![](https://dblp.uni-trier.de/img/logo.ua.320x120.png)
![](https://dblp.uni-trier.de/img/dropdown.dark.16x16.png)
![](https://dblp.uni-trier.de/img/peace.dark.16x16.png)
Остановите войну!
for scientists:
![search dblp search dblp](https://dblp.uni-trier.de/img/search.dark.16x16.png)
![search dblp](https://dblp.uni-trier.de/img/search.dark.16x16.png)
default search action
Search dblp for Publications
export results for "David Held"
@article{DBLP:journals/arobots/AnchaPZNH24, author = {Siddharth Ancha and Gaurav Pathak and Ji Zhang and Srinivasa G. Narasimhan and David Held}, title = {Active velocity estimation using light curtains via self-supervised multi-armed bandits}, journal = {Auton. Robots}, volume = {48}, number = {6-7}, pages = {15}, year = {2024}, url = {https://doi.org/10.1007/s10514-024-10168-2}, doi = {10.1007/S10514-024-10168-2}, timestamp = {Sun, 18 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/arobots/AnchaPZNH24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ral/GuptaBAH24, author = {Pranay Gupta and Abhijat Biswas and Henny Admoni and David Held}, title = {Object Importance Estimation Using Counterfactual Reasoning for Intelligent Driving}, journal = {{IEEE} Robotics Autom. Lett.}, volume = {9}, number = {4}, pages = {3648--3655}, year = {2024}, url = {https://doi.org/10.1109/lra.2024.3368301}, doi = {10.1109/LRA.2024.3368301}, timestamp = {Mon, 01 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ral/GuptaBAH24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ral/SunWHE24, author = {Zhanyi Sun and Yufei Wang and David Held and Zackory Erickson}, title = {Force-Constrained Visual Policy: Safe Robot-Assisted Dressing via Multi-Modal Sensing}, journal = {{IEEE} Robotics Autom. Lett.}, volume = {9}, number = {5}, pages = {4178--4185}, year = {2024}, url = {https://doi.org/10.1109/LRA.2024.3375712}, doi = {10.1109/LRA.2024.3375712}, timestamp = {Sat, 04 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ral/SunWHE24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcps/BenglerDLRABFHHHIKKLLPRSSSSUV24, author = {Klaus Bengler and Werner Damm and Andreas L{\"{u}}dtke and Jochem W. Rieger and Benedikt Austel and Bianca Biebl and Martin Fr{\"{a}}nzle and Willem Hagemann and Moritz Held and David Hess and Klas Ihme and Severin Kacianka and Alyssa J. Kerscher and Forrest Laine and Sebastian Lehnhoff and Alexander Pretschner and Astrid Rakow and Daniel Sonntag and Janos Sztipanovits and Maike Schwammberger and Mark Schweda and Anirudh Unni and Eric M. S. P. Veith}, title = {A References Architecture for Human Cyber Physical Systems, Part {II:} Fundamental Design Principles for Human-CPS Interaction}, journal = {{ACM} Trans. Cyber Phys. Syst.}, volume = {8}, number = {1}, pages = {3:1--3:27}, year = {2024}, url = {https://doi.org/10.1145/3622880}, doi = {10.1145/3622880}, timestamp = {Sat, 10 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcps/BenglerDLRABFHHHIKKLLPRSSSSUV24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcps/DammFKLBBHHHIKLLPRRSSSSTUV24, author = {Werner Damm and Martin Fr{\"{a}}nzle and Alyssa J. Kerscher and Forrest Laine and Klaus Bengler and Bianca Biebl and Willem Hagemann and Moritz Held and David Hess and Klas Ihme and Severin Kacianka and Sebastian Lehnhoff and Andreas L{\"{u}}dtke and Alexander Pretschner and Astrid Rakow and Jochem W. Rieger and Daniel Sonntag and Janos Sztipanovits and Maike Schwammberger and Mark Schweda and Alexander Trende and Anirudh Unni and Eric M. S. P. Veith}, title = {A Reference Architecture of Human Cyber-Physical Systems - Part {III:} Semantic Foundations}, journal = {{ACM} Trans. Cyber Phys. Syst.}, volume = {8}, number = {1}, pages = {4:1--4:23}, year = {2024}, url = {https://doi.org/10.1145/3622881}, doi = {10.1145/3622881}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcps/DammFKLBBHHHIKLLPRRSSSSTUV24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcps/DammHSSBBFHHIKKLLPRRSSAUV24, author = {Werner Damm and David Hess and Mark Schweda and Janos Sztipanovits and Klaus Bengler and Bianca Biebl and Martin Fr{\"{a}}nzle and Willem Hagemann and Moritz Held and Klas Ihme and Severin Kacianka and Alyssa J. Kerscher and Sebastian Lehnhoff and Andreas L{\"{u}}dtke and Alexander Pretschner and Astrid Rakow and Jochem W. Rieger and Daniel Sonntag and Maike Schwammberger and Benedikt Austel and Anirudh Unni and Eric M. S. P. Veith}, title = {A Reference Architecture of Human Cyber-Physical Systems - Part {I:} Fundamental Concepts}, journal = {{ACM} Trans. Cyber Phys. Syst.}, volume = {8}, number = {1}, pages = {2:1--2:32}, year = {2024}, url = {https://doi.org/10.1145/3622879}, doi = {10.1145/3622879}, timestamp = {Sat, 10 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcps/DammHSSBBFHHIKKLLPRRSSAUV24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/Eisner0DVSH24, author = {Ben Eisner and Yi Yang and Todor Davchev and Mel Vecer{\'{\i}}k and Jonathan Scholz and David Held}, title = {Deep SE(3)-Equivariant Geometric Reasoning for Precise Placement Tasks}, booktitle = {The Twelfth International Conference on Learning Representations, {ICLR} 2024, Vienna, Austria, May 7-11, 2024}, publisher = {OpenReview.net}, year = {2024}, url = {https://openreview.net/forum?id=2inBuwTyL2}, timestamp = {Wed, 07 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iclr/Eisner0DVSH24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/WangSZXBHE24, author = {Yufei Wang and Zhanyi Sun and Jesse Zhang and Zhou Xian and Erdem Biyik and David Held and Zackory Erickson}, title = {{RL-VLM-F:} Reinforcement Learning from Vision Language Foundation Model Feedback}, booktitle = {Forty-first International Conference on Machine Learning, {ICML} 2024, Vienna, Austria, July 21-27, 2024}, publisher = {OpenReview.net}, year = {2024}, url = {https://openreview.net/forum?id=YSoMmNWZZx}, timestamp = {Mon, 02 Sep 2024 16:45:29 +0200}, biburl = {https://dblp.org/rec/conf/icml/WangSZXBHE24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/WangXCWWFEHG24, author = {Yufei Wang and Zhou Xian and Feng Chen and Tsun{-}Hsuan Wang and Yian Wang and Katerina Fragkiadaki and Zackory Erickson and David Held and Chuang Gan}, title = {RoboGen: Towards Unleashing Infinite Data for Automated Robot Learning via Generative Simulation}, booktitle = {Forty-first International Conference on Machine Learning, {ICML} 2024, Vienna, Austria, July 21-27, 2024}, publisher = {OpenReview.net}, year = {2024}, url = {https://openreview.net/forum?id=SQIDlJd3hN}, timestamp = {Mon, 02 Sep 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icml/WangXCWWFEHG24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/WangDH24, author = {Jenny Wang and Octavian Donca and David Held}, title = {Learning Distributional Demonstration Spaces for Task-Specific Cross-Pose Estimation}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2024, Yokohama, Japan, May 13-17, 2024}, pages = {15054--15060}, publisher = {{IEEE}}, year = {2024}, url = {https://doi.org/10.1109/ICRA57147.2024.10611004}, doi = {10.1109/ICRA57147.2024.10611004}, timestamp = {Mon, 19 Aug 2024 15:58:53 +0200}, biburl = {https://dblp.org/rec/conf/icra/WangDH24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/YangZLZH24, author = {Fan Yang and Wenxuan Zhou and Zuxin Liu and Ding Zhao and David Held}, title = {Reinforcement Learning in a Safety-Embedded {MDP} with Trajectory Optimization}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2024, Yokohama, Japan, May 13-17, 2024}, pages = {2845--2851}, publisher = {{IEEE}}, year = {2024}, url = {https://doi.org/10.1109/ICRA57147.2024.10610047}, doi = {10.1109/ICRA57147.2024.10610047}, timestamp = {Mon, 19 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icra/YangZLZH24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2401-01993, author = {M. Nomaan Qureshi and Ben Eisner and David Held}, title = {On Time-Indexing as Inductive Bias in Deep {RL} for Sequential Manipulation Tasks}, journal = {CoRR}, volume = {abs/2401.01993}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2401.01993}, doi = {10.48550/ARXIV.2401.01993}, eprinttype = {arXiv}, eprint = {2401.01993}, timestamp = {Tue, 23 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2401-01993.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2402-03681, author = {Yufei Wang and Zhanyi Sun and Jesse Zhang and Zhou Xian and Erdem Biyik and David Held and Zackory Erickson}, title = {{RL-VLM-F:} Reinforcement Learning from Vision Language Foundation Model Feedback}, journal = {CoRR}, volume = {abs/2402.03681}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2402.03681}, doi = {10.48550/ARXIV.2402.03681}, eprinttype = {arXiv}, eprint = {2402.03681}, timestamp = {Mon, 12 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2402-03681.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2402-05421, author = {Weikang Wan and Yufei Wang and Zackory Erickson and David Held}, title = {DiffTOP: Differentiable Trajectory Optimization for Deep Reinforcement and Imitation Learning}, journal = {CoRR}, volume = {abs/2402.05421}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2402.05421}, doi = {10.48550/ARXIV.2402.05421}, eprinttype = {arXiv}, eprint = {2402.05421}, timestamp = {Wed, 14 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2402-05421.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2404-13478, author = {Ben Eisner and Yi Yang and Todor Davchev and Mel Vecer{\'{\i}}k and Jonathan Scholz and David Held}, title = {Deep SE(3)-Equivariant Geometric Reasoning for Precise Placement Tasks}, journal = {CoRR}, volume = {abs/2404.13478}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2404.13478}, doi = {10.48550/ARXIV.2404.13478}, eprinttype = {arXiv}, eprint = {2404.13478}, timestamp = {Sat, 25 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2404-13478.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2405-04609, author = {Jenny Wang and Octavian Donca and David Held}, title = {Learning Distributional Demonstration Spaces for Task-Specific Cross-Pose Estimation}, journal = {CoRR}, volume = {abs/2405.04609}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2405.04609}, doi = {10.48550/ARXIV.2405.04609}, eprinttype = {arXiv}, eprint = {2405.04609}, timestamp = {Thu, 13 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2405-04609.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2407-01361, author = {Alberta Longhini and Yufei Wang and Irene Garcia{-}Camacho and David Blanco{-}Mulero and Marco Moletta and Michael C. Welle and Guillem Aleny{\`{a}} and Hang Yin and Zackory Erickson and David Held and J{\'{u}}lia Borr{\`{a}}s and Danica Kragic}, title = {Unfolding the Literature: {A} Review of Robotic Cloth Manipulation}, journal = {CoRR}, volume = {abs/2407.01361}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2407.01361}, doi = {10.48550/ARXIV.2407.01361}, eprinttype = {arXiv}, eprint = {2407.01361}, timestamp = {Tue, 13 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2407-01361.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2407-08585, author = {Bowen Jiang and Yilin Wu and Wenxuan Zhou and Chris Paxton and David Held}, title = {HACMan++: Spatially-Grounded Motion Primitives for Manipulation}, journal = {CoRR}, volume = {abs/2407.08585}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2407.08585}, doi = {10.48550/ARXIV.2407.08585}, eprinttype = {arXiv}, eprint = {2407.08585}, timestamp = {Fri, 16 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2407-08585.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/neuroimage/ZhouLSANWDEMBWBRSDSF23, author = {Zhen Zhou and Hongming Li and Dhivya Srinivasan and Ahmed Abdulkadir and Ilya M. Nasrallah and Junhao Wen and Jimit Doshi and G{\"{u}}ray Erus and Elizabeth Mamourian and R. Nick Bryan and David A. Wolk and Lori L. Beason{-}Held and Susan M. Resnick and Theodore D. Satterthwaite and Christos Davatzikos and Haochang Shou and Yong Fan}, title = {Multiscale functional connectivity patterns of the aging brain learned from harmonized rsfMRI data of the multi-cohort iSTAGING study}, journal = {NeuroImage}, volume = {269}, pages = {119911}, year = {2023}, url = {https://doi.org/10.1016/j.neuroimage.2023.119911}, doi = {10.1016/J.NEUROIMAGE.2023.119911}, timestamp = {Tue, 28 Mar 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/neuroimage/ZhouLSANWDEMBWBRSDSF23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pacmhci/BerkholzEBST23, author = {Jenny Berkholz and Margarita Esau{-}Held and Alexander Boden and Gunnar Stevens and Peter Tolmie}, title = {Becoming an Online Wine Taster: An Ethnographic Study on the Digital Mediation of Taste}, journal = {Proc. {ACM} Hum. Comput. Interact.}, volume = {7}, number = {{CSCW1}}, pages = {1--26}, year = {2023}, url = {https://doi.org/10.1145/3579459}, doi = {10.1145/3579459}, timestamp = {Wed, 17 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pacmhci/BerkholzEBST23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/ZhangEH23, author = {Harry Zhang and Ben Eisner and David Held}, editor = {Jie Tan and Marc Toussaint and Kourosh Darvish}, title = {FlowBot++: Learning Generalized Articulated Objects Manipulation via Articulation Projection}, booktitle = {Conference on Robot Learning, CoRL 2023, 6-9 November 2023, Atlanta, GA, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {229}, pages = {1222--1241}, publisher = {{PMLR}}, year = {2023}, url = {https://proceedings.mlr.press/v229/zhang23c.html}, timestamp = {Tue, 20 Feb 2024 12:11:46 +0100}, biburl = {https://dblp.org/rec/conf/corl/ZhangEH23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/ZhouJYPH23, author = {Wenxuan Zhou and Bowen Jiang and Fan Yang and Chris Paxton and David Held}, editor = {Jie Tan and Marc Toussaint and Kourosh Darvish}, title = {HACMan: Learning Hybrid Actor-Critic Maps for 6D Non-Prehensile Manipulation}, booktitle = {Conference on Robot Learning, CoRL 2023, 6-9 November 2023, Atlanta, GA, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {229}, pages = {241--265}, publisher = {{PMLR}}, year = {2023}, url = {https://proceedings.mlr.press/v229/zhou23a.html}, timestamp = {Tue, 20 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/corl/ZhouJYPH23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/KhuranaHHR23, author = {Tarasha Khurana and Peiyun Hu and David Held and Deva Ramanan}, title = {Point Cloud Forecasting as a Proxy for 4D Occupancy Forecasting}, booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2023, Vancouver, BC, Canada, June 17-24, 2023}, pages = {1116--1124}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/CVPR52729.2023.00114}, doi = {10.1109/CVPR52729.2023.00114}, timestamp = {Mon, 28 Aug 2023 16:14:07 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/KhuranaHHR23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/ChenSSCKHG23, author = {Lawrence Yunliang Chen and Baiyu Shi and Daniel Seita and Richard Cheng and Thomas Kollar and David Held and Ken Goldberg}, title = {AutoBag: Learning to Open Plastic Bags and Insert Objects}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2023, London, UK, May 29 - June 2, 2023}, pages = {3918--3925}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/ICRA48891.2023.10161402}, doi = {10.1109/ICRA48891.2023.10161402}, timestamp = {Tue, 08 Aug 2023 10:24:29 +0200}, biburl = {https://dblp.org/rec/conf/icra/ChenSSCKHG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/HuangLH23, author = {Zixuan Huang and Xingyu Lin and David Held}, title = {Self-supervised Cloth Reconstruction via Action-conditioned Cloth Tracking}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2023, London, UK, May 29 - June 2, 2023}, pages = {7111--7118}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/ICRA48891.2023.10160653}, doi = {10.1109/ICRA48891.2023.10160653}, timestamp = {Tue, 08 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icra/HuangLH23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/LonghiniMRWHEK23, author = {Alberta Longhini and Marco Moletta and Alfredo Reichlin and Michael C. Welle and David Held and Zackory Erickson and Danica Kragic}, title = {EDO-Net: Learning Elastic Properties of Deformable Objects from Graph Dynamics}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2023, London, UK, May 29 - June 2, 2023}, pages = {3875--3881}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/ICRA48891.2023.10161234}, doi = {10.1109/ICRA48891.2023.10161234}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icra/LonghiniMRWHEK23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/LonghiniMRWKWHEK23, author = {Alberta Longhini and Marco Moletta and Alfredo Reichlin and Michael C. Welle and Alexander Kravberg and Yufei Wang and David Held and Zackory Erickson and Danica Kragic}, title = {Elastic Context: Encoding Elasticity for Data-driven Models of Textiles Elastic Context: Encoding Elasticity for Data-driven Models of Textiles}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2023, London, UK, May 29 - June 2, 2023}, pages = {1764--1770}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/ICRA48891.2023.10160740}, doi = {10.1109/ICRA48891.2023.10160740}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icra/LonghiniMRWKWHEK23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/WengHMM23, author = {Thomas Weng and David Held and Franziska Meier and Mustafa Mukadam}, title = {Neural Grasp Distance Fields for Robot Manipulation}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2023, London, UK, May 29 - June 2, 2023}, pages = {1814--1821}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/ICRA48891.2023.10160217}, doi = {10.1109/ICRA48891.2023.10160217}, timestamp = {Tue, 08 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icra/WengHMM23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/BrightAHMMTCDFGHJKPRSW23, author = {Courtney Bright and David Ardila and Erin L. Hestir and Timothy J. Malthus and Mark William Matthews and David R. Thompson and Nick Carter and Arnold G. Dekker and Renato Prata de Moraes Frasson and Robert O. Green and Alex Held and Klaus Joehnk and Jeremy Kravitz and Joshua Pease and Chris M. Roelfsema and Carl Seubert and Bozena Wojtasiewicz}, title = {The AquaSat-1 Mission Concept: Actionable Information on Water Quality and Aquatic Ecosystems for Australia and Western {USA}}, booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS} 2023, Pasadena, CA, USA, July 16-21, 2023}, pages = {4590--4593}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/IGARSS52108.2023.10282912}, doi = {10.1109/IGARSS52108.2023.10282912}, timestamp = {Mon, 29 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/igarss/BrightAHMMTCDFGHJKPRSW23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iros/ChenSLSACKHG23, author = {Lawrence Yunliang Chen and Baiyu Shi and Roy Lin and Daniel Seita and Ayah Ahmad and Richard Cheng and Thomas Kollar and David Held and Ken Goldberg}, title = {Bagging by Learning to Singulate Layers Using Interactive Perception}, booktitle = {{IROS}}, pages = {3176--3183}, year = {2023}, url = {https://doi.org/10.1109/IROS55552.2023.10341634}, doi = {10.1109/IROS55552.2023.10341634}, timestamp = {Fri, 05 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iros/ChenSLSACKHG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rss/AnchaPZNH23, author = {Siddharth Ancha and Gaurav Pathak and Ji Zhang and Srinivasa G. Narasimhan and David Held}, editor = {Kostas E. Bekris and Kris Hauser and Sylvia L. Herbert and Jingjin Yu}, title = {Active Velocity Estimation using Light Curtains via Self-Supervised Multi-Armed Bandits}, booktitle = {Robotics: Science and Systems XIX, Daegu, Republic of Korea, July 10-14, 2023}, year = {2023}, url = {https://doi.org/10.15607/RSS.2023.XIX.097}, doi = {10.15607/RSS.2023.XIX.097}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/rss/AnchaPZNH23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rss/WangSEH23, author = {Yufei Wang and Zhanyi Sun and Zackory Erickson and David Held}, editor = {Kostas E. Bekris and Kris Hauser and Sylvia L. Herbert and Jingjin Yu}, title = {One Policy to Dress Them All: Learning to Dress People with Diverse Poses and Garments}, booktitle = {Robotics: Science and Systems XIX, Daegu, Republic of Korea, July 10-14, 2023}, year = {2023}, url = {https://doi.org/10.15607/RSS.2023.XIX.008}, doi = {10.15607/RSS.2023.XIX.008}, timestamp = {Thu, 20 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/rss/WangSEH23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/sashimi-ws/2023, editor = {Jelmer M. Wolterink and David Svoboda and Can Zhao and Virginia Fernandez}, title = {Simulation and Synthesis in Medical Imaging - 8th International Workshop, {SASHIMI} 2023, Held in Conjunction with {MICCAI} 2023, Vancouver, BC, Canada, October 8, 2023, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {14288}, publisher = {Springer}, year = {2023}, url = {https://doi.org/10.1007/978-3-031-44689-4}, doi = {10.1007/978-3-031-44689-4}, isbn = {978-3-031-44688-7}, timestamp = {Wed, 18 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sashimi-ws/2023.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2302-09502, author = {Zixuan Huang and Xingyu Lin and David Held}, title = {Self-supervised Cloth Reconstruction via Action-conditioned Cloth Tracking}, journal = {CoRR}, volume = {abs/2302.09502}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2302.09502}, doi = {10.48550/ARXIV.2302.09502}, eprinttype = {arXiv}, eprint = {2302.09502}, timestamp = {Thu, 23 Feb 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2302-09502.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2302-12597, author = {Siddharth Ancha and Gaurav Pathak and Ji Zhang and Srinivasa G. Narasimhan and David Held}, title = {Active Velocity Estimation using Light Curtains via Self-Supervised Multi-Armed Bandits}, journal = {CoRR}, volume = {abs/2302.12597}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2302.12597}, doi = {10.48550/ARXIV.2302.12597}, eprinttype = {arXiv}, eprint = {2302.12597}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2302-12597.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2302-13130, author = {Tarasha Khurana and Peiyun Hu and David Held and Deva Ramanan}, title = {Point Cloud Forecasting as a Proxy for 4D Occupancy Forecasting}, journal = {CoRR}, volume = {abs/2302.13130}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2302.13130}, doi = {10.48550/ARXIV.2302.13130}, eprinttype = {arXiv}, eprint = {2302.13130}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2302-13130.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2303-16898, author = {Lawrence Yunliang Chen and Baiyu Shi and Roy Lin and Daniel Seita and Ayah Ahmad and Richard Cheng and Thomas Kollar and David Held and Ken Goldberg}, title = {Bagging by Learning to Singulate Layers Using Interactive Perception}, journal = {CoRR}, volume = {abs/2303.16898}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2303.16898}, doi = {10.48550/ARXIV.2303.16898}, eprinttype = {arXiv}, eprint = {2303.16898}, timestamp = {Fri, 14 Apr 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2303-16898.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2305-03942, author = {Wenxuan Zhou and Bowen Jiang and Fan Yang and Chris Paxton and David Held}, title = {Learning Hybrid Actor-Critic Maps for 6D Non-Prehensile Manipulation}, journal = {CoRR}, volume = {abs/2305.03942}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2305.03942}, doi = {10.48550/ARXIV.2305.03942}, eprinttype = {arXiv}, eprint = {2305.03942}, timestamp = {Thu, 11 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2305-03942.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2306-12372, author = {Yufei Wang and Zhanyi Sun and Zackory Erickson and David Held}, title = {One Policy to Dress Them All: Learning to Dress People with Diverse Poses and Garments}, journal = {CoRR}, volume = {abs/2306.12372}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2306.12372}, doi = {10.48550/ARXIV.2306.12372}, eprinttype = {arXiv}, eprint = {2306.12372}, timestamp = {Fri, 23 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2306-12372.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2306-12893, author = {Harry Zhang and Ben Eisner and David Held}, title = {FlowBot++: Learning Generalized Articulated Objects Manipulation via Articulation Projection}, journal = {CoRR}, volume = {abs/2306.12893}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2306.12893}, doi = {10.48550/ARXIV.2306.12893}, eprinttype = {arXiv}, eprint = {2306.12893}, timestamp = {Tue, 27 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2306-12893.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2310-00156, author = {Carl Qi and Sarthak J. Shetty and Xingyu Lin and David Held}, title = {Learning Generalizable Tool-use Skills through Trajectory Generation}, journal = {CoRR}, volume = {abs/2310.00156}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2310.00156}, doi = {10.48550/ARXIV.2310.00156}, eprinttype = {arXiv}, eprint = {2310.00156}, timestamp = {Wed, 18 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2310-00156.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2310-06903, author = {Fan Yang and Wenxuan Zhou and Zuxin Liu and Ding Zhao and David Held}, title = {Reinforcement Learning in a Safety-Embedded {MDP} with Trajectory Optimization}, journal = {CoRR}, volume = {abs/2310.06903}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2310.06903}, doi = {10.48550/ARXIV.2310.06903}, eprinttype = {arXiv}, eprint = {2310.06903}, timestamp = {Tue, 24 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2310-06903.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2311-01455, author = {Yufei Wang and Zhou Xian and Feng Chen and Tsun{-}Hsuan Wang and Yian Wang and Zackory Erickson and David Held and Chuang Gan}, title = {RoboGen: Towards Unleashing Infinite Data for Automated Robot Learning via Generative Simulation}, journal = {CoRR}, volume = {abs/2311.01455}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2311.01455}, doi = {10.48550/ARXIV.2311.01455}, eprinttype = {arXiv}, eprint = {2311.01455}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2311-01455.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2311-04390, author = {Zhanyi Sun and Yufei Wang and David Held and Zackory Erickson}, title = {Force-Constrained Visual Policy: Safe Robot-Assisted Dressing via Multi-Modal Sensing}, journal = {CoRR}, volume = {abs/2311.04390}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2311.04390}, doi = {10.48550/ARXIV.2311.04390}, eprinttype = {arXiv}, eprint = {2311.04390}, timestamp = {Tue, 14 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2311-04390.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2312-02467, author = {Pranay Gupta and Abhijat Biswas and Henny Admoni and David Held}, title = {Object Importance Estimation using Counterfactual Reasoning for Intelligent Driving}, journal = {CoRR}, volume = {abs/2312.02467}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2312.02467}, doi = {10.48550/ARXIV.2312.02467}, eprinttype = {arXiv}, eprint = {2312.02467}, timestamp = {Wed, 13 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2312-02467.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijmssc/BelemSSSO22, author = {John David S. Bel{\'{e}}m and Hidalyn Theodory C. M. Souza and Alvaro Sobrinho and Lenardo Chaves e Silva and Helder F. de A. Oliveira}, title = {Modeling unmanned aerial vehicle system for identifying foci of arboviral disease with monitoring system}, journal = {Int. J. Model. Simul. Sci. Comput.}, volume = {13}, number = {3}, pages = {2250015:1--2250015:23}, year = {2022}, url = {https://doi.org/10.1142/S1793962322500155}, doi = {10.1142/S1793962322500155}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijmssc/BelemSSSO22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ral/GuOH22, author = {Qiao Gu and Brian Okorn and David Held}, title = {{OSSID:} Online Self-Supervised Instance Detection by (And For) Pose Estimation}, journal = {{IEEE} Robotics Autom. Lett.}, volume = {7}, number = {2}, pages = {3022--3029}, year = {2022}, url = {https://doi.org/10.1109/LRA.2022.3145488}, doi = {10.1109/LRA.2022.3145488}, timestamp = {Fri, 01 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ral/GuOH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ral/QiLH22, author = {Carl Qi and Xingyu Lin and David Held}, title = {Learning Closed-Loop Dough Manipulation Using a Differentiable Reset Module}, journal = {{IEEE} Robotics Autom. Lett.}, volume = {7}, number = {4}, pages = {9864--9871}, year = {2022}, url = {https://doi.org/10.1109/LRA.2022.3191239}, doi = {10.1109/LRA.2022.3191239}, timestamp = {Mon, 05 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ral/QiLH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ral/WangHE22, author = {Yufei Wang and David Held and Zackory Erickson}, title = {Visual Haptic Reasoning: Estimating Contact Forces by Observing Deformable Object Interactions}, journal = {{IEEE} Robotics Autom. Lett.}, volume = {7}, number = {4}, pages = {11426--11433}, year = {2022}, url = {https://doi.org/10.1109/LRA.2022.3199684}, doi = {10.1109/LRA.2022.3199684}, timestamp = {Mon, 05 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ral/WangHE22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/PardisGDSBPL22, author = {William Pardis and Kalina C. Grabb and Michael D. DeGrandpre and Reggie Spaulding and James Beck and Jonathan A. Pfeifer and David M. Long}, title = {Measuring Protons with Photons: {A} Hand-Held, Spectrophotometric pH Analyzer for Ocean Acidification Research, Community Science and Education}, journal = {Sensors}, volume = {22}, number = {20}, pages = {7924}, year = {2022}, url = {https://doi.org/10.3390/s22207924}, doi = {10.3390/S22207924}, timestamp = {Mon, 05 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sensors/PardisGDSBPL22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbe/QinWBGZDC22, author = {Xi Qin and Bohan Wang and David Boegner and Brandon Gaitan and Yingning Zheng and Xian Du and Yu Chen}, title = {Indoor Localization of Hand-Held {OCT} Probe Using Visual Odometry and Real-Time Segmentation Using Deep Learning}, journal = {{IEEE} Trans. Biomed. Eng.}, volume = {69}, number = {4}, pages = {1378--1385}, year = {2022}, url = {https://doi.org/10.1109/TBME.2021.3116514}, doi = {10.1109/TBME.2021.3116514}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tbe/QinWBGZDC22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tse/KuhrmannTHKMLPF22, author = {Marco Kuhrmann and Paolo Tell and Regina Hebig and Jil Kl{\"{u}}nder and J{\"{u}}rgen M{\"{u}}nch and Oliver Linssen and Dietmar Pfahl and Michael Felderer and Christian R. Prause and Stephen G. MacDonell and Joyce Nakatumba{-}Nabende and David Raffo and Sarah Beecham and Eray T{\"{u}}z{\"{u}}n and Gustavo L{\'{o}}pez and Nicol{\'{a}}s Paez and Diego Fontdevila and Sherlock A. Licorish and Steffen K{\"{u}}pper and G{\"{u}}nther Ruhe and Eric Knauss and {\"{O}}zden {\"{O}}zcan{-}Top and Paul M. Clarke and Fergal McCaffery and Marcela Genero and Aurora Vizca{\'{\i}}no and Mario Piattini and Marcos Kalinowski and Tayana Conte and Rafael Prikladnicki and Stephan Krusche and Ahmet Coskun{\c{c}}ay and Ezequiel Scott and Fabio Calefato and Svetlana Pimonova and Rolf{-}Helge Pfeiffer and Ulrik Pagh Schultz and Rogardt Heldal and Masud Fazal{-}Baqaie and Craig Anslow and Maleknaz Nayebi and Kurt Schneider and Stefan Sauer and Dietmar Winkler and Stefan Biffl and Mar{\'{\i}}a Cecilia Bastarrica and Ita Richardson}, title = {What Makes Agile Software Development Agile?}, journal = {{IEEE} Trans. Software Eng.}, volume = {48}, number = {9}, pages = {3523--3539}, year = {2022}, url = {https://doi.org/10.1109/TSE.2021.3099532}, doi = {10.1109/TSE.2021.3099532}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tse/KuhrmannTHKMLPF22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/LinQZHFLGH22, author = {Xingyu Lin and Carl Qi and Yunchu Zhang and Zhiao Huang and Katerina Fragkiadaki and Yunzhu Li and Chuang Gan and David Held}, editor = {Karen Liu and Dana Kulic and Jeffrey Ichnowski}, title = {Planning with Spatial-Temporal Abstraction from Point Clouds for Deformable Object Manipulation}, booktitle = {Conference on Robot Learning, CoRL 2022, 14-18 December 2022, Auckland, New Zealand}, series = {Proceedings of Machine Learning Research}, volume = {205}, pages = {1640--1651}, publisher = {{PMLR}}, year = {2022}, url = {https://proceedings.mlr.press/v205/lin23b.html}, timestamp = {Wed, 15 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/corl/LinQZHFLGH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/OkornPHH22, author = {Brian Okorn and Chuer Pan and Martial Hebert and David Held}, editor = {Karen Liu and Dana Kulic and Jeffrey Ichnowski}, title = {Deep Projective Rotation Estimation through Relative Supervision}, booktitle = {Conference on Robot Learning, CoRL 2022, 14-18 December 2022, Auckland, New Zealand}, series = {Proceedings of Machine Learning Research}, volume = {205}, pages = {1575--1585}, publisher = {{PMLR}}, year = {2022}, url = {https://proceedings.mlr.press/v205/okorn23a.html}, timestamp = {Wed, 15 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/corl/OkornPHH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/PanOZEH22, author = {Chuer Pan and Brian Okorn and Harry Zhang and Ben Eisner and David Held}, editor = {Karen Liu and Dana Kulic and Jeffrey Ichnowski}, title = {TAX-Pose: Task-Specific Cross-Pose Estimation for Robot Manipulation}, booktitle = {Conference on Robot Learning, CoRL 2022, 14-18 December 2022, Auckland, New Zealand}, series = {Proceedings of Machine Learning Research}, volume = {205}, pages = {1783--1792}, publisher = {{PMLR}}, year = {2022}, url = {https://proceedings.mlr.press/v205/pan23a.html}, timestamp = {Wed, 15 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/corl/PanOZEH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/SeitaWSLEH22, author = {Daniel Seita and Yufei Wang and Sarthak J. Shetty and Edward Yao Li and Zackory Erickson and David Held}, editor = {Karen Liu and Dana Kulic and Jeffrey Ichnowski}, title = {ToolFlowNet: Robotic Manipulation with Tools via Predicting Tool Flow from Point Clouds}, booktitle = {Conference on Robot Learning, CoRL 2022, 14-18 December 2022, Auckland, New Zealand}, series = {Proceedings of Machine Learning Research}, volume = {205}, pages = {1038--1049}, publisher = {{PMLR}}, year = {2022}, url = {https://proceedings.mlr.press/v205/seita23a.html}, timestamp = {Wed, 15 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/corl/SeitaWSLEH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/ZhouH22, author = {Wenxuan Zhou and David Held}, editor = {Karen Liu and Dana Kulic and Jeffrey Ichnowski}, title = {Learning to Grasp the Ungraspable with Emergent Extrinsic Dexterity}, booktitle = {Conference on Robot Learning, CoRL 2022, 14-18 December 2022, Auckland, New Zealand}, series = {Proceedings of Machine Learning Research}, volume = {205}, pages = {150--160}, publisher = {{PMLR}}, year = {2022}, url = {https://proceedings.mlr.press/v205/zhou23a.html}, timestamp = {Wed, 15 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/corl/ZhouH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/KhuranaHDZHR22, author = {Tarasha Khurana and Peiyun Hu and Achal Dave and Jason Ziglar and David Held and Deva Ramanan}, editor = {Shai Avidan and Gabriel J. Brostow and Moustapha Ciss{\'{e}} and Giovanni Maria Farinella and Tal Hassner}, title = {Differentiable Raycasting for Self-Supervised Occupancy Forecasting}, booktitle = {Computer Vision - {ECCV} 2022 - 17th European Conference, Tel Aviv, Israel, October 23-27, 2022, Proceedings, Part {XXXVIII}}, series = {Lecture Notes in Computer Science}, volume = {13698}, pages = {353--369}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-19839-7\_21}, doi = {10.1007/978-3-031-19839-7\_21}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eccv/KhuranaHDZHR22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/LinHLTHG22, author = {Xingyu Lin and Zhiao Huang and Yunzhu Li and Joshua B. Tenenbaum and David Held and Chuang Gan}, title = {DiffSkill: Skill Abstraction from Differentiable Physics for Deformable Object Manipulations with Tools}, booktitle = {The Tenth International Conference on Learning Representations, {ICLR} 2022, Virtual Event, April 25-29, 2022}, publisher = {OpenReview.net}, year = {2022}, url = {https://openreview.net/forum?id=Kef8cKdHWpP}, timestamp = {Sat, 20 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iclr/LinHLTHG22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/NarasimhanZELH22, author = {Gautham Narayan Narasimhan and Kai Zhang and Ben Eisner and Xingyu Lin and David Held}, title = {Self-supervised Transparent Liquid Segmentation for Robotic Pouring}, booktitle = {2022 International Conference on Robotics and Automation, {ICRA} 2022, Philadelphia, PA, USA, May 23-27, 2022}, pages = {4555--4561}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/ICRA46639.2022.9812000}, doi = {10.1109/ICRA46639.2022.9812000}, timestamp = {Wed, 20 Jul 2022 18:22:23 +0200}, biburl = {https://dblp.org/rec/conf/icra/NarasimhanZELH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iros/TirumalaWSKTH22, author = {Sashank Tirumala and Thomas Weng and Daniel Seita and Oliver Kroemer and Fatma Zeynep Temel and David Held}, title = {Learning to Singulate Layers of Cloth using Tactile Feedback}, booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems, {IROS} 2022, Kyoto, Japan, October 23-27, 2022}, pages = {7773--7780}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/IROS47612.2022.9981341}, doi = {10.1109/IROS47612.2022.9981341}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iros/TirumalaWSKTH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ispd/PosserYHLP22, author = {Gracieli Posser and Evangeline F. Y. Young and Stephan Held and Yih{-}Lang Li and David Z. Pan}, editor = {Laleh Behjat and Stephen Yang}, title = {Challenges and Approaches in {VLSI} Routing}, booktitle = {{ISPD} 2022: International Symposium on Physical Design, Virtual Event, Canada, March 27 - 30, 2022}, pages = {185--192}, publisher = {{ACM}}, year = {2022}, url = {https://doi.org/10.1145/3505170.3511477}, doi = {10.1145/3505170.3511477}, timestamp = {Thu, 14 Apr 2022 14:53:52 +0200}, biburl = {https://dblp.org/rec/conf/ispd/PosserYHLP22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mm/0003STVBGMFRSM22, author = {Rafael Ferreira and Diogo Silva and Diogo Tavares and Frederico Vicente and Mariana Bonito and Gustavo Gon{\c{c}}alves and Rui Margarido and Paula Figueiredo and Helder Rodrigues and David Semedo and Jo{\~{a}}o Magalh{\~{a}}es}, editor = {Jo{\~{a}}o Magalh{\~{a}}es and Alberto Del Bimbo and Shin'ichi Satoh and Nicu Sebe and Xavier Alameda{-}Pineda and Qin Jin and Vincent Oria and Laura Toni}, title = {{TWIZ:} The Multimodal Conversational Task Wizard}, booktitle = {{MM} '22: The 30th {ACM} International Conference on Multimedia, Lisboa, Portugal, October 10 - 14, 2022}, pages = {6997--6999}, publisher = {{ACM}}, year = {2022}, url = {https://doi.org/10.1145/3503161.3547741}, doi = {10.1145/3503161.3547741}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mm/0003STVBGMFRSM22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rss/EisnerZH22, author = {Ben Eisner and Harry Zhang and David Held}, editor = {Kris Hauser and Dylan A. Shell and Shoudong Huang}, title = {FlowBot3D: Learning 3D Articulation Flow to Manipulate Articulated Objects}, booktitle = {Robotics: Science and Systems XVIII, New York City, NY, USA, June 27 - July 1, 2022}, year = {2022}, url = {https://doi.org/10.15607/RSS.2022.XVIII.018}, doi = {10.15607/RSS.2022.XVIII.018}, timestamp = {Thu, 20 Jul 2023 14:50:03 +0200}, biburl = {https://dblp.org/rec/conf/rss/EisnerZH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rss/HuangLH22, author = {Zixuan Huang and Xingyu Lin and David Held}, editor = {Kris Hauser and Dylan A. Shell and Shoudong Huang}, title = {Mesh-based Dynamics with Occlusion Reasoning for Cloth Manipulation}, booktitle = {Robotics: Science and Systems XVIII, New York City, NY, USA, June 27 - July 1, 2022}, year = {2022}, url = {https://doi.org/10.15607/RSS.2022.XVIII.011}, doi = {10.15607/RSS.2022.XVIII.011}, timestamp = {Thu, 20 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/rss/HuangLH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/dais/2022, editor = {David M. Eyers and Spyros Voulgaris}, title = {Distributed Applications and Interoperable Systems: 22nd {IFIP} {WG} 6.1 International Conference, {DAIS} 2022, Held as Part of the 17th International Federated Conference on Distributed Computing Techniques, DisCoTec 2022, Lucca, Italy, June 13-17, 2022, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {13272}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-16092-9}, doi = {10.1007/978-3-031-16092-9}, isbn = {978-3-031-16092-9}, timestamp = {Tue, 17 Jan 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dais/2022.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/miccai/2021midog, editor = {Marc Aubreville and David Zimmerer and Mattias P. Heinrich}, title = {Biomedical Image Registration, Domain Generalisation and Out-of-Distribution Analysis - {MICCAI} 2021 Challenges: {MIDOG} 2021, {MOOD} 2021, and Learn2Reg 2021, Held in Conjunction with {MICCAI} 2021, Strasbourg, France, September 27 - October 1, 2021, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {13166}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-030-97281-3}, doi = {10.1007/978-3-030-97281-3}, isbn = {978-3-030-97280-6}, timestamp = {Thu, 22 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miccai/2021midog.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/miccai/2022isgie, editor = {Luigi Manfredi and Seyed{-}Ahmad Ahmadi and Michael M. Bronstein and Anees Kazi and Davide Lomanto and Alwyn Mathew and Ludovic Magerand and Kamilia Mullakaeva and Bartlomiej W. Papiez and Russell H. Taylor and Emanuele Trucco}, title = {Imaging Systems for {GI} Endoscopy, and Graphs in Biomedical Image Analysis - First {MICCAI} Workshop, {ISGIE} 2022, and Fourth {MICCAI} Workshop, {GRAIL} 2022, Held in Conjunction with {MICCAI} 2022, Singapore, September 18, 2022, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {13754}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-21083-9}, doi = {10.1007/978-3-031-21083-9}, isbn = {978-3-031-21082-2}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/miccai/2022isgie.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/miccai/2022sashimi, editor = {Can Zhao and David Svoboda and Jelmer M. Wolterink and Mar{\'{\i}}a Escobar}, title = {Simulation and Synthesis in Medical Imaging - 7th International Workshop, {SASHIMI} 2022, Held in Conjunction with {MICCAI} 2022, Singapore, September 18, 2022, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {13570}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-16980-9}, doi = {10.1007/978-3-031-16980-9}, isbn = {978-3-031-16979-3}, timestamp = {Sat, 11 Feb 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/miccai/2022sashimi.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2201-07309, author = {Qiao Gu and Brian Okorn and David Held}, title = {{OSSID:} Online Self-Supervised Instance Detection by (and for) Pose Estimation}, journal = {CoRR}, volume = {abs/2201.07309}, year = {2022}, url = {https://arxiv.org/abs/2201.07309}, eprinttype = {arXiv}, eprint = {2201.07309}, timestamp = {Fri, 21 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2201-07309.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2202-00182, author = {Jianren Wang and Haiming Gang and Siddarth Ancha and Yi{-}Ting Chen and David Held}, title = {Semi-supervised 3D Object Detection via Temporal Graph Neural Networks}, journal = {CoRR}, volume = {abs/2202.00182}, year = {2022}, url = {https://arxiv.org/abs/2202.00182}, eprinttype = {arXiv}, eprint = {2202.00182}, timestamp = {Wed, 09 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2202-00182.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2203-01538, author = {Gautham Narayan Narasimhan and Kai Zhang and Ben Eisner and Xingyu Lin and David Held}, title = {Self-supervised Transparent Liquid Segmentation for Robotic Pouring}, journal = {CoRR}, volume = {abs/2203.01538}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2203.01538}, doi = {10.48550/ARXIV.2203.01538}, eprinttype = {arXiv}, eprint = {2203.01538}, timestamp = {Wed, 16 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2203-01538.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2203-08098, author = {Sudeep Dasari and Jianren Wang and Joyce Hong and Shikhar Bahl and Yixin Lin and Austin S. Wang and Abitha Thankaraj and Karanbir Chahal and Berk {\c{C}}alli and Saurabh Gupta and David Held and Lerrel Pinto and Deepak Pathak and Vikash Kumar and Abhinav Gupta}, title = {{RB2:} Robotic Manipulation Benchmarking with a Twist}, journal = {CoRR}, volume = {abs/2203.08098}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2203.08098}, doi = {10.48550/ARXIV.2203.08098}, eprinttype = {arXiv}, eprint = {2203.08098}, timestamp = {Tue, 29 Mar 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2203-08098.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2203-17275, author = {Xingyu Lin and Zhiao Huang and Yunzhu Li and Joshua B. Tenenbaum and David Held and Chuang Gan}, title = {DiffSkill: Skill Abstraction from Differentiable Physics for Deformable Object Manipulations with Tools}, journal = {CoRR}, volume = {abs/2203.17275}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2203.17275}, doi = {10.48550/ARXIV.2203.17275}, eprinttype = {arXiv}, eprint = {2203.17275}, timestamp = {Mon, 04 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2203-17275.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2205-04382, author = {Ben Eisner and Harry Zhang and David Held}, title = {FlowBot3D: Learning 3D Articulation Flow to Manipulate Articulated Objects}, journal = {CoRR}, volume = {abs/2205.04382}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2205.04382}, doi = {10.48550/ARXIV.2205.04382}, eprinttype = {arXiv}, eprint = {2205.04382}, timestamp = {Wed, 11 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2205-04382.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2206-02881, author = {Zixuan Huang and Xingyu Lin and David Held}, title = {Mesh-based Dynamics with Occlusion Reasoning for Cloth Manipulation}, journal = {CoRR}, volume = {abs/2206.02881}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2206.02881}, doi = {10.48550/ARXIV.2206.02881}, eprinttype = {arXiv}, eprint = {2206.02881}, timestamp = {Tue, 14 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2206-02881.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2207-04638, author = {Carl Qi and Xingyu Lin and David Held}, title = {Learning Closed-loop Dough Manipulation Using a Differentiable Reset Module}, journal = {CoRR}, volume = {abs/2207.04638}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2207.04638}, doi = {10.48550/ARXIV.2207.04638}, eprinttype = {arXiv}, eprint = {2207.04638}, timestamp = {Wed, 13 Jul 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2207-04638.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2207-07033, author = {Vijay Gadepally and Gregory Angelides and Andrei Barbu and Andrew Bowne and Laura J. Brattain and Tamara Broderick and Armando Cabrera and Glenn Carl and Ronisha Carter and Miriam Cha and Emilie Cowen and Jesse Cummings and Bill Freeman and James R. Glass and Sam Goldberg and Mark Hamilton and Thomas Heldt and Kuan Wei Huang and Phillip Isola and Boris Katz and Jamie Koerner and Yen{-}Chen Lin and David Mayo and Kyle McAlpin and Taylor Perron and Jean E. Piou and Hrishikesh M. Rao and Hayley Reynolds and Kaira Samuel and Siddharth Samsi and Morgan Schmidt and Leslie Shing and Olga Simek and Brandon Swenson and Vivienne Sze and Jonathan Taylor and Paul Tylkin and Mark Veillette and Matthew L. Weiss and Allan B. Wollaber and Sophia Yuditskaya and Jeremy Kepner}, title = {Developing a Series of {AI} Challenges for the United States Department of the Air Force}, journal = {CoRR}, volume = {abs/2207.07033}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2207.07033}, doi = {10.48550/ARXIV.2207.07033}, eprinttype = {arXiv}, eprint = {2207.07033}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2207-07033.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2207-11196, author = {Sashank Tirumala and Thomas Weng and Daniel Seita and Oliver Kroemer and Fatma Zeynep Temel and David Held}, title = {Learning to Singulate Layers of Cloth using Tactile Feedback}, journal = {CoRR}, volume = {abs/2207.11196}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2207.11196}, doi = {10.48550/ARXIV.2207.11196}, eprinttype = {arXiv}, eprint = {2207.11196}, timestamp = {Mon, 25 Jul 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2207-11196.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2208-05632, author = {Yufei Wang and David Held and Zackory Erickson}, title = {Visual Haptic Reasoning: Estimating Contact Forces by Observing Deformable Object Interactions}, journal = {CoRR}, volume = {abs/2208.05632}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2208.05632}, doi = {10.48550/ARXIV.2208.05632}, eprinttype = {arXiv}, eprint = {2208.05632}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2208-05632.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2209-05428, author = {Alberta Longhini and Marco Moletta and Alfredo Reichlin and Michael C. Welle and Alexander Kravberg and Yufei Wang and David Held and Zackory Erickson and Danica Kragic}, title = {Elastic Context: Encoding Elasticity for Data-driven Models of Textiles}, journal = {CoRR}, volume = {abs/2209.05428}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2209.05428}, doi = {10.48550/ARXIV.2209.05428}, eprinttype = {arXiv}, eprint = {2209.05428}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2209-05428.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2209-08996, author = {Alberta Longhini and Marco Moletta and Alfredo Reichlin and Michael C. Welle and David Held and Zackory Erickson and Danica Kragic}, title = {EDO-Net: Learning Elastic Properties of Deformable Objects from Graph Dynamics}, journal = {CoRR}, volume = {abs/2209.08996}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2209.08996}, doi = {10.48550/ARXIV.2209.08996}, eprinttype = {arXiv}, eprint = {2209.08996}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2209-08996.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2210-01917, author = {Tarasha Khurana and Peiyun Hu and Achal Dave and Jason Ziglar and David Held and Deva Ramanan}, title = {Differentiable Raycasting for Self-supervised Occupancy Forecasting}, journal = {CoRR}, volume = {abs/2210.01917}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2210.01917}, doi = {10.48550/ARXIV.2210.01917}, eprinttype = {arXiv}, eprint = {2210.01917}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2210-01917.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2210-15751, author = {Xingyu Lin and Carl Qi and Yunchu Zhang and Zhiao Huang and Katerina Fragkiadaki and Yunzhu Li and Chuang Gan and David Held}, title = {Planning with Spatial-Temporal Abstraction from Point Clouds for Deformable Object Manipulation}, journal = {CoRR}, volume = {abs/2210.15751}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2210.15751}, doi = {10.48550/ARXIV.2210.15751}, eprinttype = {arXiv}, eprint = {2210.15751}, timestamp = {Wed, 02 Nov 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2210-15751.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2210-17217, author = {Lawrence Yunliang Chen and Baiyu Shi and Daniel Seita and Richard Cheng and Thomas Kollar and David Held and Ken Goldberg}, title = {AutoBag: Learning to Open Plastic Bags and Insert Objects}, journal = {CoRR}, volume = {abs/2210.17217}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2210.17217}, doi = {10.48550/ARXIV.2210.17217}, eprinttype = {arXiv}, eprint = {2210.17217}, timestamp = {Thu, 03 Nov 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2210-17217.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2211-01500, author = {Wenxuan Zhou and David Held}, title = {Learning to Grasp the Ungraspable with Emergent Extrinsic Dexterity}, journal = {CoRR}, volume = {abs/2211.01500}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2211.01500}, doi = {10.48550/ARXIV.2211.01500}, eprinttype = {arXiv}, eprint = {2211.01500}, timestamp = {Fri, 04 Nov 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2211-01500.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2211-02647, author = {Thomas Weng and David Held and Franziska Meier and Mustafa Mukadam}, title = {Neural Grasp Distance Fields for Robot Manipulation}, journal = {CoRR}, volume = {abs/2211.02647}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2211.02647}, doi = {10.48550/ARXIV.2211.02647}, eprinttype = {arXiv}, eprint = {2211.02647}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2211-02647.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2211-09006, author = {Daniel Seita and Yufei Wang and Sarthak J. Shetty and Edward Yao Li and Zackory Erickson and David Held}, title = {ToolFlowNet: Robotic Manipulation with Tools via Predicting Tool Flow from Point Clouds}, journal = {CoRR}, volume = {abs/2211.09006}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2211.09006}, doi = {10.48550/ARXIV.2211.09006}, eprinttype = {arXiv}, eprint = {2211.09006}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2211-09006.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2211-09325, author = {Chuer Pan and Brian Okorn and Harry Zhang and Ben Eisner and David Held}, title = {TAX-Pose: Task-Specific Cross-Pose Estimation for Robot Manipulation}, journal = {CoRR}, volume = {abs/2211.09325}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2211.09325}, doi = {10.48550/ARXIV.2211.09325}, eprinttype = {arXiv}, eprint = {2211.09325}, timestamp = {Wed, 23 Nov 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2211-09325.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2211-11182, author = {Brian Okorn and Chuer Pan and Martial Hebert and David Held}, title = {Deep Projective Rotation Estimation through Relative Supervision}, journal = {CoRR}, volume = {abs/2211.11182}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2211.11182}, doi = {10.48550/ARXIV.2211.11182}, eprinttype = {arXiv}, eprint = {2211.11182}, timestamp = {Thu, 24 Nov 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2211-11182.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/WuMPS21, author = {Bang Wu and Chengqi Ma and Stefan Poslad and David R. Selviah}, title = {An Adaptive Human Activity-Aided Hand-Held Smartphone-Based Pedestrian Dead Reckoning Positioning System}, journal = {Remote. Sens.}, volume = {13}, number = {11}, pages = {2137}, year = {2021}, url = {https://doi.org/10.3390/rs13112137}, doi = {10.3390/RS13112137}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/WuMPS21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/3dim/WangGACH21, author = {Jianren Wang and Haiming Gang and Siddarth Ancha and Yi{-}Ting Chen and David Held}, title = {Semi-supervised 3D Object Detection via Temporal Graph Neural Networks}, booktitle = {International Conference on 3D Vision, 3DV 2021, London, United Kingdom, December 1-3, 2021}, pages = {413--422}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/3DV53792.2021.00051}, doi = {10.1109/3DV53792.2021.00051}, timestamp = {Wed, 12 Jan 2022 09:10:26 +0100}, biburl = {https://dblp.org/rec/conf/3dim/WangGACH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aies/KelleyYHMSKNW21, author = {Patrick Gage Kelley and Yongwei Yang and Courtney Heldreth and Christopher Moessner and Aaron Sedley and Andreas Kramm and David T. Newman and Allison Woodruff}, editor = {Marion Fourcade and Benjamin Kuipers and Seth Lazar and Deirdre K. Mulligan}, title = {Exciting, Useful, Worrying, Futuristic: Public Perception of Artificial Intelligence in 8 Countries}, booktitle = {{AIES} '21: {AAAI/ACM} Conference on AI, Ethics, and Society, Virtual Event, USA, May 19-21, 2021}, pages = {627--637}, publisher = {{ACM}}, year = {2021}, url = {https://doi.org/10.1145/3461702.3462605}, doi = {10.1145/3461702.3462605}, timestamp = {Mon, 02 Aug 2021 11:56:00 +0200}, biburl = {https://dblp.org/rec/conf/aies/KelleyYHMSKNW21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bmvc/MittalOJH21, author = {Himangi Mittal and Brian Okorn and Arpit Jangid and David Held}, title = {Self-Supervised Point Cloud Completion via Inpainting}, booktitle = {32nd British Machine Vision Conference 2021, {BMVC} 2021, Online, November 22-25, 2021}, pages = {7}, publisher = {{BMVA} Press}, year = {2021}, url = {https://www.bmvc2021-virtualconference.com/assets/papers/0443.pdf}, timestamp = {Wed, 22 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/bmvc/MittalOJH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/LinWHH21, author = {Xingyu Lin and Yufei Wang and Zixuan Huang and David Held}, editor = {Aleksandra Faust and David Hsu and Gerhard Neumann}, title = {Learning Visible Connectivity Dynamics for Cloth Smoothing}, booktitle = {Conference on Robot Learning, 8-11 November 2021, London, {UK}}, series = {Proceedings of Machine Learning Research}, volume = {164}, pages = {256--266}, publisher = {{PMLR}}, year = {2021}, url = {https://proceedings.mlr.press/v164/lin22a.html}, timestamp = {Wed, 19 Jan 2022 17:10:33 +0100}, biburl = {https://dblp.org/rec/conf/corl/LinWHH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/SikchiZH21, author = {Harshit Sikchi and Wenxuan Zhou and David Held}, editor = {Aleksandra Faust and David Hsu and Gerhard Neumann}, title = {Learning Off-Policy with Online Planning}, booktitle = {Conference on Robot Learning, 8-11 November 2021, London, {UK}}, series = {Proceedings of Machine Learning Research}, volume = {164}, pages = {1622--1633}, publisher = {{PMLR}}, year = {2021}, url = {https://proceedings.mlr.press/v164/sikchi22a.html}, timestamp = {Wed, 19 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/corl/SikchiZH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/WengBWAH21, author = {Thomas Weng and Sujay Man Bajracharya and Yufei Wang and Khush Agrawal and David Held}, editor = {Aleksandra Faust and David Hsu and Gerhard Neumann}, title = {FabricFlowNet: Bimanual Cloth Manipulation with a Flow-based Policy}, booktitle = {Conference on Robot Learning, 8-11 November 2021, London, {UK}}, series = {Proceedings of Machine Learning Research}, volume = {164}, pages = {192--202}, publisher = {{PMLR}}, year = {2021}, url = {https://proceedings.mlr.press/v164/weng22a.html}, timestamp = {Wed, 19 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/corl/WengBWAH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/HuHDHR21, author = {Peiyun Hu and Aaron Huang and John M. Dolan and David Held and Deva Ramanan}, title = {Safe Local Motion Planning With Self-Supervised Freespace Forecasting}, booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR} 2021, virtual, June 19-25, 2021}, pages = {12732--12741}, publisher = {Computer Vision Foundation / {IEEE}}, year = {2021}, url = {https://openaccess.thecvf.com/content/CVPR2021/html/Hu\_Safe\_Local\_Motion\_Planning\_With\_Self-Supervised\_Freespace\_Forecasting\_CVPR\_2021\_paper.html}, doi = {10.1109/CVPR46437.2021.01254}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/HuHDHR21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/RaajATHN21, author = {Yaadhav Raaj and Siddharth Ancha and Robert Tamburo and David Held and Srinivasa G. Narasimhan}, title = {Exploiting {\&} Refining Depth Distributions With Triangulation Light Curtains}, booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR} 2021, virtual, June 19-25, 2021}, pages = {7434--7442}, publisher = {Computer Vision Foundation / {IEEE}}, year = {2021}, url = {https://openaccess.thecvf.com/content/CVPR2021/html/Raaj\_Exploiting\_\_Refining\_Depth\_Distributions\_With\_Triangulation\_Light\_Curtains\_CVPR\_2021\_paper.html}, doi = {10.1109/CVPR46437.2021.00735}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/RaajATHN21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/OkornGHH21, author = {Brian Okorn and Qiao Gu and Martial Hebert and David Held}, title = {ZePHyR: Zero-shot Pose Hypothesis Rating}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2021, Xi'an, China, May 30 - June 5, 2021}, pages = {14141--14148}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/ICRA48506.2021.9560874}, doi = {10.1109/ICRA48506.2021.9560874}, timestamp = {Mon, 25 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icra/OkornGHH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/DasariWHBLWTCC021, author = {Sudeep Dasari and Jianren Wang and Joyce Hong and Shikhar Bahl and Yixin Lin and Austin S. Wang and Abitha Thankaraj and Karanbir Chahal and Berk {\c{C}}alli and Saurabh Gupta and David Held and Lerrel Pinto and Deepak Pathak and Vikash Kumar and Abhinav Gupta}, editor = {Joaquin Vanschoren and Sai{-}Kit Yeung}, title = {{RB2:} Robotic Manipulation Benchmarking with a Twist}, booktitle = {Proceedings of the Neural Information Processing Systems Track on Datasets and Benchmarks 1, NeurIPS Datasets and Benchmarks 2021, December 2021, virtual}, year = {2021}, url = {https://datasets-benchmarks-proceedings.neurips.cc/paper/2021/hash/3988c7f88ebcb58c6ce932b957b6f332-Abstract-round2.html}, timestamp = {Thu, 05 May 2022 16:30:03 +0200}, biburl = {https://dblp.org/rec/conf/nips/DasariWHBLWTCC021.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rss/AnchaPNH21, author = {Siddharth Ancha and Gaurav Pathak and Srinivasa G. Narasimhan and David Held}, editor = {Dylan A. Shell and Marc Toussaint and M. Ani Hsieh}, title = {Active Safety Envelopes using Light Curtains with Probabilistic Guarantees}, booktitle = {Robotics: Science and Systems XVII, Virtual Event, July 12-16, 2021}, year = {2021}, url = {https://doi.org/10.15607/RSS.2021.XVII.045}, doi = {10.15607/RSS.2021.XVII.045}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/rss/AnchaPNH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/miccai/2021sashimi, editor = {David Svoboda and Ninon Burgos and Jelmer M. Wolterink and Can Zhao}, title = {Simulation and Synthesis in Medical Imaging - 6th International Workshop, {SASHIMI} 2021, Held in Conjunction with {MICCAI} 2021, Strasbourg, France, September 27, 2021, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {12965}, publisher = {Springer}, year = {2021}, url = {https://doi.org/10.1007/978-3-030-87592-3}, doi = {10.1007/978-3-030-87592-3}, isbn = {978-3-030-87591-6}, timestamp = {Fri, 24 Sep 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miccai/2021sashimi.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2103-09230, author = {Harshit Sikchi and Wenxuan Zhou and David Held}, title = {Lyapunov Barrier Policy Optimization}, journal = {CoRR}, volume = {abs/2103.09230}, year = {2021}, url = {https://arxiv.org/abs/2103.09230}, eprinttype = {arXiv}, eprint = {2103.09230}, timestamp = {Tue, 23 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2103-09230.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2104-13526, author = {Brian Okorn and Qiao Gu and Martial Hebert and David Held}, title = {ZePHyR: Zero-shot Pose Hypothesis Rating}, journal = {CoRR}, volume = {abs/2104.13526}, year = {2021}, url = {https://arxiv.org/abs/2104.13526}, eprinttype = {arXiv}, eprint = {2104.13526}, timestamp = {Tue, 04 May 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2104-13526.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2105-10389, author = {Xingyu Lin and Yufei Wang and David Held}, title = {Learning Visible Connectivity Dynamics for Cloth Smoothing}, journal = {CoRR}, volume = {abs/2105.10389}, year = {2021}, url = {https://arxiv.org/abs/2105.10389}, eprinttype = {arXiv}, eprint = {2105.10389}, timestamp = {Mon, 31 May 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2105-10389.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2107-04000, author = {Siddharth Ancha and Gaurav Pathak and Srinivasa G. Narasimhan and David Held}, title = {Active Safety Envelopes using Light Curtains with Probabilistic Guarantees}, journal = {CoRR}, volume = {abs/2107.04000}, year = {2021}, url = {https://arxiv.org/abs/2107.04000}, eprinttype = {arXiv}, eprint = {2107.04000}, timestamp = {Tue, 20 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2107-04000.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2108-13979, author = {Kristina Dingel and Thorsten Otto and Lutz Marder and Lars Funke and Arne Held and Sara Savio and Andreas Hans and Gregor Hartmann and David Meier and Jens Viefhaus and Bernhard Sick and Arno Ehresmann and Markus Ilchen and Wolfram Helml}, title = {Toward AI-enhanced online-characterization and shaping of ultrashort X-ray free-electron laser pulses}, journal = {CoRR}, volume = {abs/2108.13979}, year = {2021}, url = {https://arxiv.org/abs/2108.13979}, eprinttype = {arXiv}, eprint = {2108.13979}, timestamp = {Fri, 03 Sep 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2108-13979.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2109-11435, author = {Marco Kuhrmann and Paolo Tell and Regina Hebig and Jil Kl{\"{u}}nder and J{\"{u}}rgen M{\"{u}}nch and Oliver Linssen and Dietmar Pfahl and Michael Felderer and Christian R. Prause and Stephen G. MacDonell and Joyce Nakatumba{-}Nabende and David Raffo and Sarah Beecham and Eray T{\"{u}}z{\"{u}}n and Gustavo L{\'{o}}pez and Nicol{\'{a}}s Paez and Diego Fontdevila and Sherlock A. Licorish and Steffen K{\"{u}}pper and G{\"{u}}nther Ruhe and Eric Knauss and {\"{O}}zden {\"{O}}zcan{-}Top and Paul M. Clarke and Fergal McCaffery and Marcela Genero and Aurora Vizca{\'{\i}}no and Mario Piattini and Marcos Kalinowski and Tayana Conte and Rafael Prikladnicki and Stephan Krusche and Ahmet Coskun{\c{c}}ay and Ezequiel Scott and Fabio Calefato and Svetlana Pimonova and Rolf{-}Helge Pfeiffer and Ulrik Pagh Schultz and Rogardt Heldal and Masud Fazal{-}Baqaie and Craig Anslow and Maleknaz Nayebi and Kurt Schneider and Stefan Sauer and Dietmar Winkler and Stefan Biffl and Mar{\'{\i}}a Cecilia Bastarrica and Ita Richardson}, title = {What Makes Agile Software Development Agile?}, journal = {CoRR}, volume = {abs/2109.11435}, year = {2021}, url = {https://arxiv.org/abs/2109.11435}, eprinttype = {arXiv}, eprint = {2109.11435}, timestamp = {Mon, 09 Jan 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2109-11435.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2111-05623, author = {Thomas Weng and Sujay Bajracharya and Yufei Wang and Khush Agrawal and David Held}, title = {FabricFlowNet: Bimanual Cloth Manipulation with a Flow-based Policy}, journal = {CoRR}, volume = {abs/2111.05623}, year = {2021}, url = {https://arxiv.org/abs/2111.05623}, eprinttype = {arXiv}, eprint = {2111.05623}, timestamp = {Tue, 16 Nov 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2111-05623.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2111-10701, author = {Himangi Mittal and Brian Okorn and Arpit Jangid and David Held}, title = {Self-Supervised Point Cloud Completion via Inpainting}, journal = {CoRR}, volume = {abs/2111.10701}, year = {2021}, url = {https://arxiv.org/abs/2111.10701}, eprinttype = {arXiv}, eprint = {2111.10701}, timestamp = {Fri, 26 Nov 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2111-10701.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ral/HuHR20, author = {Peiyun Hu and David Held and Deva Ramanan}, title = {Learning to Optimally Segment Point Clouds}, journal = {{IEEE} Robotics Autom. Lett.}, volume = {5}, number = {2}, pages = {875--882}, year = {2020}, url = {https://doi.org/10.1109/LRA.2020.2965389}, doi = {10.1109/LRA.2020.2965389}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ral/HuHR20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ral/WengPTKH20, author = {Thomas Weng and Amith Pallankize and Yimin Tang and Oliver Kroemer and David Held}, title = {Multi-Modal Transfer Learning for Grasping Transparent and Specular Objects}, journal = {{IEEE} Robotics Autom. Lett.}, volume = {5}, number = {3}, pages = {3796--3803}, year = {2020}, url = {https://doi.org/10.1109/LRA.2020.2974686}, doi = {10.1109/LRA.2020.2974686}, timestamp = {Wed, 26 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ral/WengPTKH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/HelderDBCB20, author = {Dennis L. Helder and David R. Doelling and Rajendra Bhatt and Taeyoung Choi and Julia A. Barsi}, title = {Calibrating Geosynchronous and Polar Orbiting Satellites: Sharing Best Practices}, journal = {Remote. Sens.}, volume = {12}, number = {17}, pages = {2786}, year = {2020}, url = {https://doi.org/10.3390/rs12172786}, doi = {10.3390/RS12172786}, timestamp = {Fri, 25 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/remotesensing/HelderDBCB20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbe/WadehnWMHL20, author = {Federico Wadehn and Thilo Weber and David J. Mack and Thomas Heldt and Hans{-}Andrea Loeliger}, title = {Model-Based Separation, Detection, and Classification of Eye Movements}, journal = {{IEEE} Trans. Biomed. Eng.}, volume = {67}, number = {2}, pages = {588--600}, year = {2020}, url = {https://doi.org/10.1109/TBME.2019.2918986}, doi = {10.1109/TBME.2019.2918986}, timestamp = {Thu, 27 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tbe/WadehnWMHL20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/3dim/ChenWHH20, author = {Xia Chen and Jianren Wang and David Held and Martial Hebert}, editor = {Vitomir Struc and Francisco G{\'{o}}mez Fern{\'{a}}ndez}, title = {PanoNet3D: Combining Semantic and Geometric Understanding for LiDAR Point Cloud Detection}, booktitle = {8th International Conference on 3D Vision, 3DV 2020, Virtual Event, Japan, November 25-28, 2020}, pages = {753--761}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/3DV50981.2020.00085}, doi = {10.1109/3DV50981.2020.00085}, timestamp = {Mon, 01 Feb 2021 13:50:15 +0100}, biburl = {https://dblp.org/rec/conf/3dim/ChenWHH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/LinWOH20, author = {Xingyu Lin and Yufei Wang and Jake Olkin and David Held}, editor = {Jens Kober and Fabio Ramos and Claire J. Tomlin}, title = {SoftGym: Benchmarking Deep Reinforcement Learning for Deformable Object Manipulation}, booktitle = {4th Conference on Robot Learning, CoRL 2020, 16-18 November 2020, Virtual Event / Cambridge, MA, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {155}, pages = {432--448}, publisher = {{PMLR}}, year = {2020}, url = {https://proceedings.mlr.press/v155/lin21a.html}, timestamp = {Tue, 18 Oct 2022 08:35:37 +0200}, biburl = {https://dblp.org/rec/conf/corl/LinWOH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/WangNLOH20, author = {Yufei Wang and Gautham Narayan Narasimhan and Xingyu Lin and Brian Okorn and David Held}, editor = {Jens Kober and Fabio Ramos and Claire J. Tomlin}, title = {{ROLL:} Visual Self-Supervised Reinforcement Learning with Object Reasoning}, booktitle = {4th Conference on Robot Learning, CoRL 2020, 16-18 November 2020, Virtual Event / Cambridge, MA, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {155}, pages = {1030--1048}, publisher = {{PMLR}}, year = {2020}, url = {https://proceedings.mlr.press/v155/wang21e.html}, timestamp = {Mon, 25 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/corl/WangNLOH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/ZhouBH20, author = {Wenxuan Zhou and Sujay Bajracharya and David Held}, editor = {Jens Kober and Fabio Ramos and Claire J. Tomlin}, title = {{PLAS:} Latent Action Space for Offline Reinforcement Learning}, booktitle = {4th Conference on Robot Learning, CoRL 2020, 16-18 November 2020, Virtual Event / Cambridge, MA, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {155}, pages = {1719--1735}, publisher = {{PMLR}}, year = {2020}, url = {https://proceedings.mlr.press/v155/zhou21b.html}, timestamp = {Mon, 25 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/corl/ZhouBH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/HuZHR20, author = {Peiyun Hu and Jason Ziglar and David Held and Deva Ramanan}, title = {What You See is What You Get: Exploiting Visibility for 3D Object Detection}, booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2020, Seattle, WA, USA, June 13-19, 2020}, pages = {10998--11006}, publisher = {Computer Vision Foundation / {IEEE}}, year = {2020}, url = {https://openaccess.thecvf.com/content\_CVPR\_2020/html/Hu\_What\_You\_See\_is\_What\_You\_Get\_Exploiting\_Visibility\_for\_CVPR\_2020\_paper.html}, doi = {10.1109/CVPR42600.2020.01101}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/HuZHR20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/MittalOH20, author = {Himangi Mittal and Brian Okorn and David Held}, title = {Just Go With the Flow: Self-Supervised Scene Flow Estimation}, booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2020, Seattle, WA, USA, June 13-19, 2020}, pages = {11174--11182}, publisher = {Computer Vision Foundation / {IEEE}}, year = {2020}, url = {https://openaccess.thecvf.com/content\_CVPR\_2020/html/Mittal\_Just\_Go\_With\_the\_Flow\_Self-Supervised\_Scene\_Flow\_Estimation\_CVPR\_2020\_paper.html}, doi = {10.1109/CVPR42600.2020.01119}, timestamp = {Mon, 30 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/MittalOH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/AnchaRHNH20, author = {Siddharth Ancha and Yaadhav Raaj and Peiyun Hu and Srinivasa G. Narasimhan and David Held}, editor = {Andrea Vedaldi and Horst Bischof and Thomas Brox and Jan{-}Michael Frahm}, title = {Active Perception Using Light Curtains for Autonomous Driving}, booktitle = {Computer Vision - {ECCV} 2020 - 16th European Conference, Glasgow, UK, August 23-28, 2020, Proceedings, Part {V}}, series = {Lecture Notes in Computer Science}, volume = {12350}, pages = {751--766}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-3-030-58558-7\_44}, doi = {10.1007/978-3-030-58558-7\_44}, timestamp = {Thu, 29 Oct 2020 15:29:39 +0100}, biburl = {https://dblp.org/rec/conf/eccv/AnchaRHNH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iros/OkornXHH20, author = {Brian Okorn and Mengyun Xu and Martial Hebert and David Held}, title = {Learning Orientation Distributions for Object Pose Estimation}, booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems, {IROS} 2020, Las Vegas, NV, USA, October 24, 2020 - January 24, 2021}, pages = {10580--10587}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/IROS45743.2020.9340860}, doi = {10.1109/IROS45743.2020.9340860}, timestamp = {Wed, 17 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iros/OkornXHH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iros/QianWZOH20, author = {Jianing Qian and Thomas Weng and Luxin Zhang and Brian Okorn and David Held}, title = {Cloth Region Segmentation for Robust Grasp Selection}, booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems, {IROS} 2020, Las Vegas, NV, USA, October 24, 2020 - January 24, 2021}, pages = {9553--9560}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/IROS45743.2020.9341121}, doi = {10.1109/IROS45743.2020.9341121}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iros/QianWZOH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iros/WangACH20, author = {Jianren Wang and Siddharth Ancha and Yi{-}Ting Chen and David Held}, title = {Uncertainty-aware Self-supervised 3D Data Association}, booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems, {IROS} 2020, Las Vegas, NV, USA, October 24, 2020 - January 24, 2021}, pages = {8125--8132}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/IROS45743.2020.9341251}, doi = {10.1109/IROS45743.2020.9341251}, timestamp = {Tue, 15 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iros/WangACH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iros/WengWHK20, author = {Xinshuo Weng and Jianren Wang and David Held and Kris Kitani}, title = {3D Multi-Object Tracking: {A} Baseline and New Evaluation Metrics}, booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems, {IROS} 2020, Las Vegas, NV, USA, October 24, 2020 - January 24, 2021}, pages = {10359--10366}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/IROS45743.2020.9341164}, doi = {10.1109/IROS45743.2020.9341164}, timestamp = {Wed, 17 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iros/WengWHK20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/inns/2019, editor = {Luca Oneto and Nicol{\`{o}} Navarin and Alessandro Sperduti and Davide Anguita}, title = {Recent Advances in Big Data and Deep Learning, Proceedings of the {INNS} Big Data and Deep Learning Conference {INNSBDDL} 2019, held at Sestri Levante, Genova, Italy 16-18 April 2019}, publisher = {Springer}, year = {2020}, url = {https://link.springer.com/book/10.1007/978-3-030-16841-4}, doi = {10.1007/978-3-030-16841-4}, isbn = {978-3-030-16840-7}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/inns/2019.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/miccai/2020sashimi, editor = {Ninon Burgos and David Svoboda and Jelmer M. Wolterink and Can Zhao}, title = {Simulation and Synthesis in Medical Imaging - 5th International Workshop, {SASHIMI} 2020, Held in Conjunction with {MICCAI} 2020, Lima, Peru, October 4, 2020, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {12417}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-3-030-59520-3}, doi = {10.1007/978-3-030-59520-3}, isbn = {978-3-030-59519-7}, timestamp = {Wed, 10 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/miccai/2020sashimi.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/tacas/2020-1, editor = {Armin Biere and David Parker}, title = {Tools and Algorithms for the Construction and Analysis of Systems - 26th International Conference, {TACAS} 2020, Held as Part of the European Joint Conferences on Theory and Practice of Software, {ETAPS} 2020, Dublin, Ireland, April 25-30, 2020, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {12078}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-3-030-45190-5}, doi = {10.1007/978-3-030-45190-5}, isbn = {978-3-030-45189-9}, timestamp = {Fri, 14 May 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/tacas/2020-1.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/tacas/2020-2, editor = {Armin Biere and David Parker}, title = {Tools and Algorithms for the Construction and Analysis of Systems - 26th International Conference, {TACAS} 2020, Held as Part of the European Joint Conferences on Theory and Practice of Software, {ETAPS} 2020, Dublin, Ireland, April 25-30, 2020, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {12079}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-3-030-45237-7}, doi = {10.1007/978-3-030-45237-7}, isbn = {978-3-030-45236-0}, timestamp = {Fri, 14 May 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/tacas/2020-2.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2001-00081, author = {Patrick Gage Kelley and Yongwei Yang and Courtney Heldreth and Christopher Moessner and Aaron Sedley and Andreas Kramm and David T. Newman and Allison Woodruff}, title = {"Happy and Assured that life will be easy 10years from now.": Perceptions of Artificial Intelligence in 8 Countries}, journal = {CoRR}, volume = {abs/2001.00081}, year = {2020}, url = {http://arxiv.org/abs/2001.00081}, eprinttype = {arXiv}, eprint = {2001.00081}, timestamp = {Mon, 02 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2001-00081.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2006-00028, author = {Thomas Weng and Amith Pallankize and Yimin Tang and Oliver Kroemer and David Held}, title = {Multi-modal Transfer Learning for Grasping Transparent and Specular Objects}, journal = {CoRR}, volume = {abs/2006.00028}, year = {2020}, url = {https://arxiv.org/abs/2006.00028}, eprinttype = {arXiv}, eprint = {2006.00028}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2006-00028.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2007-01418, author = {Brian Okorn and Mengyun Xu and Martial Hebert and David Held}, title = {Learning Orientation Distributions for Object Pose Estimation}, journal = {CoRR}, volume = {abs/2007.01418}, year = {2020}, url = {https://arxiv.org/abs/2007.01418}, eprinttype = {arXiv}, eprint = {2007.01418}, timestamp = {Mon, 06 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2007-01418.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2008-02191, author = {Siddharth Ancha and Yaadhav Raaj and Peiyun Hu and Srinivasa G. Narasimhan and David Held}, title = {Active Perception using Light Curtains for Autonomous Driving}, journal = {CoRR}, volume = {abs/2008.02191}, year = {2020}, url = {https://arxiv.org/abs/2008.02191}, eprinttype = {arXiv}, eprint = {2008.02191}, timestamp = {Fri, 07 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2008-02191.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2008-05626, author = {Jianing Qian and Thomas Weng and Luxin Zhang and Brian Okorn and David Held}, title = {Cloth Region Segmentation for Robust Grasp Selection}, journal = {CoRR}, volume = {abs/2008.05626}, year = {2020}, url = {https://arxiv.org/abs/2008.05626}, eprinttype = {arXiv}, eprint = {2008.05626}, timestamp = {Mon, 17 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2008-05626.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2008-08063, author = {Xinshuo Weng and Jianren Wang and David Held and Kris Kitani}, title = {{AB3DMOT:} {A} Baseline for 3D Multi-Object Tracking and New Evaluation Metrics}, journal = {CoRR}, volume = {abs/2008.08063}, year = {2020}, url = {https://arxiv.org/abs/2008.08063}, eprinttype = {arXiv}, eprint = {2008.08063}, timestamp = {Fri, 21 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2008-08063.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2008-08173, author = {Jianren Wang and Siddharth Ancha and Yi{-}Ting Chen and David Held}, title = {Uncertainty-aware Self-supervised 3D Data Association}, journal = {CoRR}, volume = {abs/2008.08173}, year = {2020}, url = {https://arxiv.org/abs/2008.08173}, eprinttype = {arXiv}, eprint = {2008.08173}, timestamp = {Tue, 15 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2008-08173.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2008-10066, author = {Harshit Sikchi and Wenxuan Zhou and David Held}, title = {Learning Off-Policy with Online Planning}, journal = {CoRR}, volume = {abs/2008.10066}, year = {2020}, url = {https://arxiv.org/abs/2008.10066}, eprinttype = {arXiv}, eprint = {2008.10066}, timestamp = {Fri, 28 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2008-10066.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2010-04367, author = {Jianing Qian and Junyu Nan and Siddharth Ancha and Brian Okorn and David Held}, title = {Robust Instance Tracking via Uncertainty Flow}, journal = {CoRR}, volume = {abs/2010.04367}, year = {2020}, url = {https://arxiv.org/abs/2010.04367}, eprinttype = {arXiv}, eprint = {2010.04367}, timestamp = {Tue, 13 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2010-04367.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2011-06777, author = {Yufei Wang and Gautham Narayan Narasimhan and Xingyu Lin and Brian Okorn and David Held}, title = {{ROLL:} Visual Self-Supervised Reinforcement Learning with Object Reasoning}, journal = {CoRR}, volume = {abs/2011.06777}, year = {2020}, url = {https://arxiv.org/abs/2011.06777}, eprinttype = {arXiv}, eprint = {2011.06777}, timestamp = {Wed, 18 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2011-06777.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2011-07213, author = {Wenxuan Zhou and Sujay Bajracharya and David Held}, title = {{PLAS:} Latent Action Space for Offline Reinforcement Learning}, journal = {CoRR}, volume = {abs/2011.07213}, year = {2020}, url = {https://arxiv.org/abs/2011.07213}, eprinttype = {arXiv}, eprint = {2011.07213}, timestamp = {Wed, 18 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2011-07213.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2011-07215, author = {Xingyu Lin and Yufei Wang and Jake Olkin and David Held}, title = {SoftGym: Benchmarking Deep Reinforcement Learning for Deformable Object Manipulation}, journal = {CoRR}, volume = {abs/2011.07215}, year = {2020}, url = {https://arxiv.org/abs/2011.07215}, eprinttype = {arXiv}, eprint = {2011.07215}, timestamp = {Wed, 18 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2011-07215.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2012-09418, author = {Xia Chen and Jianren Wang and David Held and Martial Hebert}, title = {PanoNet3D: Combining Semantic and Geometric Understanding for LiDARPoint Cloud Detection}, journal = {CoRR}, volume = {abs/2012.09418}, year = {2020}, url = {https://arxiv.org/abs/2012.09418}, eprinttype = {arXiv}, eprint = {2012.09418}, timestamp = {Sun, 03 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2012-09418.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@phdthesis{DBLP:phd/dnb/Osep19, author = {Aljosa Osep}, title = {Vision-based category agnostic object tracking for mobile robots and intelligent vehicles / Aljose Osep ; Bastian Leibe, David Held}, school = {{RWTH} Aachen University, Germany}, year = {2019}, url = {https://publications.rwth-aachen.de/record/792619}, urn = {urn:nbn:de:101:1-2020080423312685484076}, timestamp = {Sat, 17 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/phd/dnb/Osep19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aim/BarashCCCEFGGhH19, author = {Guy Barash and Mauricio Castillo{-}Effen and Niyati Chhaya and Peter Clark and Hu{\'{a}}scar Espinoza and Eitan Farchi and Christopher W. Geib and Odd Erik Gundersen and Se{\'{a}}n {\'{O}} h{\'{E}}igeartaigh and Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and Chiori Hori and Xiaowei Huang and Kokil Jaidka and Pavan Kapanipathi and Sarah Keren and Seokhwan Kim and Marc Lanctot and Danny Lange and Julian J. McAuley and David R. Martinez and Marwan Mattar and Mausam and Martin Michalowski and Reuth Mirsky and Roozbeh Mottaghi and Joseph C. Osborn and Julien P{\'{e}}rolat and Martin Schmid and Arash Shaban{-}Nejad and Onn Shehory and Biplav Srivastava and William W. Streilein and Kartik Talamadupula and Julian Togelius and Koichiro Yoshino and Quanshi Zhang and Imed Zitouni}, title = {Reports of the Workshops Held at the 2019 {AAAI} Conference on Artificial Intelligence}, journal = {{AI} Mag.}, volume = {40}, number = {3}, pages = {67--78}, year = {2019}, url = {https://doi.org/10.1609/aimag.v40i3.4981}, doi = {10.1609/AIMAG.V40I3.4981}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/aim/BarashCCCEFGGhH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/arobots/HuangHAD19, author = {Sandy H. Huang and David Held and Pieter Abbeel and Anca D. Dragan}, title = {Enabling robots to communicate their objectives}, journal = {Auton. Robots}, volume = {43}, number = {2}, pages = {309--326}, year = {2019}, url = {https://doi.org/10.1007/s10514-018-9771-0}, doi = {10.1007/S10514-018-9771-0}, timestamp = {Fri, 22 Feb 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/arobots/HuangHAD19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pacmhci/ErtlTEATW19, author = {Tanja Ertl and Sebastian Taugerbeck and Margarita Esau and Konstantin Aal and Peter Tolmie and Volker Wulf}, title = {The Social Mile - How (Psychosocial) {ICT} can Help to Promote Resocialization and to Overcome Prison}, journal = {Proc. {ACM} Hum. Comput. Interact.}, volume = {3}, number = {{GROUP}}, pages = {248:1--248:31}, year = {2019}, url = {https://doi.org/10.1145/3370270}, doi = {10.1145/3370270}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pacmhci/ErtlTEATW19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/RyanPBLRCABH19, author = {Robert E. Ryan and Mary Pagnutti and Kara Burch and Larry Leigh and Timothy A. Ruggles and Changyong Cao and David Aaron and Slawomir Blonski and Dennis L. Helder}, title = {The Terra Vega Active Light Source: {A} First Step in a New Approach to Perform Nighttime Absolute Radiometric Calibrations and Early Results Calibrating the {VIIRS} {DNB}}, journal = {Remote. Sens.}, volume = {11}, number = {6}, pages = {710}, year = {2019}, url = {https://doi.org/10.3390/rs11060710}, doi = {10.3390/RS11060710}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/RyanPBLRCABH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tgrs/JingLHPA19, author = {Xin Jing and Larry Leigh and Dennis L. Helder and Cibele Teixeira Pinto and David Aaron}, title = {Lifetime Absolute Calibration of the {EO-1} Hyperion Sensor and its Validation}, journal = {{IEEE} Trans. Geosci. Remote. Sens.}, volume = {57}, number = {11}, pages = {9466--9475}, year = {2019}, url = {https://doi.org/10.1109/TGRS.2019.2926663}, doi = {10.1109/TGRS.2019.2926663}, timestamp = {Tue, 12 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tgrs/JingLHPA19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/chiuxid/CookDK19, author = {David M. Cook and Derani Dissanayake and Kulwinder Kaur}, editor = {Yohannes Kurniawan and Eunice Ratna Sari and Adi B. Tedjasaputra}, title = {Virtual Reality and Older Hands: Dexterity and accessibility in hand-held {VR} Control}, booktitle = {Empowering Digital Transformation, CHIuXiD 2019, Proceedings, 5th International {ACM} In-Cooperation {HCI} and {UX} Conference, Bali/Jakarta/Surabaye, Indonesia, 1-9 April 2019}, pages = {147--151}, publisher = {{ACM}}, year = {2019}, url = {https://doi.org/10.1145/3328243.3328262}, doi = {10.1145/3328243.3328262}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/chiuxid/CookDK19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/AnchaNH19, author = {Siddharth Ancha and Junyu Nan and David Held}, editor = {Leslie Pack Kaelbling and Danica Kragic and Komei Sugiura}, title = {Combining Deep Learning and Verification for Precise Object Instance Detection}, booktitle = {3rd Annual Conference on Robot Learning, CoRL 2019, Osaka, Japan, October 30 - November 1, 2019, Proceedings}, series = {Proceedings of Machine Learning Research}, volume = {100}, pages = {122--141}, publisher = {{PMLR}}, year = {2019}, url = {http://proceedings.mlr.press/v100/ancha20a.html}, timestamp = {Mon, 25 May 2020 12:12:52 +0200}, biburl = {https://dblp.org/rec/conf/corl/AnchaNH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/LinGFH19, author = {Xingyu Lin and Pengsheng Guo and Carlos Florensa and David Held}, title = {Adaptive Variance for Changing Sparse-Reward Environments}, booktitle = {International Conference on Robotics and Automation, {ICRA} 2019, Montreal, QC, Canada, May 20-24, 2019}, pages = {3210--3216}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/ICRA.2019.8793650}, doi = {10.1109/ICRA.2019.8793650}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/icra/LinGFH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/LinBKH19, author = {Xingyu Lin and Harjatin Singh Baweja and George Kantor and David Held}, editor = {Hanna M. Wallach and Hugo Larochelle and Alina Beygelzimer and Florence d'Alch{\'{e}}{-}Buc and Emily B. Fox and Roman Garnett}, title = {Adaptive Auxiliary Task Weighting for Reinforcement Learning}, booktitle = {Advances in Neural Information Processing Systems 32: Annual Conference on Neural Information Processing Systems 2019, NeurIPS 2019, December 8-14, 2019, Vancouver, BC, Canada}, pages = {4773--4784}, year = {2019}, url = {https://proceedings.neurips.cc/paper/2019/hash/0e900ad84f63618452210ab8baae0218-Abstract.html}, timestamp = {Mon, 16 May 2022 15:41:51 +0200}, biburl = {https://dblp.org/rec/conf/nips/LinBKH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/gramsec/2018, editor = {George Cybenko and David J. Pym and Barbara Fila}, title = {5th International Workshop on Graphical Models for Security, held in conjunction with the Federated Logic Conference (FLoC) 2018, GraMSec@FLoC 2018, Oxford, UK, July 8, 2018, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {11086}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-15465-3}, doi = {10.1007/978-3-030-15465-3}, isbn = {978-3-030-15464-6}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/gramsec/2018.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/miccai/2019sashimi, editor = {Ninon Burgos and Ali Gooya and David Svoboda}, title = {Simulation and Synthesis in Medical Imaging - 4th International Workshop, {SASHIMI} 2019, Held in Conjunction with {MICCAI} 2019, Shenzhen, China, October 13, 2019, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {11827}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-32778-1}, doi = {10.1007/978-3-030-32778-1}, isbn = {978-3-030-32777-4}, timestamp = {Mon, 15 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miccai/2019sashimi.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/post/2019, editor = {Flemming Nielson and David Sands}, title = {Principles of Security and Trust - 8th International Conference, {POST} 2019, Held as Part of the European Joint Conferences on Theory and Practice of Software, {ETAPS} 2019, Prague, Czech Republic, April 6-11, 2019, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {11426}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-17138-4}, doi = {10.1007/978-3-030-17138-4}, isbn = {978-3-030-17137-7}, timestamp = {Fri, 31 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/post/2019.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1903-06309, author = {Xingyu Lin and Pengsheng Guo and Carlos Florensa and David Held}, title = {Adaptive Variance for Changing Sparse-Reward Environments}, journal = {CoRR}, volume = {abs/1903.06309}, year = {2019}, url = {http://arxiv.org/abs/1903.06309}, eprinttype = {arXiv}, eprint = {1903.06309}, timestamp = {Mon, 01 Apr 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1903-06309.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1905-07866, author = {Xingyu Lin and Harjatin Singh Baweja and David Held}, title = {Reinforcement Learning without Ground-Truth State}, journal = {CoRR}, volume = {abs/1905.07866}, year = {2019}, url = {http://arxiv.org/abs/1905.07866}, eprinttype = {arXiv}, eprint = {1905.07866}, timestamp = {Tue, 28 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1905-07866.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1906-04409, author = {Siddhant Jain and Sowmya Munukutla and David Held}, title = {Few-Shot Point Cloud Region Annotation with Human in the Loop}, journal = {CoRR}, volume = {abs/1906.04409}, year = {2019}, url = {http://arxiv.org/abs/1906.04409}, eprinttype = {arXiv}, eprint = {1906.04409}, timestamp = {Fri, 14 Jun 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1906-04409.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1912-00096, author = {Peng Yin and Jianing Qian and Yibo Cao and David Held and Howie Choset}, title = {FusionMapping: Learning Depth Prediction with Monocular Images and 2D Laser Scans}, journal = {CoRR}, volume = {abs/1912.00096}, year = {2019}, url = {http://arxiv.org/abs/1912.00096}, eprinttype = {arXiv}, eprint = {1912.00096}, timestamp = {Mon, 26 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1912-00096.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1912-00497, author = {Himangi Mittal and Brian Okorn and David Held}, title = {Just Go with the Flow: Self-Supervised Scene Flow Estimation}, journal = {CoRR}, volume = {abs/1912.00497}, year = {2019}, url = {http://arxiv.org/abs/1912.00497}, eprinttype = {arXiv}, eprint = {1912.00497}, timestamp = {Thu, 02 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1912-00497.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1912-04976, author = {Peiyun Hu and David Held and Deva Ramanan}, title = {Learning to Optimally Segment Point Clouds}, journal = {CoRR}, volume = {abs/1912.04976}, year = {2019}, url = {http://arxiv.org/abs/1912.04976}, eprinttype = {arXiv}, eprint = {1912.04976}, timestamp = {Thu, 02 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1912-04976.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1912-04986, author = {Peiyun Hu and Jason Ziglar and David Held and Deva Ramanan}, title = {What You See is What You Get: Exploiting Visibility for 3D Object Detection}, journal = {CoRR}, volume = {abs/1912.04986}, year = {2019}, url = {http://arxiv.org/abs/1912.04986}, eprinttype = {arXiv}, eprint = {1912.04986}, timestamp = {Thu, 02 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1912-04986.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1912-12270, author = {Siddharth Ancha and Junyu Nan and David Held}, title = {Combining Deep Learning and Verification for Precise Object Instance Detection}, journal = {CoRR}, volume = {abs/1912.12270}, year = {2019}, url = {http://arxiv.org/abs/1912.12270}, eprinttype = {arXiv}, eprint = {1912.12270}, timestamp = {Fri, 03 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1912-12270.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aim/AnCCFFJKMRSSSTT18, author = {Jisun An and Rumi Chunara and David J. Crandall and Darian Frajberg and Megan French and Bernard J. Jansen and Juhi Kulshrestha and Yelena Mejova and Daniel M. Romero and Joni Salminen and Amit Sharma and Amit P. Sheth and Chenhao Tan and Samuel Hardman Taylor and Sanjaya Wijeratne}, title = {Reports of the Workshops Held at the 2018 International {AAAI} Conference on Web and Social Media}, journal = {{AI} Mag.}, volume = {39}, number = {4}, pages = {36--44}, year = {2018}, url = {https://doi.org/10.1609/aimag.v39i4.2835}, doi = {10.1609/AIMAG.V39I4.2835}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/aim/AnCCFFJKMRSSSTT18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/HelderMMSBGCLMR18, author = {Dennis L. Helder and Brian L. Markham and Ron Morfitt and James C. Storey and Julia A. Barsi and Ferran Gascon and S{\'{e}}bastien Clerc and Bruno Lafrance and Jeffrey G. Masek and David P. Roy and Adam Lewis and Nima Pahlevan}, title = {Observations and Recommendations for the Calibration of Landsat 8 {OLI} and Sentinel 2 {MSI} for Improved Data Interoperability}, journal = {Remote. Sens.}, volume = {10}, number = {9}, pages = {1340}, year = {2018}, url = {https://doi.org/10.3390/rs10091340}, doi = {10.3390/RS10091340}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/HelderMMSBGCLMR18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/3dim/YuanKHMH18, author = {Wentao Yuan and Tejas Khot and David Held and Christoph Mertz and Martial Hebert}, title = {{PCN:} Point Completion Network}, booktitle = {2018 International Conference on 3D Vision, 3DV 2018, Verona, Italy, September 5-8, 2018}, pages = {728--737}, publisher = {{IEEE} Computer Society}, year = {2018}, url = {https://doi.org/10.1109/3DV.2018.00088}, doi = {10.1109/3DV.2018.00088}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/3dim/YuanKHMH18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cinc/WadehnMKH18, author = {Federico Wadehn and David J. Mack and Emanuela Keller and Thomas Heldt}, title = {A Multiscale Intracranial Pressure Signal Simulator}, booktitle = {Computing in Cardiology, CinC 2018, Maastricht, The Netherlands, September 23-26, 2018}, pages = {1--4}, publisher = {www.cinc.org}, year = {2018}, url = {http://www.cinc.org/archives/2018/pdf/CinC2018-010.pdf}, doi = {10.22489/CINC.2018.010}, timestamp = {Fri, 26 Jul 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cinc/WadehnMKH18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/FlorensaHGA18, author = {Carlos Florensa and David Held and Xinyang Geng and Pieter Abbeel}, editor = {Jennifer G. Dy and Andreas Krause}, title = {Automatic Goal Generation for Reinforcement Learning Agents}, booktitle = {Proceedings of the 35th International Conference on Machine Learning, {ICML} 2018, Stockholmsm{\"{a}}ssan, Stockholm, Sweden, July 10-15, 2018}, series = {Proceedings of Machine Learning Research}, volume = {80}, pages = {1514--1523}, publisher = {{PMLR}}, year = {2018}, url = {http://proceedings.mlr.press/v80/florensa18a.html}, timestamp = {Wed, 03 Apr 2019 18:17:30 +0200}, biburl = {https://dblp.org/rec/conf/icml/FlorensaHGA18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/hcc/2018, editor = {David Kreps and Charles Ess and Louise Leenen and Kai Kimppa}, title = {This Changes Everything - {ICT} and Climate Change: What Can We Do? - 13th {IFIP} {TC} 9 International Conference on Human Choice and Computers, {HCC13} 2018, Held at the 24th {IFIP} World Computer Congress, {WCC} 2018, Poznan, Poland, September 19-21, 2018, Proceedings}, series = {{IFIP} Advances in Information and Communication Technology}, volume = {537}, publisher = {Springer}, year = {2018}, url = {https://doi.org/10.1007/978-3-319-99605-9}, doi = {10.1007/978-3-319-99605-9}, isbn = {978-3-319-99604-2}, timestamp = {Thu, 06 Dec 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/hcc/2018.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/miccai/2018compay, editor = {Danail Stoyanov and Zeike Taylor and Francesco Ciompi and Yanwu Xu and Anne L. Martel and Lena Maier{-}Hein and Nasir M. Rajpoot and Jeroen van der Laak and Mitko Veta and Stephen J. McKenna and David R. J. Snead and Emanuele Trucco and Mona Kathryn Garvin and Xinjian Chen and Hrvoje Bogunovic}, title = {Computational Pathology and Ophthalmic Medical Image Analysis - First International Workshop, {COMPAY} 2018, and 5th International Workshop, {OMIA} 2018, Held in Conjunction with {MICCAI} 2018, Granada, Spain, September 16-20, 2018, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {11039}, publisher = {Springer}, year = {2018}, url = {https://doi.org/10.1007/978-3-030-00949-6}, doi = {10.1007/978-3-030-00949-6}, isbn = {978-3-030-00948-9}, timestamp = {Sat, 10 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miccai/2018compay.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1808-00671, author = {Wentao Yuan and Tejas Khot and David Held and Christoph Mertz and Martial Hebert}, title = {{PCN:} Point Completion Network}, journal = {CoRR}, volume = {abs/1808.00671}, year = {2018}, url = {http://arxiv.org/abs/1808.00671}, eprinttype = {arXiv}, eprint = {1808.00671}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1808-00671.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1811-11209, author = {Wentao Yuan and David Held and Christoph Mertz and Martial Hebert}, title = {Iterative Transformer Network for 3D Point Cloud}, journal = {CoRR}, volume = {abs/1811.11209}, year = {2018}, url = {http://arxiv.org/abs/1811.11209}, eprinttype = {arXiv}, eprint = {1811.11209}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1811-11209.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cphysics/StegmeirMCLHW17, author = {Andreas Stegmeir and Omar Maj and David Coster and Karl Lackner and Markus Held and Matthias Wiesenberger}, title = {Advances in the flux-coordinate independent approach}, journal = {Comput. Phys. Commun.}, volume = {213}, pages = {111--121}, year = {2017}, url = {https://doi.org/10.1016/j.cpc.2016.12.014}, doi = {10.1016/J.CPC.2016.12.014}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cphysics/StegmeirMCLHW17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/wpc/SilvaAR17, author = {H{\'{e}}lder David Silva and Jos{\'{e}} A. Afonso and Lu{\'{\i}}s A. Rocha}, title = {Body Attenuation and Path Loss Exponent Estimation for RSS-Based Positioning in {WSN}}, journal = {Wirel. Pers. Commun.}, volume = {94}, number = {3}, pages = {835--857}, year = {2017}, url = {https://doi.org/10.1007/s11277-016-3653-6}, doi = {10.1007/S11277-016-3653-6}, timestamp = {Thu, 26 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/wpc/SilvaAR17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/FlorensaHWZA17, author = {Carlos Florensa and David Held and Markus Wulfmeier and Michael Zhang and Pieter Abbeel}, title = {Reverse Curriculum Generation for Reinforcement Learning}, booktitle = {1st Annual Conference on Robot Learning, CoRL 2017, Mountain View, California, USA, November 13-15, 2017, Proceedings}, series = {Proceedings of Machine Learning Research}, volume = {78}, pages = {482--495}, publisher = {{PMLR}}, year = {2017}, url = {http://proceedings.mlr.press/v78/florensa17a.html}, timestamp = {Wed, 03 Apr 2019 18:17:24 +0200}, biburl = {https://dblp.org/rec/conf/corl/FlorensaHWZA17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/AchiamHTA17, author = {Joshua Achiam and David Held and Aviv Tamar and Pieter Abbeel}, editor = {Doina Precup and Yee Whye Teh}, title = {Constrained Policy Optimization}, booktitle = {Proceedings of the 34th International Conference on Machine Learning, {ICML} 2017, Sydney, NSW, Australia, 6-11 August 2017}, series = {Proceedings of Machine Learning Research}, volume = {70}, pages = {22--31}, publisher = {{PMLR}}, year = {2017}, url = {http://proceedings.mlr.press/v70/achiam17a.html}, timestamp = {Wed, 29 May 2019 08:41:45 +0200}, biburl = {https://dblp.org/rec/conf/icml/AchiamHTA17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/HeldMZSA17, author = {David Held and Zoe McCarthy and Michael Zhang and Fred Shentu and Pieter Abbeel}, title = {Probabilistically safe policy transfer}, booktitle = {2017 {IEEE} International Conference on Robotics and Automation, {ICRA} 2017, Singapore, Singapore, May 29 - June 3, 2017}, pages = {5798--5805}, publisher = {{IEEE}}, year = {2017}, url = {https://doi.org/10.1109/ICRA.2017.7989680}, doi = {10.1109/ICRA.2017.7989680}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/icra/HeldMZSA17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iros/ClaveraHA17, author = {Ignasi Clavera and David Held and Pieter Abbeel}, title = {Policy transfer via modularity and reward guiding}, booktitle = {2017 {IEEE/RSJ} International Conference on Intelligent Robots and Systems, {IROS} 2017, Vancouver, BC, Canada, September 24-28, 2017}, pages = {1537--1544}, publisher = {{IEEE}}, year = {2017}, url = {https://doi.org/10.1109/IROS.2017.8205959}, doi = {10.1109/IROS.2017.8205959}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/iros/ClaveraHA17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isami/CarneiroRN17, author = {Davide Carneiro and H{\'{e}}lder Rocha and Paulo Novais}, editor = {Juan F. De Paz and Vicente Juli{\'{a}}n and Gabriel Villarrubia and Goreti Marreiros and Paulo Novais}, title = {An Environment for Studying Visual Emotion Perception}, booktitle = {Ambient Intelligence - Software and Applications - 8th International Symposium on Ambient Intelligence, ISAmI 2017, Porto, Portugal, June 21-23, 2017}, series = {Advances in Intelligent Systems and Computing}, volume = {615}, pages = {238--245}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-61118-1\_29}, doi = {10.1007/978-3-319-61118-1\_29}, timestamp = {Wed, 26 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/isami/CarneiroRN17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rss/HuangHAD17, author = {Sandy H. Huang and David Held and Pieter Abbeel and Anca D. Dragan}, editor = {Nancy M. Amato and Siddhartha S. Srinivasa and Nora Ayanian and Scott Kuindersma}, title = {Enabling Robots to Communicate Their Objectives}, booktitle = {Robotics: Science and Systems XIII, Massachusetts Institute of Technology, Cambridge, Massachusetts, USA, July 12-16, 2017}, year = {2017}, url = {http://www.roboticsproceedings.org/rss13/p59.html}, doi = {10.15607/RSS.2017.XIII.059}, timestamp = {Fri, 29 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/rss/HuangHAD17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/AchiamHTA17, author = {Joshua Achiam and David Held and Aviv Tamar and Pieter Abbeel}, title = {Constrained Policy Optimization}, journal = {CoRR}, volume = {abs/1705.10528}, year = {2017}, url = {http://arxiv.org/abs/1705.10528}, eprinttype = {arXiv}, eprint = {1705.10528}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/AchiamHTA17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/FlorensaHWA17, author = {Carlos Florensa and David Held and Markus Wulfmeier and Pieter Abbeel}, title = {Reverse Curriculum Generation for Reinforcement Learning}, journal = {CoRR}, volume = {abs/1707.05300}, year = {2017}, url = {http://arxiv.org/abs/1707.05300}, eprinttype = {arXiv}, eprint = {1707.05300}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/FlorensaHWA17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/HeldGFA17, author = {David Held and Xinyang Geng and Carlos Florensa and Pieter Abbeel}, title = {Automatic Goal Generation for Reinforcement Learning Agents}, journal = {CoRR}, volume = {abs/1705.06366}, year = {2017}, url = {http://arxiv.org/abs/1705.06366}, eprinttype = {arXiv}, eprint = {1705.06366}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/HeldGFA17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/HeldMZSA17, author = {David Held and Zoe McCarthy and Michael Zhang and Fred Shentu and Pieter Abbeel}, title = {Probabilistically Safe Policy Transfer}, journal = {CoRR}, volume = {abs/1705.05394}, year = {2017}, url = {http://arxiv.org/abs/1705.05394}, eprinttype = {arXiv}, eprint = {1705.05394}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/HeldMZSA17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/HuangHAD17, author = {Sandy H. Huang and David Held and Pieter Abbeel and Anca D. Dragan}, title = {Enabling Robots to Communicate their Objectives}, journal = {CoRR}, volume = {abs/1702.03465}, year = {2017}, url = {http://arxiv.org/abs/1702.03465}, eprinttype = {arXiv}, eprint = {1702.03465}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/HuangHAD17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@phdthesis{DBLP:phd/pt/Silva16d, author = {H{\'{e}}lder David Silva}, title = {Indoor positioning system for wireless sensor networks}, school = {University of Minho, Portugal}, year = {2016}, url = {https://hdl.handle.net/1822/42551}, timestamp = {Tue, 13 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/phd/pt/Silva16d.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@phdthesis{DBLP:phd/us/Held16, author = {David A. Held}, title = {Deep learning and probabilistic methods for robotic perception from streaming data}, school = {Stanford University, {USA}}, year = {2016}, url = {https://searchworks.stanford.edu/view/11586194}, timestamp = {Fri, 02 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/phd/us/Held16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aim/AnCFFGHPPQWZ16, author = {Jisun An and David J. Crandall and Roman Fedorov and Casey Fiesler and Fabio Giglietto and Bahareh R. Heravi and Jessica Pater and Konstantinos Pelechrinis and Daniele Quercia and Katrin Weller and Arkaitz Zubiaga}, title = {Reports of the Workshops Held at the 2016 International {AAAI} Conference on Web and Social Media}, journal = {{AI} Mag.}, volume = {37}, number = {4}, pages = {89--93}, year = {2016}, url = {https://doi.org/10.1609/aimag.v37i4.2692}, doi = {10.1609/AIMAG.V37I4.2692}, timestamp = {Sat, 05 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/aim/AnCFFGHPPQWZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cin/CostaGYFSRSB16, author = {Lu{\'{\i}}s Costa and Miguel F. Gago and Darya Yelshyna and Jaime Ferreira and H{\'{e}}lder David Silva and Lu{\'{\i}}s Alexandre Rocha and Nuno J. Sousa and Estela Bicho}, title = {Application of Machine Learning in Postural Control Kinematics for the Diagnosis of Alzheimer's Disease}, journal = {Comput. Intell. Neurosci.}, volume = {2016}, pages = {3891253:1--3891253:15}, year = {2016}, url = {https://doi.org/10.1155/2016/3891253}, doi = {10.1155/2016/3891253}, timestamp = {Thu, 16 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cin/CostaGYFSRSB16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijrr/HeldLTS16, author = {David Held and Jesse Levinson and Sebastian Thrun and Silvio Savarese}, title = {Robust real-time tracking combining 3D shape, color, and motion}, journal = {Int. J. Robotics Res.}, volume = {35}, number = {1-3}, pages = {30--49}, year = {2016}, url = {https://doi.org/10.1177/0278364915593399}, doi = {10.1177/0278364915593399}, timestamp = {Thu, 17 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijrr/HeldLTS16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/PintoPCLMAH16, author = {Cibele T. Pinto and Fl{\'{a}}vio Ponzoni and Ruy M. Castro and Larry Leigh and Nischal Mishra and David Aaron and Dennis L. Helder}, title = {First in-Flight Radiometric Calibration of {MUX} and {WFI} on-Board {CBERS-4}}, journal = {Remote. Sens.}, volume = {8}, number = {5}, pages = {405}, year = {2016}, url = {https://doi.org/10.3390/rs8050405}, doi = {10.3390/RS8050405}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/PintoPCLMAH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/HeldTS16, author = {David Held and Sebastian Thrun and Silvio Savarese}, editor = {Bastian Leibe and Jiri Matas and Nicu Sebe and Max Welling}, title = {Learning to Track at 100 {FPS} with Deep Regression Networks}, booktitle = {Computer Vision - {ECCV} 2016 - 14th European Conference, Amsterdam, The Netherlands, October 11-14, 2016, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {9905}, pages = {749--765}, publisher = {Springer}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-46448-0\_45}, doi = {10.1007/978-3-319-46448-0\_45}, timestamp = {Wed, 07 Dec 2022 23:10:23 +0100}, biburl = {https://dblp.org/rec/conf/eccv/HeldTS16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/HeldTS16, author = {David Held and Sebastian Thrun and Silvio Savarese}, editor = {Danica Kragic and Antonio Bicchi and Alessandro De Luca}, title = {Robust single-view instance recognition}, booktitle = {2016 {IEEE} International Conference on Robotics and Automation, {ICRA} 2016, Stockholm, Sweden, May 16-21, 2016}, pages = {2152--2159}, publisher = {{IEEE}}, year = {2016}, url = {https://doi.org/10.1109/ICRA.2016.7487365}, doi = {10.1109/ICRA.2016.7487365}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/icra/HeldTS16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/GuoJPH16, author = {Yiqing Guo and Xiuping Jia and David Paull and Alex Held}, title = {Multi-kernel retrieval of land surface bidirectional reflectance distribution functions based on l1-norm optimization}, booktitle = {2016 {IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS} 2016, Beijing, China, July 10-15, 2016}, pages = {1358--1361}, publisher = {{IEEE}}, year = {2016}, url = {https://doi.org/10.1109/IGARSS.2016.7729346}, doi = {10.1109/IGARSS.2016.7729346}, timestamp = {Wed, 16 Oct 2019 14:14:53 +0200}, biburl = {https://dblp.org/rec/conf/igarss/GuoJPH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/LiJTWLH16, author = {Fuqin Li and David L. B. Jupp and Medhavy Thankappan and Lan{-}Wei Wang and Adam Lewis and Alex Held}, title = {Evaluation of the TanDEM-X intermediate {DEM} for terrain illumination correction in Landsat data}, booktitle = {2016 {IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS} 2016, Beijing, China, July 10-15, 2016}, pages = {5366--5369}, publisher = {{IEEE}}, year = {2016}, url = {https://doi.org/10.1109/IGARSS.2016.7730398}, doi = {10.1109/IGARSS.2016.7730398}, timestamp = {Sat, 05 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/igarss/LiJTWLH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mammo/EibenLVHSWSBKMY16, author = {Bj{\"{o}}rn Eiben and Rene M. Lacher and Vasileios Vavourakis and John H. Hipwell and Danail Stoyanov and Norman R. Williams and J{\"{o}}rg Sabczynski and Thomas B{\"{u}}low and Dominik Kutra and Kirsten Meetz and Stewart Young and Hans Barschdorf and H{\'{e}}lder P. Oliveira and Jaime S. Cardoso and Jo{\~{a}}o P. Monteiro and Hooshiar Zolfagharnasab and Ralph Sinkus and Pedro Gouveia and Gerrit{-}Jan Liefers and Barbara Molenkamp and Cornelis J. H. van de Velde and David J. Hawkes and Maria Jo{\~{a}}o Cardoso and Mohammed Keshtgar}, editor = {Anders Tingberg and Kristina L{\aa}ng and Pontus Timberg}, title = {Breast Conserving Surgery Outcome Prediction: {A} Patient-Specific, Integrated Multi-modal Imaging and Mechano-Biological Modelling Framework}, booktitle = {Breast Imaging - 13th International Workshop, {IWDM} 2016, Malm{\"{o}}, Sweden, June 19-22, 2016, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {9699}, pages = {274--281}, publisher = {Springer}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-41546-8\_35}, doi = {10.1007/978-3-319-41546-8\_35}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mammo/EibenLVHSWSBKMY16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rss/HeldGRTS16, author = {David Held and Devin Guillory and Brice Rebsamen and Sebastian Thrun and Silvio Savarese}, editor = {David Hsu and Nancy M. Amato and Spring Berman and Sam Ade Jacobs}, title = {A Probabilistic Framework for Real-time 3D Segmentation using Spatial, Temporal, and Semantic Cues}, booktitle = {Robotics: Science and Systems XII, University of Michigan, Ann Arbor, Michigan, USA, June 18 - June 22, 2016}, year = {2016}, url = {http://www.roboticsproceedings.org/rss12/p24.html}, doi = {10.15607/RSS.2016.XII.024}, timestamp = {Fri, 29 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/rss/HeldGRTS16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ro-man/2015cr, editor = {Jeffrey T. K. V. Koh and Belinda J. Dunstan and David Silvera Tawil and Mari Velonaki}, title = {Cultural Robotics - First International Workshop, {CR} 2015, Held as Part of {IEEE} {RO-MAN} 2015, Kobe, Japan, August 31, 2015, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {9549}, publisher = {Springer}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-42945-8}, doi = {10.1007/978-3-319-42945-8}, isbn = {978-3-319-42944-1}, timestamp = {Sat, 19 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ro-man/2015cr.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/HeldTS16, author = {David Held and Sebastian Thrun and Silvio Savarese}, title = {Learning to Track at 100 {FPS} with Deep Regression Networks}, journal = {CoRR}, volume = {abs/1604.01802}, year = {2016}, url = {http://arxiv.org/abs/1604.01802}, eprinttype = {arXiv}, eprint = {1604.01802}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/HeldTS16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aim/GarciaHMPPRW0Z15, author = {David Garc{\'{\i}}a and Germaine R. Halegoua and Yelena Mejova and Nicola Perra and J{\"{u}}rgen Pfeffer and Derek Ruths and Ingmar Weber and Robert West and Leila Zia}, title = {Reports of the 2015 Workshops Held at the International {AAAI} Conference on Web and Social Media}, journal = {{AI} Mag.}, volume = {36}, number = {4}, pages = {119--123}, year = {2015}, url = {https://doi.org/10.1609/aimag.v36i4.2619}, doi = {10.1609/AIMAG.V36I4.2619}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/aim/GarciaHMPPRW0Z15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/Czapla-MyersMAT15, author = {Jeffrey Czapla{-}Myers and Joel McCorkel and Nikolaus Anderson and Kurtis J. Thome and Stuart F. Biggar and Dennis L. Helder and David Aaron and Larry Leigh and Nischal Mishra}, title = {The Ground-Based Absolute Radiometric Calibration of Landsat 8 {OLI}}, journal = {Remote. Sens.}, volume = {7}, number = {1}, pages = {600--626}, year = {2015}, url = {https://doi.org/10.3390/rs70100600}, doi = {10.3390/RS70100600}, timestamp = {Tue, 18 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/Czapla-MyersMAT15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/rskt/2015, editor = {Davide Ciucci and Guoyin Wang and Sushmita Mitra and Wei{-}Zhi Wu}, title = {Rough Sets and Knowledge Technology - 10th International Conference, {RSKT} 2015, held as part of the International Joint Conference on Rough Sets, {IJCRS} 2015, Tianjin, China, November 20-23, 2015, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {9436}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-319-25754-9}, doi = {10.1007/978-3-319-25754-9}, isbn = {978-3-319-25753-2}, timestamp = {Tue, 20 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/rskt/2015.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/HeldTS15, author = {David Held and Sebastian Thrun and Silvio Savarese}, title = {Deep Learning for Single-View Instance Recognition}, journal = {CoRR}, volume = {abs/1507.08286}, year = {2015}, url = {http://arxiv.org/abs/1507.08286}, eprinttype = {arXiv}, eprint = {1507.08286}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/HeldTS15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/MishraHLAHM14, author = {Nischal Mishra and Md. Obaidul Haque and Larry Leigh and David Aaron and Dennis L. Helder and Brian L. Markham}, title = {Radiometric Cross Calibration of Landsat 8 Operational Land Imager {(OLI)} and Landsat 7 Enhanced Thematic Mapper Plus {(ETM+)}}, journal = {Remote. Sens.}, volume = {6}, number = {12}, pages = {12619--12638}, year = {2014}, url = {https://doi.org/10.3390/rs61212619}, doi = {10.3390/RS61212619}, timestamp = {Tue, 18 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/MishraHLAHM14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/atal/AntunesNC14, author = {Luis Antunes and Davide Nunes and Helder Coelho}, editor = {Ana L. C. Bazzan and Michael N. Huhns and Alessio Lomuscio and Paul Scerri}, title = {The geometry of desire}, booktitle = {International conference on Autonomous Agents and Multi-Agent Systems, {AAMAS} '14, Paris, France, May 5-9, 2014}, pages = {1169--1172}, publisher = {{IFAAMAS/ACM}}, year = {2014}, url = {http://dl.acm.org/citation.cfm?id=2617433}, timestamp = {Thu, 28 Dec 2017 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/atal/AntunesNC14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/memea/FerreiraGFSSRB14, author = {Jaime Ferreira and Miguel F. Gago and Vitor Fernandes and H{\'{e}}lder David Silva and Nuno J. Sousa and Lu{\'{\i}}s A. Rocha and Estela Bicho}, title = {Analysis of postural kinetics data using Artificial Neural Networks in Alzheimer's Disease}, booktitle = {2014 {IEEE} International Symposium on Medical Measurements and Applications, MeMeA 2014, Lisboa, Portugal, June 11-12, 2014}, pages = {108--113}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/MeMeA.2014.6860040}, doi = {10.1109/MEMEA.2014.6860040}, timestamp = {Thu, 16 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/memea/FerreiraGFSSRB14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rss/HeldLTS14, author = {David Held and Jesse Levinson and Sebastian Thrun and Silvio Savarese}, editor = {Dieter Fox and Lydia E. Kavraki and Hanna Kurniawati}, title = {Combining 3D Shape, Color, and Motion for Robust Anytime Tracking}, booktitle = {Robotics: Science and Systems X, University of California, Berkeley, USA, July 12-16, 2014}, year = {2014}, url = {http://www.roboticsproceedings.org/rss10/p14.html}, doi = {10.15607/RSS.2014.X.014}, timestamp = {Fri, 29 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/rss/HeldLTS14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/miccai/2014aecai, editor = {Cristian A. Linte and Ziv Yaniv and Pascal Fallavollita and Purang Abolmaesumi and David R. Holmes III}, title = {Augmented Environments for Computer-Assisted Interventions - 9th International Workshop, {AE-CAI} 2014, Held in Conjunction with {MICCAI} 2014, Boston, MA, USA, September 14, 2014. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {8678}, publisher = {Springer}, year = {2014}, url = {https://doi.org/10.1007/978-3-319-10437-9}, doi = {10.1007/978-3-319-10437-9}, isbn = {978-3-319-10436-2}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miccai/2014aecai.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/rseisp/2014, editor = {Marzena Kryszkiewicz and Chris Cornelis and Davide Ciucci and Jes{\'{u}}s Medina{-}Moreno and Hiroshi Motoda and Zbigniew W. Ras}, title = {Rough Sets and Intelligent Systems Paradigms - Second International Conference, {RSEISP} 2014, Held as Part of {JRS} 2014, Granada and Madrid, Spain, July 9-13, 2014. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {8537}, publisher = {Springer}, year = {2014}, url = {https://doi.org/10.1007/978-3-319-08729-0}, doi = {10.1007/978-3-319-08729-0}, isbn = {978-3-319-08728-3}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/rseisp/2014.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/vsl/2014kr4hc, editor = {Silvia Miksch and David Ria{\~{n}}o and Annette ten Teije}, title = {Knowledge Representation for Health Care - 6th International Workshop, {KR4HC} 2014, Held as Part of the Vienna Summer of Logic, {VSL} 2014, Vienna, Austria, July 21, 2014, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {8903}, publisher = {Springer}, year = {2014}, url = {https://doi.org/10.1007/978-3-319-13281-5}, doi = {10.1007/978-3-319-13281-5}, isbn = {978-3-319-13280-8}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/vsl/2014kr4hc.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cmpb/RevieSCHLGKSHD13, author = {James A. Revie and David J. Stevenson and J. Geoffrey Chase and Christopher E. Hann and Bernard C. Lambermont and Alexandre Ghuysen and Philippe Kolh and Geoffrey M. Shaw and Stefan Heldmann and Thomas Desaive}, title = {Validation of subject-specific cardiovascular system models from porcine measurements}, journal = {Comput. Methods Programs Biomed.}, volume = {109}, number = {2}, pages = {197--210}, year = {2013}, url = {https://doi.org/10.1016/j.cmpb.2011.10.013}, doi = {10.1016/J.CMPB.2011.10.013}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cmpb/RevieSCHLGKSHD13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tgrs/ChanderHAMS13, author = {Gyanesh Chander and Dennis L. Helder and David Aaron and Nischal Mishra and Alok K. Shrestha}, title = {Assessment of Spectral, Misregistration, and Spatial Uncertainties Inherent in the Cross-Calibration Study}, journal = {{IEEE} Trans. Geosci. Remote. Sens.}, volume = {51}, number = {3-1}, pages = {1282--1296}, year = {2013}, url = {https://doi.org/10.1109/TGRS.2012.2228008}, doi = {10.1109/TGRS.2012.2228008}, timestamp = {Tue, 12 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tgrs/ChanderHAMS13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tgrs/ChanderMHAACXD13, author = {Gyanesh Chander and Nischal Mishra and Dennis L. Helder and David Aaron and Amit Angal and Taeyoung Choi and Xiaoxiong Xiong and David R. Doelling}, title = {Applications of Spectral Band Adjustment Factors {(SBAF)} for Cross-Calibration}, journal = {{IEEE} Trans. Geosci. Remote. Sens.}, volume = {51}, number = {3-1}, pages = {1267--1281}, year = {2013}, url = {https://doi.org/10.1109/TGRS.2012.2228007}, doi = {10.1109/TGRS.2012.2228007}, timestamp = {Tue, 12 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tgrs/ChanderMHAACXD13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/HeldLT13, author = {David Held and Jesse Levinson and Sebastian Thrun}, title = {Precision tracking with sparse 3D and dense color 2D data}, booktitle = {2013 {IEEE} International Conference on Robotics and Automation, Karlsruhe, Germany, May 6-10, 2013}, pages = {1138--1145}, publisher = {{IEEE}}, year = {2013}, url = {https://doi.org/10.1109/ICRA.2013.6630715}, doi = {10.1109/ICRA.2013.6630715}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/icra/HeldLT13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/LiJTPLH13, author = {Fuqin Li and David L. B. Jupp and Medhavy Thankappan and Matt Paget and Adam Lewis and Alex Held}, title = {The variability of satellite derived surface {BRDF} shape over Australia from 2001 to 2011}, booktitle = {2013 {IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS} 2013, Melbourne, Australia, July 21-26, 2013}, pages = {255--258}, publisher = {{IEEE}}, year = {2013}, url = {https://doi.org/10.1109/IGARSS.2013.6721140}, doi = {10.1109/IGARSS.2013.6721140}, timestamp = {Wed, 16 Oct 2019 14:14:53 +0200}, biburl = {https://dblp.org/rec/conf/igarss/LiJTPLH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/haw/2012, editor = {Rainer Keller and David Kramer and Jan{-}Philipp Weiss}, title = {Facing the Multicore-Challenge - Aspects of New Paradigms and Technologies in Parallel Computing [Proceedings of a conference held at Stuttgart, Germany, September 19-21, 2012]}, series = {Lecture Notes in Computer Science}, volume = {7686}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-35893-7}, doi = {10.1007/978-3-642-35893-7}, isbn = {978-3-642-35892-0}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/haw/2012.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/miccai/2012aecai, editor = {Cristian A. Linte and Elvis C. S. Chen and Marie{-}Odile Berger and John T. Moore and David R. Holmes III}, title = {Augmented Environments for Computer-Assisted Interventions - 7th International Workshop, {AE-CAI} 2012, Held in Conjunction with {MICCAI} 2012, Nice, France, October 5, 2012, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {7815}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-38085-3}, doi = {10.1007/978-3-642-38085-3}, isbn = {978-3-642-38084-6}, timestamp = {Sat, 05 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miccai/2012aecai.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/mkm/2013, editor = {Jacques Carette and David Aspinall and Christoph Lange and Petr Sojka and Wolfgang Windsteiger}, title = {Intelligent Computer Mathematics - MKM, Calculemus, DML, and Systems and Projects 2013, Held as Part of {CICM} 2013, Bath, UK, July 8-12, 2013. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {7961}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-39320-4}, doi = {10.1007/978-3-642-39320-4}, isbn = {978-3-642-39319-8}, timestamp = {Sun, 02 Jun 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mkm/2013.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/post/2013, editor = {David A. Basin and John C. Mitchell}, title = {Principles of Security and Trust - Second International Conference, {POST} 2013, Held as Part of the European Joint Conferences on Theory and Practice of Software, {ETAPS} 2013, Rome, Italy, March 16-24, 2013. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {7796}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-36830-1}, doi = {10.1007/978-3-642-36830-1}, isbn = {978-3-642-36829-5}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/post/2013.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ahci/PitmanC12, author = {David J. Pitman and Mary L. Cummings}, title = {Collaborative Exploration with a Micro Aerial Vehicle: {A} Novel Interaction Method for Controlling a {MAV} with a Hand-Held Device}, journal = {Adv. Hum. Comput. Interact.}, volume = {2012}, pages = {768180:1--768180:15}, year = {2012}, url = {https://doi.org/10.1155/2012/768180}, doi = {10.1155/2012/768180}, timestamp = {Wed, 22 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ahci/PitmanC12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cn/PalmaAC12, author = {David Palma and Helder Ara{\'{u}}jo and Mar{\'{\i}}lia Curado}, title = {Link quality estimation in wireless multi-hop networks using Kernel based methods}, journal = {Comput. Networks}, volume = {56}, number = {16}, pages = {3629--3638}, year = {2012}, url = {https://doi.org/10.1016/j.comnet.2012.07.012}, doi = {10.1016/J.COMNET.2012.07.012}, timestamp = {Wed, 22 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cn/PalmaAC12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tgrs/HelderKBMAJ12, author = {Dennis L. Helder and Sadhana Karki and Rajendra Bhatt and Esad Micijevic and David Aaron and Benjamin Jasinski}, title = {Radiometric Calibration of the Landsat {MSS} Sensor Series}, journal = {{IEEE} Trans. Geosci. Remote. Sens.}, volume = {50}, number = {6}, pages = {2380--2399}, year = {2012}, url = {https://doi.org/10.1109/TGRS.2011.2171351}, doi = {10.1109/TGRS.2011.2171351}, timestamp = {Tue, 12 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tgrs/HelderKBMAJ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tgrs/MarkhamHBMHTAC12, author = {Brian L. Markham and Md. Obaidul Haque and Julia A. Barsi and Esad Micijevic and Dennis L. Helder and Kurtis J. Thome and David Aaron and Jeffrey Czapla{-}Myers}, title = {Landsat-7 {ETM+:} 12 Years On-Orbit Reflective-Band Radiometric Performance}, journal = {{IEEE} Trans. Geosci. Remote. Sens.}, volume = {50}, number = {5-2}, pages = {2056--2062}, year = {2012}, url = {https://doi.org/10.1109/TGRS.2011.2169803}, doi = {10.1109/TGRS.2011.2169803}, timestamp = {Tue, 12 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tgrs/MarkhamHBMHTAC12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ei-sda/KaneHB12, author = {David Kane and Robert T. Held and Martin S. Banks}, editor = {Andrew J. Woods and Nicolas S. Holliman and Gregg E. Favalora}, title = {Visual discomfort with stereo 3D displays when the head is not upright}, booktitle = {Stereoscopic Displays and Applications XXIII, Burlingame, California, USA, January 22-26, 2012}, series = {{SPIE} Proceedings}, volume = {8288}, pages = {828814}, publisher = {{SPIE}}, year = {2012}, url = {https://doi.org/10.1117/12.912204}, doi = {10.1117/12.912204}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ei-sda/KaneHB12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/embc/HeldmanFRWWGGM12, author = {Dustin A. Heldman and Danielle E. Filipkowski and David E. Riley and Christina M. Whitney and Benjamin L. Walter and Steven A. Gunzler and Joseph P. Giuffrida and Thomas O. Mera}, title = {Automated motion sensor quantification of gait and lower extremity bradykinesia}, booktitle = {Annual International Conference of the {IEEE} Engineering in Medicine and Biology Society, {EMBC} 2012, San Diego, CA, USA, August 28 - September 1, 2012}, pages = {1956--1959}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/EMBC.2012.6346338}, doi = {10.1109/EMBC.2012.6346338}, timestamp = {Sat, 19 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/embc/HeldmanFRWWGGM12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/HeldLT12, author = {David Held and Jesse Levinson and Sebastian Thrun}, title = {A probabilistic framework for car detection in images using context and scale}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2012, 14-18 May, 2012, St. Paul, Minnesota, {USA}}, pages = {1628--1634}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/ICRA.2012.6224722}, doi = {10.1109/ICRA.2012.6224722}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/icra/HeldLT12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/HeldYF12, author = {David Held and Yoram Yekutieli and Tamar Flash}, title = {Characterizing the stiffness of a multi-segment flexible arm during motion}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2012, 14-18 May, 2012, St. Paul, Minnesota, {USA}}, pages = {3825--3832}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/ICRA.2012.6225070}, doi = {10.1109/ICRA.2012.6225070}, timestamp = {Mon, 22 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icra/HeldYF12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/robio/FangSGSL12, author = {Chen Fang and Weiwei Sang and Jan D. J. Gumprecht and Gero Strau{\ss} and Tim C. Lueth}, title = {Image-guided steering of a motorized hand-held flexible rhino endoscope in {ENT} diagnoses}, booktitle = {2012 {IEEE} International Conference on Robotics and Biomimetics, {ROBIO} 2012, Guangzhou, China, December 11-14, 2012}, pages = {1086--1091}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/ROBIO.2012.6491114}, doi = {10.1109/ROBIO.2012.6491114}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/robio/FangSGSL12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/haw/2011, editor = {Rainer Keller and David Kramer and Jan{-}Philipp Weiss}, title = {Facing the Multicore - Challenge {II} - Aspects of New Paradigms and Technologies in Parallel Computing [Proceedings of a conference held at the Karlsruhe Institute of Technology (KIT), September 28-30, 2011]}, series = {Lecture Notes in Computer Science}, volume = {7174}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-30397-5}, doi = {10.1007/978-3-642-30397-5}, isbn = {978-3-642-30396-8}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/haw/2011.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/miccai/2011aecai, editor = {Cristian A. Linte and John T. Moore and Elvis C. S. Chen and David R. Holmes III}, title = {Augmented Environments for Computer-Assisted Interventions - 6th International Workshop, {AE-CAI} 2011, Held in Conjunction with {MICCAI} 2011, Toronto, ON, Canada, September 22, 2011, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {7264}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-32630-1}, doi = {10.1007/978-3-642-32630-1}, isbn = {978-3-642-32629-5}, timestamp = {Sat, 05 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miccai/2011aecai.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/miccai/2012col, editor = {Hiroyuki Yoshida and David J. Hawkes and Michael W. Vannier}, title = {Abdominal Imaging. Computational and Clinical Applications - 4th International Workshop, Held in Conjunction with {MICCAI} 2012, Nice, France, October 1, 2012. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {7601}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-33612-6}, doi = {10.1007/978-3-642-33612-6}, isbn = {978-3-642-33611-9}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miccai/2012col.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cmpb/HannRSHDFLGKSC11, author = {Christopher E. Hann and James A. Revie and David J. Stevenson and Stefan Heldmann and Thomas Desaive and C. B. Froissart and Bernard C. Lambermont and Alexandre Ghuysen and Philippe Kolh and Geoffrey M. Shaw and J. Geoffrey Chase}, title = {Patient specific identification of the cardiac driver function in a cardiovascular system model}, journal = {Comput. Methods Programs Biomed.}, volume = {101}, number = {2}, pages = {201--207}, year = {2011}, url = {https://doi.org/10.1016/j.cmpb.2010.06.005}, doi = {10.1016/J.CMPB.2010.06.005}, timestamp = {Sat, 30 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cmpb/HannRSHDFLGKSC11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/AfonsoSMR11, author = {Jos{\'{e}} A. Afonso and H{\'{e}}lder David Silva and Pedro Macedo and Lu{\'{\i}}s A. Rocha}, title = {An Enhanced Reservation-Based {MAC} Protocol for {IEEE} 802.15.4 Networks}, journal = {Sensors}, volume = {11}, number = {4}, pages = {3852--3873}, year = {2011}, url = {https://doi.org/10.3390/s110403852}, doi = {10.3390/S110403852}, timestamp = {Thu, 26 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sensors/AfonsoSMR11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/software/HeldR11, author = {Isaac Held and David A. andall}, title = {Point/Counterpoint}, journal = {{IEEE} Softw.}, volume = {28}, number = {6}, pages = {62--65}, year = {2011}, url = {https://doi.org/10.1109/MS.2011.144}, doi = {10.1109/MS.2011.144}, timestamp = {Mon, 31 May 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/software/HeldR11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbc/DalyHH11, author = {Scott J. Daly and Robert T. Held and David M. Hoffman}, title = {Perceptual Issues in Stereoscopic Signal Processing}, journal = {{IEEE} Trans. Broadcast.}, volume = {57}, number = {2}, pages = {347--361}, year = {2011}, url = {https://doi.org/10.1109/TBC.2011.2127630}, doi = {10.1109/TBC.2011.2127630}, timestamp = {Thu, 09 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tbc/DalyHH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbe/LattNSPNSY11, author = {Win Tun Latt and Richard C. Newton and Marco Visentini Scarzanella and Christopher J. Payne and David P. Noonan and Jianzhong Shang and Guang{-}Zhong Yang}, title = {A Hand-held Instrument to Maintain Steady Tissue Contact during Probe-Based Confocal Laser Endomicroscopy}, journal = {{IEEE} Trans. Biomed. Eng.}, volume = {58}, number = {9}, pages = {2694--2703}, year = {2011}, url = {https://doi.org/10.1109/TBME.2011.2162064}, doi = {10.1109/TBME.2011.2162064}, timestamp = {Wed, 06 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tbe/LattNSPNSY11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isvc/PrachyabruedDB11, author = {Mores Prachyabrued and David L. Ducrest and Christoph W. Borst}, editor = {George Bebis and Richard D. Boyle and Bahram Parvin and Darko Koracin and Song Wang and Kyungnam Kim and Bedrich Benes and Kenneth Moreland and Christoph W. Borst and Stephen DiVerdi and Yi{-}Jen Chiang and Jiang Ming}, title = {Handymap: {A} Selection Interface for Cluttered {VR} Environments Using a Tracked Hand-Held Touch Device}, booktitle = {Advances in Visual Computing - 7th International Symposium, {ISVC} 2011, Las Vegas, NV, USA, September 26-28, 2011. Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {6939}, pages = {45--54}, publisher = {Springer}, year = {2011}, url = {https://doi.org/10.1007/978-3-642-24031-7\_5}, doi = {10.1007/978-3-642-24031-7\_5}, timestamp = {Wed, 23 Jun 2021 18:21:47 +0200}, biburl = {https://dblp.org/rec/conf/isvc/PrachyabruedDB11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ivs/LevinsonABDHKKLPPSSSTWT11, author = {Jesse Levinson and Jake Askeland and Jan Becker and Jennifer Dolson and David Held and S{\"{o}}ren Kammel and J. Zico Kolter and Dirk Langer and Oliver Pink and Vaughan R. Pratt and Michael Sokolsky and Ganymed Stanek and David Michael Stavens and Alex Teichman and Moritz Werling and Sebastian Thrun}, title = {Towards fully autonomous driving: Systems and algorithms}, booktitle = {{IEEE} Intelligent Vehicles Symposium (IV), 2011, Baden-Baden, Germany, June 5-9, 2011}, pages = {163--168}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/IVS.2011.5940562}, doi = {10.1109/IVS.2011.5940562}, timestamp = {Wed, 16 Oct 2019 14:14:57 +0200}, biburl = {https://dblp.org/rec/conf/ivs/LevinsonABDHKKLPPSSSTWT11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/haw/2010, editor = {Rainer Keller and David Kramer and Jan{-}Philipp Weiss}, title = {Facing the Multicore-Challenge - Aspects of New Paradigms and Technologies in Parallel Computing [Proceedings of a conference held at the Heidelberger Akademie der Wissenschaften, March 17-19, 2010]}, series = {Lecture Notes in Computer Science}, volume = {6310}, publisher = {Springer}, year = {2011}, url = {https://doi.org/10.1007/978-3-642-16233-6}, doi = {10.1007/978-3-642-16233-6}, isbn = {978-3-642-16232-9}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/haw/2010.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jasss/DavidCC10, author = {Nuno David and Jos{\'{e}} Castro Caldas and Helder Coelho}, title = {Epistemological Perspectives on Simulation {III:} An introduction}, journal = {J. Artif. Soc. Soc. Simul.}, volume = {13}, number = {1}, year = {2010}, url = {https://doi.org/10.18564/jasss.1591}, doi = {10.18564/JASSS.1591}, timestamp = {Thu, 09 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jasss/DavidCC10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/haptics/JonesHH10, author = {Lynette A. Jones and David A. Held and Ian W. Hunter}, title = {Surface waves and spatial localization in vibrotactile displays}, booktitle = {2010 {IEEE} Haptics Symposium, {HAPTICS} 2010, Waltham, MA, USA, March 25-26, 2010}, pages = {91--94}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/HAPTIC.2010.5444673}, doi = {10.1109/HAPTIC.2010.5444673}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/haptics/JonesHH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/ChanderMHACAX10, author = {Gyanesh Chander and Nischal Mishra and Dennis L. Helder and David Aaron and Taeyoung Choi and Amit Angal and Xiaoxiong Xiong}, title = {Use of {EO-1} Hyperion data to calculate spectral band adjustment factors {(SBAF)} between the {L7} {ETM+} and Terra {MODIS} sensors}, booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium, {IGARSS} 2010, July 25-30, 2010, Honolulu, Hawaii, USA, Proceedings}, pages = {1667--1670}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/IGARSS.2010.5652746}, doi = {10.1109/IGARSS.2010.5652746}, timestamp = {Wed, 16 Oct 2019 14:14:53 +0200}, biburl = {https://dblp.org/rec/conf/igarss/ChanderMHACAX10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/fase/2010, editor = {David S. Rosenblum and Gabriele Taentzer}, title = {Fundamental Approaches to Software Engineering, 13th International Conference, {FASE} 2010, Held as Part of the Joint European Conferences on Theory and Practice of Software, {ETAPS} 2010, Paphos, Cyprus, March 20-28, 2010. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6013}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-12029-9}, doi = {10.1007/978-3-642-12029-9}, isbn = {978-3-642-12028-2}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/fase/2010.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/hcc/2010, editor = {Jacques Berleur and Magda David Hercheui and Lorenz M. Hilty}, title = {What Kind of Information Society? Governance, Virtuality, Surveillance, Sustainability, Resilience - 9th {IFIP} {TC} 9 International Conference, {HCC9} 2010 and 1st {IFIP} {TC} 11 International Conference, {CIP} 2010, Held as Part of {WCC} 2010, Brisbane, Australia, September 20-23, 2010. Proceedings}, series = {{IFIP} Advances in Information and Communication Technology}, volume = {328}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-15479-9}, doi = {10.1007/978-3-642-15479-9}, isbn = {978-3-642-15478-2}, timestamp = {Thu, 23 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/hcc/2010.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/starai/2012, editor = {Henry A. Kautz and Kristian Kersting and Sriraam Natarajan and David Poole}, title = {2nd International Workshop on Statistical Relational {AI} (StaRAI-12), held at the Uncertainty in Artificial Intelligence Conference {(UAI} 2012), Catalina Island, CA, USA, August 18, 2012}, year = {2010}, url = {https://starai.cs.kuleuven.be/2012/papers.htm}, timestamp = {Thu, 10 Nov 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/starai/2012.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ieeesp/DuranCCDH09, author = {Felicia Duran and Stephen H. Conrad and Gregory N. Conrad and David P. Duggan and Edward Bruce Held}, title = {Building {A} System For Insider Security}, journal = {{IEEE} Secur. Priv.}, volume = {7}, number = {6}, pages = {30--38}, year = {2009}, url = {https://doi.org/10.1109/MSP.2009.111}, doi = {10.1109/MSP.2009.111}, timestamp = {Sun, 15 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ieeesp/DuranCCDH09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/MataboschFSB09, author = {Carles Matabosch and David Fofi and Joaquim Salvi and Elisabet Batlle}, title = {Corrigendum to "Registration of surfaces minimizing error propagation for a one-shot multi-slit hand-held scanner" [Pattern Recognition 41 {(6)} 2055-2067]}, journal = {Pattern Recognit.}, volume = {42}, number = {3}, pages = {495}, year = {2009}, url = {https://doi.org/10.1016/j.patcog.2008.08.002}, doi = {10.1016/J.PATCOG.2008.08.002}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/MataboschFSB09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/epia/AntunesNCBU09, author = {Luis Antunes and Davide Nunes and Helder Coelho and Jo{\~{a}}o Balsa and Paulo Urbano}, editor = {Lu{\'{\i}}s Seabra Lopes and Nuno Lau and Pedro Mariano and Luis M. Rocha}, title = {Context Switching versus Context Permeability in Multiple Social Networks}, booktitle = {Progress in Artificial Intelligence, 14th Portuguese Conference on Artificial Intelligence, {EPIA} 2009, Aveiro, Portugal, October 12-15, 2009. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5816}, pages = {547--559}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-04686-5\_45}, doi = {10.1007/978-3-642-04686-5\_45}, timestamp = {Sun, 02 Oct 2022 16:00:30 +0200}, biburl = {https://dblp.org/rec/conf/epia/AntunesNCBU09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcise/JonesH08, author = {Lynette A. Jones and David A. Held}, title = {Characterization of Tactors Used in Vibrotactile Displays}, journal = {J. Comput. Inf. Sci. Eng.}, volume = {8}, number = {4}, year = {2008}, url = {https://doi.org/10.1115/1.2988384}, doi = {10.1115/1.2988384}, timestamp = {Thu, 07 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jcise/JonesH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/MataboschFSB08, author = {Carles Matabosch and David Fofi and Joaquim Salvi and Elisabet Batlle}, title = {Registration of surfaces minimizing error propagation for a one-shot multi-slit hand-held scanner}, journal = {Pattern Recognit.}, volume = {41}, number = {6}, pages = {2055--2067}, year = {2008}, url = {https://doi.org/10.1016/j.patcog.2007.10.019}, doi = {10.1016/J.PATCOG.2007.10.019}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/MataboschFSB08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigsoft/BudgenB07, author = {David Budgen and Pearl Brereton}, title = {Realising evidence-based software engineering {(REBSE-2)} a report from the workshop held at {ICSE} 2007}, journal = {{ACM} {SIGSOFT} Softw. Eng. Notes}, volume = {32}, number = {4}, pages = {36--39}, year = {2007}, url = {https://doi.org/10.1145/1281421.1281441}, doi = {10.1145/1281421.1281441}, timestamp = {Thu, 17 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigsoft/BudgenB07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hci/HeldalRBW07, author = {Ilona Heldal and David J. Roberts and Lars Br{\aa}the and Robin Wolff}, editor = {Julie A. Jacko}, title = {Presence, Creativity and Collaborative Work in Virtual Environments}, booktitle = {Human-Computer Interaction. Interaction Design and Usability, 12th International Conference, {HCI} International 2007, Beijing, China, July 22-27, 2007, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {4550}, pages = {802--811}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-73105-4\_88}, doi = {10.1007/978-3-540-73105-4\_88}, timestamp = {Tue, 14 May 2019 10:00:43 +0200}, biburl = {https://dblp.org/rec/conf/hci/HeldalRBW07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/CastleGKM07, author = {Robert Oliver Castle and D. J. Gawley and Georg Klein and David William Murray}, title = {Towards simultaneous recognition, localization and mapping for hand-held and wearable cameras}, booktitle = {2007 {IEEE} International Conference on Robotics and Automation, {ICRA} 2007, 10-14 April 2007, Roma, Italy}, pages = {4102--4107}, publisher = {{IEEE}}, year = {2007}, url = {https://doi.org/10.1109/ROBOT.2007.364109}, doi = {10.1109/ROBOT.2007.364109}, timestamp = {Mon, 22 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icra/CastleGKM07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rss/ClementeDRNT07, author = {Laura A. Clemente and Andrew J. Davison and Ian D. Reid and Jos{\'{e}} Neira and Juan D. Tard{\'{o}}s}, editor = {Wolfram Burgard and Oliver Brock and Cyrill Stachniss}, title = {Mapping Large Loops with a Single Hand-Held Camera}, booktitle = {Robotics: Science and Systems III, June 27-30, 2007, Georgia Institute of Technology, Atlanta, Georgia, {USA}}, publisher = {The {MIT} Press}, year = {2007}, url = {http://www.roboticsproceedings.org/rss03/p38.html}, doi = {10.15607/RSS.2007.III.038}, timestamp = {Fri, 29 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/rss/ClementeDRNT07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jssc/KhanWKLNYBHGHGW06, author = {Aurangzeb Khan and Philip Watson and George Kuo and Due Le and Trung{-}Kien Nguyen and Steven Yang and Peter Bennett and Pokai Huang and Jaspal Gill and Chris Hawkins and John Goodenough and Demin Wang and Irfan Ahmed and Peter Tran and Helder Mak and Oanh Kim and Frank Martin and Yimu Fan and David Ge and Joseph Kung and Vincent Shek}, title = {A 90-nm Power Optimization Methodology With Application to the {ARM} 1136JF-S Microprocessor}, journal = {{IEEE} J. Solid State Circuits}, volume = {41}, number = {8}, pages = {1707--1717}, year = {2006}, url = {https://doi.org/10.1109/JSSC.2006.877248}, doi = {10.1109/JSSC.2006.877248}, timestamp = {Wed, 12 Apr 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jssc/KhanWKLNYBHGHGW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/vr/RobertsHOW06, author = {David J. Roberts and Ilona Heldal and Oliver Otto and Robin Wolff}, title = {Factors influencing flow of object focussed collaboration in collaborative virtual environments}, journal = {Virtual Real.}, volume = {10}, number = {2}, pages = {119--133}, year = {2006}, url = {https://doi.org/10.1007/s10055-006-0050-6}, doi = {10.1007/S10055-006-0050-6}, timestamp = {Thu, 18 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/vr/RobertsHOW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eumas/DavidSC06, author = {Nuno David and Jaime Sim{\~{a}}o Sichman and Helder Coelho}, editor = {Barbara Dunin{-}Keplicz and Andrea Omicini and Julian A. Padget}, title = {Simulation as Formal and Generative Social Science: The Very Idea}, booktitle = {Proceedings of the 4th European Workshop on Multi-Agent Systems EUMAS'06, Lisbon, Portugal, December 14-15, 2006}, series = {{CEUR} Workshop Proceedings}, volume = {223}, publisher = {CEUR-WS.org}, year = {2006}, url = {https://ceur-ws.org/Vol-223/8.pdf}, timestamp = {Fri, 10 Mar 2023 16:22:57 +0100}, biburl = {https://dblp.org/rec/conf/eumas/DavidSC06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/Huggins-DainesKCBRR06, author = {David Huggins{-}Daines and Mohit Kumar and Arthur Chan and Alan W. Black and Mosur Ravishankar and Alexander I. Rudnicky}, title = {Pocketsphinx: {A} Free, Real-Time Continuous Speech Recognition System for Hand-Held Devices}, booktitle = {2006 {IEEE} International Conference on Acoustics Speech and Signal Processing, {ICASSP} 2006, Toulouse, France, May 14-19, 2006}, pages = {185--188}, publisher = {{IEEE}}, year = {2006}, url = {https://doi.org/10.1109/ICASSP.2006.1659988}, doi = {10.1109/ICASSP.2006.1659988}, timestamp = {Mon, 22 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icassp/Huggins-DainesKCBRR06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceis/DavidC06, author = {Nuno David and Helder Coelho}, editor = {Yannis Manolopoulos and Joaquim Filipe and Panos Constantopoulos and Jos{\'{e}} Cordeiro}, title = {Around the Empirical and Intentional References of Agent-Based Simulation in the Social Sciences}, booktitle = {{ICEIS} 2006 - Proceedings of the Eighth International Conference on Enterprise Information Systems: Databases and Information Systems Integration, Paphos, Cyprus, May 23-27, 2006}, pages = {31--38}, year = {2006}, timestamp = {Thu, 02 Feb 2017 12:53:45 +0100}, biburl = {https://dblp.org/rec/conf/iceis/DavidC06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ifip2-5/GroppHHKMSY06, author = {William Gropp and Eldad Haber and Stefan Heldmann and David E. Keyes and Neill Miller and Jennifer M. Schopf and Tianzhi Yang}, editor = {Patrick W. Gaffney and James C. T. Pool}, title = {Grid-based Image Registration}, booktitle = {Grid-Based Problem Solving Environments - {IFIP} {TC2/} {WG} 2.5 Working Conference on Grid-Based Problem Solving Environments: Implications for Development and Deployment of Numerical Software July 17-21, 2006, Prescott, Arizona, {USA}}, series = {{IFIP}}, volume = {239}, pages = {435--448}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/978-0-387-73659-4\_26}, doi = {10.1007/978-0-387-73659-4\_26}, timestamp = {Tue, 26 Jun 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ifip2-5/GroppHHKMSY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/heuristics/HeldW05, author = {Harald Held and David L. Woodruff}, title = {Heuristics for Multi-Stage Interdiction of Stochastic Networks}, journal = {J. Heuristics}, volume = {11}, number = {5-6}, pages = {483--500}, year = {2005}, url = {https://doi.org/10.1007/s10732-005-3122-y}, doi = {10.1007/S10732-005-3122-Y}, timestamp = {Thu, 18 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/heuristics/HeldW05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jasss/Coelho05, author = {Helder Coelho}, title = {The Design of Innovation: Lessons from and for Competent Genetic Algorithms \emph{by David E. Goldberg}}, journal = {J. Artif. Soc. Soc. Simul.}, volume = {8}, number = {3}, year = {2005}, url = {http://jasss.soc.surrey.ac.uk/8/3/reviews/coelho.html}, timestamp = {Thu, 09 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jasss/Coelho05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jasss/DavidSC05, author = {Nuno David and Jaime Sim{\~{a}}o Sichman and Helder Coelho}, title = {The Logic of the Method of Agent-Based Simulation in the Social Sciences: Empirical and Intentional Adequacy of Computer Programs}, journal = {J. Artif. Soc. Soc. Simul.}, volume = {8}, number = {4}, year = {2005}, url = {http://jasss.soc.surrey.ac.uk/8/4/2.html}, timestamp = {Thu, 09 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jasss/DavidSC05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigsoft/BudgenK05, author = {David Budgen and Barbara A. Kitchenham}, title = {Realising evidence-based software engineering a report from the workshop held at {ICSE} 2005}, journal = {{ACM} {SIGSOFT} Softw. Eng. Notes}, volume = {30}, number = {5}, pages = {1--5}, year = {2005}, url = {https://doi.org/10.1145/1095430.1095435}, doi = {10.1145/1095430.1095435}, timestamp = {Thu, 17 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigsoft/BudgenK05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/atal/DavidSC05, author = {Nuno David and Jaime Sim{\~{a}}o Sichman and Helder Coelho}, editor = {Frank Dignum and Virginia Dignum and Sven Koenig and Sarit Kraus and Munindar P. Singh and Michael J. Wooldridge}, title = {Intentional adequacy of computer programs as the experimental reference of agent-based social simulation}, booktitle = {4th International Joint Conference on Autonomous Agents and Multiagent Systems {(AAMAS} 2005), July 25-29, 2005, Utrecht, The Netherlands}, pages = {1359--1360}, publisher = {{ACM}}, year = {2005}, url = {https://doi.org/10.1145/1082473.1082772}, doi = {10.1145/1082473.1082772}, timestamp = {Fri, 26 Apr 2019 14:26:42 +0200}, biburl = {https://dblp.org/rec/conf/atal/DavidSC05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mum/LiuDL05, author = {Xu Liu and David S. Doermann and Huiping Li}, editor = {Mark Billinghurst}, title = {Fast camera motion estimation for hand-held devices and applications}, booktitle = {Proceedings of the 4th International Conference on Mobile and Ubiquitous Multimedia, {MUM} 2005, Christchurch, New Zealand, December 8-10, 2005}, series = {{ACM} International Conference Proceeding Series}, volume = {154}, pages = {103--108}, publisher = {{ACM}}, year = {2005}, url = {https://doi.org/10.1145/1149488.1149505}, doi = {10.1145/1149488.1149505}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/mum/LiuDL05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cphysics/Blanco-ReyAHK04, author = {Maria Blanco{-}Rey and Pedro de Andres and Georg Held and David A. King}, title = {A {FORTRAN-90} Low-Energy Electron Diffraction program {(LEED90} v1.1)}, journal = {Comput. Phys. Commun.}, volume = {161}, number = {3}, pages = {151--165}, year = {2004}, url = {https://doi.org/10.1016/j.cpc.2004.05.002}, doi = {10.1016/J.CPC.2004.05.002}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cphysics/Blanco-ReyAHK04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cphysics/Blanco-ReyAHK04a, author = {Maria Blanco{-}Rey and Pedro de Andres and Georg Held and David A. King}, title = {Molecular t-matrices for Low-Energy Electron Diffraction {(TMOL} v1.1)}, journal = {Comput. Phys. Commun.}, volume = {161}, number = {3}, pages = {166--178}, year = {2004}, url = {https://doi.org/10.1016/j.cpc.2004.05.003}, doi = {10.1016/J.CPC.2004.05.003}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cphysics/Blanco-ReyAHK04a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jasss/DavidMSC04, author = {Nuno David and Maria Bruno Marietto and Jaime Sim{\~{a}}o Sichman and Helder Coelho}, title = {The Structure and Logic of Interdisciplinary Research in Agent-Based Social Simulation}, journal = {J. Artif. Soc. Soc. Simul.}, volume = {7}, number = {3}, year = {2004}, url = {http://jasss.soc.surrey.ac.uk/7/3/4.html}, timestamp = {Thu, 09 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jasss/DavidMSC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tgrs/ChanderMH04, author = {Gyanesh Chander and David J. Meyer and Dennis L. Helder}, title = {Cross calibration of the Landsat-7 {ETM+} and {EO-1} {ALI} sensor}, journal = {{IEEE} Trans. Geosci. Remote. Sens.}, volume = {42}, number = {12}, pages = {2821--2831}, year = {2004}, url = {https://doi.org/10.1109/TGRS.2004.836387}, doi = {10.1109/TGRS.2004.836387}, timestamp = {Tue, 12 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tgrs/ChanderMH04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tgrs/ThomeHAD04, author = {Kurtis J. Thome and Dennis L. Helder and David Aaron and James D. Dewald}, title = {Landsat-5 {TM} and Landsat-7 {ETM+} absolute radiometric calibration using the reflectance-based method}, journal = {{IEEE} Trans. Geosci. Remote. Sens.}, volume = {42}, number = {12}, pages = {2777--2785}, year = {2004}, url = {https://doi.org/10.1109/TGRS.2004.839085}, doi = {10.1109/TGRS.2004.839085}, timestamp = {Tue, 12 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tgrs/ThomeHAD04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amcc/JinWWLSFHM04, author = {Zhipu Jin and Stephan Waydo and Elisabeth B. Wildanger and Michael Lammers and Hans Scholze and Peter Foley and David Held and Richard M. Murray}, title = {{MVWT-II:} the second generation Caltech Multi-Vehicle Wireless Testbed}, booktitle = {Proceedings of the 2004 American Control Conference, {ACC} 2004, Boston, MA, USA, June 30 - July 2, 2004}, pages = {5321--5326}, publisher = {{IEEE}}, year = {2004}, url = {https://doi.org/10.23919/ACC.2004.1384698}, doi = {10.23919/ACC.2004.1384698}, timestamp = {Thu, 24 Nov 2022 09:21:27 +0100}, biburl = {https://dblp.org/rec/conf/amcc/JinWWLSFHM04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cicc/KhanRJGLNYYABCC04, author = {Aurangzeb Khan and K. Ruparel and C. Joly and V. Ghanta and Due Le and T. Nguyen and J. Yu and Steven Yang and Irfan Ahmed and N. Burnside and V. Chagarlamudi and M. Cheung and F. Chiu and Yimu Fan and David Ge and Jaspal Gill and Pokai Huang and V. Jayapal and Oanh Kim and M. Li and Helder Mak and P. McKeever and S. Nguyen and K. Rajan and S. Riley and Peter Tran and H. Truong and A. Tsou and Demin Wang and C. Yang and J. Zhang and X. Zhong}, title = {Design and development of 130-nanometer ICs for a multi-Gigabit switching network system}, booktitle = {Proceedings of the {IEEE} 2004 Custom Integrated Circuits Conference, {CICC} 2004, Orlando, FL, USA, October 2004}, pages = {317--320}, publisher = {{IEEE}}, year = {2004}, url = {https://doi.org/10.1109/CICC.2004.1358809}, doi = {10.1109/CICC.2004.1358809}, timestamp = {Fri, 15 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cicc/KhanRJGLNYYABCC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/esop/2004, editor = {David A. Schmidt}, title = {Programming Languages and Systems, 13th European Symposium on Programming, {ESOP} 2004, Held as Part of the Joint European Conferences on Theory and Practice of Software, {ETAPS} 2004, Barcelona, Spain, March 29 - April 2, 2004, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {2986}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/b96702}, doi = {10.1007/B96702}, isbn = {3-540-21313-9}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/esop/2004.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bib/DevilleGHW03, author = {Yves Deville and David R. Gilbert and Jacques van Helden and Shoshana J. Wodak}, title = {An overview of data models for the analysis of biochemical pathways}, journal = {Briefings Bioinform.}, volume = {4}, number = {3}, pages = {246--259}, year = {2003}, url = {https://doi.org/10.1093/bib/4.3.246}, doi = {10.1093/BIB/4.3.246}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bib/DevilleGHW03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/mj/JoshiABLMR03, author = {Yogendra Joshi and Kaveh Azar and David L. Blackburn and Clemens J. M. Lasance and Ravi Mahajan and Jukka Rantala}, title = {How well can we assess thermally driven reliability issues in electronic systems today? Summary of panel held at the Therminic 2002}, journal = {Microelectron. J.}, volume = {34}, number = {12}, pages = {1195--1201}, year = {2003}, url = {https://doi.org/10.1016/S0026-2692(03)00200-3}, doi = {10.1016/S0026-2692(03)00200-3}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/mj/JoshiABLMR03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03, author = {James Allan and Jay Aslam and Nicholas J. Belkin and Chris Buckley and James P. Callan and W. Bruce Croft and Susan T. Dumais and Norbert Fuhr and Donna Harman and David J. Harper and Djoerd Hiemstra and Thomas Hofmann and Eduard H. Hovy and Wessel Kraaij and John D. Lafferty and Victor Lavrenko and David D. Lewis and Liz Liddy and R. Manmatha and Andrew McCallum and Jay M. Ponte and John M. Prager and Dragomir R. Radev and Philip Resnik and Stephen E. Robertson and Ronald Rosenfeld and Salim Roukos and Mark Sanderson and Richard M. Schwartz and Amit Singhal and Alan F. Smeaton and Howard R. Turtle and Ellen M. Voorhees and Ralph M. Weischedel and Jinxi Xu and ChengXiang Zhai}, title = {Challenges in information retrieval and language modeling: report of a workshop held at the center for intelligent information retrieval, University of Massachusetts Amherst, September 2002}, journal = {{SIGIR} Forum}, volume = {37}, number = {1}, pages = {31--47}, year = {2003}, url = {https://doi.org/10.1145/945546.945549}, doi = {10.1145/945546.945549}, timestamp = {Sun, 22 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cmsb/DevilleGHW03, author = {Yves Deville and David R. Gilbert and Jacques van Helden and Shoshana J. Wodak}, editor = {Corrado Priami}, title = {An Overview of Data Models for the Analysis of Biochemical Pathways}, booktitle = {Computational Methods in Systems Biology, First International Workshop, {CMSB} 2003, Roverto, Italy, February 24-26, 2003, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {2602}, pages = {174}, publisher = {Springer}, year = {2003}, url = {https://doi.org/10.1007/3-540-36481-1\_23}, doi = {10.1007/3-540-36481-1\_23}, timestamp = {Tue, 14 May 2019 10:00:49 +0200}, biburl = {https://dblp.org/rec/conf/cmsb/DevilleGHW03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mabs/MariettoDSC03, author = {Maria Bruno Marietto and Nuno David and Jaime Sim{\~{a}}o Sichman and Helder Coelho}, editor = {David Hales and Bruce Edmonds and Emma Norling and Juliette Rouchier}, title = {A Classification of Paradigmatic Models for Agent-Based Social Simulation}, booktitle = {Multi-Agent-Based Simulation III, 4th International Workshop, {MABS} 2003, Melbourne, Australia, July 14th, 2003, Revised Papers}, series = {Lecture Notes in Computer Science}, volume = {2927}, pages = {193--208}, publisher = {Springer}, year = {2003}, url = {https://doi.org/10.1007/978-3-540-24613-8\_14}, doi = {10.1007/978-3-540-24613-8\_14}, timestamp = {Tue, 14 May 2019 10:00:36 +0200}, biburl = {https://dblp.org/rec/conf/mabs/MariettoDSC03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ccgrid/HelderJ02, author = {David A. Helder and Sugih Jamin}, title = {End-Host Multicast Communication Using Switch-Trees Protocols}, booktitle = {2nd {IEEE} International Symposium on Cluster Computing and the Grid (CCGrid 2002), 22-24 May 2002, Berlin, Germany}, pages = {419--424}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://doi.org/10.1109/CCGRID.2002.1017172}, doi = {10.1109/CCGRID.2002.1017172}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ccgrid/HelderJ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mabs/DavidSC02, author = {Nuno David and Jaime Sim{\~{a}}o Sichman and Helder Coelho}, editor = {Jaime Sim{\~{a}}o Sichman and Fran{\c{c}}ois Bousquet and Paul Davidsson}, title = {Towards an Emergence-Driven Software Process for Agent-Based Simulatio}, booktitle = {Multi-Agent-Based Simulation, Third International Workshop, {MABS} 2002, Bologna, Italy, July 15-16, 2002, Revised Papers}, series = {Lecture Notes in Computer Science}, volume = {2581}, pages = {89--104}, publisher = {Springer}, year = {2002}, url = {https://doi.org/10.1007/3-540-36483-8\_7}, doi = {10.1007/3-540-36483-8\_7}, timestamp = {Wed, 25 Sep 2019 18:15:39 +0200}, biburl = {https://dblp.org/rec/conf/mabs/DavidSC02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mabs/MariettoDSC02, author = {Maria Bruno Marietto and Nuno David and Jaime Sim{\~{a}}o Sichman and Helder Coelho}, editor = {Jaime Sim{\~{a}}o Sichman and Fran{\c{c}}ois Bousquet and Paul Davidsson}, title = {Requirements Analysis of Agent-Based Simulation Platforms: State of the Art and New Prospects}, booktitle = {Multi-Agent-Based Simulation, Third International Workshop, {MABS} 2002, Bologna, Italy, July 15-16, 2002, Revised Papers}, series = {Lecture Notes in Computer Science}, volume = {2581}, pages = {125--141}, publisher = {Springer}, year = {2002}, url = {https://doi.org/10.1007/3-540-36483-8\_9}, doi = {10.1007/3-540-36483-8\_9}, timestamp = {Fri, 02 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/mabs/MariettoDSC02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ngc/WangHJZ02, author = {Wenjie Wang and David A. Helder and Sugih Jamin and Lixia Zhang}, title = {Overlay Optimizations for End-host Multicast}, booktitle = {Networked Group Communication, Fourth International {COST264} Workshop, {NGC} 2002, Boston, MA, USA, October 23-25, 2002, Proceedings}, pages = {154--161}, publisher = {{ACM}}, year = {2002}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ngc/WangHJZ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sbia/DavidSC02, author = {Nuno David and Jaime Sim{\~{a}}o Sichman and Helder Coelho}, editor = {Guilherme Bittencourt and Geber L. Ramalho}, title = {Multiple Society Organisations and Social Opacity: When Agents Play the Role of Observers}, booktitle = {Advances in Artificial Intelligence, 16th Brazilian Symposium on Artificial Intelligence, {SBIA} 2002, Porto de Galinhas/Recife, Brazil, November 11-14, 2002, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {2507}, pages = {63--73}, publisher = {Springer}, year = {2002}, url = {https://doi.org/10.1007/3-540-36127-8\_7}, doi = {10.1007/3-540-36127-8\_7}, timestamp = {Fri, 11 Oct 2019 15:30:43 +0200}, biburl = {https://dblp.org/rec/conf/sbia/DavidSC02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/SchroederGHN01, author = {Michael Schroeder and David R. Gilbert and Jacques van Helden and Penny Noy}, title = {Approaches to visualisation in bioinformatics: from dendrograms to Space Explorer}, journal = {Inf. Sci.}, volume = {139}, number = {1-2}, pages = {19--57}, year = {2001}, url = {https://doi.org/10.1016/S0020-0255(01)00156-6}, doi = {10.1016/S0020-0255(01)00156-6}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/isci/SchroederGHN01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amia/LobachLARTE01, author = {David F. Lobach and Richard Low and Jennifer M. Arbanas and J. S. Rabold and Jacqueline L. Tatum and Susan D. Epstein}, title = {Defining and supporting the diverse information needs of community-based care using the web and hand-held devices}, booktitle = {{AMIA} 2001, American Medical Informatics Association Annual Symposium, Washington, DC, USA, November 3-7, 2001}, publisher = {{AMIA}}, year = {2001}, url = {https://knowledge.amia.org/amia-55142-a2001a-1.597057/t-001-1.599654/f-001-1.599655/a-080-1.599899/a-081-1.599896}, timestamp = {Wed, 17 Apr 2024 11:48:39 +0200}, biburl = {https://dblp.org/rec/conf/amia/LobachLARTE01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amia/LynnNL01, author = {Thomas E. Lynn and John O. Naugle and David F. Lobach}, title = {Delivering Interactive Clinical Practice Guidelines to the Point of Care Using Hand-held Devices}, booktitle = {{AMIA} 2001, American Medical Informatics Association Annual Symposium, Washington, DC, USA, November 3-7, 2001}, publisher = {{AMIA}}, year = {2001}, url = {https://knowledge.amia.org/amia-55142-a2001a-1.597057/t-002-1.598852/f-001-1.598853/a-320-1.599176/a-321-1.599173}, timestamp = {Wed, 17 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amia/LynnNL01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/esop/2001, editor = {David Sands}, title = {Programming Languages and Systems, 10th European Symposium on Programming, {ESOP} 2001 Held as Part of the Joint European Conferences on Theory and Practice of Software, {ETAPS} 2001 Genova, Italy, April 2-6, 2001, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {2028}, publisher = {Springer}, year = {2001}, url = {https://doi.org/10.1007/3-540-45309-1}, doi = {10.1007/3-540-45309-1}, isbn = {3-540-41862-8}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/esop/2001.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/jobim/HeldenGWSW00, author = {Jacques van Helden and David R. Gilbert and Lorenz Wernisch and Michael Schroeder and Shoshana J. Wodak}, editor = {Olivier Gascuel and Marie{-}France Sagot}, title = {Application of Regulatory Sequence Analysis and Metabolic Network Analysis to the Interpretation of Gene Expression Data}, booktitle = {Computational Biology, First International Conference on Biology, Informatics, and Mathematics, {JOBIM} 2000, Montpellier, France, May 3-5, 2000, Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {2066}, pages = {147--164}, publisher = {Springer}, year = {2000}, url = {https://doi.org/10.1007/3-540-45727-5\_13}, doi = {10.1007/3-540-45727-5\_13}, timestamp = {Tue, 14 May 2019 10:00:36 +0200}, biburl = {https://dblp.org/rec/conf/jobim/HeldenGWSW00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mabs/DavidSC00, author = {Nuno David and Jaime Sim{\~{a}}o Sichman and Helder Coelho}, editor = {Scott Moss and Paul Davidsson}, title = {Agent-Based Social Simulation with Coalitions in Social Reasoning}, booktitle = {Multi-Agent-Based Simulation, Second International Workshop, {MABS} 2000, Boston, MA, USA, July, 2000, Revised and Additional Papers}, series = {Lecture Notes in Computer Science}, volume = {1979}, pages = {244--265}, publisher = {Springer}, year = {2000}, url = {https://doi.org/10.1007/3-540-44561-7\_18}, doi = {10.1007/3-540-44561-7\_18}, timestamp = {Wed, 25 Sep 2019 18:15:39 +0200}, biburl = {https://dblp.org/rec/conf/mabs/DavidSC00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/cc/2000, editor = {David A. Watt}, title = {Compiler Construction, 9th International Conference, {CC} 2000, Held as Part of the European Joint Conferences on the Theory and Practice of Software, {ETAPS} 2000, Berlin, Germany, March 25 - April 2, 2000, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {1781}, publisher = {Springer}, year = {2000}, url = {https://doi.org/10.1007/3-540-46423-9}, doi = {10.1007/3-540-46423-9}, isbn = {3-540-67263-X}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cc/2000.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/gcb/HeldenGWMEDW99, author = {Jacques van Helden and David R. Gilbert and Lorenz Wernisch and Renato Mancuso and Matthew D. Eldridge and Kirill Degtyarenko and Shoshana J. Wodak}, title = {Logical Tools for Quering and Assisting Annotation of a Biochemical Pathway Database}, booktitle = {Proceedings of the German Conference on Bioinformatics, {GCB} 1999, October 4-6, 1999, Hannover, Germany}, pages = {227--229}, year = {1999}, timestamp = {Wed, 25 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/gcb/HeldenGWMEDW99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/maamaw/DavidSC99, author = {Nuno David and Jaime Sim{\~{a}}o Sichman and Helder Coelho}, editor = {Francisco J. Garijo and Magnus Boman}, title = {Extending Social Reasoning to Cope with Multiple Partner Coalitions}, booktitle = {MultiAgent System Engineering, 9th European Workshop on Modelling Autonomous Agents in a Multi-Agent World, {MAAMAW} '99, Valencia, Spain, June 30 - July 2, 1999, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {1647}, pages = {175--187}, publisher = {Springer}, year = {1999}, url = {https://doi.org/10.1007/3-540-48437-X\_15}, doi = {10.1007/3-540-48437-X\_15}, timestamp = {Tue, 14 May 2019 10:00:48 +0200}, biburl = {https://dblp.org/rec/conf/maamaw/DavidSC99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigmod/BernsteinBCDFGGHHJLMNPSU98, author = {Philip A. Bernstein and Michael L. Brodie and Stefano Ceri and David J. DeWitt and Michael J. Franklin and Hector Garcia{-}Molina and Jim Gray and Gerald Held and Joseph M. Hellerstein and H. V. Jagadish and Michael Lesk and David Maier and Jeffrey F. Naughton and Hamid Pirahesh and Michael Stonebraker and Jeffrey D. Ullman}, title = {The Asilomar Report on Database Research}, journal = {{SIGMOD} Rec.}, volume = {27}, number = {4}, pages = {74--80}, year = {1998}, url = {https://doi.org/10.1145/306101.306137}, doi = {10.1145/306101.306137}, timestamp = {Fri, 06 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sigmod/BernsteinBCDFGGHHJLMNPSU98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ep/1998, editor = {Roger D. Hersch and Jacques Andr{\'{e}} and Heather Brown}, title = {Electronic Publishing, Artistic Imaging, and Digital Typography, 7th International Conference on Electronic Publishing, {EP} '98, Held Jointly with the 4th International Conference on Raster Imaging and Digital Typography, {RIDT} '98, St. Malo, France, March 30 - April 3, 1998, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {1375}, publisher = {Springer}, year = {1998}, url = {https://doi.org/10.1007/BFb0053257}, doi = {10.1007/BFB0053257}, isbn = {3-540-64298-6}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ep/1998.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/cs-DB-9811013, author = {Philip A. Bernstein and Michael L. Brodie and Stefano Ceri and David J. DeWitt and Michael J. Franklin and Hector Garcia{-}Molina and Jim Gray and Gerald Held and Joseph M. Hellerstein and H. V. Jagadish and Michael Lesk and David Maier and Jeffrey F. Naughton and Hamid Pirahesh and Michael Stonebraker and Jeffrey D. Ullman}, title = {The Asilomar Report on Database Research}, journal = {CoRR}, volume = {cs.DB/9811013}, year = {1998}, url = {https://arxiv.org/abs/cs/9811013}, timestamp = {Fri, 10 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/cs-DB-9811013.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/siggraph/Small97, author = {David Small}, editor = {Lynn Pocock and Rick Hopkins and David S. Ebert and Judith Crow}, title = {Hand held tools for navigating information}, booktitle = {{ACM} {SIGGRAPH} 97 Visual Proceedings: The art and interdisciplinary programs of {SIGGRAPH} '97, Los Angeles, California, USA, August 3-8, 1997}, pages = {139}, publisher = {{ACM}}, year = {1997}, url = {https://doi.org/10.1145/259081.259225}, doi = {10.1145/259081.259225}, timestamp = {Tue, 06 Nov 2018 16:59:12 +0100}, biburl = {https://dblp.org/rec/conf/siggraph/Small97.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/soda/JohnsonMR96, author = {David S. Johnson and Lyle A. McGeoch and Edward E. Rothberg}, editor = {{\'{E}}va Tardos}, title = {Asymptotic Experimental Analysis for the Held-Karp Traveling Salesman Bound}, booktitle = {Proceedings of the Seventh Annual {ACM-SIAM} Symposium on Discrete Algorithms, 28-30 January 1996, Atlanta, Georgia, {USA}}, pages = {341--350}, publisher = {{ACM/SIAM}}, year = {1996}, url = {http://dl.acm.org/citation.cfm?id=313852.314081}, timestamp = {Thu, 05 Jul 2018 07:29:31 +0200}, biburl = {https://dblp.org/rec/conf/soda/JohnsonMR96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:journals/oopsm/MonarchiHBJMRW94, author = {David E. Monarchi and Brian Henderson{-}Sellers and Grady Booch and Ivar Jacobson and Stephen J. Mellor and James E. Rumbaugh and Rebecca Wirfs{-}Brock}, editor = {Mark C. Wilkes}, title = {"Methodology standards: help or hindrance?" held at {OOPSIA} 94 October 1994, Portland, Oregon: Report on panel}, booktitle = {Addendum to the Proceedings on Object-Oriented Programming Systems, Languages, and Applications, {OOPSLA} 1994 Addendum, Portland, Oregon, USA, October 23-28, 1994}, pages = {54--58}, publisher = {{ACM}}, year = {1994}, url = {https://doi.org/10.1145/260028.260114}, doi = {10.1145/260028.260114}, timestamp = {Fri, 20 May 2022 14:44:08 +0200}, biburl = {https://dblp.org/rec/journals/oopsm/MonarchiHBJMRW94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/orl/Williamson92, author = {David P. Williamson}, title = {Analysis of the Held-Karp lower bound for the asymmetric {TSP}}, journal = {Oper. Res. Lett.}, volume = {12}, number = {2}, pages = {83--88}, year = {1992}, url = {https://doi.org/10.1016/0167-6377(92)90068-E}, doi = {10.1016/0167-6377(92)90068-E}, timestamp = {Thu, 23 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/orl/Williamson92.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ipl/ShmoysW90, author = {David B. Shmoys and David P. Williamson}, title = {Analyzing the Held-Karp {TSP} Bound: {A} Monotonicity Property with Application}, journal = {Inf. Process. Lett.}, volume = {35}, number = {6}, pages = {281--285}, year = {1990}, url = {https://doi.org/10.1016/0020-0190(90)90028-V}, doi = {10.1016/0020-0190(90)90028-V}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ipl/ShmoysW90.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigmod/JosephTTW89, author = {John Joseph and Satish M. Thatte and Craig W. Thompson and David L. Wells}, title = {Report on the Object-Oriented Database Workshop, Held in Conjuction with {OOPSLA} '88}, journal = {{SIGMOD} Rec.}, volume = {18}, number = {3}, pages = {78--101}, year = {1989}, url = {https://doi.org/10.1145/71031.71041}, doi = {10.1145/71031.71041}, timestamp = {Fri, 06 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sigmod/JosephTTW89.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ibmrd/BajorekCRT74, author = {Christopher H. Bajorek and Charles W. Coker Jr. and Lubomyr T. Romankiw and David A. Thompson}, title = {Hand-Held Magnetoresistive Transducer}, journal = {{IBM} J. Res. Dev.}, volume = {18}, number = {6}, pages = {541--546}, year = {1974}, url = {https://doi.org/10.1147/rd.186.0541}, doi = {10.1147/RD.186.0541}, timestamp = {Fri, 13 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ibmrd/BajorekCRT74.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
![](https://dblp.uni-trier.de/img/cog.dark.24x24.png)
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.