = {Howard Barringer and
Dov M. Gabbay and
David E. Rydeheard},
title = {From Runtime Verification to Evolvable Systems},
booktitle = {{RV}},
series = {Lecture Notes in Computer Science},
volume = {4839},
pages = {97--110},
publisher = {Springer},
year = {2007}
}
@inproceedings{DBLP:conf/rv/BarringerRH07,
author = {Howard Barringer and
David E. Rydeheard and
Klaus Havelund},
title = {Rule Systems for Run-Time Monitoring: From Eagleto RuleR},
booktitle = {{RV}},
series = {Lecture Notes in Computer Science},
volume = {4839},
pages = {111--125},
publisher = {Springer},
year = {2007}
}
@inproceedings{DBLP:conf/saso/ShrobeLBGWTHE07,
author = {Howard E. Shrobe and
Robert Laddaga and
Robert Balzer and
Neil M. Goldman and
David S. Wile and
Marcelo Tallis and
Tim Hollebeek and
Alexander Egyed},
title = {Self-Adaptive Systems for Information Survivability: {PMOP} and {AWDRAT}},
booktitle = {{SASO}},
pages = {332--335},
publisher = {{IEEE} Computer Society},
year = {2007}
}
@inproceedings{DBLP:conf/sigsoft/FosterEKMRU07,
author = {Howard Foster and
Wolfgang Emmerich and
Jeff Kramer and
Jeff Magee and
David S. Rosenblum and
Sebasti{\'{a}}n Uchitel},
title = {Model checking service compositions under resource constraints},
booktitle = {{ESEC/SIGSOFT} {FSE}},
pages = {225--234},
publisher = {{ACM}},
year = {2007}
}
@inproceedings{DBLP:conf/soda/ApplegateCJKLW07,
author = {David L. Applegate and
Gruia C{\u{a}}linescu and
David S. Johnson and
Howard J. Karloff and
Katrina Ligett and
Jia Wang},
title = {Compressing rectilinear pictures and minimizing access control lists},
booktitle = {{SODA}},
pages = {1066--1075},
publisher = {{SIAM}},
year = {2007}
}
@inproceedings{DBLP:conf/tase/BarringerRG07,
author = {Howard Barringer and
David E. Rydeheard and
Dov M. Gabbay},
title = {A Logical Framework for Monitoring and Evolving Software Components},
booktitle = {{TASE}},
pages = {273--282},
publisher = {{IEEE} Computer Society},
year = {2007}
}
@inproceedings{DBLP:conf/vtc/ChuangXHCM07,
author = {James Chuang and
Ni Xin and
Howard Huang and
Simon Chiu and
David G. Michelson},
title = {{UWB} Radiowave Propagation within the Passenger Cabin of a Boeing
737-200 Aircraft},
booktitle = {{VTC} Spring},
pages = {496--500},
publisher = {{IEEE}},
year = {2007}
}
@proceedings{DBLP:conf/iwsos/2007,
editor = {David Hutchison and
Randy H. Katz},
title = {Self-Organizing Systems, Second International Workshop, {IWSOS} 2007,
The Lake District, UK, September 11-13, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4725},
publisher = {Springer},
year = {2007}
}
@article{DBLP:journals/cbm/ShoemakerBWBCCLDBJ06,
author = {William C. Shoemaker and
David S. Bayard and
Charles C. J. Wo and
Andreas Botnen and
Linda S. Chan and
Li{-}Chien Chien and
Kevin Lu and
Demetrios Demetriades and
Howard Belzberg and
Roger W. Jelliffe},
title = {Stochastic model for outcome prediction in acute illness},
journal = {Comput. Biol. Medicine},
volume = {36},
number = {6},
pages = {585--600},
year = {2006}
}
@article{DBLP:journals/cluster/KimHKSJILPPF06,
author = {Jong{-}Kook Kim and
Debra A. Hensgen and
Taylor Kidd and
Howard Jay Siegel and
David St. John and
Cynthia E. Irvine and
Timothy E. Levin and
N. Wayne Porter and
Viktor K. Prasanna and
Richard F. Freund},
title = {A flexible multi-dimensional QoS performance measure framework for
distributed heterogeneous systems},
journal = {Clust. Comput.},
volume = {9},
number = {3},
pages = {281--296},
year = {2006}
}
@article{DBLP:journals/eor/French06,
author = {Simon French},
title = {Howard Raiffa, John Richardson and David Metcalfe, Editors, Negotiation
Analysis: The Science and Art of Collaborative Decision Making, Harvard
University Press, Cambridge, Mass {(2002)} {ISBN} 0-674-00890-1, p.
xiv+548 {GBP32.95}},
journal = {Eur. J. Oper. Res.},
volume = {168},
number = {2},
pages = {655--656},
year = {2006}
}
@article{DBLP:journals/taslp/CooperMHT06,
author = {Crispin H. V. Cooper and
Damian T. Murphy and
David M. Howard and
Alexander Tyrrell},
title = {Singing synthesis with an evolved physical model},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {14},
number = {4},
pages = {1454--1461},
year = {2006}
}
@article{DBLP:journals/taslp/MullenHM06,
author = {Jack Mullen and
David M. Howard and
Damian T. Murphy},
title = {Waveguide physical modeling of vocal tract acoustics: flexible formant
bandwidth control from increased model dimensionality},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {14},
number = {3},
pages = {964--971},
year = {2006}
}
@inproceedings{DBLP:conf/aaai/ShrobeLBGWTHE06,
author = {Howard E. Shrobe and
Robert Laddaga and
Robert Balzer and
Neil M. Goldman and
David S. Wile and
Marcelo Tallis and
Tim Hollebeek and
Alexander Egyed},
title = {{AWDRAT:} {A} Cognitive Middleware System for Information Survivability},
booktitle = {{AAAI}},
pages = {1836--1843},
publisher = {{AAAI} Press},
year = {2006}
}
@inproceedings{DBLP:conf/cdc/MillerTL06,
author = {Haynes R. Miller and
David L. Trumper and
Kent H. Lundberg},
title = {A Brief Treatment of Generalized Functions for Use in Teaching the
Laplace Transform},
booktitle = {{CDC}},
pages = {3885--3889},
publisher = {{IEEE}},
year = {2006}
}
@inproceedings{DBLP:conf/dac/ShiH06,
author = {Kaijian Shi and
David Howard},
title = {Challenges in sleep transistor design and implementation in low-power
designs},
booktitle = {{DAC}},
pages = {113--116},
publisher = {{ACM}},
year = {2006}
}
@inproceedings{DBLP:conf/ecce/ManserHG06,
author = {Tanja Manser and
Steven K. Howard and
David M. Gaba},
title = {Self-regulation as a central mechanism to collaboratively manage unexpected
events in complex work environments},
booktitle = {{ECCE}},
pages = {162--169},
publisher = {{ACM}},
year = {2006}
}
@inproceedings{DBLP:conf/ecows/MillardHCDJGW06,
author = {David E. Millard and
Yvonne Margaret Howard and
Swapna Chennupati and
Hugh C. Davis and
Ehtesham{-}Rasheed Jam and
Lester Gilbert and
Gary B. Wills},
title = {Design Patterns for Wrapping Similar Legacy Systems with Common Service
Interfaces},
booktitle = {{ECOWS}},
pages = {191--200},
publisher = {{IEEE} Computer Society},
year = {2006}
}
@inproceedings{DBLP:conf/embc/TresadernTKHG06,
author = {Philip A. Tresadern and
Sibylle B. Thies and
Laurence P. J. Kenney and
David Howard and
John Yannis Goulermas},
title = {Artificial Neural Network Prediction Using Accelerometers to Control
Upper Limb {FES} During Reaching and Grasping Following Stroke},
booktitle = {{EMBC}},
pages = {2916--2919},
publisher = {{IEEE}},
year = {2006}
}
@inproceedings{DBLP:conf/icalt/MillardBDGHW06,
author = {David E. Millard and
Christopher Bailey and
Hugh C. Davis and
Lester Gilbert and
Yvonne Margaret Howard and
Gary B. Wills},
title = {The e-Learning Assessment Landscape},
booktitle = {{ICALT}},
pages = {964--966},
publisher = {{IEEE} Computer Society},
year = {2006}
}
@inproceedings{DBLP:conf/ijcnn/MichelAR06,
author = {Howard E. Michel and
Abdul Ahad S. Awwal and
David Rancour},
title = {Artificial Neural Networks Using Complex Numbers and Phase Encoded
Weights - Electronic and Optical Implementations},
booktitle = {{IJCNN}},
pages = {486--491},
publisher = {{IEEE}},
year = {2006}
}
@inproceedings{DBLP:conf/vtc/LiouHM06,
author = {Anthony E.{-}L. Liou and
Howard H.{-}H. Huang and
David G. Michelson},
title = {Issues in the Estimation of Ricean K-Factor from Correlated Samples},
booktitle = {{VTC} Fall},
pages = {1--4},
publisher = {{IEEE}},
year = {2006}
}
@inproceedings{DBLP:conf/woc/FoldenHJJJLPTOW06,
author = {Dwayne Folden and
Todd Howard and
Trent Jackson and
Eric Julian and
Levi Junkert and
David L{\'{o}}pez and
Michael Panique and
Rianon Tiensvold and
Michael J. Oudshoorn and
Richard S. Wolff},
title = {A Wireless Computer Games and Video Entertainment System for the Aircraft
Cabin Environment},
booktitle = {Wireless and Optical Communications},
publisher = {{IASTED/ACTA} Press},
year = {2006}
}
@article{DBLP:journals/cn/BeckVWSPCRSHVITFLLFKHGGJFBKRGGSHHE05,
author = {Richard A. Beck and
Robert K. Vincent and
Doyle W. Watts and
Marc A. Seibert and
David P. Pleva and
Michael A. Cauley and
Calvin T. Ramos and
Theresa M. Scott and
Dean W. Harter and
Mary Vickerman and
David Irmies and
Al Tucholski and
Brian Frantz and
Glenn Lindamood and
Isaac Lopez and
Gregory J. Follen and
Thaddeus J. Kollar and
Jay Horowitz and
Robert Griffin and
Raymond Gilstrap and
Marjory J. Johnson and
Kenneth Freeman and
Celeste Banaag and
Joseph Kosmo and
Amy Ross and
Kevin Groneman and
Jeffrey Graham and
Kim Shillcutt and
Robert Hirsh and
Nathan Howard and
Dean B. Eppler},
title = {A space-based end-to-end prototype geographic information network
for lunar and planetary exploration and emergency response {(2002}
and 2003 field experiments)},
journal = {Comput. Networks},
volume = {47},
number = {5},
pages = {765--783},
year = {2005}
}
@article{DBLP:journals/jbi/BuckeridgeBCHM05,
author = {David L. Buckeridge and
Howard S. Burkom and
Murray Campbell and
William R. Hogan and
Andrew W. Moore},
title = {Algorithms for rapid outbreak detection: a research synthesis},
journal = {J. Biomed. Informatics},
volume = {38},
number = {2},
pages = {99--113},
year = {2005}
}
@article{DBLP:journals/jcc/NguyenHH05,
author = {Thanh Ha Nguyen and
David E. Hibbs and
Si{\^{a}}n T. Howard},
title = {Conformations, energies, and intramolecular hydrogen bonds in dicarboxylic
acids: Implications for the design of synthetic dicarboxylic acid
receptors},
journal = {J. Comput. Chem.},
volume = {26},
number = {12},
pages = {1233--1241},
year = {2005}
}
@article{DBLP:journals/jml/BlairBH05,
author = {David Blair and
Andreas Blass and
Paul E. Howard},
title = {Divisibility of Dedekind finite Sets},
journal = {J. Math. Log.},
volume = {5},
number = {1},
year = {2005}
}
@article{DBLP:journals/jocn/JohnsonSKRALD05,
author = {Sterling C. Johnson and
Taylor W. Schmitz and
Tisha N. Kawahara{-}Baccus and
Howard A. Rowley and
Andrew L. Alexander and
Jonghoon Lee and
Richard J. Davidson},
title = {The Cerebral Response during Subjective Choice with and without Self-reference},
journal = {J. Cogn. Neurosci.},
volume = {17},
number = {12},
pages = {1897--1906},
year = {2005}
}
@article{DBLP:journals/pc/ShivleSSMBCDKPPSSSSSV05,
author = {Sameer Shivle and
Prasanna Sugavanam and
Howard Jay Siegel and
Anthony A. Maciejewski and
Tarun Banka and
Kiran Chindam and
Steve Dussinger and
Andrew Kutruff and
Prashanth Penumarthy and
Prakash Pichumani and
Praveen Satyasekaran and
David Sendek and
Jay Smith and
J. Sousa and
Jayashree Sridharan and
Jose Velazco},
title = {Mapping subtasks with multiple versions on an ad hoc grid},
journal = {Parallel Comput.},
volume = {31},
number = {7},
pages = {671--690},
year = {2005}
}
@article{DBLP:journals/taslp/CamposH05,
author = {G. R. Campos and
David M. Howard},
title = {On the Computational Efficiency of Different Waveguide Mesh Topologies
for Room Acoustic Simulation},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {13},
number = {5-2},
pages = {1063--1072},
year = {2005}
}
@article{DBLP:journals/tbe/GoulermasFNHB05,
author = {John Yannis Goulermas and
Andrew H. Findlow and
Christopher J. Nester and
David Howard and
Peter Bowker},
title = {Automated design of robust discriminant analysis classifier for foot
pressure lesions using kinematic data},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {52},
number = {9},
pages = {1549--1562},
year = {2005}
}
@inproceedings{DBLP:conf/acl/BelvinEGGKMMNNT05,
author = {Robert S. Belvin and
Emil Ettelaie and
Sudeep Gandhe and
Panayiotis G. Georgiou and
Kevin Knight and
Daniel Marcu and
Scott Millward and
Shrikanth S. Narayanan and
Howard Neely and
David R. Traum},
title = {Transonics: {A} Practical Speech-to-Speech Translator for English-Farsi
Medical Dialogs},
booktitle = {{ACL}},
pages = {89--92},
publisher = {The Association for Computer Linguistics},
year = {2005}
}
@inproceedings{DBLP:conf/birthday/BarringerR05,
author = {Howard Barringer and
David E. Rydeheard},
title = {Modelling Evolvable Systems: {A} Temporal Logic View},
booktitle = {We Will Show Them! {(1)}},
pages = {195--228},
publisher = {College Publications},
year = {2005}
}
@inproceedings{DBLP:conf/clawar/KenneyTMBBHSHAHBHS05,
author = {Laurence P. J. Kenney and
Paul Taylor and
Geraldine Mann and
Gerrit Bultstra and
Hendrik Buschman and
Hermie J. Hermens and
Per J. Slycke and
John Hobby and
N. van der Aa and
Ben W. Heller and
A. Barker and
David Howard and
N. Sha},
title = {Recent Developments in Implantable and Surface Based Dropped Foot
Functional Electrical Stimulators},
booktitle = {{CLAWAR}},
pages = {89--96},
publisher = {Springer},
year = {2005}
}
@inproceedings{DBLP:conf/cpsn/MichelR05,
author = {Howard E. Michel and
David Rancour},
title = {Using Heat Plumes in Controlled Breathing as Non-Contact Assistive
Technology},
booktitle = {{CPSN}},
pages = {63--69},
publisher = {{CSREA} Press},
year = {2005}
}
@inproceedings{DBLP:conf/igarss/JunyentFMCBF05,
author = {Francesc Junyent and
Stephen J. Frasier and
David J. McLaughlin and
Venkatachalam Chandrasekar and
Howard Bluestein and
Michael French},
title = {High resolution dual-polarization radar observation of tornados: implications
for radar development and tornado detection},
booktitle = {{IGARSS}},
pages = {2034--2037},
publisher = {{IEEE}},
year = {2005}
}
@article{DBLP:journals/ejasp/HowardR04,
author = {David M. Howard and
Stuart Rimell},
title = {Real-Time Gesture-Controlled Physical Modelling Music Synthesis with
Tactile Feedback},
journal = {{EURASIP} J. Adv. Signal Process.},
volume = {2004},
number = {7},
pages = {1001--1006},
year = {2004}
}
@article{DBLP:journals/ijon/McCormickKCAKMMD04,
author = {Bruce H. McCormick and
Wonryull Koh and
Yoonsuck Choe and
Louise C. Abbott and
John Keyser and
David Mayerich and
Zeki Melek and
Purna Doddapaneni},
title = {Construction of anatomically correct models of mouse brain networks},
journal = {Neurocomputing},
volume = {58-60},
pages = {379--386},
year = {2004}
}
@inproceedings{DBLP:conf/aaaifs/NarayananABEGGG04,
author = {Shri Narayanan and
S. Ananthakrishnan and
Robert S. Belvin and
Emil Ettelaie and
Sudeep Gandhe and
Shadi Ganjavi and
Panayiotis G. Georgiou and
C. M. Hein and
S. Kadambe and
Kevin Knight and
Daniel Marcu and
Howard Neely and
Naveen Srinivasamurthy and
David R. Traum and
Dagen Wang},
title = {The Transonics Spoken Dialogue Translator: An Aid for English-Persian
Doctor-Patient Interviews},
booktitle = {{AAAI} Technical Report {(4)}},
volume = {{FS-04-04}},
pages = {97--103},
publisher = {{AAAI} Press},
year = {2004}
}
@inproceedings{DBLP:conf/asist/OConnorBWMMM04,
author = {Brian C. O'Connor and
David Blair and
Howard D. White and
Francis Miksa and
Jens{-}Erik Mai and
Shawne D. Miksa},
title = {Knowledge, information and behavior - {A} tribute to Patrick Wilson
{(SIG} HFIS, {CR)}},
booktitle = {{ASIST}},
series = {Proc. Assoc. Inf. Sci. Technol.},
volume = {41},
number = {1},
pages = {554},
publisher = {Wiley},
year = {2004}
}
@inproceedings{DBLP:conf/bncod/CawseyDPWMM04,
author = {Alison Cawsey and
Euan W. Dempster and
Daniel Pacey and
M. Howard Williams and
David H. Marwick and
Lachlan M. MacKinnon},
title = {Constraining {XML} Transformations for Personalised Information Presentation},
booktitle = {{BNCOD}},
series = {Lecture Notes in Computer Science},
volume = {3112},
pages = {136--143},
publisher = {Springer},
year = {2004}
}
@inproceedings{DBLP:conf/ccgrid/FigueiraNCCDGHLMMT04,
author = {Silvia M. Figueira and
Sumit Naiksatam and
Howard J. Cohen and
Doug Cutrell and
Paul Daspit and
David Gutierrez and
Doan B. Hoang and
Tal Lavian and
Joe Mambretti and
Steve Merrill and
Franco Travostino},
title = {{DWDM-RAM:} enabling Grid services with dynamic optical networks},
booktitle = {{CCGRID}},
pages = {707--714},
publisher = {{IEEE} Computer Society},
year = {2004}
}
@inproceedings{DBLP:conf/ccgrid/LavianMCCMDDMNFGHT04,
author = {Tal Lavian and
Joe Mambretti and
Doug Cutrell and
Howard J. Cohen and
Steve Merrill and
Ramesh Durairaj and
Paul Daspit and
Inder Monga and
Sumit Naiksatam and
Silvia M. Figueira and
David Gutierrez and
Doan B. Hoang and
Franco Travostino},
title = {{DWDM-RAM:} a data intensive Grid service architecture enabled by
dynamic optical networks},
booktitle = {{CCGRID}},
pages = {762--764},
publisher = {{IEEE} Computer Society},
year = {2004}
}
@inproceedings{DBLP:conf/csreaESA/MichelRI04,
author = {Howard E. Michel and
David Rancour and
Sushanth Iringentavida},
title = {{CMOS} Implementation of Phase-Encoded Complex-Valued Artificial Neural
Networks},
booktitle = {{ESA/VLSI}},
pages = {551--557},
publisher = {{CSREA} Press},
year = {2004}
}
@inproceedings{DBLP:conf/evoW/CooperHT04,
author = {Crispin H. V. Cooper and
David M. Howard and
Andrew M. Tyrrell},
title = {Using GAs to Create a Waveguide Model of the Oral Vocal Tract},
booktitle = {EvoWorkshops},
series = {Lecture Notes in Computer Science},
volume = {3005},
pages = {280--288},
publisher = {Springer},
year = {2004}
}
@inproceedings{DBLP:conf/hicss/FalknerDHMMN04,
author = {Katrina Falkner and
Henry Detmold and
Diana Howard and
David S. Munro and
Ronald Morrison and
Stuart J. Norcross},
title = {Unifying Static and Dynamic Approaches to Evolution through the Compliant
Systems Architecture},
booktitle = {{HICSS}},
publisher = {{IEEE} Computer Society},
year = {2004}
}
@inproceedings{DBLP:conf/infocom/MaoJRWK04,
author = {Zhuoqing Morley Mao and
David Johnson and
Jennifer Rexford and
Jia Wang and
Randy H. Katz},
title = {Scalable and Accurate Identification of AS-level Forwarding Paths},
booktitle = {{INFOCOM}},
pages = {1605--1615},
publisher = {{IEEE}},
year = {2004}
}
@inproceedings{DBLP:conf/ipps/ShivleCSMBCDPSSSSSSV04,
author = {Sameer Shivle and
Ralph H. Castain and
Howard Jay Siegel and
Anthony A. Maciejewski and
Tarun Banka and
Kiran Chindam and
Steve Dussinger and
Prakash Pichumani and
Praveen Satyasekaran and
William W. Saylor and
David Sendek and
J. Sousa and
Jayashree Sridharan and
Prasanna Sugavanam and
Jose Velazco},
title = {Static Mapping of Subtasks in a Heterogeneous Ad Hoc Grid Environment},
booktitle = {{IPDPS}},
publisher = {{IEEE} Computer Society},
year = {2004}
}
@inproceedings{DBLP:conf/ispdc/ShivleSMBCDKPPSSSSSV04,
author = {Sameer Shivle and
Howard Jay Siegel and
Anthony A. Maciejewski and
Tarun Banka and
Kiran Chindam and
Steve Dussinger and
Andrew Kutruff and
Prashanth Penumarthy and
Prakash Pichumani and
Praveen Satyasekaran and
David Sendek and
J. Sousa and
Jayashree Sridharan and
Prasanna Sugavanam and
Jose Velazco},
title = {Mapping of Subtasks with Multiple Versions in a Heterogeneous Ad Hoc
Grid Environment},
booktitle = {ISPDC/HeteroPar},
pages = {380--387},
publisher = {{IEEE} Computer Society},
year = {2004}
}
@inproceedings{DBLP:conf/para/BalleBLR04,
author = {Susanne M. Balle and
John L. Bishop and
David LaFrance{-}Linden and
Howard Rifkin},
title = {Ygdrasil: Aggregator Network Toolkit for Large Scale Systems and the
Grid},
booktitle = {{PARA}},
series = {Lecture Notes in Computer Science},
volume = {3732},
pages = {207--216},
publisher = {Springer},
year = {2004}
}
@inproceedings{DBLP:conf/sab/PaytonEH04,
author = {David W. Payton and
Regina Estkowski and
Mike Howard},
title = {Pheromone Robotics and the Logic of Virtual Pheromones},
booktitle = {Swarm Robotics},
series = {Lecture Notes in Computer Science},
volume = {3342},
pages = {45--57},
publisher = {Springer},
year = {2004}
}
@inproceedings{DBLP:conf/sigcomm/ChenBSK04,
author = {Yan Chen and
David Bindel and
Han Hee Song and
Randy H. Katz},
title = {An algebraic approach to practical and scalable overlay network monitoring},
booktitle = {{SIGCOMM}},
pages = {55--66},
publisher = {{ACM}},
year = {2004}
}
@inproceedings{DBLP:conf/visualization/McCormickDMMK04,
author = {Bruce H. McCormick and
Purna Doddapaneni and
David Mayerich and
Zeki Melek and
John Keyser},
title = {Compression, Segmentation, and Modeling of Large-Scale Filamentary
Volumetric Data},
booktitle = {{IEEE} Visualization},
pages = {31},
publisher = {{IEEE} Computer Society},
year = {2004}
}
@article{DBLP:journals/jssc/HoskoteBDEFHKNR03,
author = {Yatin Vasant Hoskote and
Bradley A. Bloechel and
Gregory E. Dermer and
Vasantha Erraguntla and
David Finan and
Jason Howard and
Dan Klowden and
Siva G. Narendra and
Greg Ruhl and
James W. Tschanz and
Sriram R. Vangal and
Venkat Veeramachaneni and
Howard Wilson and
Jianping Xu and
Nitin Borkar},
title = {A {TCP} offload accelerator for 10 Gb/s Ethernet in 90-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {38},
number = {11},
pages = {1866--1875},
year = {2003}
}
@article{DBLP:journals/qip/AbbottDCLBHFGBK03,
author = {Derek Abbott and
Charles R. Doering and
Carlton M. Caves and
Daniel M. Lidar and
Howard E. Brandt and
Alex R. Hamilton and
David K. Ferry and
Julio Gea{-}Banacloche and
Sergey M. Bezrukov and
Laszlo B. Kish},
title = {Dreams Versus Reality: Plenary Debate Session on Quantum Computing},
journal = {Quantum Inf. Process.},
volume = {2},
number = {6},
pages = {449--472},
year = {2003}
}
@article{DBLP:journals/ras/PaytonEH03,
author = {David W. Payton and
Regina Estkowski and
Mike Howard},
title = {Compound behaviors in pheromone robotics},
journal = {Robotics Auton. Syst.},
volume = {44},
number = {3-4},
pages = {229--240},
year = {2003}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003}
}
@article{DBLP:journals/tgrs/StrowHSMT03,
author = {Larrabee L. Strow and
Scott E. Hannon and
Sergio De Souza{-}Machado and
Howard E. Motteler and
David C. Tobin},
title = {An overview of the {AIRS} radiative transfer model},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {41},
number = {2},
pages = {303--313},
year = {2003}
}
@inproceedings{DBLP:conf/amia/MavigliaSBK03,
author = {Saverio M. Maviglia and
Howard R. Strasberg and
David W. Bates and
Gilad J. Kuperman},
title = {KnowledgeLink Update: Just-in-time Context-sensitive Information Retrieval},
booktitle = {{AMIA}},
publisher = {{AMIA}},
year = {2003}
}
@inproceedings{DBLP:conf/bncod/DempsterPWCMM03,
author = {Euan W. Dempster and
Daniel Pacey and
M. Howard Williams and
Alison Cawsey and
David H. Marwick and
Lachlan M. MacKinnon},
title = {Tools for Personalised Presentation of Information},
booktitle = {{BNCOD}},
series = {Lecture Notes in Computer Science},
volume = {2712},
pages = {261--270},
publisher = {Springer},
year = {2003}
}
@inproceedings{DBLP:conf/bncod/HowardDFM03,
author = {Diana Howard and
Henry Detmold and
Katrina Falkner and
David S. Munro},
title = {Using the Compliant Systems Architecture to Deliver Flexible Policies
within Two-Phase Commit},
booktitle = {{BNCOD}},
series = {Lecture Notes in Computer Science},
volume = {2712},
pages = {245--252},
publisher = {Springer},
year = {2003}
}
@inproceedings{DBLP:conf/eon/GoldbergMMQ03,
author = {Howard Goldberg and
Alfredo Morales and
David MacMillan and
Matthew Quinlan},
title = {An Ontology-Driven Application to Improve the Prescription of Educational
Resources to Parents of Premature Infants},
booktitle = {{EON}},
series = {{CEUR} Workshop Proceedings},
volume = {87},
publisher = {CEUR-WS.org},
year = {2003}
}
@inproceedings{DBLP:conf/huc/KoileTDSD03,
author = {Kimberle Koile and
Konrad Tollmar and
David Demirdjian and
Howard E. Shrobe and
Trevor Darrell},
title = {Activity Zones for Context-Aware Computing},
booktitle = {UbiComp},
series = {Lecture Notes in Computer Science},
volume = {2864},
pages = {90--106},
publisher = {Springer},
year = {2003}
}
@inproceedings{DBLP:conf/iadis/PaceyWDCMM03,
author = {Daniel Pacey and
M. Howard Williams and
Euan W. Dempster and
Alison Cawsey and
David H. Marwick and
Lachlan M. MacKinnon},
title = {Recreating Personalization Features of the Youngster Mobile Service
Platform with the Dip Toolkit},
booktitle = {{ICWI}},
pages = {1035--1038},
publisher = {{IADIS}},
year = {2003}
}
@inproceedings{DBLP:conf/imc/ChenBK03,
author = {Yan Chen and
David Bindel and
Randy H. Katz},
title = {Tomography-based overlay network monitoring},
booktitle = {Internet Measurement Conference},
pages = {216--231},
publisher = {{ACM}},
year = {2003}
}
@inproceedings{DBLP:conf/jcdl/McArthurGB03,
author = {David McArthur and
Sarah Giersch and
Howard Burrows},
title = {Sustainability Issues and Activities for the {NSDL}},
booktitle = {{JCDL}},
pages = {395},
publisher = {{IEEE} Computer Society},
year = {2003}
}
@inproceedings{DBLP:conf/maveba/HowardWBH03,
author = {David M. Howard and
Graham F. Welch and
Jude Brereton and
Evangelos Himonides},
title = {Towards a novel real-time visual display for singing training},
booktitle = {{MAVEBA}},
pages = {179--182},
publisher = {Firenze University Press / {ISCA}},
year = {2003}
}
@inproceedings{DBLP:conf/mss/DiamondBCM03,
author = {Howard J. Diamond and
John J. Bates and
David M. Clark and
Robert L. Mairs},
title = {Archive Management: The Missing Component},
booktitle = {{IEEE} Symposium on Mass Storage Systems},
pages = {40--48},
publisher = {{IEEE} Computer Society},
year = {2003}
}
@inproceedings{DBLP:conf/nime/HowardRH03,
author = {David M. Howard and
Stuart Rimell and
Andy Hunt},
title = {Force Feedback Gesture Controlled Physical Modelling Synthesis},
booktitle = {{NIME}},
pages = {95--98},
publisher = {Faculty of Music, McGill University},
year = {2003}
}
@inproceedings{DBLP:conf/webi/PaceyDWCMM03,
author = {Daniel Pacey and
Euan W. Dempster and
M. Howard Williams and
Alison Cawsey and
David H. Marwick and
Lachlan M. MacKinnon},
title = {A Toolkit for Creating Personalized Presentations},
booktitle = {Web Intelligence},
pages = {550--553},
publisher = {{IEEE} Computer Society},
year = {2003}
}
@book{DBLP:books/daglib/0009529,
author = {David R. Westhead and
John Howard Parish and
Richard M. Twyman},
title = {Bioinformatics},
series = {Instant notes},
publisher = {{BIOS} Scientific Publishers},
year = {2002}
}
@article{DBLP:journals/cj/El-KhatibWMM02,
author = {Hazem Turki El Khatib and
M. Howard Williams and
David H. Marwick and
Lachlan M. MacKinnon},
title = {Using a Distributed Approach to Retrieve and Integrate Information
from Heterogeneous Distributed Databases},
journal = {Comput. J.},
volume = {45},
number = {4},
pages = {381--394},
year = {2002}
}
@article{DBLP:journals/cm/ClarkJRS02,
author = {David D. Clark and
Van Jacobson and
John Romkey and
Howard C. Salwen},
title = {An analysis of {TCP} processing overhead},
journal = {{IEEE} Commun. Mag.},
volume = {40},
number = {5},
pages = {94--101},
year = {2002}
}
@article{DBLP:journals/ibmrd/CurranCWCNHLEHS02,
author = {Brian W. Curran and
Yuen H. Chan and
Philip T. Wu and
Peter J. Camporese and
Gregory A. Northrop and
Robert F. Hatch and
Lisa B. Lacey and
James P. Eckhardt and
David T. Hui and
Howard H. Smith},
title = {{IBM} eServer z900 high-frequency microprocessor technology, circuits,
and design methodology},
journal = {{IBM} J. Res. Dev.},
volume = {46},
number = {4-5},
pages = {631},
year = {2002}
}
@article{DBLP:journals/jssc/GuoLCHKLCL02,
author = {Chun Bing Guo and
Chi{-}Wa Lo and
Yu{-}Wing Choi and
Issac Hsu and
Toby Kwok{-}Kei Kan and
David Leung and
Alan N. L. Chan and
Howard C. Luong},
title = {A fully integrated 900-MHz {CMOS} wireless receiver with on-chip {RF}
and {IF} filters and 79-dB image rejection},
journal = {{IEEE} J. Solid State Circuits},
volume = {37},
number = {8},
pages = {1084--1089},
year = {2002}
}
@article{DBLP:journals/nm/ElmanSW02,
author = {Howard C. Elman and
David J. Silvester and
Andrew J. Wathen},
title = {Performance and analysis of saddle point preconditioners for the discrete
steady-state Navier-Stokes equations},
journal = {Numerische Mathematik},
volume = {90},
number = {4},
pages = {665--688},
year = {2002}
}
@article{DBLP:journals/tvlsi/KopcsayKWDRS02,
author = {Gerard V. Kopcsay and
Byron Krauter and
David Widiger and
Alina Deutsch and
Barry J. Rubin and
Howard H. Smith},
title = {A comprehensive 2-D inductance modeling approach for {VLSI} interconnects:
frequency-dependent extraction and compact circuit model synthesis},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {10},
number = {6},
pages = {695--711},
year = {2002}
}
@inproceedings{DBLP:conf/ah/CawseyDBPWMM02,
author = {Alison Cawsey and
Euan W. Dempster and
Diana Bental and
Daniel Pacey and
M. Howard Williams and
Lachlan M. MacKinnon and
David H. Marwick},
title = {Preventing Misleading Presentations of {XML} Documents: Some Initial
Proposals},
booktitle = {{AH}},
series = {Lecture Notes in Computer Science},
volume = {2347},
pages = {492--496},
publisher = {Springer},
year = {2002}
}
@inproceedings{DBLP:conf/dgo/MacEachrenHLHDG02,
author = {Alan M. MacEachren and
Mark Harrower and
Bonan Li and
David Howard and
Roger Downs and
Mark Gahegan},
title = {Supporting statistical, graphic/cartographic, and domain literacy
through onlinelearning activities: MapStats for Kids},
booktitle = {{DG.O}},
series = {{ACM} International Conference Proceeding Series},
publisher = {Digital Government Research Center},
year = {2002}
}
@inproceedings{DBLP:conf/icmc/RimellHTKH02,
author = {Stuart Rimell and
David M. Howard and
Andy M. Tyrrell and
Ross Kirk and
Andy Hunt},
title = {Cymatic. Restoring the Physical Manifestation of Digital Sound Using
Haptic Interfaces to Control a New Computer Based Musical Instrument},
booktitle = {{ICMC}},
publisher = {Michigan Publishing},
year = {2002}
}
@article{DBLP:journals/arobots/PaytonDEHL01,
author = {David W. Payton and
Mike Daily and
Regina Estkowski and
Mike Howard and
Craig Lee},
title = {Pheromone Robotic},
journal = {Auton. Robots},
volume = {11},
number = {3},
pages = {319--324},
year = {2001}
}
@article{DBLP:journals/ce/Vermeer01,
author = {Ross Vermeer},
title = {The Virtual University: The Internet and Resource-based Learning:
Steve Ryan, Bernard Scott, Howard Freeman and Daxa Patel, Kogan Page,
London, 2000, 204 pp, {ISBN} 0 7494 2508 3, The Changing Face of Learning
Technology Edited by David Squires, Gr{\'{a}}inne Conole and
Gabriel Jacobs, University of Wales Press, Cardiff, 182pp, {ISBN}
0 7083 1681 6, Integrating Technology in Learning and Teaching Pat
Maier and Adam Warren, Kogan Page, London, 2000, 162 pp, {ISBN} 0
7494 31806},
journal = {Comput. Educ.},
volume = {37},
number = {2},
pages = {179--182},
year = {2001}
}
@article{DBLP:journals/cn/GribbleWBBCBCGHJKMRZ01,
author = {Steven D. Gribble and
Matt Welsh and
J. Robert von Behren and
Eric A. Brewer and
David E. Culler and
Nikita Borisov and
Steven E. Czerwinski and
Ramakrishna Gummadi and
Jon R. Hill and
Anthony D. Joseph and
Randy H. Katz and
Zhuoqing Morley Mao and
Steven J. Ross and
Ben Y. Zhao},
title = {The Ninja architecture for robust Internet-scale systems and services},
journal = {Comput. Networks},
volume = {35},
number = {4},
pages = {473--497},
year = {2001}
}
@article{DBLP:journals/infsof/PuaWM01,
author = {Chai Seng Pua and
M. Howard Williams and
David H. Marwick},
title = {Data placement in a parallel {DBMS} with multiple disks},
journal = {Inf. Softw. Technol.},
volume = {43},
number = {1},
pages = {41--51},
year = {2001}
}
@article{DBLP:journals/robotica/LiuH01,
author = {Anmin Liu and
David Howard},
title = {Kinematic design of crab-like legged vehicles},
journal = {Robotica},
volume = {19},
number = {1},
pages = {67--77},
year = {2001}
}
@article{DBLP:journals/titb/WilliamsVVM01,
author = {M. Howard Williams and
Gavin Venters and
George Venters and
David H. Marwick},
title = {Developing a regional healthcare information network},
journal = {{IEEE} Trans. Inf. Technol. Biomed.},
volume = {5},
number = {2},
pages = {177--180},
year = {2001}
}
@inproceedings{DBLP:conf/bcshci/BentalMWMPDC01,
author = {Diana Bental and
Lachlan M. MacKinnon and
M. Howard Williams and
David H. Marwick and
Daniel Pacey and
Euan W. Dempster and
Alison Cawsey},
title = {Dynamic Information Presentation through Web-based Personalisation
and Adaptation - An Initial Review},
booktitle = {{BCS} {HCI/IHM}},
pages = {485--499},
publisher = {Springer},
year = {2001}
}
@inproceedings{DBLP:conf/cicc/SmithDMWBDKK01,
author = {Howard H. Smith and
Aline Deutsch and
Sharad Mehrotra and
David Widiger and
Michael A. Bowen and
Allan H. Dansky and
Gerard V. Kopcsay and
Byron Krauter},
title = {R(f)L(f)C coupled noise evaluation of an {S/390} microprocessor chip},
booktitle = {{CICC}},
pages = {237--240},
publisher = {{IEEE}},
year = {2001}
}
@inproceedings{DBLP:conf/icics/ChenBBKK01,
author = {Yan Chen and
Adam W. Bargteil and
David Bindel and
Randy H. Katz and
John Kubiatowicz},
title = {Quantifying Network Denial of Service: {A} Location Service Case Study},
booktitle = {{ICICS}},
series = {Lecture Notes in Computer Science},
volume = {2229},
pages = {340--351},
publisher = {Springer},
year = {2001}
}
@inproceedings{DBLP:conf/ipps/KimKSILHJPFP01,
author = {Jong{-}Kook Kim and
Taylor Kidd and
Howard Jay Siegel and
Cynthia E. Irvine and
Timothy E. Levin and
Debra A. Hensgen and
David St. John and
Viktor K. Prasanna and
Richard F. Freund and
N. Wayne Porter},
title = {Collective Value of QoS: {A} Performance Measure Framework for Distributed
Heterogeneous Networks},
booktitle = {{IPDPS}},
pages = {84},
publisher = {{IEEE} Computer Society},
year = {2001}
}
@inproceedings{DBLP:conf/maveba/Howard01,
author = {David M. Howard},
title = {The real and the non-real in speech measurements},
booktitle = {{MAVEBA}},
pages = {35--44},
publisher = {{ISCA}},
year = {2001}
}
@article{DBLP:journals/csur/KaziCSL00,
author = {Iffat H. Kazi and
Howard H. Chen and
Berdenia Stanley and
David J. Lilja},
title = {Techniques for obtaining high performance in Java programs},
journal = {{ACM} Comput. Surv.},
volume = {32},
number = {3},
pages = {213--240},
year = {2000}
}
@article{DBLP:journals/dlib/AtkinsLRRSSS00,
author = {Helen Atkins and
Catherine Lyons and
Howard Ratner and
Carol Risher and
Chris Shillum and
David Sidman and
Andrew Stevens},
title = {Reference Linking with DOIs: {A} Case Study},
journal = {D Lib Mag.},
volume = {6},
number = {2},
year = {2000}
}
@article{DBLP:journals/ibmsj/DillenbergerBCDEGHOSJ00,
author = {Donna N. Dillenberger and
Rajesh Bordawekar and
Clarence W. Clark III and
Donald Durand and
David Emmes and
Osamu Gohda and
Sally Howard and
Michael F. Oliver and
Frank Samuel and
Robert W. St. John},
title = {Building a Java virtual machine for server applications: The Jvm on
{OS/390}},
journal = {{IBM} Syst. J.},
volume = {39},
number = {1},
pages = {194--210},
year = {2000}
}
@article{DBLP:journals/infsof/El-KhatibWMM00,
author = {Hazem Turki El Khatib and
M. Howard Williams and
Lachlan M. MacKinnon and
David H. Marwick},
title = {A framework and test-suite for assessing approaches to resolving heterogeneity
in distributed databases},
journal = {Inf. Softw. Technol.},
volume = {42},
number = {7},
pages = {505--515},
year = {2000}
}
@article{DBLP:journals/jcc/ChunPCWKASBBCNHF00,
author = {Hon M. Chun and
Carlos E. Padilla and
Donovan N. Chin and
Masakatsu Watanabe and
Valeri I. Karlov and
Howard E. Alper and
Keto Soosaar and
Kim B. Blair and
Oren M. Becker and
Leo S. D. Caves and
Robert Nagle and
David N. Haney and
Barry L. Farmer},
title = {{MBO(N)D:} {A} multibody method for long-time molecular dynamics simulations},
journal = {J. Comput. Chem.},
volume = {21},
number = {3},
pages = {159--184},
year = {2000}
}
@article{DBLP:journals/mva/GracePTS00,
author = {A. E. Grace and
David Pycock and
Howard T. Tillotson and
Martin S. Snaith},
title = {Active shape from stereo for highway inspection},
journal = {Mach. Vis. Appl.},
volume = {12},
number = {1},
pages = {7--15},
year = {2000}
}
@article{DBLP:journals/pc/PuaWM00,
author = {Chai Seng Pua and
M. Howard Williams and
David H. Marwick},
title = {Modelling parallel databases with process algebra},
journal = {Parallel Comput.},
volume = {26},
number = {13-14},
pages = {1909--1924},
year = {2000}
}
@article{DBLP:journals/pieee/LytelDNS00,
author = {Rick Lytel and
Howard L. Davidson and
Nyles Nettleton and
Theresa Sze},
title = {Optical interconnections within modern high-performance computing
systems},
journal = {Proc. {IEEE}},
volume = {88},
number = {6},
pages = {758--763},
year = {2000}
}
@article{DBLP:journals/robotica/MiaoH00,
author = {Shan Miao and
David Howard},
title = {Optimal tripod turning gait generation for hexapod walking machines},
journal = {Robotica},
volume = {18},
number = {6},
pages = {639--649},
year = {2000}
}
@article{DBLP:journals/tnn/MozerWGJK00,
author = {Michael C. Mozer and
Richard H. Wolniewicz and
David B. Grimes and
Eric Johnson and
Howard Kaushansky},
title = {Predicting subscriber dissatisfaction and improving retention in the
wireless telecommunications industry},
journal = {{IEEE} Trans. Neural Networks Learn. Syst.},
volume = {11},
number = {3},
pages = {690--696},
year = {2000}
}
@inproceedings{DBLP:conf/amia/RothschildUWEFB00,
author = {Jeffrey M. Rothschild and
Howard R. Underwood and
Jane Weeks and
Craig Earle and
Julie M. Fiskio and
David W. Bates},
title = {A Severity Adjustment System Using Electronic Data Sources for Predicting
Financial Outcomes for Oncology},
booktitle = {{AMIA}},
publisher = {{AMIA}},
year = {2000}
}
@inproceedings{DBLP:conf/assets/JackBMATRBP00,
author = {David Jack and
Rares F. Boian and
Alma S. Merians and
Sergei V. Adamovich and
Marilyn Tremaine and
Michael Recce and
Grigore C. Burdea and
Howard Poizner},
title = {A virtual reality-based exercise program for stroke rehabilitation},
booktitle = {{ASSETS}},
pages = {56--63},
publisher = {{ACM}},
year = {2000}
}
@inproceedings{DBLP:conf/euromicro/BattyGHTW00,
author = {S. V. Batty and
Paul Edwin Garner and
David M. Howard and
P. Turner and
A. D. White},
title = {The Development of a Portable Real-Time Display of Voice Source Characteristics},
booktitle = {{EUROMICRO}},
pages = {2419--2422},
publisher = {{IEEE} Computer Society},
year = {2000}
}
@inproceedings{DBLP:conf/euromicro/CamposH00,
author = {Guilherme Campos and
David M. Howard},
title = {On the Computation Time of Three-Dimensional Digital Waveguide Mesh
Acoustic Models},
booktitle = {{EUROMICRO}},
pages = {2332--2339},
publisher = {{IEEE} Computer Society},
year = {2000}
}
@inproceedings{DBLP:conf/euromicro/HuntHW00,
author = {Andy Hunt and
David M. Howard and
Jim Worsdall},
title = {Real-Time Interfaces for Speech and Singing},
booktitle = {{EUROMICRO}},
pages = {2356},
publisher = {{IEEE} Computer Society},
year = {2000}
}
@inproceedings{DBLP:conf/hicss/PletcherBL00,
author = {Klaus{-}Peter Behr and
James A. Freer and
Howard Levine and
Timothy A. Pletcher and
Warren Russel and
David J. Treloar and
Dag von Lubitz and
William Wilkerson and
Eric Wolf},
title = {An Immersive Virtual Reality Platform for Medical Education: Introduction
to the Medical Readiness Trainer},
booktitle = {{HICSS}},
publisher = {{IEEE} Computer Society},
year = {2000}
}
@inproceedings{DBLP:conf/mr/PaytonDHHL00,
author = {David W. Payton and
Michael J. Daily and
Bruce Hoff and
Michael D. Howard and
Craig Lee},
title = {Pheromone robotics},
booktitle = {Mobile Robots / Telemanipulator and Telepresence Technologies},
series = {{SPIE} Proceedings},
volume = {4195},
pages = {67--75},
publisher = {{SPIE}},
year = {2000}
}
@inproceedings{DBLP:conf/pdp/KimHKSJILPPF00,
author = {Jong{-}Kook Kim and
Debra A. Hensgen and
Taylor Kidd and
Howard Jay Siegel and
David St. John and
Cynthia E. Irvine and
Timothy E. Levin and
N. Wayne Porter and
Viktor K. Prasanna and
Richard F. Freund},
title = {A QoS performance measure framework for distributed heterogeneous
networks},
booktitle = {{PDP}},
pages = {18--27},
publisher = {{IEEE} Computer Society},
year = {2000}
}
@article{DBLP:journals/cc/BarringtonS99,
author = {David A. Mix Barrington and
Howard Straubing},
title = {Lower bounds for modular counting by circuits with modular gates},
journal = {Comput. Complex.},
volume = {8},
number = {3},
pages = {258--272},
year = {1999}
}
@article{DBLP:journals/comj/Wooten99,
author = {Arthur Wooten},
title = {David M. Howard and James Angus: Acoustics and Psychoacoustics},
journal = {Comput. Music. J.},
volume = {23},
number = {2},
pages = {99--100},
year = {1999}
}
@article{DBLP:journals/dsp/HowardS99,
author = {David Howard and
Jim Schroeder},
title = {Multiscale Models for Target Detection and Background Discrimination
in Synthetic Aperture Radar Imagery},
journal = {Digit. Signal Process.},
volume = {9},
number = {3},
pages = {149--161},
year = {1999}
}
@article{DBLP:journals/ibmrd/AverillBBCDHHMMMMNSSWW99,
author = {Robert M. Averill III and
Keith G. Barkley and
Michael A. Bowen and
Peter J. Camporese and
Allan H. Dansky and
Robert F. Hatch and
Dale E. Hoffman and
Mark D. Mayo and
Scott A. McCabe and
Timothy G. McNamara and
Thomas J. McPherson and
Gregory A. Northrop and
Leon J. Sigal and
Howard H. Smith and
David A. Webber and
Patrick M. Williams},
title = {Chip integration methodology for the {IBM} {S/390} {G5} and {G6} custom
microprocessors},
journal = {{IBM} J. Res. Dev.},
volume = {43},
number = {5},
pages = {681--706},
year = {1999}
}
@article{DBLP:journals/internet/EllisonFLLLM99,
author = {Robert J. Ellison and
David A. Fisher and
Richard C. Linger and
Howard F. Lipson and
Thomas A. Longstaff and
Nancy R. Mead},
title = {Survivability: Protecting Your Critical Systems},
journal = {{IEEE} Internet Comput.},
volume = {3},
number = {6},
pages = {55--63},
year = {1999}
}
@article{DBLP:journals/jss/HowardBJLKAC99,
author = {Geoffry S. Howard and
Thomas Bodnovich and
Thomas Janicki and
Jens Liegle and
Steven Klein and
Paul Albert and
David Cannon},
title = {The efficacy of matching information systems development methodologies
with application characteristics - an empirical study},
journal = {J. Syst. Softw.},
volume = {45},
number = {3},
pages = {177--195},
year = {1999}
}
@article{DBLP:journals/pc/GiolmasWCHYS99,
author = {Nicholas Giolmas and
Daniel W. Watson and
David M. Chelberg and
Peter V. Henstock and
June{-}Ho Yi and
Howard Jay Siegel},
title = {Aspects of computational mode and data distribution for parallel range
image segmentation},
journal = {Parallel Comput.},
volume = {25},
number = {5},
pages = {499--523},
year = {1999}
}
@inproceedings{DBLP:conf/euromicro/DasHS99,
author = {M. Das and
David M. Howard and
Stephen L. Smith},
title = {Motion Curves in Music: The Statistical Analysis of Midi Data},
booktitle = {{EUROMICRO}},
pages = {2013--2019},
publisher = {{IEEE} Computer Society},
year = {1999}
}
@inproceedings{DBLP:conf/euromicro/GarnerH99,
author = {Paul Edwin Garner and
David M. Howard},
title = {Distance Learning Support for Teaching Musical Temperament},
booktitle = {{EUROMICRO}},
pages = {2042},
publisher = {{IEEE} Computer Society},
year = {1999}
}
@inproceedings{DBLP:conf/euromicro/GibsonHT99,
author = {Ian S. Gibson and
David M. Howard and
Andrew M. Tyrrell},
title = {A Parallel Processing System for Polyphonic Singing Synthesis},
booktitle = {{EUROMICRO}},
pages = {2070--2074},
publisher = {{IEEE} Computer Society},
year = {1999}
}
@inproceedings{DBLP:conf/euromicro/Howard99,
author = {David M. Howard},
title = {Workshop Chair Introduction: Music Technology and Audio Processing},
booktitle = {{EUROMICRO}},
pages = {2004},
publisher = {{IEEE} Computer Society},
year = {1999}
}
@inproceedings{DBLP:conf/euromicro/Howard99a,
author = {David M. Howard},
title = {Digital Waveguide Modelling of Room Acoustics: Comparing Mesh Topologies},
booktitle = {{EUROMICRO}},
pages = {2082},
publisher = {{IEEE} Computer Society},
year = {1999}
}
@inproceedings{DBLP:conf/hcw/HensgenKJSSBMAKILFKGDCKPBA99,
author = {Debra A. Hensgen and
Taylor Kidd and
David St. John and
Matthew C. Schnaidt and
Howard Jay Siegel and
Tracy D. Braun and
Muthucumaru Maheswaran and
Shoukat Ali and
Jong{-}Kook Kim and
Cynthia E. Irvine and
Timothy E. Levin and
Richard F. Freund and
Matt Kussow and
Michael W. Godfrey and
Alpay Duman and
Paul Carff and
Shirley Kidd and
Viktor K. Prasanna and
Prashanth B. Bhat and
Ammar H. Alhusaini},
title = {An Overview of {MSHN:} The Management System for Heterogeneous Networks},
booktitle = {Heterogeneous Computing Workshop},
pages = {184--198},
publisher = {{IEEE} Computer Society},
year = {1999}
}
@inproceedings{DBLP:conf/hicss/FisherL99,
author = {David A. Fisher and
Howard F. Lipson},
title = {Emergent Algorithms - {A} New Method for Enhancing Survivability in
Unbounded Systems},
booktitle = {{HICSS}},
publisher = {{IEEE} Computer Society},
year = {1999}
}
@inproceedings{DBLP:conf/icmc/GibsonHT99,
author = {Ian S. Gibson and
David M. Howard and
Andrew M. Tyrrell},
title = {Composing With the York Polyphonic Real-Time Singing Synthesiser},
booktitle = {{ICMC}},
publisher = {Michigan Publishing},
year = {1999}
}
@inproceedings{DBLP:conf/icmc/MurphyH99,
author = {Damian T. Murphy and
David M. Howard},
title = {The WaveVerb Multi-Channel Room Acoustics Modelling System},
booktitle = {{ICMC}},
publisher = {Michigan Publishing},
year = {1999}
}
@inproceedings{DBLP:conf/interact/DunckleySH99,
author = {Lynne Dunckley and
Andy Smith and
David Howard},
title = {Designing for Shared Interfaces with Diverse User Groups},
booktitle = {{INTERACT}},
pages = {630--636},
publisher = {{IOS} Press},
year = {1999}
}
@inproceedings{DBLP:conf/ishpc/GobioffNG99,
author = {Howard Gobioff and
David Nagle and
Garth A. Gibson},
title = {Integrity and Performance in Network Attached Storage},
booktitle = {{ISHPC}},
series = {Lecture Notes in Computer Science},
volume = {1615},
pages = {244--256},
publisher = {Springer},
year = {1999}
}
@inproceedings{DBLP:conf/mie/WilliamsVVM99,
author = {M. Howard Williams and
Gavin Venters and
George Venters and
David H. Marwick},
title = {Developing a Health Care Information System for Scotland},
booktitle = {{MIE}},
series = {Studies in Health Technology and Informatics},
volume = {68},
pages = {125--128},
publisher = {{IOS} Press},
year = {1999}
}
@inproceedings{DBLP:conf/nips/MozerWGJK99,
author = {Michael Mozer and
Richard H. Wolniewicz and
David B. Grimes and
Eric Johnson and
Howard Kaushansky},
title = {Churn Reduction in the Wireless Industry},
booktitle = {{NIPS}},
pages = {935--941},
publisher = {The {MIT} Press},
year = {1999}
}
@inproceedings{DBLP:conf/nspw/LipsonF99,
author = {Howard F. Lipson and
David A. Fisher},
title = {Survivability - a new technical and business perspective on security},
booktitle = {{NSPW}},
pages = {33--39},
publisher = {{ACM}},
year = {1999}
}
@inproceedings{DBLP:conf/pdp/PriceHLT99,
author = {Tony P. W. Price and
David M. Howard and
Alwyn V. Lewis and
Andrew M. Tyrrell},
title = {Adaptive microphone array beamforming for teleconferencing using {VHDL}
and parallel architectures},
booktitle = {{PDP}},
pages = {13--18},
publisher = {{IEEE} Computer Society},
year = {1999}
}
@inproceedings{DBLP:journals/sigcse/BlumS99,
author = {Howard Blum and
David A. Sachs},
title = {An asynchronous distance-learning course in data communications and
networks},
booktitle = {ITiCSE-WGR},
pages = {52--55},
publisher = {{ACM}},
year = {1999}
}
@incollection{DBLP:books/sp/99/BlairDJRS99,
author = {Howard A. Blair and
Fred Dushin and
David W. Jakel and
Angel J. Rivera and
T. Metin Sezgin},
title = {Continuous Models of Computation for Logic Programs: Importing Continuous
Mathematics into Logic Programming's Algorithmic Foundations},
booktitle = {The Logic Programming Paradigm},
series = {Artificial Intelligence},
pages = {231--255},
publisher = {Springer},
year = {1999}
}
@article{DBLP:journals/jiis/MacKinnonMW98,
author = {Lachlan M. MacKinnon and
David H. Marwick and
M. Howard Williams},
title = {A Model for Query Decomposition and Answer Construction in Heterogeneous
Distributed Database Systems},
journal = {J. Intell. Inf. Syst.},
volume = {11},
number = {1},
pages = {69--87},
year = {1998}
}
@article{DBLP:journals/jirs/HowardZ98,
author = {David W. Howard and
Ali Zilouchian},
title = {Application of Fuzzy Logic for the Solution of Inverse Kinematics
and Hierarchical Controls of Robotic Manipulators},
journal = {J. Intell. Robotic Syst.},
volume = {23},
number = {2-4},
pages = {217--247},
year = {1998}
}
@article{DBLP:journals/mam/PriceHT98,
author = {Tony P. W. Price and
David M. Howard and
Andrew M. Tyrrell},
title = {Stereo output transputer interface board},
journal = {Microprocess. Microsystems},
volume = {22},
number = {2},
pages = {87--101},
year = {1998}
}
@article{DBLP:journals/sLogica/BauerleACJ98,
author = {Frank A. B{\"{a}}uerle and
David W. Albrecht and
John N. Crossley and
John S. Jeavons},
title = {Curry-Howard Terms for Linear Logic},
journal = {Stud Logica},
volume = {61},
number = {2},
pages = {223--235},
year = {1998}
}
@article{DBLP:journals/simpra/TyrrellHB98,
author = {Andrew M. Tyrrell and
David M. Howard and
Tim S. Brookes},
title = {Transputer-based human hearing simulation},
journal = {Simul. Pract. Theory},
volume = {6},
number = {5},
pages = {479--491},
year = {1998}
}
@article{DBLP:journals/tgrs/DinerBRBCKMADGGMMSPV98,
author = {David J. Diner and
Jewel C. Beckert and
Terrence H. Reilly and
Carol J. Bruegge and
James E. Conel and
Ralph A. Kahn and
John V. Martonchik and
Thomas P. Ackerman and
Roger Davies and
Siegfried A. W. Gerstl and
Howard R. Gordon and
Jan{-}Peter Muller and
Ranga B. Myneni and
Piers J. Sellers and
Bernard Pinty and
Michel M. Verstraete},
title = {Multi-angle Imaging SpectroRadiometer {(MISR)} instrument description
and experiment overview},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {36},
number = {4},
pages = {1072--1087},
year = {1998}
}
@article{DBLP:journals/tgrs/MartonchikDKAVPG98,
author = {John V. Martonchik and
David J. Diner and
Ralph A. Kahn and
Thomas P. Ackerman and
Michel M. Verstraete and
Bernard Pinty and
Howard R. Gordon},
title = {Techniques for the retrieval of aerosol properties over land and ocean
using multiangle imaging},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {36},
number = {4},
pages = {1212--1227},
year = {1998}
}
@article{DBLP:journals/tgrs/MartonchikDPVMKG98,
author = {John V. Martonchik and
David J. Diner and
Bernard Pinty and
Michel M. Verstraete and
Ranga B. Myneni and
Yuri Knyazikhin and
Howard R. Gordon},
title = {Determination of land and ocean reflective, radiative, and biophysical
properties using multiangle imaging},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {36},
number = {4},
pages = {1266--1281},
year = {1998}
}
@inproceedings{DBLP:conf/amia/JonesSADGMNRRRS98,
author = {Peter C. Jones and
Barry G. Silverman and
M. Athanasoulis and
D. Drucker and
Howard Goldberg and
J. Marsh and
C. Nguyen and
D. Ravichandar and
L. Reis and
David M. Rind and
Charles Safran},
title = {Nationwide telecare for diabetics: a pilot implementation of the {HOLON}
architecture},
booktitle = {{AMIA}},
publisher = {{AMIA}},
year = {1998}
}
@inproceedings{DBLP:conf/amia/UnderwoodML98,
author = {Howard R. Underwood and
J. Lloyd Michener and
David F. Lobach},
title = {Providing a Clinical Practice Guideline for Asthma Electronically
at the Point of Use to Promote Regional Standardization of Care},
booktitle = {{AMIA}},
publisher = {{AMIA}},
year = {1998}
}
@inproceedings{DBLP:conf/asplos/GibsonNABCGHRRZ98,
author = {Garth A. Gibson and
David Nagle and
Khalil Amiri and
Jeff Butler and
Fay W. Chang and
Howard Gobioff and
Charles Hardin and
Erik Riedel and
David Rochberg and
Jim Zelenka},
title = {A Cost-Effective, High-Bandwidth Storage Architecture},
booktitle = {{ASPLOS}},
pages = {92--103},
publisher = {{ACM} Press},
year = {1998}
}
@inproceedings{DBLP:conf/ieaaie/ZilouchianHJ98,
author = {Ali Zilouchian and
David W. Howard and
Timothy Jordanides},
title = {An Adaptive Neuro-Fuzzy Inference System {(ANFIS)} Approach to Control
of Robotic Manipulators},
booktitle = {{IEA/AIE} (Vol. 2)},
series = {Lecture Notes in Computer Science},
volume = {1416},
pages = {383--392},
publisher = {Springer},
year = {1998}
}
@article{DBLP:journals/bell/DorwardPPRTW97,
author = {Sean M. Dorward and
Rob Pike and
David L. Presotto and
Dennis M. Ritchie and
Howard W. Trickey and
Philip Winterbottom},
title = {The Inferno{\texttrademark} operating system},
journal = {Bell Labs Tech. J.},
volume = {2},
number = {1},
pages = {5--18},
year = {1997}
}
@article{DBLP:journals/dss/ShawGT97,
author = {Michael J. Shaw and
David M. Gardner and
Howard Thomas},
title = {Research opportunities in electronic commerce},
journal = {Decis. Support Syst.},
volume = {21},
number = {3},
pages = {149--156},
year = {1997}
}
@article{DBLP:journals/jdi/GurRKPFRK97,
author = {David Gur and
David A. Rubin and
Barry H. Kart and
Arleen M. Peterson and
Carl Fuhrman and
Howard E. Rockette and
Jill L. King},
title = {Forced choice and ordinal discrete rating assessment of image quality:
{A} comparison},
journal = {J. Digit. Imaging},
volume = {10},
number = {3},
pages = {103--107},
year = {1997}
}
@article{DBLP:journals/jsa/TyrrellBH97,
author = {Andrew M. Tyrrell and
Tim S. Brookes and
David M. Howard},
title = {{T9000} and {T800} transputers: {A} real-time application},
journal = {J. Syst. Archit.},
volume = {43},
number = {1-5},
pages = {341--344},
year = {1997}
}
@article{DBLP:journals/jssc/WilliamsonECDSL97,
author = {William Williamson III and
Steven B. Enquist and
David H. Chow and
Howard L. Dunlap and
Suresh Subramaniam and
Peiming Lei and
Gary H. Bernstein and
Barry K. Gilbert},
title = {12 GHz clocked operation of ultralow power interband resonant tunneling
diode pipelined logic gates},
journal = {{IEEE} J. Solid State Circuits},
volume = {32},
number = {2},
pages = {222--231},
year = {1997}
}
@article{DBLP:journals/robotica/ZhangHSM97,
author = {Shu{-}jun Zhang and
David Howard and
D. John Sanger and
Shan Miao},
title = {Multi-legged walking machine body design},
journal = {Robotica},
volume = {15},
number = {6},
pages = {593--598},
year = {1997}
}
@article{DBLP:journals/tcs/AlbrechtCJ97,
author = {David W. Albrecht and
John N. Crossley and
John S. Jeavons},
title = {New Curry-Howard Terms for Full Linear Logic},
journal = {Theor. Comput. Sci.},
volume = {185},
number = {2},
pages = {217--235},
year = {1997}
}
@article{DBLP:journals/tse/HoltzblattPRRH97,
author = {Lester J. Holtzblatt and
Richard L. Piazza and
Howard B. Reubenstein and
Susan N. Roberts and
David R. Harris},
title = {Design Recovery for Distributed Systems},
journal = {{IEEE} Trans. Software Eng.},
volume = {23},
number = {7},
pages = {461--472},
year = {1997}
}
@article{DBLP:journals/wc/BuchananFMPSX97,
author = {Ken Buchanan and
Rodger Fudge and
David McFarlane and
Tim Phillips and
Akio Sasaki and
Howard Xia},
title = {{IMT-2000:} service provider's perspective},
journal = {{IEEE} Wirel. Commun.},
volume = {4},
number = {4},
pages = {8--13},
year = {1997}
}
@inproceedings{DBLP:conf/compcon/DorwardPPRTW97,
author = {Sean Dorward and
Rob Pike and
David L. Presotto and
Dennis Ritchie and
Howard Trickey and
Phil Winterbottom},
title = {Inferno},
booktitle = {{COMPCON}},
pages = {241--244},
publisher = {{IEEE} Computer Society},
year = {1997}
}
@inproceedings{DBLP:conf/dac/ChenL97,
author = {Howard H. Chen and
David D. Ling},
title = {Power Supply Noise Analysis Methodology for Deep-Submicron {VLSI}
Chip Design},
booktitle = {{DAC}},
pages = {638--643},
publisher = {{ACM} Press},
year = {1997}
}
@inproceedings{DBLP:conf/hcw/MessinaBDGCES97,
author = {Paul Messina and
Sharon Brunett and
Dan M. Davis and
Thomas D. Gottschalk and
David W. Curkendall and
L. Ekroot and
Howard Jay Siegel},
title = {Distributed interactive simulation for synthetic forces},
booktitle = {Heterogeneous Computing Workshop},
pages = {112},
publisher = {{IEEE} Computer Society},
year = {1997}
}
@inproceedings{DBLP:conf/icnn/KhanBMC97,
author = {Imran Khan and
David C. Blight and
Robert D. McLeod and
Howard C. Card},
title = {Categorizing Web documents using competitive learning: an ingredient
of a personal adaptive agent},
booktitle = {{ICNN}},
pages = {96--99},
publisher = {{IEEE}},
year = {1997}
}
@inproceedings{DBLP:conf/icra/DrotningKWDHJKKLM97,
author = {William Drotning and
Howard Kimberly and
Walter Wapman and
David Darras and
Dan Homan and
Paul Johnson and
Brian Kast and
Joel Kuhlmann and
R. Charleene Lennox and
Carla Montoya},
title = {A sensor-based automation system for handling nuclear materials},
booktitle = {{ICRA}},
pages = {352--358},
publisher = {{IEEE}},
year = {1997}
}
@inproceedings{DBLP:conf/sigmetrics/GibsonNACFGLORRZ97,
author = {Garth A. Gibson and
David Nagle and
Khalil Amiri and
Fay W. Chang and
Eugene M. Feinberg and
Howard Gobioff and
Chen Lee and
Berend Ozceri and
Erik Riedel and
David Rochberg and
Jim Zelenka},
title = {File Server Scaling with Network-Attached Secure Disks},
booktitle = {{SIGMETRICS}},
pages = {272--284},
publisher = {{ACM}},
year = {1997}
}
@article{DBLP:journals/ase/HarrisYR96,
author = {David R. Harris and
Alexander S. Yeh and
Howard B. Reubenstein},
title = {Extracting Architectural Features from Source Code},
journal = {Autom. Softw. Eng.},
volume = {3},
number = {1/2},
pages = {109--138},
year = {1996}
}
@article{DBLP:journals/robotica/ZhangHS96,
author = {Shu{-}jun Zhang and
David Howard and
D. John Sanger},
title = {Workspaces of a walking machine and their graphical representation.
Part {II:} static workspaces},
journal = {Robotica},
volume = {14},
number = {2},
pages = {219--226},
year = {1996}
}
@article{DBLP:journals/robotica/ZhangSH96,
author = {Shu{-}jun Zhang and
D. John Sanger and
David Howard},
title = {Workspaces of a walking machine and their graphical representation.
Part {I:} kinematic workspaces},
journal = {Robotica},
volume = {14},
number = {1},
pages = {71--79},
year = {1996}
}
@article{DBLP:journals/siamsc/ElmanS96,
author = {Howard C. Elman and
David J. Silvester},
title = {Fast Nonsymmetric Iterations and Preconditioning for Navier-Stokes
Equations},
journal = {{SIAM} J. Sci. Comput.},
volume = {17},
number = {1},
pages = {33--46},
year = {1996}
}
@article{DBLP:journals/sopr/NelsonNR96,
author = {Howard C. Nelson and
Tom Nute and
David J. Rodjak},
title = {Applying the spiral model: {A} case study in small project management},
journal = {Softw. Process. Improv. Pract.},
volume = {2},
number = {4},
pages = {239--251},
year = {1996}
}
@article{DBLP:journals/wc/NarayanaswamySABBBBCFGHKLMR96,
author = {Shankar Narayanaswamy and
Srinivasan Seshan and
Elan Amir and
Eric A. Brewer and
Robert W. Brodersen and
Fred L. Burghardt and
Andrew J. Burstein and
Yuan{-}Chi Chang and
Armando Fox and
Jeffrey M. Gilbert and
Richard Han and
Randy H. Katz and
Allan Christian Long Jr. and
David G. Messerschmitt and
Jan M. Rabaey},
title = {A low-power, lightweight unit to provide ubiquitous information access
application and network support for InfoPad},
journal = {{IEEE} Wirel. Commun.},
volume = {3},
number = {2},
pages = {4--17},
year = {1996}
}
@inproceedings{DBLP:conf/ht/BesserBBDHCRHSD96,
author = {Howard Besser and
Michael Bieber and
Paul De Bra and
Frank Dignum and
Gary Hill and
Les Carr and
David De Roure and
Wendy Hall and
Norbert A. Streitz and
Steven J. DeRoss},
title = {World-Wide Web Authoring and Collaboration},
booktitle = {Hypertext},
pages = {262},
publisher = {{ACM}},
year = {1996}
}
@inproceedings{DBLP:conf/icmc/BrookesTH96,
author = {Tim S. Brookes and
Andy M. Tyrrell and
David M. Howard},
title = {Musical Analysis using a Real-Time Model of Peripheral Hearing},
booktitle = {{ICMC}},
publisher = {Michigan Publishing},
year = {1996}
}
@inproceedings{DBLP:conf/icmc/CreaseyHT96,
author = {David P. Creasey and
David M. Howard and
Andrew M. Tyrrell},
title = {The Timbral Object - An Alternative Route to the Control of Timbre
Space},
booktitle = {{ICMC}},
publisher = {Michigan Publishing},
year = {1996}
}
@inproceedings{DBLP:conf/icmc/EvansH96,
author = {Michelle Evans and
David M. Howard},
title = {The Synthesis of Sung Vowels in Female Opera and Belt Qualities},
booktitle = {{ICMC}},
publisher = {Michigan Publishing},
year = {1996}
}
@inproceedings{DBLP:conf/icmc/PearsonH96,
author = {Mark Pearson and
David M. Howard},
title = {Recent Developments with the {TAO} Physical Modelling System},
booktitle = {{ICMC}},
publisher = {Michigan Publishing},
year = {1996}
}
@inproceedings{DBLP:conf/pdp/GarnerHBT96,
author = {Neil Garner and
David M. Howard and
P. A. Barrett and
Andrew M. Tyrrell},
title = {A Parallel Processing Environment for Speech Signal Processing Applications},
booktitle = {{PDP}},
pages = {470--477},
publisher = {{IEEE} Computer Society},
year = {1996}
}
@article{DBLP:journals/ci/HamiltonF95,
author = {Howard J. Hamilton and
David R. Fudger},
title = {Estimating DBLEARN's Potential for Knowledge Discovery in Databases},
journal = {Comput. Intell.},
volume = {11},
pages = {280--296},
year = {1995}
}
@article{DBLP:journals/csys/PikePDFTT95,
author = {Rob Pike and
David L. Presotto and
Sean Dorward and
Bob Flandrena and
Ken Thompson and
Howard Trickey and
Phil Winterbottom},
title = {Plan 9 from Bell Labs},
journal = {Comput. Syst.},
volume = {8},
number = {2},
pages = {221--254},
year = {1995}
}
@article{DBLP:journals/hf/GabaHS95,
author = {David M. Gaba and
Steven K. Howard and
Stephen D. Small},
title = {Situation Awareness in Anesthesiology},
journal = {Hum. Factors},
volume = {37},
number = {1},
pages = {20--31},
year = {1995}
}
@article{DBLP:journals/ibmrd/KoburgerCAABBBCDGHHHLLLMMNNSTWW95,
author = {Charles W. Koburger III and
William F. Clark and
James W. Adkisson and
Eric Adler and
Paul E. Bakeman and
Albert S. Bergendahl and
Alan B. Botula and
W. Chang and
Bijan Davari and
John H. Givens and
Howard H. Hansen and
Steven J. Holmes and
David V. Horak and
Chung Hon Lam and
Jerome B. Lasky and
Stephen E. Luce and
Randy W. Mann and
Glen L. Miles and
James S. Nakos and
Edward J. Nowak and
Ghavam G. Shahidi and
Yuan Taur and
Francis R. White and
Matthew R. Wordeman},
title = {A half-micron {CMOS} logic generation},
journal = {{IBM} J. Res. Dev.},
volume = {39},
number = {1-2},
pages = {215--228},
year = {1995}
}
@article{DBLP:journals/ieeemm/AndersonBHRSW95,
author = {David B. Anderson and
John W. Barrus and
John H. Howard and
Charles Rich and
Chia Shen and
Richard C. Waters},
title = {Building Multiuser Interactive Multimedia Environments at {MERL}},
journal = {{IEEE} Multim.},
volume = {2},
number = {4},
pages = {77--82},
year = {1995}
}
@article{DBLP:journals/jcss/BarringtonS95,
author = {David A. Mix Barrington and
Howard Straubing},
title = {Superlinear Lower Bounds for Bounded-Width Branching Programs},
journal = {J. Comput. Syst. Sci.},
volume = {50},
number = {3},
pages = {374--381},
year = {1995}
}
@article{DBLP:journals/tcom/PanGDK95,
author = {Si{-}Ming Pan and
Howard A. Grant and
David E. Dodds and
Surinder Kumar},
title = {An offset-Z search strategy for spread spectrum systems},
journal = {{IEEE} Trans. Commun.},
volume = {43},
number = {12},
pages = {2900--2902},
year = {1995}
}
@inproceedings{DBLP:conf/cav/DillW95,
author = {David L. Dill and
Howard Wong{-}Toi},
title = {Verification of Real-Time Systems by Successive Over and Under Approximation},
booktitle = {{CAV}},
series = {Lecture Notes in Computer Science},
volume = {939},
pages = {409--422},
publisher = {Springer},
year = {1995}
}
@inproceedings{DBLP:conf/icmc/GibsonH95,
author = {Ian S. Gibson and
David M. Howard},
title = {Intuitive and Dynamic Control of Synthesized Sounds by Voice},
booktitle = {{ICMC}},
publisher = {Michigan Publishing},
year = {1995}
}
@inproceedings{DBLP:conf/icmc/PearsonH95,
author = {Mark Pearson and
David M. Howard},
title = {A Musicians Approach to Physical Modeling},
booktitle = {{ICMC}},
publisher = {Michigan Publishing},
year = {1995}
}
@inproceedings{DBLP:conf/icnn/GarnerBHT95,
author = {Neil Garner and
Andy Breen and
David M. Howard and
Andy M. Tyrrell},
title = {Neural network for syntactic categorisation of words},
booktitle = {{ICNN}},
pages = {2863--2866},
publisher = {{IEEE}},
year = {1995}
}
@inproceedings{DBLP:conf/icse/HarrisRY95,
author = {David R. Harris and
Howard B. Reubenstein and
Alexander S. Yeh},
title = {Reverse Engineering to the Architectural Level},
booktitle = {{ICSE}},
pages = {186--195},
publisher = {{ACM}},
year = {1995}
}
@inproceedings{DBLP:conf/latin/BarringtonS95,
author = {David A. Mix Barrington and
Howard Straubing},
title = {Lower Bounds for Modular Counting by Circuits with Modular Gates},
booktitle = {{LATIN}},
series = {Lecture Notes in Computer Science},
volume = {911},
pages = {60--71},
publisher = {Springer},
year = {1995}
}
@inproceedings{DBLP:conf/mm/ChervenakPK95,
author = {Ann L. Chervenak and
David A. Patterson and
Randy H. Katz},
title = {Choosing the Best Storage System for Video Service},
booktitle = {{ACM} Multimedia},
pages = {109--119},
publisher = {{ACM} Press},
year = {1995}
}
@inproceedings{DBLP:conf/mss/ChervenakPK95,
author = {Ann L. Chervenak and
David A. Patterson and
Randy H. Katz},
title = {Storage Systems for Movies-on-Demand Video Servers},
booktitle = {{IEEE} Symposium on Mass Storage Systems},
pages = {246--256},
publisher = {{IEEE} Computer Society},
year = {1995}
}
@inproceedings{DBLP:conf/wcre/HarrisYR95,
author = {David R. Harris and
Alexander S. Yeh and
Howard B. Reubenstein},
title = {Recognizers for Extracting Architectural Features from Source Code},
booktitle = {{WCRE}},
publisher = {{IEEE} Computer Society},
year = {1995}
}
@inproceedings{DBLP:conf/wcre/YehHR95,
author = {Alexander S. Yeh and
David R. Harris and
Howard B. Reubenstein},
title = {Recovering Abstract Data Types and Object Instances from a Conventional
Procedural Language},
booktitle = {{WCRE}},
pages = {227--236},
publisher = {{IEEE} Computer Society},
year = {1995}
}
@article{DBLP:journals/algorithmica/HellersteinGKKP94,
author = {Lisa Hellerstein and
Garth A. Gibson and
Richard M. Karp and
Randy H. Katz and
David A. Patterson},
title = {Coding Techniques for Handling Failures in Large Disk Arrays},
journal = {Algorithmica},
volume = {12},
number = {2/3},
pages = {182--208},
year = {1994}
}
@article{DBLP:journals/cc/BarringtonS94,
author = {David A. Mix Barrington and
Howard Straubing},
title = {Complex Polynomials and Circuit Lower Bounds for Modular Counting},
journal = {Comput. Complex.},
volume = {4},
pages = {325--338},
year = {1994}
}
@article{DBLP:journals/csur/ChenLGKP94,
author = {Peter M. Chen and
Edward K. Lee and
Garth A. Gibson and
Randy H. Katz and
David A. Patterson},
title = {{RAID:} High-Performance, Reliable Secondary Storage},
journal = {{ACM} Comput. Surv.},
volume = {26},
number = {2},
pages = {145--185},
year = {1994}
}
@article{DBLP:journals/dpd/ChenLDLMSSPK94,
author = {Peter M. Chen and
Edward K. Lee and
Ann L. Drapeau and
Ken Lutz and
Ethan L. Miller and
Srinivasan Seshan and
Ken Shirriff and
David A. Patterson and
Randy H. Katz},
title = {Performance and Design Evaluation of the {RAID-II} Storage Server},
journal = {Distributed Parallel Databases},
volume = {2},
number = {3},
pages = {243--260},
year = {1994}
}
@article{DBLP:journals/mam/SwanHT94,
author = {Chris Swan and
David M. Howard and
Andrew M. Tyrrell},
title = {Real-time transputer simulation of the human peripheral hearing system},
journal = {Microprocess. Microsystems},
volume = {18},
number = {4},
pages = {215--221},
year = {1994}
}
@inproceedings{DBLP:conf/enter/AustinHKMJMWW94,
author = {W. J. Austin and
E. K. Hutchinson and
John Kalmus and
Lachlan M. MacKinnon and
Keith G. Jeffery and
David H. Marwick and
M. Howard Williams and
Michael D. Wilson},
title = {Processing Travel Queries in a Multimedia Information System},
booktitle = {{ENTER}},
pages = {64--71},
publisher = {Springer},
year = {1994}
}
@inproceedings{DBLP:conf/icmc/RossiterH94,
author = {David Rossiter and
David M. Howard},
title = {A Graphical Environment for Electroacoustic Music Composition},
booktitle = {{ICMC}},
publisher = {Michigan Publishing},
year = {1994}
}
@inproceedings{DBLP:conf/icmc/RossiterH94a,
author = {David Rossiter and
David M. Howard},
title = {Voice Source and Acoustic Output Qualities for Singing Synthesis},
booktitle = {{ICMC}},
publisher = {Michigan Publishing},
year = {1994}
}
@inproceedings{DBLP:conf/isca/DrapeauSHMSKLPLCG94,
author = {Ann L. Drapeau and
Ken Shirriff and
John H. Hartman and
Ethan L. Miller and
Srinivasan Seshan and
Randy H. Katz and
Ken Lutz and
David A. Patterson and
Edward K. Lee and
Peter M. Chen and
Garth A. Gibson},
title = {{RAID-II:} {A} High-Bandwidth Network File Server},
booktitle = {{ISCA}},
pages = {234--244},
publisher = {{IEEE} Computer Society},
year = {1994}
}
@inproceedings{DBLP:conf/mss/KeetonDPK94,
author = {Kimberly Keeton and
Ann L. Drapeau and
David A. Patterson and
Randy H. Katz},
title = {Storage alternatives for video service},
booktitle = {{MSS}},
pages = {100--105},
publisher = {{IEEE} Computer Society},
year = {1994}
}
@inproceedings{DBLP:conf/re/ShekaranGJMPR94,
author = {M. Chandra Shekaran and
David Garlan and
Michael Jackson and
Nancy R. Mead and
Colin Potts and
Howard B. Reubenstein},
title = {The role of software architecture in requirements engineering},
booktitle = {{ICRE}},
pages = {239--245},
publisher = {{IEEE} Computer Society},
year = {1994}
}
@inproceedings{DBLP:conf/sigmetrics/DrapeauPK94,
author = {Ann L. Drapeau and
David A. Patterson and
Randy H. Katz},
title = {Toward Workload Characterization of Video Server and Digital Library
Applications},
booktitle = {{SIGMETRICS}},
pages = {274--275},
publisher = {{ACM}},
year = {1994}
}
@article{DBLP:journals/nar/GamperRCVAGSM93,
author = {Howard B. Gamper and
Michael W. Reed and
Thomas Cox and
Jeanne S. Virosco and
A. David Adams and
Alexander A. Gall and
John K. Scholler and
Rich B. Meyer Jr.},
title = {Facile preparation of nuclease resistant 3' modified oligodeoxynucleotides},
journal = {Nucleic Acids Res.},
volume = {21},
number = {1},
pages = {145--150},
year = {1993}
}
@article{DBLP:journals/robotica/MittelstadtPKZWPCKRM93,
author = {Brent D. Mittelstadt and
Howard A. Paul and
Peter Kazanzides and
Joel F. Zuhars and
Bill Williamson and
Robert Pettit and
Phillip Cain and
David Kloth and
Luke Rose and
Bela L. Musits},
title = {Development of a surgical robot for cementless total hip replacement},
journal = {Robotica},
volume = {11},
number = {6},
pages = {553--560},
year = {1993}
}
@article{DBLP:journals/sigops/PikePTTW93,
author = {Rob Pike and
David L. Presotto and
Ken Thompson and
Howard Trickey and
Phil Winterbottom},
title = {The Use of Name Spaces in Plan 9},
journal = {{ACM} {SIGOPS} Oper. Syst. Rev.},
volume = {27},
number = {2},
pages = {72--76},
year = {1993}
}
@inproceedings{DBLP:conf/icra/SwiftKC93,
author = {David C. Swift and
Howard Kaufman and
Steven T. Cummings},
title = {Direct Model Reference Adaptive Control of a Puma Manipulator},
booktitle = {{ICRA} {(2)}},
pages = {346--351},
publisher = {{IEEE} Computer Society Press},
year = {1993}
}
@inproceedings{DBLP:conf/rsctc/FudgerH93,
author = {David R. Fudger and
Howard J. Hamilton},
title = {A Heuristic for Evaluating Databases for Knowledge Discovery with
{DBLEARN}},
booktitle = {{RSKD}},
series = {Workshops in Computing},
pages = {44--51},
publisher = {Springer},
year = {1993}
}
@incollection{DBLP:books/el/93/WestHHMSB93,
author = {Adrian J. West and
T. L. J. Howard and
Roger J. Hubbold and
Alan Murta and
David N. Snowdon and
D. A. Butler},
title = {{AVIARY} - {A} Generic Virtual Reality Interface for Real Applications},
booktitle = {Virtual Reality Systems},
pages = {213--236},
publisher = {Elsevier},
year = {1993}
}
@article{DBLP:journals/jcss/BarringtonCST92,
author = {David A. Mix Barrington and
Kevin J. Compton and
Howard Straubing and
Denis Th{\'{e}}rien},
title = {Regular Languages in NC{\({^1}\)}},
journal = {J. Comput. Syst. Sci.},
volume = {44},
number = {3},
pages = {478--499},
year = {1992}
}
@article{DBLP:journals/jct/BenderCRR92,
author = {Edward A. Bender and
Raymond Coley and
David P. Robbins and
Howard Rumsey Jr.},
title = {Enumeration of Subspaces by Dimension Sequence},
journal = {J. Comb. Theory {A}},
volume = {59},
number = {1},
pages = {1--11},
year = {1992}
}
@article{DBLP:journals/jpdc/SiegelABBCDDDFGHJJPSSSSTW92,
author = {Howard Jay Siegel and
Seth Abraham and
William L. Bain and
Kenneth E. Batcher and
Thomas L. Casavant and
Doug DeGroot and
Jack B. Dennis and
David C. Douglas and
Tse{-}Yun Feng and
James R. Goodman and
Alan Huang and
Harry F. Jordan and
J. Robert Jamp and
Yale N. Patt and
Alan Jay Smith and
James E. Smith and
Lawrence Snyder and
Harold S. Stone and
Russ Tuck and
Benjamin W. Wah},
title = {Report of the Purdue Workshop on Grand Challenges in Computer Architecture
for the Support of High Performance Computing},
journal = {J. Parallel Distributed Comput.},
volume = {16},
number = {3},
pages = {199--211},
year = {1992}
}
@article{DBLP:journals/jsa/TyrrellHB92,
author = {Andrew M. Tyrrell and
David M. Howard and
Nicola A. Beasley},
title = {Transputer model of the human peripheral hearing system},
journal = {Microprocess. Microprogramming},
volume = {35},
number = {1-5},
pages = {619--624},
year = {1992}
}
@inproceedings{DBLP:conf/concur/AlurCHDW92,
author = {Rajeev Alur and
Costas Courcoubetis and
Nicolas Halbwachs and
David L. Dill and
Howard Wong{-}Toi},
title = {Minimization of Timed Transition Systems},
booktitle = {{CONCUR}},
series = {Lecture Notes in Computer Science},
volume = {630},
pages = {340--354},
publisher = {Springer},
year = {1992}
}
@inproceedings{DBLP:conf/ipps/GiolmasWCS92,
author = {Nicholas Giolmas and
Daniel W. Watson and
David M. Chelberg and
Howard Jay Siegel},
title = {A Parallel Approach to Hybrid Range Image Segmentation},
booktitle = {{IPPS}},
pages = {334--342},
publisher = {{IEEE} Computer Society},
year = {1992}
}
@inproceedings{DBLP:conf/latin/BarringtonS92,
author = {David A. Mix Barrington and
Howard Straubing},
title = {Complex Polynomials and Circuit Lower Bounds for Modular Counting},
booktitle = {{LATIN}},
series = {Lecture Notes in Computer Science},
volume = {583},
pages = {24--31},
publisher = {Springer},
year = {1992}
}
@inproceedings{DBLP:conf/rtss/AlurCDHW92,
author = {Rajeev Alur and
Costas Courcoubetis and
David L. Dill and
Nicolas Halbwachs and
Howard Wong{-}Toi},
title = {An implementation of three algorithms for timing verification based
on automata emptiness},
booktitle = {{RTSS}},
pages = {157--166},
publisher = {{IEEE} Computer Society},
year = {1992}
}
@inproceedings{DBLP:conf/sigopsE/PikePTTW92,
author = {Rob Pike and
David L. Presotto and
Ken Thompson and
Howard Trickey and
Phil Winterbottom},
title = {The use of name spaces in plan 9},
booktitle = {{ACM} {SIGOPS} European Workshop},
publisher = {{ACM}},
year = {1992}
}
@inproceedings{DBLP:conf/cav/DillHW91,
author = {David L. Dill and
Alan J. Hu and
Howard Wong{-}Toi},
title = {Checking for Language Inclusion Using Simulation Preorders},
booktitle = {{CAV}},
series = {Lecture Notes in Computer Science},
volume = {575},
pages = {255--265},
publisher = {Springer},
year = {1991}
}
@inproceedings{DBLP:conf/coco/BarringtonS91,
author = {David A. Mix Barrington and
Howard Straubing},
title = {Superlinear Lower Bounds for Bounded-Width Branching Programs},
booktitle = {{SCT}},
pages = {305--313},
publisher = {{IEEE} Computer Society},
year = {1991}
}
@inproceedings{DBLP:conf/sigir/CroftTL91,
author = {W. Bruce Croft and
Howard R. Turtle and
David D. Lewis},
title = {The Use of Phrases and Structured Queries in Information Retrieval},
booktitle = {{SIGIR}},
pages = {32--45},
publisher = {{ACM}},
year = {1991}
}
@article{DBLP:journals/dm/CharlapRR90,
author = {Leonard S. Charlap and
Howard D. Rees and
David P. Robbins},
title = {The asymptotic probability that a random biased matrix is invertible},
journal = {Discret. Math.},
volume = {82},
number = {2},
pages = {153--163},
year = {1990}
}
@article{DBLP:journals/dt/WoodGK90,
author = {David A. Wood and
Garth A. Gibson and
Randy H. Katz},
title = {Verifying a Multiprocessor Cache Controller Using Random Test Generation},
journal = {{IEEE} Des. Test Comput.},
volume = {7},
number = {4},
pages = {13--25},
year = {1990}
}
@article{DBLP:journals/iandc/BarringtonST90,
author = {David A. Mix Barrington and
Howard Straubing and
Denis Th{\'{e}}rien},
title = {Non-Uniform Automata Over Groups},
journal = {Inf. Comput.},
volume = {89},
number = {2},
pages = {109--132},
year = {1990}
}
@article{DBLP:journals/jcss/BarringtonIS90,
author = {David A. Mix Barrington and
Neil Immerman and
Howard Straubing},
title = {On Uniformity within NC{\({^1}\)}},
journal = {J. Comput. Syst. Sci.},
volume = {41},
number = {3},
pages = {274--306},
year = {1990}
}
@inproceedings{DBLP:conf/cav/Wong-ToiD90,
author = {Howard Wong{-}Toi and
David L. Dill},
title = {Synthesizing Processes and Schedulers from Temporal Specifications},
booktitle = {{CAV}},
series = {Lecture Notes in Computer Science},
volume = {531},
pages = {272--281},
publisher = {Springer},
year = {1990}
}
@inproceedings{DBLP:conf/dimacs/Wong-ToiD90,
author = {Howard Wong{-}Toi and
David L. Dill},
title = {Synthesizing Processes and Schedulers from Temporal Specifications},
booktitle = {{CAV} {(DIMACS/AMS} volume)},
series = {{DIMACS} Series in Discrete Mathematics and Theoretical Computer Science},
volume = {3},
pages = {177--186},
publisher = {{DIMACS/AMS}},
year = {1990}
}
@inproceedings{DBLP:conf/si3d/EllsworthGT90,
author = {David A. Ellsworth and
Howard Good and
Brice Tebbs},
title = {Distributing display lists on a multicomputer},
booktitle = {{I3D}},
pages = {147--154},
publisher = {{ACM}},
year = {1990}
}
@inproceedings{DBLP:conf/sigmetrics/ChenGKP90,
author = {Peter M. Chen and
Garth A. Gibson and
Randy H. Katz and
David A. Patterson},
title = {An Evaluation of Redundant Arrays of Disks Using an Amdahl 5890},
booktitle = {{SIGMETRICS}},
pages = {74--85},
publisher = {{ACM}},
year = {1990}
}
@article{DBLP:journals/cm/ClarkJRS89,
author = {David D. Clark and
Van Jacobson and
John Romkey and
Howard Salwen},
title = {An analysis of {TCP} processing overhead},
journal = {{IEEE} Commun. Mag.},
volume = {27},
number = {6},
pages = {23--29},
year = {1989}
}
@article{DBLP:journals/pieee/KatzGP89,
author = {Randy H. Katz and
Garth A. Gibson and
David A. Patterson},
title = {Disk system architectures for high performance computing},
journal = {Proc. {IEEE}},
volume = {77},
number = {12},
pages = {1842--1858},
year = {1989}
}
@article{DBLP:journals/spe/ChangGK89,
author = {Ellis E. Chang and
David Gedye and
Randy H. Katz},
title = {The Design and Implementation of a Version Server for Computer-aided
Design},
journal = {Softw. Pract. Exp.},
volume = {19},
number = {3},
pages = {199--222},
year = {1989}
}
@inproceedings{DBLP:conf/asplos/GibsonHKKP89,
author = {Garth A. Gibson and
Lisa Hellerstein and
Richard M. Karp and
Randy H. Katz and
David A. Patterson},
title = {Failure Correction Techniques for Large Disk Arrays},
booktitle = {{ASPLOS}},
pages = {123--132},
publisher = {{ACM} Press},
year = {1989}
}
@inproceedings{DBLP:conf/compcon/PattersonCGK89,
author = {David A. Patterson and
Peter M. Chen and
Garth Gibson and
Randy H. Katz},
title = {Introduction to redundant arrays of inexpensive disks {(RAID)}},
booktitle = {{COMPCON}},
pages = {112--117},
publisher = {{IEEE} Computer Society},
year = {1989}
}
@inproceedings{DBLP:conf/compcon/SchulzeKP89,
author = {Martin Schulze and
Garth Gibson and
Randy H. Katz and
David A. Patterson},
title = {How reliable is a RAID?},
booktitle = {{COMPCON}},
pages = {118--123},
publisher = {{IEEE} Computer Society},
year = {1989}
}
@inproceedings{DBLP:conf/dac/SilvaGKN89,
author = {M{\'{a}}rio J. Silva and
David Gedye and
Randy H. Katz and
Richard Newton},
title = {Protection and Versioning for {OCT}},
booktitle = {{DAC}},
pages = {264--269},
publisher = {{ACM} Press},
year = {1989}
}
@inproceedings{DBLP:conf/icassp/HowardB89,
author = {David M. Howard and
Andrew P. Breen},
title = {Methods for dynamic excitation control in parallel formant speech
synthesis},
booktitle = {{ICASSP}},
pages = {215--218},
publisher = {{IEEE}},
year = {1989}
}
@inproceedings{DBLP:conf/interspeech/HowardW89a,
author = {David M. Howard and
Graham F. Welch},
title = {Visual feedback applied to the learning of conscious pitch control
in singing},
booktitle = {{EUROSPEECH}},
pages = {2485--2488},
publisher = {{ISCA}},
year = {1989}
}
@inproceedings{DBLP:conf/isca/WoodK89,
author = {David A. Wood and
Randy H. Katz},
title = {Supporting Reference and Dirty Bits in SPUR's Virtual Address Cache},
booktitle = {{ISCA}},
pages = {122--130},
publisher = {{ACM}},
year = {1989}
}
@article{DBLP:journals/debu/KatzOPS88,
author = {Randy H. Katz and
John K. Ousterhout and
David A. Patterson and
Michael Stonebraker},
title = {A Project on High Performance {I/O} Subsystems},
journal = {{IEEE} Data Eng. Bull.},
volume = {11},
number = {1},
pages = {40--47},
year = {1988}
}
@article{DBLP:journals/tocs/HowardKMNSSW88,
author = {John H. Howard and
Michael L. Kazar and
Sherri G. Menees and
David A. Nichols and
Mahadev Satyanarayanan and
Robert N. Sidebotham and
Michael J. West},
title = {Scale and Performance in a Distributed File System},
journal = {{ACM} Trans. Comput. Syst.},
volume = {6},
number = {1},
pages = {51--81},
year = {1988}
}
@article{DBLP:journals/tsp/HowardL88,
author = {David M. Howard and
Geoffrey Lindsey},
title = {Conditioned variability in voicing offsets},
journal = {{IEEE} Trans. Acoust. Speech Signal Process.},
volume = {36},
number = {3},
pages = {406--407},
year = {1988}
}
@article{DBLP:journals/tsp/WasemGDP88,
author = {Ondria J. Wasem and
David J. Goodman and
Charles A. Dvorak and
Howard G. Page},
title = {The effect of waveform substitution on the quality of {PCM} packet
communications},
journal = {{IEEE} Trans. Acoust. Speech Signal Process.},
volume = {36},
number = {3},
pages = {342--348},
year = {1988}
}
@inproceedings{DBLP:conf/coco/BarringtonIS88,
author = {David A. Mix Barrington and
Neil Immerman and
Howard Straubing},
title = {On uniformity within NC\({}^{\mbox{1}}\)},
booktitle = {{SCT}},
pages = {47--59},
publisher = {{IEEE} Computer Society},
year = {1988}
}
@inproceedings{DBLP:conf/dac/GedyeK88,
author = {David Gedye and
Randy H. Katz},
title = {Browsing in Chip Design Database},
booktitle = {{DAC}},
pages = {269--274},
publisher = {{ACM}},
year = {1988}
}
@inproceedings{DBLP:conf/dac/StavridouBE88,
author = {Victoria Stavridou and
Howard Barringer and
David A. Edwards},
title = {Formal Specification and Verification of Hardware: {A} Comparative
Case Study},
booktitle = {{DAC}},
pages = {197--204},
publisher = {{ACM}},
year = {1988}
}
@inproceedings{DBLP:conf/lcn/ClarkRS88,
author = {David D. Clark and
John Romkey and
Howard C. Salwen},
title = {An analysis of {TCP} processing overhead},
booktitle = {{LCN}},
pages = {284--291},
publisher = {{IEEE} Computer Society},
year = {1988}
}
@inproceedings{DBLP:conf/scm/LeblangCS88,
author = {David B. Leblang and
Robert P. Chase Jr. and
Howard Spilke},
title = {Increasing Productivity with a Parallel Configuration Manager},
booktitle = {{SCM}},
series = {Berichte des German Chapter of the {ACM}},
volume = {30},
pages = {21--37},
publisher = {Teubner},
year = {1988}
}
@inproceedings{DBLP:conf/sigmod/PattersonGK88,
author = {David A. Patterson and
Garth A. Gibson and
Randy H. Katz},
title = {A Case for Redundant Arrays of Inexpensive Disks {(RAID)}},
booktitle = {{SIGMOD} Conference},
pages = {109--116},
publisher = {{ACM} Press},
year = {1988}
}
@inproceedings{DBLP:conf/vldb/StonebrakerKPO88,
author = {Michael Stonebraker and
Randy H. Katz and
David A. Patterson and
John K. Ousterhout},
title = {The Design of {XPRS}},
booktitle = {{VLDB}},
pages = {318--330},
publisher = {Morgan Kaufmann},
year = {1988}
}
@article{DBLP:journals/dm/MillsRR87,
author = {W. H. Mills and
David P. Robbins and
Howard Rumsey Jr.},
title = {Enumeration of a symmetry class of plane partitions},
journal = {Discret. Math.},
volume = {67},
number = {1},
pages = {43--55},
year = {1987}
}
@article{DBLP:journals/dt/KatzBCGT87,
author = {Randy H. Katz and
Rajiv Bhateja and
Ellis E. Chang and
David Gedye and
Vony Trijanto},
title = {Design Version Management},
journal = {{IEEE} Des. Test},
volume = {4},
number = {1},
pages = {12--22},
year = {1987}
}
@article{DBLP:journals/jal/KarloffS87,
author = {Howard J. Karloff and
David B. Shmoys},
title = {Efficient Parallel Algorithms for Edge Coloring Problems},
journal = {J. Algorithms},
volume = {8},
number = {1},
pages = {39--52},
year = {1987}
}
@article{DBLP:journals/mam/SiegelSMH87,
author = {Howard Jay Siegel and
Thomas Schwederski and
David G. Meyer and
William Tsun{-}Yuk Hsu},
title = {Large-scale parallel processing systems},
journal = {Microprocess. Microsystems},
volume = {11},
number = {1},
pages = {3--20},
year = {1987}
}
@inproceedings{DBLP:conf/icassp/WoodsPK87,
author = {John W. Woods and
David J. Potter and
Howard Kaufman},
title = {Parallel realizations of 2-D recursive Kalman filters},
booktitle = {{ICASSP}},
pages = {1657--1660},
publisher = {{IEEE}},
year = {1987}
}
@inproceedings{DBLP:conf/interspeech/HowardFH87,
author = {David M. Howard and
Andrew Faulkner and
Ian S. Howard},
title = {Speech fundamental frequency estimation by multi-channel peak-picking},
booktitle = {{ECST}},
pages = {1318--1321},
publisher = {{ISCA}},
year = {1987}
}
@inproceedings{DBLP:conf/sosp/HowardKMNSSW87,
author = {John H. Howard and
Michael L. Kazar and
Sherri G. Menees and
David A. Nichols and
Mahadev Satyanarayanan and
Robert N. Sidebotham and
Michael J. West},
title = {Scale and Performance in a Distributed File System (Extended Abstract)},
booktitle = {{SOSP}},
pages = {1--2},
publisher = {{ACM}},
year = {1987}
}
@article{DBLP:journals/cacm/MorrisSCHRS86,
author = {James H. Morris and
Mahadev Satyanarayanan and
Michael H. Conner and
John H. Howard and
David S. H. Rosenthal and
F. Donelson Smith},
title = {Andrew: {A} Distributed Personal Computing Environment},
journal = {Commun. {ACM}},
volume = {29},
number = {3},
pages = {184--201},
year = {1986}
}
@article{DBLP:journals/jct/MillsRR86,
author = {W. H. Mills and
David P. Robbins and
Howard Rumsey Jr.},
title = {Self-complementary totally symmetric plane partitions},
journal = {J. Comb. Theory {A}},
volume = {42},
number = {2},
pages = {277--292},
year = {1986}
}
@article{DBLP:journals/jsac/KernerLS86,
author = {Martin Kerner and
Howard L. Lemberg and
David M. Simmons},
title = {An Analysis of Alternative Architectures for the Interoffice Network},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {4},
number = {9},
pages = {1404--1413},
year = {1986}
}
@article{DBLP:journals/tc/TuomenoksaS86,
author = {David Lee Tuomenoksa and
Howard Jay Siegel},
title = {Determining an Optimal Secondary Storage Service Rate for the {PASM}
Control System},
journal = {{IEEE} Trans. Computers},
volume = {35},
number = {1},
pages = {43--53},
year = {1986}
}
@inproceedings{DBLP:conf/isca/WoodEGHPRTKP86,
author = {David A. Wood and
Susan J. Eggers and
Garth A. Gibson and
Mark D. Hill and
Joan M. Pendleton and
Scott A. Ritchie and
George S. Taylor and
Randy H. Katz and
David A. Patterson},
title = {An In-Cache Address Translation Mechanism},
booktitle = {{ISCA}},
pages = {358--365},
publisher = {{IEEE} Computer Society},
year = {1986}
}
@article{DBLP:journals/pieee/PisoniNG85,
author = {David B. Pisoni and
Howard C. Nusbaum and
Beth G. Greene},
title = {Perception of synthetic speech generated by rule},
journal = {Proc. {IEEE}},
volume = {73},
number = {11},
pages = {1665--1676},
year = {1985}
}
@article{DBLP:journals/spe/ChouDKK85,
author = {Hong{-}Tai Chou and
David J. DeWitt and
Randy H. Katz and
Anthony C. Klug},
title = {Design and Implementation of the Wisconsin Storage System},
journal = {Softw. Pract. Exp.},
volume = {15},
number = {10},
pages = {943--962},
year = {1985}
}
@article{DBLP:journals/speech/PisoniNLS85,
author = {David B. Pisoni and
Howard C. Nusbaum and
Paul A. Luce and
Louisa M. Slowiaczek},
title = {Speech perception, word recognition and the structure of the lexicon},
journal = {Speech Commun.},
volume = {4},
number = {1-3},
pages = {75--95},
year = {1985}
}
@article{DBLP:journals/tse/TuomenoksaS85,
author = {David Lee Tuomenoksa and
Howard Jay Siegel},
title = {Task Scheduling on the {PASM} Parallel Processing System},
journal = {{IEEE} Trans. Software Eng.},
volume = {11},
number = {2},
pages = {145--157},
year = {1985}
}
@inproceedings{DBLP:conf/compcon/MeyerSSDK85,
author = {David G. Meyer and
Howard Jay Siegel and
Thomas Schwederski and
Nathaniel J. Davis IV and
James T. Kuehn},
title = {The {PASM} Parallel System Prototype},
booktitle = {{COMPCON}},
pages = {429},
publisher = {{IEEE} Computer Society},
year = {1985}
}
@inproceedings{DBLP:conf/icassp/PisoniBNY85,
author = {David B. Pisoni and
Robert H. Bernacki and
Howard C. Nusbaum and
Moshe Yuchtman},
title = {Some acoustic-phonetic correlates of speech produced in noise},
booktitle = {{ICASSP}},
pages = {1581--1584},
publisher = {{IEEE}},
year = {1985}
}
@inproceedings{DBLP:conf/isca/KatzEWPS85,
author = {Randy H. Katz and
Susan J. Eggers and
David A. Wood and
Charles L. Perkins and
Robert G. Sheldon},
title = {Implementing {A} Cache Consistency Protocol},
booktitle = {{ISCA}},
pages = {276--283},
publisher = {{IEEE} Computer Society},
year = {1985}
}
@inproceedings{DBLP:conf/sosp/SatyanarayananHNSSW85,
author = {Mahadev Satyanarayanan and
John H. Howard and
David A. Nichols and
Robert N. Sidebotham and
Alfred Z. Spector and
Michael J. West},
title = {The {ITC} Distributed File System: Principles and Design},
booktitle = {{SOSP}},
pages = {35--50},
publisher = {{ACM}},
year = {1985}
}
@article{DBLP:journals/sigsoft/BarstowSSS84,
author = {David R. Barstow and
Howard E. Shrobe and
Erik Sandewall and
Stephen W. Smoliar},
title = {Interactive programming environments},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {9},
number = {4},
pages = {56--58},
year = {1984}
}
@article{DBLP:journals/tc/TuomenoksaS84,
author = {David Lee Tuomenoksa and
Howard Jay Siegel},
title = {Task Preloading Schemes for Reconfigurable Parallel Processing Systems},
journal = {{IEEE} Trans. Computers},
volume = {33},
number = {10},
pages = {895--905},
year = {1984}
}
@inproceedings{DBLP:conf/sigmod/DeWittKOSSW84,
author = {David J. DeWitt and
Randy H. Katz and
Frank Olken and
Leonard D. Shapiro and
Michael Stonebraker and
David A. Wood},
title = {Implementation Techniques for Main Memory Database Systems},
booktitle = {{SIGMOD} Conference},
pages = {1--8},
publisher = {{ACM} Press},
year = {1984}
}
@article{DBLP:journals/jct/MillsRR83,
author = {W. H. Mills and
David P. Robbins and
Howard Rumsey Jr.},
title = {Alternating Sign Matrices and Descending Plane Partitions},
journal = {J. Comb. Theory {A}},
volume = {34},
number = {3},
pages = {340--359},
year = {1983}
}
@inproceedings{DBLP:conf/icassp/PisoniNLS83,
author = {David B. Pisoni and
Howard C. Nusbaum and
Paul A. Luce and
Eileen C. Schwab},
title = {Perceptual evaluation of synthetic speech: Some considerations of
the user/System interface},
booktitle = {{ICASSP}},
pages = {535--538},
publisher = {{IEEE}},
year = {1983}
}
@inproceedings{DBLP:conf/icpp/TuomenoksaS83,
author = {David Lee Tuomenoksa and
Howard Jay Siegel},
title = {Preloading Schemes for the {PASM} Parallel Memory System},
booktitle = {{ICPP}},
pages = {407--415},
publisher = {{IEEE} Computer Society},
year = {1983}
}
@article{DBLP:journals/debu/Katz82a,
author = {Randy H. Katz},
title = {{DAVID:} Design Aids for {VLSI} using Inegrated Databases},
journal = {{IEEE} Database Eng. Bull.},
volume = {5},
number = {2},
pages = {29--32},
year = {1982}
}
@article{DBLP:journals/pami/ElliottCCS82,
author = {Howard Elliott and
David B. Cooper and
Fernand S. Cohen and
Peter F. Symosek},
title = {Implementation, Interpretation, and Analysis of a Suboptimal Boundary
Finding Algorithm},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {4},
number = {2},
pages = {167--182},
year = {1982}
}
@article{DBLP:journals/sigarch/FitzpatrickFKLP82,
author = {Daniel T. Fitzpatrick and
John K. Foderaro and
Manolis G. H. Katevenis and
Howard A. Landman and
David A. Patterson and
James B. Peek and
Zvi Peshkess and
Carlo H. S{\'{e}}quin and
Robert W. Sherburne and
Korbin S. Van Dyke},
title = {A RISCy approach to {VLSI}},
journal = {{SIGARCH} Comput. Archit. News},
volume = {10},
number = {1},
pages = {28--32},
year = {1982}
}
@article{DBLP:journals/sigmod/BoralDKK82,
author = {Haran Boral and
David J. DeWitt and
Randy H. Katz and
Anthony C. Klug},
title = {Database Research Activities at the University of Wisconsin},
journal = {{SIGMOD} Rec.},
volume = {12},
number = {3},
pages = {19--26},
year = {1982}
}
@inproceedings{DBLP:conf/chi/PetersonB82,
author = {David E. Peterson and
J. Howard Botterill},
title = {{IBM} system/38 - an {IBM} usability experience},
booktitle = {{CHI}},
pages = {262--267},
publisher = {{ACM}},
year = {1982}
}
@inproceedings{DBLP:conf/icdcs/TuomenoksaS82,
author = {David Lee Tuomenoksa and
Howard Jay Siegel},
title = {Analysis of multiple-queue task scheduling algorithms for multiple-SIMD
machines},
booktitle = {{ICDCS}},
pages = {114--121},
publisher = {{IEEE} Computer Society},
year = {1982}
}
@inproceedings{DBLP:conf/icpp/TuomenoksaS82,
author = {David Lee Tuomenoksa and
Howard Jay Siegel},
title = {Analysis of the {PASM} control system memory hierarchy},
booktitle = {{ICPP}},
pages = {363--370},
publisher = {{IEEE} Computer Society},
year = {1982}
}
@inproceedings{DBLP:conf/siggraph/LutherJRJT82,
author = {David Luther and
Irwin Jarett and
Jack Russell and
Howard Johnson and
John Thompson},
title = {Business graphics(Panel Session): What is it?},
booktitle = {{SIGGRAPH}},
pages = {275},
publisher = {{ACM}},
year = {1982}
}
@article{DBLP:journals/tse/BarstowS81,
author = {David R. Barstow and
Howard E. Shrobe},
title = {Guest Editorial: Programming Environments},
journal = {{IEEE} Trans. Software Eng.},
volume = {7},
number = {5},
pages = {449--450},
year = {1981}
}
@proceedings{DBLP:conf/sosp/1981,
editor = {John Howard and
David P. Reed},
title = {Proceedings of the Eighth Symposium on Operating System Principles,
{SOSP} 1981, Asilomar Conference Grounds, Pacific Grove, California,
USA, December 14-16, 1981},
publisher = {{ACM}},
year = {1981}
}
@inproceedings{DBLP:conf/icassp/CohenCES80,
author = {Fernand S. Cohen and
David B. Cooper and
Howard Elliott and
Peter F. Symosek},
title = {Two-dimensional image boundary estimation by use of likelihood maximization
and Kalman filtering},
booktitle = {{ICASSP}},
pages = {410--413},
publisher = {{IEEE}},
year = {1980}
}
@article{DBLP:journals/computer/ElmquistFGM79,
author = {K. A. Elmquist and
Howard Fullmer and
David B. Gustavson and
George Morrow},
title = {Standard Specification for {S-100} Bus Interface Devices},
journal = {Computer},
volume = {12},
number = {7},
pages = {28--52},
year = {1979}
}
@article{DBLP:journals/ibmsj/HolleyPSS79,
author = {L. Howard Holley and
Richard P. Parmelee and
Charles A. Salisbury and
David N. Saul},
title = {{VM/370} Asymmetric Multiprocessing},
journal = {{IBM} Syst. J.},
volume = {18},
number = {1},
pages = {47--70},
year = {1979}
}
@article{DBLP:journals/mam/Dunlop79,
author = {Dominic Dunlop},
title = {Microcomputer-analog converter software and hardware interfacing:
Johnathon {A} Titus, Christopher {A} Titus, Peter {R} Rony and David
{G} Larsen, Howard {W} Sams {\&} Co Inc., {(1979)} 288 pp, {\textdollar}9.50},
journal = {Microprocess. Microsystems},
volume = {3},
number = {6},
pages = {291},
year = {1979}
}
@article{DBLP:journals/tsmc/KeeneyRR79,
author = {David W. Rajala},
title = {Review of "Decisions with Multiple Objectives: Preferences and Value
Trade-Offs" by Ralph L. Keeney and Howard Raiffa},
journal = {{IEEE} Trans. Syst. Man Cybern.},
volume = {9},
number = {7},
pages = {403},
year = {1979}
}
@article{DBLP:journals/ipm/ProctorRVPT78,
author = {David J. Proctor and
Alan Robson and
Margaret A. Veal and
J. Howard Petrie and
William G. Town},
title = {Development of an exchange format for the European Environmental Chemical
Data and Information Network {(ECDIN)}},
journal = {Inf. Process. Manag.},
volume = {14},
number = {6},
pages = {429--443},
year = {1978}
}
@inproceedings{DBLP:conf/acm/ZelkowitzMMLDRH76,
author = {Marvin V. Zelkowitz and
Paul R. McMullin and
Keith R. Merkel and
Howard J. Larsen and
Frederick C. Druseikis and
G. David Ripley and
David R. Hanson and
Gary Lindstrom},
title = {SIGPLAN(Paper Session)},
booktitle = {{ACM} Annual Conference},
pages = {390},
publisher = {{ACM}},
year = {1976}
}
@inproceedings{DBLP:conf/sigcpr/BryantA76,
author = {J. Howard Bryant and
David A. Ameen},
title = {Use of personal history, activities, ability and attitude questionnaire
to predict success as a systems analyst},
booktitle = {{SIGCPR}},
pages = {133--143},
publisher = {{ACM}},
year = {1976}
}
@article{DBLP:journals/ibmsj/BitontiCFH65,
author = {Frank Bitonti and
DeWitt W. Cooper and
David N. Frayne and
Howard H. Hansen},
title = {An Experimental Program for Linkage Analysis},
journal = {{IBM} Syst. J.},
volume = {4},
number = {3},
pages = {200--223},
year = {1965}
}
@inproceedings{DBLP:conf/dac/BitontiCFH65,
author = {Frank Bitonti and
DeWitt W. Cooper and
David N. Frayne and
Howard H. Hansen},
title = {A computer-aided linkage analysis system},
booktitle = {{DAC}},
publisher = {{ACM}},
year = {1965}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-07-13 00:49 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
