Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "David Held"
download as .bib file
@article{DBLP:journals/arobots/AnchaPZNH24,
author = {Siddharth Ancha and
Gaurav Pathak and
Ji Zhang and
Srinivasa G. Narasimhan and
David Held},
title = {Active velocity estimation using light curtains via self-supervised
multi-armed bandits},
journal = {Auton. Robots},
volume = {48},
number = {6-7},
pages = {15},
year = {2024}
}
@article{DBLP:journals/ral/GuptaBAH24,
author = {Pranay Gupta and
Abhijat Biswas and
Henny Admoni and
David Held},
title = {Object Importance Estimation Using Counterfactual Reasoning for Intelligent
Driving},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {9},
number = {4},
pages = {3648--3655},
year = {2024}
}
@article{DBLP:journals/ral/SunWHE24,
author = {Zhanyi Sun and
Yufei Wang and
David Held and
Zackory Erickson},
title = {Force-Constrained Visual Policy: Safe Robot-Assisted Dressing via
Multi-Modal Sensing},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {9},
number = {5},
pages = {4178--4185},
year = {2024}
}
@article{DBLP:journals/tcps/BenglerDLRABFHHHIKKLLPRSSSSUV24,
author = {Klaus Bengler and
Werner Damm and
Andreas L{\"{u}}dtke and
Jochem W. Rieger and
Benedikt Austel and
Bianca Biebl and
Martin Fr{\"{a}}nzle and
Willem Hagemann and
Moritz Held and
David Hess and
Klas Ihme and
Severin Kacianka and
Alyssa J. Kerscher and
Forrest Laine and
Sebastian Lehnhoff and
Alexander Pretschner and
Astrid Rakow and
Daniel Sonntag and
Janos Sztipanovits and
Maike Schwammberger and
Mark Schweda and
Anirudh Unni and
Eric M. S. P. Veith},
title = {A References Architecture for Human Cyber Physical Systems, Part {II:}
Fundamental Design Principles for Human-CPS Interaction},
journal = {{ACM} Trans. Cyber Phys. Syst.},
volume = {8},
number = {1},
pages = {3:1--3:27},
year = {2024}
}
@article{DBLP:journals/tcps/DammFKLBBHHHIKLLPRRSSSSTUV24,
author = {Werner Damm and
Martin Fr{\"{a}}nzle and
Alyssa J. Kerscher and
Forrest Laine and
Klaus Bengler and
Bianca Biebl and
Willem Hagemann and
Moritz Held and
David Hess and
Klas Ihme and
Severin Kacianka and
Sebastian Lehnhoff and
Andreas L{\"{u}}dtke and
Alexander Pretschner and
Astrid Rakow and
Jochem W. Rieger and
Daniel Sonntag and
Janos Sztipanovits and
Maike Schwammberger and
Mark Schweda and
Alexander Trende and
Anirudh Unni and
Eric M. S. P. Veith},
title = {A Reference Architecture of Human Cyber-Physical Systems - Part {III:}
Semantic Foundations},
journal = {{ACM} Trans. Cyber Phys. Syst.},
volume = {8},
number = {1},
pages = {4:1--4:23},
year = {2024}
}
@article{DBLP:journals/tcps/DammHSSBBFHHIKKLLPRRSSAUV24,
author = {Werner Damm and
David Hess and
Mark Schweda and
Janos Sztipanovits and
Klaus Bengler and
Bianca Biebl and
Martin Fr{\"{a}}nzle and
Willem Hagemann and
Moritz Held and
Klas Ihme and
Severin Kacianka and
Alyssa J. Kerscher and
Sebastian Lehnhoff and
Andreas L{\"{u}}dtke and
Alexander Pretschner and
Astrid Rakow and
Jochem W. Rieger and
Daniel Sonntag and
Maike Schwammberger and
Benedikt Austel and
Anirudh Unni and
Eric M. S. P. Veith},
title = {A Reference Architecture of Human Cyber-Physical Systems - Part {I:}
Fundamental Concepts},
journal = {{ACM} Trans. Cyber Phys. Syst.},
volume = {8},
number = {1},
pages = {2:1--2:32},
year = {2024}
}
@inproceedings{DBLP:conf/iclr/Eisner0DVSH24,
author = {Ben Eisner and
Yi Yang and
Todor Davchev and
Mel Vecer{\'{\i}}k and
Jonathan Scholz and
David Held},
title = {Deep SE(3)-Equivariant Geometric Reasoning for Precise Placement Tasks},
booktitle = {{ICLR}},
publisher = {OpenReview.net},
year = {2024}
}
@inproceedings{DBLP:conf/icml/WangSZXBHE24,
author = {Yufei Wang and
Zhanyi Sun and
Jesse Zhang and
Zhou Xian and
Erdem Biyik and
David Held and
Zackory Erickson},
title = {{RL-VLM-F:} Reinforcement Learning from Vision Language Foundation
Model Feedback},
booktitle = {{ICML}},
publisher = {OpenReview.net},
year = {2024}
}
@inproceedings{DBLP:conf/icml/WangXCWWFEHG24,
author = {Yufei Wang and
Zhou Xian and
Feng Chen and
Tsun{-}Hsuan Wang and
Yian Wang and
Katerina Fragkiadaki and
Zackory Erickson and
David Held and
Chuang Gan},
title = {RoboGen: Towards Unleashing Infinite Data for Automated Robot Learning
via Generative Simulation},
booktitle = {{ICML}},
publisher = {OpenReview.net},
year = {2024}
}
@inproceedings{DBLP:conf/icra/WangDH24,
author = {Jenny Wang and
Octavian Donca and
David Held},
title = {Learning Distributional Demonstration Spaces for Task-Specific Cross-Pose
Estimation},
booktitle = {{ICRA}},
pages = {15054--15060},
publisher = {{IEEE}},
year = {2024}
}
@inproceedings{DBLP:conf/icra/YangZLZH24,
author = {Fan Yang and
Wenxuan Zhou and
Zuxin Liu and
Ding Zhao and
David Held},
title = {Reinforcement Learning in a Safety-Embedded {MDP} with Trajectory
Optimization},
booktitle = {{ICRA}},
pages = {2845--2851},
publisher = {{IEEE}},
year = {2024}
}
@article{DBLP:journals/corr/abs-2401-01993,
author = {M. Nomaan Qureshi and
Ben Eisner and
David Held},
title = {On Time-Indexing as Inductive Bias in Deep {RL} for Sequential Manipulation
Tasks},
journal = {CoRR},
volume = {abs/2401.01993},
year = {2024}
}
@article{DBLP:journals/corr/abs-2402-03681,
author = {Yufei Wang and
Zhanyi Sun and
Jesse Zhang and
Zhou Xian and
Erdem Biyik and
David Held and
Zackory Erickson},
title = {{RL-VLM-F:} Reinforcement Learning from Vision Language Foundation
Model Feedback},
journal = {CoRR},
volume = {abs/2402.03681},
year = {2024}
}
@article{DBLP:journals/corr/abs-2402-05421,
author = {Weikang Wan and
Yufei Wang and
Zackory Erickson and
David Held},
title = {DiffTOP: Differentiable Trajectory Optimization for Deep Reinforcement
and Imitation Learning},
journal = {CoRR},
volume = {abs/2402.05421},
year = {2024}
}
@article{DBLP:journals/corr/abs-2404-13478,
author = {Ben Eisner and
Yi Yang and
Todor Davchev and
Mel Vecer{\'{\i}}k and
Jonathan Scholz and
David Held},
title = {Deep SE(3)-Equivariant Geometric Reasoning for Precise Placement Tasks},
journal = {CoRR},
volume = {abs/2404.13478},
year = {2024}
}
@article{DBLP:journals/corr/abs-2405-04609,
author = {Jenny Wang and
Octavian Donca and
David Held},
title = {Learning Distributional Demonstration Spaces for Task-Specific Cross-Pose
Estimation},
journal = {CoRR},
volume = {abs/2405.04609},
year = {2024}
}
@article{DBLP:journals/corr/abs-2407-01361,
author = {Alberta Longhini and
Yufei Wang and
Irene Garcia{-}Camacho and
David Blanco{-}Mulero and
Marco Moletta and
Michael C. Welle and
Guillem Aleny{\`{a}} and
Hang Yin and
Zackory Erickson and
David Held and
J{\'{u}}lia Borr{\`{a}}s and
Danica Kragic},
title = {Unfolding the Literature: {A} Review of Robotic Cloth Manipulation},
journal = {CoRR},
volume = {abs/2407.01361},
year = {2024}
}
@article{DBLP:journals/corr/abs-2407-08585,
author = {Bowen Jiang and
Yilin Wu and
Wenxuan Zhou and
Chris Paxton and
David Held},
title = {HACMan++: Spatially-Grounded Motion Primitives for Manipulation},
journal = {CoRR},
volume = {abs/2407.08585},
year = {2024}
}
@article{DBLP:journals/neuroimage/ZhouLSANWDEMBWBRSDSF23,
author = {Zhen Zhou and
Hongming Li and
Dhivya Srinivasan and
Ahmed Abdulkadir and
Ilya M. Nasrallah and
Junhao Wen and
Jimit Doshi and
G{\"{u}}ray Erus and
Elizabeth Mamourian and
R. Nick Bryan and
David A. Wolk and
Lori L. Beason{-}Held and
Susan M. Resnick and
Theodore D. Satterthwaite and
Christos Davatzikos and
Haochang Shou and
Yong Fan},
title = {Multiscale functional connectivity patterns of the aging brain learned
from harmonized rsfMRI data of the multi-cohort iSTAGING study},
journal = {NeuroImage},
volume = {269},
pages = {119911},
year = {2023}
}
@article{DBLP:journals/pacmhci/BerkholzEBST23,
author = {Jenny Berkholz and
Margarita Esau{-}Held and
Alexander Boden and
Gunnar Stevens and
Peter Tolmie},
title = {Becoming an Online Wine Taster: An Ethnographic Study on the Digital
Mediation of Taste},
journal = {Proc. {ACM} Hum. Comput. Interact.},
volume = {7},
number = {{CSCW1}},
pages = {1--26},
year = {2023}
}
@inproceedings{DBLP:conf/corl/ZhangEH23,
author = {Harry Zhang and
Ben Eisner and
David Held},
title = {FlowBot++: Learning Generalized Articulated Objects Manipulation via
Articulation Projection},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {229},
pages = {1222--1241},
publisher = {{PMLR}},
year = {2023}
}
@inproceedings{DBLP:conf/corl/ZhouJYPH23,
author = {Wenxuan Zhou and
Bowen Jiang and
Fan Yang and
Chris Paxton and
David Held},
title = {HACMan: Learning Hybrid Actor-Critic Maps for 6D Non-Prehensile Manipulation},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {229},
pages = {241--265},
publisher = {{PMLR}},
year = {2023}
}
@inproceedings{DBLP:conf/cvpr/KhuranaHHR23,
author = {Tarasha Khurana and
Peiyun Hu and
David Held and
Deva Ramanan},
title = {Point Cloud Forecasting as a Proxy for 4D Occupancy Forecasting},
booktitle = {{CVPR}},
pages = {1116--1124},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/icra/ChenSSCKHG23,
author = {Lawrence Yunliang Chen and
Baiyu Shi and
Daniel Seita and
Richard Cheng and
Thomas Kollar and
David Held and
Ken Goldberg},
title = {AutoBag: Learning to Open Plastic Bags and Insert Objects},
booktitle = {{ICRA}},
pages = {3918--3925},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/icra/HuangLH23,
author = {Zixuan Huang and
Xingyu Lin and
David Held},
title = {Self-supervised Cloth Reconstruction via Action-conditioned Cloth
Tracking},
booktitle = {{ICRA}},
pages = {7111--7118},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/icra/LonghiniMRWHEK23,
author = {Alberta Longhini and
Marco Moletta and
Alfredo Reichlin and
Michael C. Welle and
David Held and
Zackory Erickson and
Danica Kragic},
title = {EDO-Net: Learning Elastic Properties of Deformable Objects from Graph
Dynamics},
booktitle = {{ICRA}},
pages = {3875--3881},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/icra/LonghiniMRWKWHEK23,
author = {Alberta Longhini and
Marco Moletta and
Alfredo Reichlin and
Michael C. Welle and
Alexander Kravberg and
Yufei Wang and
David Held and
Zackory Erickson and
Danica Kragic},
title = {Elastic Context: Encoding Elasticity for Data-driven Models of Textiles
Elastic Context: Encoding Elasticity for Data-driven Models of Textiles},
booktitle = {{ICRA}},
pages = {1764--1770},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/icra/WengHMM23,
author = {Thomas Weng and
David Held and
Franziska Meier and
Mustafa Mukadam},
title = {Neural Grasp Distance Fields for Robot Manipulation},
booktitle = {{ICRA}},
pages = {1814--1821},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/igarss/BrightAHMMTCDFGHJKPRSW23,
author = {Courtney Bright and
David Ardila and
Erin L. Hestir and
Timothy J. Malthus and
Mark William Matthews and
David R. Thompson and
Nick Carter and
Arnold G. Dekker and
Renato Prata de Moraes Frasson and
Robert O. Green and
Alex Held and
Klaus Joehnk and
Jeremy Kravitz and
Joshua Pease and
Chris M. Roelfsema and
Carl Seubert and
Bozena Wojtasiewicz},
title = {The AquaSat-1 Mission Concept: Actionable Information on Water Quality
and Aquatic Ecosystems for Australia and Western {USA}},
booktitle = {{IGARSS}},
pages = {4590--4593},
publisher = {{IEEE}},
year = {2023}
}
@inproceedings{DBLP:conf/iros/ChenSLSACKHG23,
author = {Lawrence Yunliang Chen and
Baiyu Shi and
Roy Lin and
Daniel Seita and
Ayah Ahmad and
Richard Cheng and
Thomas Kollar and
David Held and
Ken Goldberg},
title = {Bagging by Learning to Singulate Layers Using Interactive Perception},
booktitle = {{IROS}},
pages = {3176--3183},
year = {2023}
}
@inproceedings{DBLP:conf/rss/AnchaPZNH23,
author = {Siddharth Ancha and
Gaurav Pathak and
Ji Zhang and
Srinivasa G. Narasimhan and
David Held},
title = {Active Velocity Estimation using Light Curtains via Self-Supervised
Multi-Armed Bandits},
booktitle = {Robotics: Science and Systems},
year = {2023}
}
@inproceedings{DBLP:conf/rss/WangSEH23,
author = {Yufei Wang and
Zhanyi Sun and
Zackory Erickson and
David Held},
title = {One Policy to Dress Them All: Learning to Dress People with Diverse
Poses and Garments},
booktitle = {Robotics: Science and Systems},
year = {2023}
}
@proceedings{DBLP:conf/sashimi-ws/2023,
editor = {Jelmer M. Wolterink and
David Svoboda and
Can Zhao and
Virginia Fernandez},
title = {Simulation and Synthesis in Medical Imaging - 8th International Workshop,
{SASHIMI} 2023, Held in Conjunction with {MICCAI} 2023, Vancouver,
BC, Canada, October 8, 2023, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {14288},
publisher = {Springer},
year = {2023}
}
@article{DBLP:journals/corr/abs-2302-09502,
author = {Zixuan Huang and
Xingyu Lin and
David Held},
title = {Self-supervised Cloth Reconstruction via Action-conditioned Cloth
Tracking},
journal = {CoRR},
volume = {abs/2302.09502},
year = {2023}
}
@article{DBLP:journals/corr/abs-2302-12597,
author = {Siddharth Ancha and
Gaurav Pathak and
Ji Zhang and
Srinivasa G. Narasimhan and
David Held},
title = {Active Velocity Estimation using Light Curtains via Self-Supervised
Multi-Armed Bandits},
journal = {CoRR},
volume = {abs/2302.12597},
year = {2023}
}
@article{DBLP:journals/corr/abs-2302-13130,
author = {Tarasha Khurana and
Peiyun Hu and
David Held and
Deva Ramanan},
title = {Point Cloud Forecasting as a Proxy for 4D Occupancy Forecasting},
journal = {CoRR},
volume = {abs/2302.13130},
year = {2023}
}
@article{DBLP:journals/corr/abs-2303-16898,
author = {Lawrence Yunliang Chen and
Baiyu Shi and
Roy Lin and
Daniel Seita and
Ayah Ahmad and
Richard Cheng and
Thomas Kollar and
David Held and
Ken Goldberg},
title = {Bagging by Learning to Singulate Layers Using Interactive Perception},
journal = {CoRR},
volume = {abs/2303.16898},
year = {2023}
}
@article{DBLP:journals/corr/abs-2305-03942,
author = {Wenxuan Zhou and
Bowen Jiang and
Fan Yang and
Chris Paxton and
David Held},
title = {Learning Hybrid Actor-Critic Maps for 6D Non-Prehensile Manipulation},
journal = {CoRR},
volume = {abs/2305.03942},
year = {2023}
}
@article{DBLP:journals/corr/abs-2306-12372,
author = {Yufei Wang and
Zhanyi Sun and
Zackory Erickson and
David Held},
title = {One Policy to Dress Them All: Learning to Dress People with Diverse
Poses and Garments},
journal = {CoRR},
volume = {abs/2306.12372},
year = {2023}
}
@article{DBLP:journals/corr/abs-2306-12893,
author = {Harry Zhang and
Ben Eisner and
David Held},
title = {FlowBot++: Learning Generalized Articulated Objects Manipulation via
Articulation Projection},
journal = {CoRR},
volume = {abs/2306.12893},
year = {2023}
}
@article{DBLP:journals/corr/abs-2310-00156,
author = {Carl Qi and
Sarthak J. Shetty and
Xingyu Lin and
David Held},
title = {Learning Generalizable Tool-use Skills through Trajectory Generation},
journal = {CoRR},
volume = {abs/2310.00156},
year = {2023}
}
@article{DBLP:journals/corr/abs-2310-06903,
author = {Fan Yang and
Wenxuan Zhou and
Zuxin Liu and
Ding Zhao and
David Held},
title = {Reinforcement Learning in a Safety-Embedded {MDP} with Trajectory
Optimization},
journal = {CoRR},
volume = {abs/2310.06903},
year = {2023}
}
@article{DBLP:journals/corr/abs-2311-01455,
author = {Yufei Wang and
Zhou Xian and
Feng Chen and
Tsun{-}Hsuan Wang and
Yian Wang and
Zackory Erickson and
David Held and
Chuang Gan},
title = {RoboGen: Towards Unleashing Infinite Data for Automated Robot Learning
via Generative Simulation},
journal = {CoRR},
volume = {abs/2311.01455},
year = {2023}
}
@article{DBLP:journals/corr/abs-2311-04390,
author = {Zhanyi Sun and
Yufei Wang and
David Held and
Zackory Erickson},
title = {Force-Constrained Visual Policy: Safe Robot-Assisted Dressing via
Multi-Modal Sensing},
journal = {CoRR},
volume = {abs/2311.04390},
year = {2023}
}
@article{DBLP:journals/corr/abs-2312-02467,
author = {Pranay Gupta and
Abhijat Biswas and
Henny Admoni and
David Held},
title = {Object Importance Estimation using Counterfactual Reasoning for Intelligent
Driving},
journal = {CoRR},
volume = {abs/2312.02467},
year = {2023}
}
@article{DBLP:journals/ijmssc/BelemSSSO22,
author = {John David S. Bel{\'{e}}m and
Hidalyn Theodory C. M. Souza and
Alvaro Sobrinho and
Lenardo Chaves e Silva and
Helder F. de A. Oliveira},
title = {Modeling unmanned aerial vehicle system for identifying foci of arboviral
disease with monitoring system},
journal = {Int. J. Model. Simul. Sci. Comput.},
volume = {13},
number = {3},
pages = {2250015:1--2250015:23},
year = {2022}
}
@article{DBLP:journals/ral/GuOH22,
author = {Qiao Gu and
Brian Okorn and
David Held},
title = {{OSSID:} Online Self-Supervised Instance Detection by (And For) Pose
Estimation},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {7},
number = {2},
pages = {3022--3029},
year = {2022}
}
@article{DBLP:journals/ral/QiLH22,
author = {Carl Qi and
Xingyu Lin and
David Held},
title = {Learning Closed-Loop Dough Manipulation Using a Differentiable Reset
Module},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {7},
number = {4},
pages = {9864--9871},
year = {2022}
}
@article{DBLP:journals/ral/WangHE22,
author = {Yufei Wang and
David Held and
Zackory Erickson},
title = {Visual Haptic Reasoning: Estimating Contact Forces by Observing Deformable
Object Interactions},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {7},
number = {4},
pages = {11426--11433},
year = {2022}
}
@article{DBLP:journals/sensors/PardisGDSBPL22,
author = {William Pardis and
Kalina C. Grabb and
Michael D. DeGrandpre and
Reggie Spaulding and
James Beck and
Jonathan A. Pfeifer and
David M. Long},
title = {Measuring Protons with Photons: {A} Hand-Held, Spectrophotometric
pH Analyzer for Ocean Acidification Research, Community Science and
Education},
journal = {Sensors},
volume = {22},
number = {20},
pages = {7924},
year = {2022}
}
@article{DBLP:journals/tbe/QinWBGZDC22,
author = {Xi Qin and
Bohan Wang and
David Boegner and
Brandon Gaitan and
Yingning Zheng and
Xian Du and
Yu Chen},
title = {Indoor Localization of Hand-Held {OCT} Probe Using Visual Odometry
and Real-Time Segmentation Using Deep Learning},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {69},
number = {4},
pages = {1378--1385},
year = {2022}
}
@article{DBLP:journals/tse/KuhrmannTHKMLPF22,
author = {Marco Kuhrmann and
Paolo Tell and
Regina Hebig and
Jil Kl{\"{u}}nder and
J{\"{u}}rgen M{\"{u}}nch and
Oliver Linssen and
Dietmar Pfahl and
Michael Felderer and
Christian R. Prause and
Stephen G. MacDonell and
Joyce Nakatumba{-}Nabende and
David Raffo and
Sarah Beecham and
Eray T{\"{u}}z{\"{u}}n and
Gustavo L{\'{o}}pez and
Nicol{\'{a}}s Paez and
Diego Fontdevila and
Sherlock A. Licorish and
Steffen K{\"{u}}pper and
G{\"{u}}nther Ruhe and
Eric Knauss and
{\"{O}}zden {\"{O}}zcan{-}Top and
Paul M. Clarke and
Fergal McCaffery and
Marcela Genero and
Aurora Vizca{\'{\i}}no and
Mario Piattini and
Marcos Kalinowski and
Tayana Conte and
Rafael Prikladnicki and
Stephan Krusche and
Ahmet Coskun{\c{c}}ay and
Ezequiel Scott and
Fabio Calefato and
Svetlana Pimonova and
Rolf{-}Helge Pfeiffer and
Ulrik Pagh Schultz and
Rogardt Heldal and
Masud Fazal{-}Baqaie and
Craig Anslow and
Maleknaz Nayebi and
Kurt Schneider and
Stefan Sauer and
Dietmar Winkler and
Stefan Biffl and
Mar{\'{\i}}a Cecilia Bastarrica and
Ita Richardson},
title = {What Makes Agile Software Development Agile?},
journal = {{IEEE} Trans. Software Eng.},
volume = {48},
number = {9},
pages = {3523--3539},
year = {2022}
}
@inproceedings{DBLP:conf/corl/LinQZHFLGH22,
author = {Xingyu Lin and
Carl Qi and
Yunchu Zhang and
Zhiao Huang and
Katerina Fragkiadaki and
Yunzhu Li and
Chuang Gan and
David Held},
title = {Planning with Spatial-Temporal Abstraction from Point Clouds for Deformable
Object Manipulation},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {205},
pages = {1640--1651},
publisher = {{PMLR}},
year = {2022}
}
@inproceedings{DBLP:conf/corl/OkornPHH22,
author = {Brian Okorn and
Chuer Pan and
Martial Hebert and
David Held},
title = {Deep Projective Rotation Estimation through Relative Supervision},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {205},
pages = {1575--1585},
publisher = {{PMLR}},
year = {2022}
}
@inproceedings{DBLP:conf/corl/PanOZEH22,
author = {Chuer Pan and
Brian Okorn and
Harry Zhang and
Ben Eisner and
David Held},
title = {TAX-Pose: Task-Specific Cross-Pose Estimation for Robot Manipulation},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {205},
pages = {1783--1792},
publisher = {{PMLR}},
year = {2022}
}
@inproceedings{DBLP:conf/corl/SeitaWSLEH22,
author = {Daniel Seita and
Yufei Wang and
Sarthak J. Shetty and
Edward Yao Li and
Zackory Erickson and
David Held},
title = {ToolFlowNet: Robotic Manipulation with Tools via Predicting Tool Flow
from Point Clouds},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {205},
pages = {1038--1049},
publisher = {{PMLR}},
year = {2022}
}
@inproceedings{DBLP:conf/corl/ZhouH22,
author = {Wenxuan Zhou and
David Held},
title = {Learning to Grasp the Ungraspable with Emergent Extrinsic Dexterity},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {205},
pages = {150--160},
publisher = {{PMLR}},
year = {2022}
}
@inproceedings{DBLP:conf/eccv/KhuranaHDZHR22,
author = {Tarasha Khurana and
Peiyun Hu and
Achal Dave and
Jason Ziglar and
David Held and
Deva Ramanan},
title = {Differentiable Raycasting for Self-Supervised Occupancy Forecasting},
booktitle = {{ECCV} {(38)}},
series = {Lecture Notes in Computer Science},
volume = {13698},
pages = {353--369},
publisher = {Springer},
year = {2022}
}
@inproceedings{DBLP:conf/iclr/LinHLTHG22,
author = {Xingyu Lin and
Zhiao Huang and
Yunzhu Li and
Joshua B. Tenenbaum and
David Held and
Chuang Gan},
title = {DiffSkill: Skill Abstraction from Differentiable Physics for Deformable
Object Manipulations with Tools},
booktitle = {{ICLR}},
publisher = {OpenReview.net},
year = {2022}
}
@inproceedings{DBLP:conf/icra/NarasimhanZELH22,
author = {Gautham Narayan Narasimhan and
Kai Zhang and
Ben Eisner and
Xingyu Lin and
David Held},
title = {Self-supervised Transparent Liquid Segmentation for Robotic Pouring},
booktitle = {{ICRA}},
pages = {4555--4561},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/iros/TirumalaWSKTH22,
author = {Sashank Tirumala and
Thomas Weng and
Daniel Seita and
Oliver Kroemer and
Fatma Zeynep Temel and
David Held},
title = {Learning to Singulate Layers of Cloth using Tactile Feedback},
booktitle = {{IROS}},
pages = {7773--7780},
publisher = {{IEEE}},
year = {2022}
}
@inproceedings{DBLP:conf/ispd/PosserYHLP22,
author = {Gracieli Posser and
Evangeline F. Y. Young and
Stephan Held and
Yih{-}Lang Li and
David Z. Pan},
title = {Challenges and Approaches in {VLSI} Routing},
booktitle = {{ISPD}},
pages = {185--192},
publisher = {{ACM}},
year = {2022}
}
@inproceedings{DBLP:conf/mm/0003STVBGMFRSM22,
author = {Rafael Ferreira and
Diogo Silva and
Diogo Tavares and
Frederico Vicente and
Mariana Bonito and
Gustavo Gon{\c{c}}alves and
Rui Margarido and
Paula Figueiredo and
Helder Rodrigues and
David Semedo and
Jo{\~{a}}o Magalh{\~{a}}es},
title = {{TWIZ:} The Multimodal Conversational Task Wizard},
booktitle = {{ACM} Multimedia},
pages = {6997--6999},
publisher = {{ACM}},
year = {2022}
}
@inproceedings{DBLP:conf/rss/EisnerZH22,
author = {Ben Eisner and
Harry Zhang and
David Held},
title = {FlowBot3D: Learning 3D Articulation Flow to Manipulate Articulated
Objects},
booktitle = {Robotics: Science and Systems},
year = {2022}
}
@inproceedings{DBLP:conf/rss/HuangLH22,
author = {Zixuan Huang and
Xingyu Lin and
David Held},
title = {Mesh-based Dynamics with Occlusion Reasoning for Cloth Manipulation},
booktitle = {Robotics: Science and Systems},
year = {2022}
}
@proceedings{DBLP:conf/dais/2022,
editor = {David M. Eyers and
Spyros Voulgaris},
title = {Distributed Applications and Interoperable Systems: 22nd {IFIP} {WG}
6.1 International Conference, {DAIS} 2022, Held as Part of the 17th
International Federated Conference on Distributed Computing Techniques,
DisCoTec 2022, Lucca, Italy, June 13-17, 2022, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13272},
publisher = {Springer},
year = {2022}
}
@proceedings{DBLP:conf/miccai/2021midog,
editor = {Marc Aubreville and
David Zimmerer and
Mattias P. Heinrich},
title = {Biomedical Image Registration, Domain Generalisation and Out-of-Distribution
Analysis - {MICCAI} 2021 Challenges: {MIDOG} 2021, {MOOD} 2021, and
Learn2Reg 2021, Held in Conjunction with {MICCAI} 2021, Strasbourg,
France, September 27 - October 1, 2021, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13166},
publisher = {Springer},
year = {2022}
}
@proceedings{DBLP:conf/miccai/2022isgie,
editor = {Luigi Manfredi and
Seyed{-}Ahmad Ahmadi and
Michael M. Bronstein and
Anees Kazi and
Davide Lomanto and
Alwyn Mathew and
Ludovic Magerand and
Kamilia Mullakaeva and
Bartlomiej W. Papiez and
Russell H. Taylor and
Emanuele Trucco},
title = {Imaging Systems for {GI} Endoscopy, and Graphs in Biomedical Image
Analysis - First {MICCAI} Workshop, {ISGIE} 2022, and Fourth {MICCAI}
Workshop, {GRAIL} 2022, Held in Conjunction with {MICCAI} 2022, Singapore,
September 18, 2022, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13754},
publisher = {Springer},
year = {2022}
}
@proceedings{DBLP:conf/miccai/2022sashimi,
editor = {Can Zhao and
David Svoboda and
Jelmer M. Wolterink and
Mar{\'{\i}}a Escobar},
title = {Simulation and Synthesis in Medical Imaging - 7th International Workshop,
{SASHIMI} 2022, Held in Conjunction with {MICCAI} 2022, Singapore,
September 18, 2022, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13570},
publisher = {Springer},
year = {2022}
}
@article{DBLP:journals/corr/abs-2201-07309,
author = {Qiao Gu and
Brian Okorn and
David Held},
title = {{OSSID:} Online Self-Supervised Instance Detection by (and for) Pose
Estimation},
journal = {CoRR},
volume = {abs/2201.07309},
year = {2022}
}
@article{DBLP:journals/corr/abs-2202-00182,
author = {Jianren Wang and
Haiming Gang and
Siddarth Ancha and
Yi{-}Ting Chen and
David Held},
title = {Semi-supervised 3D Object Detection via Temporal Graph Neural Networks},
journal = {CoRR},
volume = {abs/2202.00182},
year = {2022}
}
@article{DBLP:journals/corr/abs-2203-01538,
author = {Gautham Narayan Narasimhan and
Kai Zhang and
Ben Eisner and
Xingyu Lin and
David Held},
title = {Self-supervised Transparent Liquid Segmentation for Robotic Pouring},
journal = {CoRR},
volume = {abs/2203.01538},
year = {2022}
}
@article{DBLP:journals/corr/abs-2203-08098,
author = {Sudeep Dasari and
Jianren Wang and
Joyce Hong and
Shikhar Bahl and
Yixin Lin and
Austin S. Wang and
Abitha Thankaraj and
Karanbir Chahal and
Berk {\c{C}}alli and
Saurabh Gupta and
David Held and
Lerrel Pinto and
Deepak Pathak and
Vikash Kumar and
Abhinav Gupta},
title = {{RB2:} Robotic Manipulation Benchmarking with a Twist},
journal = {CoRR},
volume = {abs/2203.08098},
year = {2022}
}
@article{DBLP:journals/corr/abs-2203-17275,
author = {Xingyu Lin and
Zhiao Huang and
Yunzhu Li and
Joshua B. Tenenbaum and
David Held and
Chuang Gan},
title = {DiffSkill: Skill Abstraction from Differentiable Physics for Deformable
Object Manipulations with Tools},
journal = {CoRR},
volume = {abs/2203.17275},
year = {2022}
}
@article{DBLP:journals/corr/abs-2205-04382,
author = {Ben Eisner and
Harry Zhang and
David Held},
title = {FlowBot3D: Learning 3D Articulation Flow to Manipulate Articulated
Objects},
journal = {CoRR},
volume = {abs/2205.04382},
year = {2022}
}
@article{DBLP:journals/corr/abs-2206-02881,
author = {Zixuan Huang and
Xingyu Lin and
David Held},
title = {Mesh-based Dynamics with Occlusion Reasoning for Cloth Manipulation},
journal = {CoRR},
volume = {abs/2206.02881},
year = {2022}
}
@article{DBLP:journals/corr/abs-2207-04638,
author = {Carl Qi and
Xingyu Lin and
David Held},
title = {Learning Closed-loop Dough Manipulation Using a Differentiable Reset
Module},
journal = {CoRR},
volume = {abs/2207.04638},
year = {2022}
}
@article{DBLP:journals/corr/abs-2207-07033,
author = {Vijay Gadepally and
Gregory Angelides and
Andrei Barbu and
Andrew Bowne and
Laura J. Brattain and
Tamara Broderick and
Armando Cabrera and
Glenn Carl and
Ronisha Carter and
Miriam Cha and
Emilie Cowen and
Jesse Cummings and
Bill Freeman and
James R. Glass and
Sam Goldberg and
Mark Hamilton and
Thomas Heldt and
Kuan Wei Huang and
Phillip Isola and
Boris Katz and
Jamie Koerner and
Yen{-}Chen Lin and
David Mayo and
Kyle McAlpin and
Taylor Perron and
Jean E. Piou and
Hrishikesh M. Rao and
Hayley Reynolds and
Kaira Samuel and
Siddharth Samsi and
Morgan Schmidt and
Leslie Shing and
Olga Simek and
Brandon Swenson and
Vivienne Sze and
Jonathan Taylor and
Paul Tylkin and
Mark Veillette and
Matthew L. Weiss and
Allan B. Wollaber and
Sophia Yuditskaya and
Jeremy Kepner},
title = {Developing a Series of {AI} Challenges for the United States Department
of the Air Force},
journal = {CoRR},
volume = {abs/2207.07033},
year = {2022}
}
@article{DBLP:journals/corr/abs-2207-11196,
author = {Sashank Tirumala and
Thomas Weng and
Daniel Seita and
Oliver Kroemer and
Fatma Zeynep Temel and
David Held},
title = {Learning to Singulate Layers of Cloth using Tactile Feedback},
journal = {CoRR},
volume = {abs/2207.11196},
year = {2022}
}
@article{DBLP:journals/corr/abs-2208-05632,
author = {Yufei Wang and
David Held and
Zackory Erickson},
title = {Visual Haptic Reasoning: Estimating Contact Forces by Observing Deformable
Object Interactions},
journal = {CoRR},
volume = {abs/2208.05632},
year = {2022}
}
@article{DBLP:journals/corr/abs-2209-05428,
author = {Alberta Longhini and
Marco Moletta and
Alfredo Reichlin and
Michael C. Welle and
Alexander Kravberg and
Yufei Wang and
David Held and
Zackory Erickson and
Danica Kragic},
title = {Elastic Context: Encoding Elasticity for Data-driven Models of Textiles},
journal = {CoRR},
volume = {abs/2209.05428},
year = {2022}
}
@article{DBLP:journals/corr/abs-2209-08996,
author = {Alberta Longhini and
Marco Moletta and
Alfredo Reichlin and
Michael C. Welle and
David Held and
Zackory Erickson and
Danica Kragic},
title = {EDO-Net: Learning Elastic Properties of Deformable Objects from Graph
Dynamics},
journal = {CoRR},
volume = {abs/2209.08996},
year = {2022}
}
@article{DBLP:journals/corr/abs-2210-01917,
author = {Tarasha Khurana and
Peiyun Hu and
Achal Dave and
Jason Ziglar and
David Held and
Deva Ramanan},
title = {Differentiable Raycasting for Self-supervised Occupancy Forecasting},
journal = {CoRR},
volume = {abs/2210.01917},
year = {2022}
}
@article{DBLP:journals/corr/abs-2210-15751,
author = {Xingyu Lin and
Carl Qi and
Yunchu Zhang and
Zhiao Huang and
Katerina Fragkiadaki and
Yunzhu Li and
Chuang Gan and
David Held},
title = {Planning with Spatial-Temporal Abstraction from Point Clouds for Deformable
Object Manipulation},
journal = {CoRR},
volume = {abs/2210.15751},
year = {2022}
}
@article{DBLP:journals/corr/abs-2210-17217,
author = {Lawrence Yunliang Chen and
Baiyu Shi and
Daniel Seita and
Richard Cheng and
Thomas Kollar and
David Held and
Ken Goldberg},
title = {AutoBag: Learning to Open Plastic Bags and Insert Objects},
journal = {CoRR},
volume = {abs/2210.17217},
year = {2022}
}
@article{DBLP:journals/corr/abs-2211-01500,
author = {Wenxuan Zhou and
David Held},
title = {Learning to Grasp the Ungraspable with Emergent Extrinsic Dexterity},
journal = {CoRR},
volume = {abs/2211.01500},
year = {2022}
}
@article{DBLP:journals/corr/abs-2211-02647,
author = {Thomas Weng and
David Held and
Franziska Meier and
Mustafa Mukadam},
title = {Neural Grasp Distance Fields for Robot Manipulation},
journal = {CoRR},
volume = {abs/2211.02647},
year = {2022}
}
@article{DBLP:journals/corr/abs-2211-09006,
author = {Daniel Seita and
Yufei Wang and
Sarthak J. Shetty and
Edward Yao Li and
Zackory Erickson and
David Held},
title = {ToolFlowNet: Robotic Manipulation with Tools via Predicting Tool Flow
from Point Clouds},
journal = {CoRR},
volume = {abs/2211.09006},
year = {2022}
}
@article{DBLP:journals/corr/abs-2211-09325,
author = {Chuer Pan and
Brian Okorn and
Harry Zhang and
Ben Eisner and
David Held},
title = {TAX-Pose: Task-Specific Cross-Pose Estimation for Robot Manipulation},
journal = {CoRR},
volume = {abs/2211.09325},
year = {2022}
}
@article{DBLP:journals/corr/abs-2211-11182,
author = {Brian Okorn and
Chuer Pan and
Martial Hebert and
David Held},
title = {Deep Projective Rotation Estimation through Relative Supervision},
journal = {CoRR},
volume = {abs/2211.11182},
year = {2022}
}
@article{DBLP:journals/remotesensing/WuMPS21,
author = {Bang Wu and
Chengqi Ma and
Stefan Poslad and
David R. Selviah},
title = {An Adaptive Human Activity-Aided Hand-Held Smartphone-Based Pedestrian
Dead Reckoning Positioning System},
journal = {Remote. Sens.},
volume = {13},
number = {11},
pages = {2137},
year = {2021}
}
@inproceedings{DBLP:conf/3dim/WangGACH21,
author = {Jianren Wang and
Haiming Gang and
Siddarth Ancha and
Yi{-}Ting Chen and
David Held},
title = {Semi-supervised 3D Object Detection via Temporal Graph Neural Networks},
booktitle = {3DV},
pages = {413--422},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/aies/KelleyYHMSKNW21,
author = {Patrick Gage Kelley and
Yongwei Yang and
Courtney Heldreth and
Christopher Moessner and
Aaron Sedley and
Andreas Kramm and
David T. Newman and
Allison Woodruff},
title = {Exciting, Useful, Worrying, Futuristic: Public Perception of Artificial
Intelligence in 8 Countries},
booktitle = {{AIES}},
pages = {627--637},
publisher = {{ACM}},
year = {2021}
}
@inproceedings{DBLP:conf/bmvc/MittalOJH21,
author = {Himangi Mittal and
Brian Okorn and
Arpit Jangid and
David Held},
title = {Self-Supervised Point Cloud Completion via Inpainting},
booktitle = {{BMVC}},
pages = {7},
publisher = {{BMVA} Press},
year = {2021}
}
@inproceedings{DBLP:conf/corl/LinWHH21,
author = {Xingyu Lin and
Yufei Wang and
Zixuan Huang and
David Held},
title = {Learning Visible Connectivity Dynamics for Cloth Smoothing},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {164},
pages = {256--266},
publisher = {{PMLR}},
year = {2021}
}
@inproceedings{DBLP:conf/corl/SikchiZH21,
author = {Harshit Sikchi and
Wenxuan Zhou and
David Held},
title = {Learning Off-Policy with Online Planning},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {164},
pages = {1622--1633},
publisher = {{PMLR}},
year = {2021}
}
@inproceedings{DBLP:conf/corl/WengBWAH21,
author = {Thomas Weng and
Sujay Man Bajracharya and
Yufei Wang and
Khush Agrawal and
David Held},
title = {FabricFlowNet: Bimanual Cloth Manipulation with a Flow-based Policy},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {164},
pages = {192--202},
publisher = {{PMLR}},
year = {2021}
}
@inproceedings{DBLP:conf/cvpr/HuHDHR21,
author = {Peiyun Hu and
Aaron Huang and
John M. Dolan and
David Held and
Deva Ramanan},
title = {Safe Local Motion Planning With Self-Supervised Freespace Forecasting},
booktitle = {{CVPR}},
pages = {12732--12741},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/cvpr/RaajATHN21,
author = {Yaadhav Raaj and
Siddharth Ancha and
Robert Tamburo and
David Held and
Srinivasa G. Narasimhan},
title = {Exploiting {\&} Refining Depth Distributions With Triangulation
Light Curtains},
booktitle = {{CVPR}},
pages = {7434--7442},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/icra/OkornGHH21,
author = {Brian Okorn and
Qiao Gu and
Martial Hebert and
David Held},
title = {ZePHyR: Zero-shot Pose Hypothesis Rating},
booktitle = {{ICRA}},
pages = {14141--14148},
publisher = {{IEEE}},
year = {2021}
}
@inproceedings{DBLP:conf/nips/DasariWHBLWTCC021,
author = {Sudeep Dasari and
Jianren Wang and
Joyce Hong and
Shikhar Bahl and
Yixin Lin and
Austin S. Wang and
Abitha Thankaraj and
Karanbir Chahal and
Berk {\c{C}}alli and
Saurabh Gupta and
David Held and
Lerrel Pinto and
Deepak Pathak and
Vikash Kumar and
Abhinav Gupta},
title = {{RB2:} Robotic Manipulation Benchmarking with a Twist},
booktitle = {NeurIPS Datasets and Benchmarks},
year = {2021}
}
@inproceedings{DBLP:conf/rss/AnchaPNH21,
author = {Siddharth Ancha and
Gaurav Pathak and
Srinivasa G. Narasimhan and
David Held},
title = {Active Safety Envelopes using Light Curtains with Probabilistic Guarantees},
booktitle = {Robotics: Science and Systems},
year = {2021}
}
@proceedings{DBLP:conf/miccai/2021sashimi,
editor = {David Svoboda and
Ninon Burgos and
Jelmer M. Wolterink and
Can Zhao},
title = {Simulation and Synthesis in Medical Imaging - 6th International Workshop,
{SASHIMI} 2021, Held in Conjunction with {MICCAI} 2021, Strasbourg,
France, September 27, 2021, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12965},
publisher = {Springer},
year = {2021}
}
@article{DBLP:journals/corr/abs-2103-09230,
author = {Harshit Sikchi and
Wenxuan Zhou and
David Held},
title = {Lyapunov Barrier Policy Optimization},
journal = {CoRR},
volume = {abs/2103.09230},
year = {2021}
}
@article{DBLP:journals/corr/abs-2104-13526,
author = {Brian Okorn and
Qiao Gu and
Martial Hebert and
David Held},
title = {ZePHyR: Zero-shot Pose Hypothesis Rating},
journal = {CoRR},
volume = {abs/2104.13526},
year = {2021}
}
@article{DBLP:journals/corr/abs-2105-10389,
author = {Xingyu Lin and
Yufei Wang and
David Held},
title = {Learning Visible Connectivity Dynamics for Cloth Smoothing},
journal = {CoRR},
volume = {abs/2105.10389},
year = {2021}
}
@article{DBLP:journals/corr/abs-2107-04000,
author = {Siddharth Ancha and
Gaurav Pathak and
Srinivasa G. Narasimhan and
David Held},
title = {Active Safety Envelopes using Light Curtains with Probabilistic Guarantees},
journal = {CoRR},
volume = {abs/2107.04000},
year = {2021}
}
@article{DBLP:journals/corr/abs-2108-13979,
author = {Kristina Dingel and
Thorsten Otto and
Lutz Marder and
Lars Funke and
Arne Held and
Sara Savio and
Andreas Hans and
Gregor Hartmann and
David Meier and
Jens Viefhaus and
Bernhard Sick and
Arno Ehresmann and
Markus Ilchen and
Wolfram Helml},
title = {Toward AI-enhanced online-characterization and shaping of ultrashort
X-ray free-electron laser pulses},
journal = {CoRR},
volume = {abs/2108.13979},
year = {2021}
}
@article{DBLP:journals/corr/abs-2109-11435,
author = {Marco Kuhrmann and
Paolo Tell and
Regina Hebig and
Jil Kl{\"{u}}nder and
J{\"{u}}rgen M{\"{u}}nch and
Oliver Linssen and
Dietmar Pfahl and
Michael Felderer and
Christian R. Prause and
Stephen G. MacDonell and
Joyce Nakatumba{-}Nabende and
David Raffo and
Sarah Beecham and
Eray T{\"{u}}z{\"{u}}n and
Gustavo L{\'{o}}pez and
Nicol{\'{a}}s Paez and
Diego Fontdevila and
Sherlock A. Licorish and
Steffen K{\"{u}}pper and
G{\"{u}}nther Ruhe and
Eric Knauss and
{\"{O}}zden {\"{O}}zcan{-}Top and
Paul M. Clarke and
Fergal McCaffery and
Marcela Genero and
Aurora Vizca{\'{\i}}no and
Mario Piattini and
Marcos Kalinowski and
Tayana Conte and
Rafael Prikladnicki and
Stephan Krusche and
Ahmet Coskun{\c{c}}ay and
Ezequiel Scott and
Fabio Calefato and
Svetlana Pimonova and
Rolf{-}Helge Pfeiffer and
Ulrik Pagh Schultz and
Rogardt Heldal and
Masud Fazal{-}Baqaie and
Craig Anslow and
Maleknaz Nayebi and
Kurt Schneider and
Stefan Sauer and
Dietmar Winkler and
Stefan Biffl and
Mar{\'{\i}}a Cecilia Bastarrica and
Ita Richardson},
title = {What Makes Agile Software Development Agile?},
journal = {CoRR},
volume = {abs/2109.11435},
year = {2021}
}
@article{DBLP:journals/corr/abs-2111-05623,
author = {Thomas Weng and
Sujay Bajracharya and
Yufei Wang and
Khush Agrawal and
David Held},
title = {FabricFlowNet: Bimanual Cloth Manipulation with a Flow-based Policy},
journal = {CoRR},
volume = {abs/2111.05623},
year = {2021}
}
@article{DBLP:journals/corr/abs-2111-10701,
author = {Himangi Mittal and
Brian Okorn and
Arpit Jangid and
David Held},
title = {Self-Supervised Point Cloud Completion via Inpainting},
journal = {CoRR},
volume = {abs/2111.10701},
year = {2021}
}
@article{DBLP:journals/ral/HuHR20,
author = {Peiyun Hu and
David Held and
Deva Ramanan},
title = {Learning to Optimally Segment Point Clouds},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {5},
number = {2},
pages = {875--882},
year = {2020}
}
@article{DBLP:journals/ral/WengPTKH20,
author = {Thomas Weng and
Amith Pallankize and
Yimin Tang and
Oliver Kroemer and
David Held},
title = {Multi-Modal Transfer Learning for Grasping Transparent and Specular
Objects},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {5},
number = {3},
pages = {3796--3803},
year = {2020}
}
@article{DBLP:journals/remotesensing/HelderDBCB20,
author = {Dennis L. Helder and
David R. Doelling and
Rajendra Bhatt and
Taeyoung Choi and
Julia A. Barsi},
title = {Calibrating Geosynchronous and Polar Orbiting Satellites: Sharing
Best Practices},
journal = {Remote. Sens.},
volume = {12},
number = {17},
pages = {2786},
year = {2020}
}
@article{DBLP:journals/tbe/WadehnWMHL20,
author = {Federico Wadehn and
Thilo Weber and
David J. Mack and
Thomas Heldt and
Hans{-}Andrea Loeliger},
title = {Model-Based Separation, Detection, and Classification of Eye Movements},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {67},
number = {2},
pages = {588--600},
year = {2020}
}
@inproceedings{DBLP:conf/3dim/ChenWHH20,
author = {Xia Chen and
Jianren Wang and
David Held and
Martial Hebert},
title = {PanoNet3D: Combining Semantic and Geometric Understanding for LiDAR
Point Cloud Detection},
booktitle = {3DV},
pages = {753--761},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/corl/LinWOH20,
author = {Xingyu Lin and
Yufei Wang and
Jake Olkin and
David Held},
title = {SoftGym: Benchmarking Deep Reinforcement Learning for Deformable Object
Manipulation},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {155},
pages = {432--448},
publisher = {{PMLR}},
year = {2020}
}
@inproceedings{DBLP:conf/corl/WangNLOH20,
author = {Yufei Wang and
Gautham Narayan Narasimhan and
Xingyu Lin and
Brian Okorn and
David Held},
title = {{ROLL:} Visual Self-Supervised Reinforcement Learning with Object
Reasoning},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {155},
pages = {1030--1048},
publisher = {{PMLR}},
year = {2020}
}
@inproceedings{DBLP:conf/corl/ZhouBH20,
author = {Wenxuan Zhou and
Sujay Bajracharya and
David Held},
title = {{PLAS:} Latent Action Space for Offline Reinforcement Learning},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {155},
pages = {1719--1735},
publisher = {{PMLR}},
year = {2020}
}
@inproceedings{DBLP:conf/cvpr/HuZHR20,
author = {Peiyun Hu and
Jason Ziglar and
David Held and
Deva Ramanan},
title = {What You See is What You Get: Exploiting Visibility for 3D Object
Detection},
booktitle = {{CVPR}},
pages = {10998--11006},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/cvpr/MittalOH20,
author = {Himangi Mittal and
Brian Okorn and
David Held},
title = {Just Go With the Flow: Self-Supervised Scene Flow Estimation},
booktitle = {{CVPR}},
pages = {11174--11182},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/eccv/AnchaRHNH20,
author = {Siddharth Ancha and
Yaadhav Raaj and
Peiyun Hu and
Srinivasa G. Narasimhan and
David Held},
title = {Active Perception Using Light Curtains for Autonomous Driving},
booktitle = {{ECCV} {(5)}},
series = {Lecture Notes in Computer Science},
volume = {12350},
pages = {751--766},
publisher = {Springer},
year = {2020}
}
@inproceedings{DBLP:conf/iros/OkornXHH20,
author = {Brian Okorn and
Mengyun Xu and
Martial Hebert and
David Held},
title = {Learning Orientation Distributions for Object Pose Estimation},
booktitle = {{IROS}},
pages = {10580--10587},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/iros/QianWZOH20,
author = {Jianing Qian and
Thomas Weng and
Luxin Zhang and
Brian Okorn and
David Held},
title = {Cloth Region Segmentation for Robust Grasp Selection},
booktitle = {{IROS}},
pages = {9553--9560},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/iros/WangACH20,
author = {Jianren Wang and
Siddharth Ancha and
Yi{-}Ting Chen and
David Held},
title = {Uncertainty-aware Self-supervised 3D Data Association},
booktitle = {{IROS}},
pages = {8125--8132},
publisher = {{IEEE}},
year = {2020}
}
@inproceedings{DBLP:conf/iros/WengWHK20,
author = {Xinshuo Weng and
Jianren Wang and
David Held and
Kris Kitani},
title = {3D Multi-Object Tracking: {A} Baseline and New Evaluation Metrics},
booktitle = {{IROS}},
pages = {10359--10366},
publisher = {{IEEE}},
year = {2020}
}
@proceedings{DBLP:conf/inns/2019,
editor = {Luca Oneto and
Nicol{\`{o}} Navarin and
Alessandro Sperduti and
Davide Anguita},
title = {Recent Advances in Big Data and Deep Learning, Proceedings of the
{INNS} Big Data and Deep Learning Conference {INNSBDDL} 2019, held
at Sestri Levante, Genova, Italy 16-18 April 2019},
publisher = {Springer},
year = {2020}
}
@proceedings{DBLP:conf/miccai/2020sashimi,
editor = {Ninon Burgos and
David Svoboda and
Jelmer M. Wolterink and
Can Zhao},
title = {Simulation and Synthesis in Medical Imaging - 5th International Workshop,
{SASHIMI} 2020, Held in Conjunction with {MICCAI} 2020, Lima, Peru,
October 4, 2020, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12417},
publisher = {Springer},
year = {2020}
}
@proceedings{DBLP:conf/tacas/2020-1,
editor = {Armin Biere and
David Parker},
title = {Tools and Algorithms for the Construction and Analysis of Systems
- 26th International Conference, {TACAS} 2020, Held as Part of the
European Joint Conferences on Theory and Practice of Software, {ETAPS}
2020, Dublin, Ireland, April 25-30, 2020, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {12078},
publisher = {Springer},
year = {2020}
}
@proceedings{DBLP:conf/tacas/2020-2,
editor = {Armin Biere and
David Parker},
title = {Tools and Algorithms for the Construction and Analysis of Systems
- 26th International Conference, {TACAS} 2020, Held as Part of the
European Joint Conferences on Theory and Practice of Software, {ETAPS}
2020, Dublin, Ireland, April 25-30, 2020, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {12079},
publisher = {Springer},
year = {2020}
}
@article{DBLP:journals/corr/abs-2001-00081,
author = {Patrick Gage Kelley and
Yongwei Yang and
Courtney Heldreth and
Christopher Moessner and
Aaron Sedley and
Andreas Kramm and
David T. Newman and
Allison Woodruff},
title = {"Happy and Assured that life will be easy 10years from now.": Perceptions
of Artificial Intelligence in 8 Countries},
journal = {CoRR},
volume = {abs/2001.00081},
year = {2020}
}
@article{DBLP:journals/corr/abs-2006-00028,
author = {Thomas Weng and
Amith Pallankize and
Yimin Tang and
Oliver Kroemer and
David Held},
title = {Multi-modal Transfer Learning for Grasping Transparent and Specular
Objects},
journal = {CoRR},
volume = {abs/2006.00028},
year = {2020}
}
@article{DBLP:journals/corr/abs-2007-01418,
author = {Brian Okorn and
Mengyun Xu and
Martial Hebert and
David Held},
title = {Learning Orientation Distributions for Object Pose Estimation},
journal = {CoRR},
volume = {abs/2007.01418},
year = {2020}
}
@article{DBLP:journals/corr/abs-2008-02191,
author = {Siddharth Ancha and
Yaadhav Raaj and
Peiyun Hu and
Srinivasa G. Narasimhan and
David Held},
title = {Active Perception using Light Curtains for Autonomous Driving},
journal = {CoRR},
volume = {abs/2008.02191},
year = {2020}
}
@article{DBLP:journals/corr/abs-2008-05626,
author = {Jianing Qian and
Thomas Weng and
Luxin Zhang and
Brian Okorn and
David Held},
title = {Cloth Region Segmentation for Robust Grasp Selection},
journal = {CoRR},
volume = {abs/2008.05626},
year = {2020}
}
@article{DBLP:journals/corr/abs-2008-08063,
author = {Xinshuo Weng and
Jianren Wang and
David Held and
Kris Kitani},
title = {{AB3DMOT:} {A} Baseline for 3D Multi-Object Tracking and New Evaluation
Metrics},
journal = {CoRR},
volume = {abs/2008.08063},
year = {2020}
}
@article{DBLP:journals/corr/abs-2008-08173,
author = {Jianren Wang and
Siddharth Ancha and
Yi{-}Ting Chen and
David Held},
title = {Uncertainty-aware Self-supervised 3D Data Association},
journal = {CoRR},
volume = {abs/2008.08173},
year = {2020}
}
@article{DBLP:journals/corr/abs-2008-10066,
author = {Harshit Sikchi and
Wenxuan Zhou and
David Held},
title = {Learning Off-Policy with Online Planning},
journal = {CoRR},
volume = {abs/2008.10066},
year = {2020}
}
@article{DBLP:journals/corr/abs-2010-04367,
author = {Jianing Qian and
Junyu Nan and
Siddharth Ancha and
Brian Okorn and
David Held},
title = {Robust Instance Tracking via Uncertainty Flow},
journal = {CoRR},
volume = {abs/2010.04367},
year = {2020}
}
@article{DBLP:journals/corr/abs-2011-06777,
author = {Yufei Wang and
Gautham Narayan Narasimhan and
Xingyu Lin and
Brian Okorn and
David Held},
title = {{ROLL:} Visual Self-Supervised Reinforcement Learning with Object
Reasoning},
journal = {CoRR},
volume = {abs/2011.06777},
year = {2020}
}
@article{DBLP:journals/corr/abs-2011-07213,
author = {Wenxuan Zhou and
Sujay Bajracharya and
David Held},
title = {{PLAS:} Latent Action Space for Offline Reinforcement Learning},
journal = {CoRR},
volume = {abs/2011.07213},
year = {2020}
}
@article{DBLP:journals/corr/abs-2011-07215,
author = {Xingyu Lin and
Yufei Wang and
Jake Olkin and
David Held},
title = {SoftGym: Benchmarking Deep Reinforcement Learning for Deformable Object
Manipulation},
journal = {CoRR},
volume = {abs/2011.07215},
year = {2020}
}
@article{DBLP:journals/corr/abs-2012-09418,
author = {Xia Chen and
Jianren Wang and
David Held and
Martial Hebert},
title = {PanoNet3D: Combining Semantic and Geometric Understanding for LiDARPoint
Cloud Detection},
journal = {CoRR},
volume = {abs/2012.09418},
year = {2020}
}
@phdthesis{DBLP:phd/dnb/Osep19,
author = {Aljosa Osep},
title = {Vision-based category agnostic object tracking for mobile robots and
intelligent vehicles / Aljose Osep ; Bastian Leibe, David Held},
school = {{RWTH} Aachen University, Germany},
year = {2019}
}
@article{DBLP:journals/aim/BarashCCCEFGGhH19,
author = {Guy Barash and
Mauricio Castillo{-}Effen and
Niyati Chhaya and
Peter Clark and
Hu{\'{a}}scar Espinoza and
Eitan Farchi and
Christopher W. Geib and
Odd Erik Gundersen and
Se{\'{a}}n {\'{O}} h{\'{E}}igeartaigh and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Chiori Hori and
Xiaowei Huang and
Kokil Jaidka and
Pavan Kapanipathi and
Sarah Keren and
Seokhwan Kim and
Marc Lanctot and
Danny Lange and
Julian J. McAuley and
David R. Martinez and
Marwan Mattar and
Mausam and
Martin Michalowski and
Reuth Mirsky and
Roozbeh Mottaghi and
Joseph C. Osborn and
Julien P{\'{e}}rolat and
Martin Schmid and
Arash Shaban{-}Nejad and
Onn Shehory and
Biplav Srivastava and
William W. Streilein and
Kartik Talamadupula and
Julian Togelius and
Koichiro Yoshino and
Quanshi Zhang and
Imed Zitouni},
title = {Reports of the Workshops Held at the 2019 {AAAI} Conference on Artificial
Intelligence},
journal = {{AI} Mag.},
volume = {40},
number = {3},
pages = {67--78},
year = {2019}
}
@article{DBLP:journals/arobots/HuangHAD19,
author = {Sandy H. Huang and
David Held and
Pieter Abbeel and
Anca D. Dragan},
title = {Enabling robots to communicate their objectives},
journal = {Auton. Robots},
volume = {43},
number = {2},
pages = {309--326},
year = {2019}
}
@article{DBLP:journals/pacmhci/ErtlTEATW19,
author = {Tanja Ertl and
Sebastian Taugerbeck and
Margarita Esau and
Konstantin Aal and
Peter Tolmie and
Volker Wulf},
title = {The Social Mile - How (Psychosocial) {ICT} can Help to Promote Resocialization
and to Overcome Prison},
journal = {Proc. {ACM} Hum. Comput. Interact.},
volume = {3},
number = {{GROUP}},
pages = {248:1--248:31},
year = {2019}
}
@article{DBLP:journals/remotesensing/RyanPBLRCABH19,
author = {Robert E. Ryan and
Mary Pagnutti and
Kara Burch and
Larry Leigh and
Timothy A. Ruggles and
Changyong Cao and
David Aaron and
Slawomir Blonski and
Dennis L. Helder},
title = {The Terra Vega Active Light Source: {A} First Step in a New Approach
to Perform Nighttime Absolute Radiometric Calibrations and Early Results
Calibrating the {VIIRS} {DNB}},
journal = {Remote. Sens.},
volume = {11},
number = {6},
pages = {710},
year = {2019}
}
@article{DBLP:journals/tgrs/JingLHPA19,
author = {Xin Jing and
Larry Leigh and
Dennis L. Helder and
Cibele Teixeira Pinto and
David Aaron},
title = {Lifetime Absolute Calibration of the {EO-1} Hyperion Sensor and its
Validation},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {57},
number = {11},
pages = {9466--9475},
year = {2019}
}
@inproceedings{DBLP:conf/chiuxid/CookDK19,
author = {David M. Cook and
Derani Dissanayake and
Kulwinder Kaur},
title = {Virtual Reality and Older Hands: Dexterity and accessibility in hand-held
{VR} Control},
booktitle = {CHIuXiD},
pages = {147--151},
publisher = {{ACM}},
year = {2019}
}
@inproceedings{DBLP:conf/corl/AnchaNH19,
author = {Siddharth Ancha and
Junyu Nan and
David Held},
title = {Combining Deep Learning and Verification for Precise Object Instance
Detection},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {100},
pages = {122--141},
publisher = {{PMLR}},
year = {2019}
}
@inproceedings{DBLP:conf/icra/LinGFH19,
author = {Xingyu Lin and
Pengsheng Guo and
Carlos Florensa and
David Held},
title = {Adaptive Variance for Changing Sparse-Reward Environments},
booktitle = {{ICRA}},
pages = {3210--3216},
publisher = {{IEEE}},
year = {2019}
}
@inproceedings{DBLP:conf/nips/LinBKH19,
author = {Xingyu Lin and
Harjatin Singh Baweja and
George Kantor and
David Held},
title = {Adaptive Auxiliary Task Weighting for Reinforcement Learning},
booktitle = {NeurIPS},
pages = {4773--4784},
year = {2019}
}
@proceedings{DBLP:conf/gramsec/2018,
editor = {George Cybenko and
David J. Pym and
Barbara Fila},
title = {5th International Workshop on Graphical Models for Security, held
in conjunction with the Federated Logic Conference (FLoC) 2018, GraMSec@FLoC
2018, Oxford, UK, July 8, 2018, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {11086},
publisher = {Springer},
year = {2019}
}
@proceedings{DBLP:conf/miccai/2019sashimi,
editor = {Ninon Burgos and
Ali Gooya and
David Svoboda},
title = {Simulation and Synthesis in Medical Imaging - 4th International Workshop,
{SASHIMI} 2019, Held in Conjunction with {MICCAI} 2019, Shenzhen,
China, October 13, 2019, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {11827},
publisher = {Springer},
year = {2019}
}
@proceedings{DBLP:conf/post/2019,
editor = {Flemming Nielson and
David Sands},
title = {Principles of Security and Trust - 8th International Conference, {POST}
2019, Held as Part of the European Joint Conferences on Theory and
Practice of Software, {ETAPS} 2019, Prague, Czech Republic, April
6-11, 2019, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {11426},
publisher = {Springer},
year = {2019}
}
@article{DBLP:journals/corr/abs-1903-06309,
author = {Xingyu Lin and
Pengsheng Guo and
Carlos Florensa and
David Held},
title = {Adaptive Variance for Changing Sparse-Reward Environments},
journal = {CoRR},
volume = {abs/1903.06309},
year = {2019}
}
@article{DBLP:journals/corr/abs-1905-07866,
author = {Xingyu Lin and
Harjatin Singh Baweja and
David Held},
title = {Reinforcement Learning without Ground-Truth State},
journal = {CoRR},
volume = {abs/1905.07866},
year = {2019}
}
@article{DBLP:journals/corr/abs-1906-04409,
author = {Siddhant Jain and
Sowmya Munukutla and
David Held},
title = {Few-Shot Point Cloud Region Annotation with Human in the Loop},
journal = {CoRR},
volume = {abs/1906.04409},
year = {2019}
}
@article{DBLP:journals/corr/abs-1912-00096,
author = {Peng Yin and
Jianing Qian and
Yibo Cao and
David Held and
Howie Choset},
title = {FusionMapping: Learning Depth Prediction with Monocular Images and
2D Laser Scans},
journal = {CoRR},
volume = {abs/1912.00096},
year = {2019}
}
@article{DBLP:journals/corr/abs-1912-00497,
author = {Himangi Mittal and
Brian Okorn and
David Held},
title = {Just Go with the Flow: Self-Supervised Scene Flow Estimation},
journal = {CoRR},
volume = {abs/1912.00497},
year = {2019}
}
@article{DBLP:journals/corr/abs-1912-04976,
author = {Peiyun Hu and
David Held and
Deva Ramanan},
title = {Learning to Optimally Segment Point Clouds},
journal = {CoRR},
volume = {abs/1912.04976},
year = {2019}
}
@article{DBLP:journals/corr/abs-1912-04986,
author = {Peiyun Hu and
Jason Ziglar and
David Held and
Deva Ramanan},
title = {What You See is What You Get: Exploiting Visibility for 3D Object
Detection},
journal = {CoRR},
volume = {abs/1912.04986},
year = {2019}
}
@article{DBLP:journals/corr/abs-1912-12270,
author = {Siddharth Ancha and
Junyu Nan and
David Held},
title = {Combining Deep Learning and Verification for Precise Object Instance
Detection},
journal = {CoRR},
volume = {abs/1912.12270},
year = {2019}
}
@article{DBLP:journals/aim/AnCCFFJKMRSSSTT18,
author = {Jisun An and
Rumi Chunara and
David J. Crandall and
Darian Frajberg and
Megan French and
Bernard J. Jansen and
Juhi Kulshrestha and
Yelena Mejova and
Daniel M. Romero and
Joni Salminen and
Amit Sharma and
Amit P. Sheth and
Chenhao Tan and
Samuel Hardman Taylor and
Sanjaya Wijeratne},
title = {Reports of the Workshops Held at the 2018 International {AAAI} Conference
on Web and Social Media},
journal = {{AI} Mag.},
volume = {39},
number = {4},
pages = {36--44},
year = {2018}
}
@article{DBLP:journals/remotesensing/HelderMMSBGCLMR18,
author = {Dennis L. Helder and
Brian L. Markham and
Ron Morfitt and
James C. Storey and
Julia A. Barsi and
Ferran Gascon and
S{\'{e}}bastien Clerc and
Bruno Lafrance and
Jeffrey G. Masek and
David P. Roy and
Adam Lewis and
Nima Pahlevan},
title = {Observations and Recommendations for the Calibration of Landsat 8
{OLI} and Sentinel 2 {MSI} for Improved Data Interoperability},
journal = {Remote. Sens.},
volume = {10},
number = {9},
pages = {1340},
year = {2018}
}
@inproceedings{DBLP:conf/3dim/YuanKHMH18,
author = {Wentao Yuan and
Tejas Khot and
David Held and
Christoph Mertz and
Martial Hebert},
title = {{PCN:} Point Completion Network},
booktitle = {3DV},
pages = {728--737},
publisher = {{IEEE} Computer Society},
year = {2018}
}
@inproceedings{DBLP:conf/cinc/WadehnMKH18,
author = {Federico Wadehn and
David J. Mack and
Emanuela Keller and
Thomas Heldt},
title = {A Multiscale Intracranial Pressure Signal Simulator},
booktitle = {CinC},
pages = {1--4},
publisher = {www.cinc.org},
year = {2018}
}
@inproceedings{DBLP:conf/icml/FlorensaHGA18,
author = {Carlos Florensa and
David Held and
Xinyang Geng and
Pieter Abbeel},
title = {Automatic Goal Generation for Reinforcement Learning Agents},
booktitle = {{ICML}},
series = {Proceedings of Machine Learning Research},
volume = {80},
pages = {1514--1523},
publisher = {{PMLR}},
year = {2018}
}
@proceedings{DBLP:conf/hcc/2018,
editor = {David Kreps and
Charles Ess and
Louise Leenen and
Kai Kimppa},
title = {This Changes Everything - {ICT} and Climate Change: What Can We Do?
- 13th {IFIP} {TC} 9 International Conference on Human Choice and
Computers, {HCC13} 2018, Held at the 24th {IFIP} World Computer Congress,
{WCC} 2018, Poznan, Poland, September 19-21, 2018, Proceedings},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {537},
publisher = {Springer},
year = {2018}
}
@proceedings{DBLP:conf/miccai/2018compay,
editor = {Danail Stoyanov and
Zeike Taylor and
Francesco Ciompi and
Yanwu Xu and
Anne L. Martel and
Lena Maier{-}Hein and
Nasir M. Rajpoot and
Jeroen van der Laak and
Mitko Veta and
Stephen J. McKenna and
David R. J. Snead and
Emanuele Trucco and
Mona Kathryn Garvin and
Xinjian Chen and
Hrvoje Bogunovic},
title = {Computational Pathology and Ophthalmic Medical Image Analysis - First
International Workshop, {COMPAY} 2018, and 5th International Workshop,
{OMIA} 2018, Held in Conjunction with {MICCAI} 2018, Granada, Spain,
September 16-20, 2018, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {11039},
publisher = {Springer},
year = {2018}
}
@article{DBLP:journals/corr/abs-1808-00671,
author = {Wentao Yuan and
Tejas Khot and
David Held and
Christoph Mertz and
Martial Hebert},
title = {{PCN:} Point Completion Network},
journal = {CoRR},
volume = {abs/1808.00671},
year = {2018}
}
@article{DBLP:journals/corr/abs-1811-11209,
author = {Wentao Yuan and
David Held and
Christoph Mertz and
Martial Hebert},
title = {Iterative Transformer Network for 3D Point Cloud},
journal = {CoRR},
volume = {abs/1811.11209},
year = {2018}
}
@article{DBLP:journals/cphysics/StegmeirMCLHW17,
author = {Andreas Stegmeir and
Omar Maj and
David Coster and
Karl Lackner and
Markus Held and
Matthias Wiesenberger},
title = {Advances in the flux-coordinate independent approach},
journal = {Comput. Phys. Commun.},
volume = {213},
pages = {111--121},
year = {2017}
}
@article{DBLP:journals/wpc/SilvaAR17,
author = {H{\'{e}}lder David Silva and
Jos{\'{e}} A. Afonso and
Lu{\'{\i}}s A. Rocha},
title = {Body Attenuation and Path Loss Exponent Estimation for RSS-Based Positioning
in {WSN}},
journal = {Wirel. Pers. Commun.},
volume = {94},
number = {3},
pages = {835--857},
year = {2017}
}
@inproceedings{DBLP:conf/corl/FlorensaHWZA17,
author = {Carlos Florensa and
David Held and
Markus Wulfmeier and
Michael Zhang and
Pieter Abbeel},
title = {Reverse Curriculum Generation for Reinforcement Learning},
booktitle = {CoRL},
series = {Proceedings of Machine Learning Research},
volume = {78},
pages = {482--495},
publisher = {{PMLR}},
year = {2017}
}
@inproceedings{DBLP:conf/icml/AchiamHTA17,
author = {Joshua Achiam and
David Held and
Aviv Tamar and
Pieter Abbeel},
title = {Constrained Policy Optimization},
booktitle = {{ICML}},
series = {Proceedings of Machine Learning Research},
volume = {70},
pages = {22--31},
publisher = {{PMLR}},
year = {2017}
}
@inproceedings{DBLP:conf/icra/HeldMZSA17,
author = {David Held and
Zoe McCarthy and
Michael Zhang and
Fred Shentu and
Pieter Abbeel},
title = {Probabilistically safe policy transfer},
booktitle = {{ICRA}},
pages = {5798--5805},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/iros/ClaveraHA17,
author = {Ignasi Clavera and
David Held and
Pieter Abbeel},
title = {Policy transfer via modularity and reward guiding},
booktitle = {{IROS}},
pages = {1537--1544},
publisher = {{IEEE}},
year = {2017}
}
@inproceedings{DBLP:conf/isami/CarneiroRN17,
author = {Davide Carneiro and
H{\'{e}}lder Rocha and
Paulo Novais},
title = {An Environment for Studying Visual Emotion Perception},
booktitle = {ISAmI},
series = {Advances in Intelligent Systems and Computing},
volume = {615},
pages = {238--245},
publisher = {Springer},
year = {2017}
}
@inproceedings{DBLP:conf/rss/HuangHAD17,
author = {Sandy H. Huang and
David Held and
Pieter Abbeel and
Anca D. Dragan},
title = {Enabling Robots to Communicate Their Objectives},
booktitle = {Robotics: Science and Systems},
year = {2017}
}
@article{DBLP:journals/corr/AchiamHTA17,
author = {Joshua Achiam and
David Held and
Aviv Tamar and
Pieter Abbeel},
title = {Constrained Policy Optimization},
journal = {CoRR},
volume = {abs/1705.10528},
year = {2017}
}
@article{DBLP:journals/corr/FlorensaHWA17,
author = {Carlos Florensa and
David Held and
Markus Wulfmeier and
Pieter Abbeel},
title = {Reverse Curriculum Generation for Reinforcement Learning},
journal = {CoRR},
volume = {abs/1707.05300},
year = {2017}
}
@article{DBLP:journals/corr/HeldGFA17,
author = {David Held and
Xinyang Geng and
Carlos Florensa and
Pieter Abbeel},
title = {Automatic Goal Generation for Reinforcement Learning Agents},
journal = {CoRR},
volume = {abs/1705.06366},
year = {2017}
}
@article{DBLP:journals/corr/HeldMZSA17,
author = {David Held and
Zoe McCarthy and
Michael Zhang and
Fred Shentu and
Pieter Abbeel},
title = {Probabilistically Safe Policy Transfer},
journal = {CoRR},
volume = {abs/1705.05394},
year = {2017}
}
@article{DBLP:journals/corr/HuangHAD17,
author = {Sandy H. Huang and
David Held and
Pieter Abbeel and
Anca D. Dragan},
title = {Enabling Robots to Communicate their Objectives},
journal = {CoRR},
volume = {abs/1702.03465},
year = {2017}
}
@phdthesis{DBLP:phd/pt/Silva16d,
author = {H{\'{e}}lder David Silva},
title = {Indoor positioning system for wireless sensor networks},
school = {University of Minho, Portugal},
year = {2016}
}
@phdthesis{DBLP:phd/us/Held16,
author = {David A. Held},
title = {Deep learning and probabilistic methods for robotic perception from
streaming data},
school = {Stanford University, {USA}},
year = {2016}
}
@article{DBLP:journals/aim/AnCFFGHPPQWZ16,
author = {Jisun An and
David J. Crandall and
Roman Fedorov and
Casey Fiesler and
Fabio Giglietto and
Bahareh R. Heravi and
Jessica Pater and
Konstantinos Pelechrinis and
Daniele Quercia and
Katrin Weller and
Arkaitz Zubiaga},
title = {Reports of the Workshops Held at the 2016 International {AAAI} Conference
on Web and Social Media},
journal = {{AI} Mag.},
volume = {37},
number = {4},
pages = {89--93},
year = {2016}
}
@article{DBLP:journals/cin/CostaGYFSRSB16,
author = {Lu{\'{\i}}s Costa and
Miguel F. Gago and
Darya Yelshyna and
Jaime Ferreira and
H{\'{e}}lder David Silva and
Lu{\'{\i}}s Alexandre Rocha and
Nuno J. Sousa and
Estela Bicho},
title = {Application of Machine Learning in Postural Control Kinematics for
the Diagnosis of Alzheimer's Disease},
journal = {Comput. Intell. Neurosci.},
volume = {2016},
pages = {3891253:1--3891253:15},
year = {2016}
}
@article{DBLP:journals/ijrr/HeldLTS16,
author = {David Held and
Jesse Levinson and
Sebastian Thrun and
Silvio Savarese},
title = {Robust real-time tracking combining 3D shape, color, and motion},
journal = {Int. J. Robotics Res.},
volume = {35},
number = {1-3},
pages = {30--49},
year = {2016}
}
@article{DBLP:journals/remotesensing/PintoPCLMAH16,
author = {Cibele T. Pinto and
Fl{\'{a}}vio Ponzoni and
Ruy M. Castro and
Larry Leigh and
Nischal Mishra and
David Aaron and
Dennis L. Helder},
title = {First in-Flight Radiometric Calibration of {MUX} and {WFI} on-Board
{CBERS-4}},
journal = {Remote. Sens.},
volume = {8},
number = {5},
pages = {405},
year = {2016}
}
@inproceedings{DBLP:conf/eccv/HeldTS16,
author = {David Held and
Sebastian Thrun and
Silvio Savarese},
title = {Learning to Track at 100 {FPS} with Deep Regression Networks},
booktitle = {{ECCV} {(1)}},
series = {Lecture Notes in Computer Science},
volume = {9905},
pages = {749--765},
publisher = {Springer},
year = {2016}
}
@inproceedings{DBLP:conf/icra/HeldTS16,
author = {David Held and
Sebastian Thrun and
Silvio Savarese},
title = {Robust single-view instance recognition},
booktitle = {{ICRA}},
pages = {2152--2159},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/igarss/GuoJPH16,
author = {Yiqing Guo and
Xiuping Jia and
David Paull and
Alex Held},
title = {Multi-kernel retrieval of land surface bidirectional reflectance distribution
functions based on l1-norm optimization},
booktitle = {{IGARSS}},
pages = {1358--1361},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/igarss/LiJTWLH16,
author = {Fuqin Li and
David L. B. Jupp and
Medhavy Thankappan and
Lan{-}Wei Wang and
Adam Lewis and
Alex Held},
title = {Evaluation of the TanDEM-X intermediate {DEM} for terrain illumination
correction in Landsat data},
booktitle = {{IGARSS}},
pages = {5366--5369},
publisher = {{IEEE}},
year = {2016}
}
@inproceedings{DBLP:conf/mammo/EibenLVHSWSBKMY16,
author = {Bj{\"{o}}rn Eiben and
Rene M. Lacher and
Vasileios Vavourakis and
John H. Hipwell and
Danail Stoyanov and
Norman R. Williams and
J{\"{o}}rg Sabczynski and
Thomas B{\"{u}}low and
Dominik Kutra and
Kirsten Meetz and
Stewart Young and
Hans Barschdorf and
H{\'{e}}lder P. Oliveira and
Jaime S. Cardoso and
Jo{\~{a}}o P. Monteiro and
Hooshiar Zolfagharnasab and
Ralph Sinkus and
Pedro Gouveia and
Gerrit{-}Jan Liefers and
Barbara Molenkamp and
Cornelis J. H. van de Velde and
David J. Hawkes and
Maria Jo{\~{a}}o Cardoso and
Mohammed Keshtgar},
title = {Breast Conserving Surgery Outcome Prediction: {A} Patient-Specific,
Integrated Multi-modal Imaging and Mechano-Biological Modelling Framework},
booktitle = {Digital Mammography / {IWDM}},
series = {Lecture Notes in Computer Science},
volume = {9699},
pages = {274--281},
publisher = {Springer},
year = {2016}
}
@inproceedings{DBLP:conf/rss/HeldGRTS16,
author = {David Held and
Devin Guillory and
Brice Rebsamen and
Sebastian Thrun and
Silvio Savarese},
title = {A Probabilistic Framework for Real-time 3D Segmentation using Spatial,
Temporal, and Semantic Cues},
booktitle = {Robotics: Science and Systems},
year = {2016}
}
@proceedings{DBLP:conf/ro-man/2015cr,
editor = {Jeffrey T. K. V. Koh and
Belinda J. Dunstan and
David Silvera Tawil and
Mari Velonaki},
title = {Cultural Robotics - First International Workshop, {CR} 2015, Held
as Part of {IEEE} {RO-MAN} 2015, Kobe, Japan, August 31, 2015, Revised
Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {9549},
publisher = {Springer},
year = {2016}
}
@article{DBLP:journals/corr/HeldTS16,
author = {David Held and
Sebastian Thrun and
Silvio Savarese},
title = {Learning to Track at 100 {FPS} with Deep Regression Networks},
journal = {CoRR},
volume = {abs/1604.01802},
year = {2016}
}
@article{DBLP:journals/aim/GarciaHMPPRW0Z15,
author = {David Garc{\'{\i}}a and
Germaine R. Halegoua and
Yelena Mejova and
Nicola Perra and
J{\"{u}}rgen Pfeffer and
Derek Ruths and
Ingmar Weber and
Robert West and
Leila Zia},
title = {Reports of the 2015 Workshops Held at the International {AAAI} Conference
on Web and Social Media},
journal = {{AI} Mag.},
volume = {36},
number = {4},
pages = {119--123},
year = {2015}
}
@article{DBLP:journals/remotesensing/Czapla-MyersMAT15,
author = {Jeffrey Czapla{-}Myers and
Joel McCorkel and
Nikolaus Anderson and
Kurtis J. Thome and
Stuart F. Biggar and
Dennis L. Helder and
David Aaron and
Larry Leigh and
Nischal Mishra},
title = {The Ground-Based Absolute Radiometric Calibration of Landsat 8 {OLI}},
journal = {Remote. Sens.},
volume = {7},
number = {1},
pages = {600--626},
year = {2015}
}
@proceedings{DBLP:conf/rskt/2015,
editor = {Davide Ciucci and
Guoyin Wang and
Sushmita Mitra and
Wei{-}Zhi Wu},
title = {Rough Sets and Knowledge Technology - 10th International Conference,
{RSKT} 2015, held as part of the International Joint Conference on
Rough Sets, {IJCRS} 2015, Tianjin, China, November 20-23, 2015, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9436},
publisher = {Springer},
year = {2015}
}
@article{DBLP:journals/corr/HeldTS15,
author = {David Held and
Sebastian Thrun and
Silvio Savarese},
title = {Deep Learning for Single-View Instance Recognition},
journal = {CoRR},
volume = {abs/1507.08286},
year = {2015}
}
@article{DBLP:journals/remotesensing/MishraHLAHM14,
author = {Nischal Mishra and
Md. Obaidul Haque and
Larry Leigh and
David Aaron and
Dennis L. Helder and
Brian L. Markham},
title = {Radiometric Cross Calibration of Landsat 8 Operational Land Imager
{(OLI)} and Landsat 7 Enhanced Thematic Mapper Plus {(ETM+)}},
journal = {Remote. Sens.},
volume = {6},
number = {12},
pages = {12619--12638},
year = {2014}
}
@inproceedings{DBLP:conf/atal/AntunesNC14,
author = {Luis Antunes and
Davide Nunes and
Helder Coelho},
title = {The geometry of desire},
booktitle = {{AAMAS}},
pages = {1169--1172},
publisher = {{IFAAMAS/ACM}},
year = {2014}
}
@inproceedings{DBLP:conf/memea/FerreiraGFSSRB14,
author = {Jaime Ferreira and
Miguel F. Gago and
Vitor Fernandes and
H{\'{e}}lder David Silva and
Nuno J. Sousa and
Lu{\'{\i}}s A. Rocha and
Estela Bicho},
title = {Analysis of postural kinetics data using Artificial Neural Networks
in Alzheimer's Disease},
booktitle = {MeMeA},
pages = {108--113},
publisher = {{IEEE}},
year = {2014}
}
@inproceedings{DBLP:conf/rss/HeldLTS14,
author = {David Held and
Jesse Levinson and
Sebastian Thrun and
Silvio Savarese},
title = {Combining 3D Shape, Color, and Motion for Robust Anytime Tracking},
booktitle = {Robotics: Science and Systems},
year = {2014}
}
@proceedings{DBLP:conf/miccai/2014aecai,
editor = {Cristian A. Linte and
Ziv Yaniv and
Pascal Fallavollita and
Purang Abolmaesumi and
David R. Holmes III},
title = {Augmented Environments for Computer-Assisted Interventions - 9th International
Workshop, {AE-CAI} 2014, Held in Conjunction with {MICCAI} 2014, Boston,
MA, USA, September 14, 2014. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8678},
publisher = {Springer},
year = {2014}
}
@proceedings{DBLP:conf/rseisp/2014,
editor = {Marzena Kryszkiewicz and
Chris Cornelis and
Davide Ciucci and
Jes{\'{u}}s Medina{-}Moreno and
Hiroshi Motoda and
Zbigniew W. Ras},
title = {Rough Sets and Intelligent Systems Paradigms - Second International
Conference, {RSEISP} 2014, Held as Part of {JRS} 2014, Granada and
Madrid, Spain, July 9-13, 2014. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8537},
publisher = {Springer},
year = {2014}
}
@proceedings{DBLP:conf/vsl/2014kr4hc,
editor = {Silvia Miksch and
David Ria{\~{n}}o and
Annette ten Teije},
title = {Knowledge Representation for Health Care - 6th International Workshop,
{KR4HC} 2014, Held as Part of the Vienna Summer of Logic, {VSL} 2014,
Vienna, Austria, July 21, 2014, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {8903},
publisher = {Springer},
year = {2014}
}
@article{DBLP:journals/cmpb/RevieSCHLGKSHD13,
author = {James A. Revie and
David J. Stevenson and
J. Geoffrey Chase and
Christopher E. Hann and
Bernard C. Lambermont and
Alexandre Ghuysen and
Philippe Kolh and
Geoffrey M. Shaw and
Stefan Heldmann and
Thomas Desaive},
title = {Validation of subject-specific cardiovascular system models from porcine
measurements},
journal = {Comput. Methods Programs Biomed.},
volume = {109},
number = {2},
pages = {197--210},
year = {2013}
}
@article{DBLP:journals/tgrs/ChanderHAMS13,
author = {Gyanesh Chander and
Dennis L. Helder and
David Aaron and
Nischal Mishra and
Alok K. Shrestha},
title = {Assessment of Spectral, Misregistration, and Spatial Uncertainties
Inherent in the Cross-Calibration Study},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {51},
number = {3-1},
pages = {1282--1296},
year = {2013}
}
@article{DBLP:journals/tgrs/ChanderMHAACXD13,
author = {Gyanesh Chander and
Nischal Mishra and
Dennis L. Helder and
David Aaron and
Amit Angal and
Taeyoung Choi and
Xiaoxiong Xiong and
David R. Doelling},
title = {Applications of Spectral Band Adjustment Factors {(SBAF)} for Cross-Calibration},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {51},
number = {3-1},
pages = {1267--1281},
year = {2013}
}
@inproceedings{DBLP:conf/icra/HeldLT13,
author = {David Held and
Jesse Levinson and
Sebastian Thrun},
title = {Precision tracking with sparse 3D and dense color 2D data},
booktitle = {{ICRA}},
pages = {1138--1145},
publisher = {{IEEE}},
year = {2013}
}
@inproceedings{DBLP:conf/igarss/LiJTPLH13,
author = {Fuqin Li and
David L. B. Jupp and
Medhavy Thankappan and
Matt Paget and
Adam Lewis and
Alex Held},
title = {The variability of satellite derived surface {BRDF} shape over Australia
from 2001 to 2011},
booktitle = {{IGARSS}},
pages = {255--258},
publisher = {{IEEE}},
year = {2013}
}
@proceedings{DBLP:conf/haw/2012,
editor = {Rainer Keller and
David Kramer and
Jan{-}Philipp Weiss},
title = {Facing the Multicore-Challenge - Aspects of New Paradigms and Technologies
in Parallel Computing [Proceedings of a conference held at Stuttgart,
Germany, September 19-21, 2012]},
series = {Lecture Notes in Computer Science},
volume = {7686},
publisher = {Springer},
year = {2013}
}
@proceedings{DBLP:conf/miccai/2012aecai,
editor = {Cristian A. Linte and
Elvis C. S. Chen and
Marie{-}Odile Berger and
John T. Moore and
David R. Holmes III},
title = {Augmented Environments for Computer-Assisted Interventions - 7th International
Workshop, {AE-CAI} 2012, Held in Conjunction with {MICCAI} 2012, Nice,
France, October 5, 2012, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {7815},
publisher = {Springer},
year = {2013}
}
@proceedings{DBLP:conf/mkm/2013,
editor = {Jacques Carette and
David Aspinall and
Christoph Lange and
Petr Sojka and
Wolfgang Windsteiger},
title = {Intelligent Computer Mathematics - MKM, Calculemus, DML, and Systems
and Projects 2013, Held as Part of {CICM} 2013, Bath, UK, July 8-12,
2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7961},
publisher = {Springer},
year = {2013}
}
@proceedings{DBLP:conf/post/2013,
editor = {David A. Basin and
John C. Mitchell},
title = {Principles of Security and Trust - Second International Conference,
{POST} 2013, Held as Part of the European Joint Conferences on Theory
and Practice of Software, {ETAPS} 2013, Rome, Italy, March 16-24,
2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7796},
publisher = {Springer},
year = {2013}
}
@article{DBLP:journals/ahci/PitmanC12,
author = {David J. Pitman and
Mary L. Cummings},
title = {Collaborative Exploration with a Micro Aerial Vehicle: {A} Novel Interaction
Method for Controlling a {MAV} with a Hand-Held Device},
journal = {Adv. Hum. Comput. Interact.},
volume = {2012},
pages = {768180:1--768180:15},
year = {2012}
}
@article{DBLP:journals/cn/PalmaAC12,
author = {David Palma and
Helder Ara{\'{u}}jo and
Mar{\'{\i}}lia Curado},
title = {Link quality estimation in wireless multi-hop networks using Kernel
based methods},
journal = {Comput. Networks},
volume = {56},
number = {16},
pages = {3629--3638},
year = {2012}
}
@article{DBLP:journals/tgrs/HelderKBMAJ12,
author = {Dennis L. Helder and
Sadhana Karki and
Rajendra Bhatt and
Esad Micijevic and
David Aaron and
Benjamin Jasinski},
title = {Radiometric Calibration of the Landsat {MSS} Sensor Series},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {50},
number = {6},
pages = {2380--2399},
year = {2012}
}
@article{DBLP:journals/tgrs/MarkhamHBMHTAC12,
author = {Brian L. Markham and
Md. Obaidul Haque and
Julia A. Barsi and
Esad Micijevic and
Dennis L. Helder and
Kurtis J. Thome and
David Aaron and
Jeffrey Czapla{-}Myers},
title = {Landsat-7 {ETM+:} 12 Years On-Orbit Reflective-Band Radiometric Performance},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {50},
number = {5-2},
pages = {2056--2062},
year = {2012}
}
@inproceedings{DBLP:conf/ei-sda/KaneHB12,
author = {David Kane and
Robert T. Held and
Martin S. Banks},
title = {Visual discomfort with stereo 3D displays when the head is not upright},
booktitle = {SD{\&}A},
series = {{SPIE} Proceedings},
volume = {8288},
pages = {828814},
publisher = {{SPIE}},
year = {2012}
}
@inproceedings{DBLP:conf/embc/HeldmanFRWWGGM12,
author = {Dustin A. Heldman and
Danielle E. Filipkowski and
David E. Riley and
Christina M. Whitney and
Benjamin L. Walter and
Steven A. Gunzler and
Joseph P. Giuffrida and
Thomas O. Mera},
title = {Automated motion sensor quantification of gait and lower extremity
bradykinesia},
booktitle = {{EMBC}},
pages = {1956--1959},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/icra/HeldLT12,
author = {David Held and
Jesse Levinson and
Sebastian Thrun},
title = {A probabilistic framework for car detection in images using context
and scale},
booktitle = {{ICRA}},
pages = {1628--1634},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/icra/HeldYF12,
author = {David Held and
Yoram Yekutieli and
Tamar Flash},
title = {Characterizing the stiffness of a multi-segment flexible arm during
motion},
booktitle = {{ICRA}},
pages = {3825--3832},
publisher = {{IEEE}},
year = {2012}
}
@inproceedings{DBLP:conf/robio/FangSGSL12,
author = {Chen Fang and
Weiwei Sang and
Jan D. J. Gumprecht and
Gero Strau{\ss} and
Tim C. Lueth},
title = {Image-guided steering of a motorized hand-held flexible rhino endoscope
in {ENT} diagnoses},
booktitle = {{ROBIO}},
pages = {1086--1091},
publisher = {{IEEE}},
year = {2012}
}
@proceedings{DBLP:conf/haw/2011,
editor = {Rainer Keller and
David Kramer and
Jan{-}Philipp Weiss},
title = {Facing the Multicore - Challenge {II} - Aspects of New Paradigms and
Technologies in Parallel Computing [Proceedings of a conference held
at the Karlsruhe Institute of Technology (KIT), September 28-30, 2011]},
series = {Lecture Notes in Computer Science},
volume = {7174},
publisher = {Springer},
year = {2012}
}
@proceedings{DBLP:conf/miccai/2011aecai,
editor = {Cristian A. Linte and
John T. Moore and
Elvis C. S. Chen and
David R. Holmes III},
title = {Augmented Environments for Computer-Assisted Interventions - 6th International
Workshop, {AE-CAI} 2011, Held in Conjunction with {MICCAI} 2011, Toronto,
ON, Canada, September 22, 2011, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {7264},
publisher = {Springer},
year = {2012}
}
@proceedings{DBLP:conf/miccai/2012col,
editor = {Hiroyuki Yoshida and
David J. Hawkes and
Michael W. Vannier},
title = {Abdominal Imaging. Computational and Clinical Applications - 4th International
Workshop, Held in Conjunction with {MICCAI} 2012, Nice, France, October
1, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7601},
publisher = {Springer},
year = {2012}
}
@article{DBLP:journals/cmpb/HannRSHDFLGKSC11,
author = {Christopher E. Hann and
James A. Revie and
David J. Stevenson and
Stefan Heldmann and
Thomas Desaive and
C. B. Froissart and
Bernard C. Lambermont and
Alexandre Ghuysen and
Philippe Kolh and
Geoffrey M. Shaw and
J. Geoffrey Chase},
title = {Patient specific identification of the cardiac driver function in
a cardiovascular system model},
journal = {Comput. Methods Programs Biomed.},
volume = {101},
number = {2},
pages = {201--207},
year = {2011}
}
@article{DBLP:journals/sensors/AfonsoSMR11,
author = {Jos{\'{e}} A. Afonso and
H{\'{e}}lder David Silva and
Pedro Macedo and
Lu{\'{\i}}s A. Rocha},
title = {An Enhanced Reservation-Based {MAC} Protocol for {IEEE} 802.15.4 Networks},
journal = {Sensors},
volume = {11},
number = {4},
pages = {3852--3873},
year = {2011}
}
@article{DBLP:journals/software/HeldR11,
author = {Isaac Held and
David A. andall},
title = {Point/Counterpoint},
journal = {{IEEE} Softw.},
volume = {28},
number = {6},
pages = {62--65},
year = {2011}
}
@article{DBLP:journals/tbc/DalyHH11,
author = {Scott J. Daly and
Robert T. Held and
David M. Hoffman},
title = {Perceptual Issues in Stereoscopic Signal Processing},
journal = {{IEEE} Trans. Broadcast.},
volume = {57},
number = {2},
pages = {347--361},
year = {2011}
}
@article{DBLP:journals/tbe/LattNSPNSY11,
author = {Win Tun Latt and
Richard C. Newton and
Marco Visentini Scarzanella and
Christopher J. Payne and
David P. Noonan and
Jianzhong Shang and
Guang{-}Zhong Yang},
title = {A Hand-held Instrument to Maintain Steady Tissue Contact during Probe-Based
Confocal Laser Endomicroscopy},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {58},
number = {9},
pages = {2694--2703},
year = {2011}
}
@inproceedings{DBLP:conf/isvc/PrachyabruedDB11,
author = {Mores Prachyabrued and
David L. Ducrest and
Christoph W. Borst},
title = {Handymap: {A} Selection Interface for Cluttered {VR} Environments
Using a Tracked Hand-Held Touch Device},
booktitle = {{ISVC} {(2)}},
series = {Lecture Notes in Computer Science},
volume = {6939},
pages = {45--54},
publisher = {Springer},
year = {2011}
}
@inproceedings{DBLP:conf/ivs/LevinsonABDHKKLPPSSSTWT11,
author = {Jesse Levinson and
Jake Askeland and
Jan Becker and
Jennifer Dolson and
David Held and
S{\"{o}}ren Kammel and
J. Zico Kolter and
Dirk Langer and
Oliver Pink and
Vaughan R. Pratt and
Michael Sokolsky and
Ganymed Stanek and
David Michael Stavens and
Alex Teichman and
Moritz Werling and
Sebastian Thrun},
title = {Towards fully autonomous driving: Systems and algorithms},
booktitle = {Intelligent Vehicles Symposium},
pages = {163--168},
publisher = {{IEEE}},
year = {2011}
}
@proceedings{DBLP:conf/haw/2010,
editor = {Rainer Keller and
David Kramer and
Jan{-}Philipp Weiss},
title = {Facing the Multicore-Challenge - Aspects of New Paradigms and Technologies
in Parallel Computing [Proceedings of a conference held at the Heidelberger
Akademie der Wissenschaften, March 17-19, 2010]},
series = {Lecture Notes in Computer Science},
volume = {6310},
publisher = {Springer},
year = {2011}
}
@article{DBLP:journals/jasss/DavidCC10,
author = {Nuno David and
Jos{\'{e}} Castro Caldas and
Helder Coelho},
title = {Epistemological Perspectives on Simulation {III:} An introduction},
journal = {J. Artif. Soc. Soc. Simul.},
volume = {13},
number = {1},
year = {2010}
}
@inproceedings{DBLP:conf/haptics/JonesHH10,
author = {Lynette A. Jones and
David A. Held and
Ian W. Hunter},
title = {Surface waves and spatial localization in vibrotactile displays},
booktitle = {{HAPTICS}},
pages = {91--94},
publisher = {{IEEE} Computer Society},
year = {2010}
}
@inproceedings{DBLP:conf/igarss/ChanderMHACAX10,
author = {Gyanesh Chander and
Nischal Mishra and
Dennis L. Helder and
David Aaron and
Taeyoung Choi and
Amit Angal and
Xiaoxiong Xiong},
title = {Use of {EO-1} Hyperion data to calculate spectral band adjustment
factors {(SBAF)} between the {L7} {ETM+} and Terra {MODIS} sensors},
booktitle = {{IGARSS}},
pages = {1667--1670},
publisher = {{IEEE}},
year = {2010}
}
@proceedings{DBLP:conf/fase/2010,
editor = {David S. Rosenblum and
Gabriele Taentzer},
title = {Fundamental Approaches to Software Engineering, 13th International
Conference, {FASE} 2010, Held as Part of the Joint European Conferences
on Theory and Practice of Software, {ETAPS} 2010, Paphos, Cyprus,
March 20-28, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6013},
publisher = {Springer},
year = {2010}
}
@proceedings{DBLP:conf/hcc/2010,
editor = {Jacques Berleur and
Magda David Hercheui and
Lorenz M. Hilty},
title = {What Kind of Information Society? Governance, Virtuality, Surveillance,
Sustainability, Resilience - 9th {IFIP} {TC} 9 International Conference,
{HCC9} 2010 and 1st {IFIP} {TC} 11 International Conference, {CIP}
2010, Held as Part of {WCC} 2010, Brisbane, Australia, September 20-23,
2010. Proceedings},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {328},
publisher = {Springer},
year = {2010}
}
@proceedings{DBLP:conf/starai/2012,
editor = {Henry A. Kautz and
Kristian Kersting and
Sriraam Natarajan and
David Poole},
title = {2nd International Workshop on Statistical Relational {AI} (StaRAI-12),
held at the Uncertainty in Artificial Intelligence Conference {(UAI}
2012), Catalina Island, CA, USA, August 18, 2012},
year = {2010}
}
@article{DBLP:journals/ieeesp/DuranCCDH09,
author = {Felicia Duran and
Stephen H. Conrad and
Gregory N. Conrad and
David P. Duggan and
Edward Bruce Held},
title = {Building {A} System For Insider Security},
journal = {{IEEE} Secur. Priv.},
volume = {7},
number = {6},
pages = {30--38},
year = {2009}
}
@article{DBLP:journals/pr/MataboschFSB09,
author = {Carles Matabosch and
David Fofi and
Joaquim Salvi and
Elisabet Batlle},
title = {Corrigendum to "Registration of surfaces minimizing error propagation
for a one-shot multi-slit hand-held scanner" [Pattern Recognition
41 {(6)} 2055-2067]},
journal = {Pattern Recognit.},
volume = {42},
number = {3},
pages = {495},
year = {2009}
}
@inproceedings{DBLP:conf/epia/AntunesNCBU09,
author = {Luis Antunes and
Davide Nunes and
Helder Coelho and
Jo{\~{a}}o Balsa and
Paulo Urbano},
title = {Context Switching versus Context Permeability in Multiple Social Networks},
booktitle = {{EPIA}},
series = {Lecture Notes in Computer Science},
volume = {5816},
pages = {547--559},
publisher = {Springer},
year = {2009}
}
@article{DBLP:journals/jcise/JonesH08,
author = {Lynette A. Jones and
David A. Held},
title = {Characterization of Tactors Used in Vibrotactile Displays},
journal = {J. Comput. Inf. Sci. Eng.},
volume = {8},
number = {4},
year = {2008}
}
@article{DBLP:journals/pr/MataboschFSB08,
author = {Carles Matabosch and
David Fofi and
Joaquim Salvi and
Elisabet Batlle},
title = {Registration of surfaces minimizing error propagation for a one-shot
multi-slit hand-held scanner},
journal = {Pattern Recognit.},
volume = {41},
number = {6},
pages = {2055--2067},
year = {2008}
}
@article{DBLP:journals/sigsoft/BudgenB07,
author = {David Budgen and
Pearl Brereton},
title = {Realising evidence-based software engineering {(REBSE-2)} a report
from the workshop held at {ICSE} 2007},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {32},
number = {4},
pages = {36--39},
year = {2007}
}
@inproceedings{DBLP:conf/hci/HeldalRBW07,
author = {Ilona Heldal and
David J. Roberts and
Lars Br{\aa}the and
Robin Wolff},
title = {Presence, Creativity and Collaborative Work in Virtual Environments},
booktitle = {{HCI} {(1)}},
series = {Lecture Notes in Computer Science},
volume = {4550},
pages = {802--811},
publisher = {Springer},
year = {2007}
}
@inproceedings{DBLP:conf/icra/CastleGKM07,
author = {Robert Oliver Castle and
D. J. Gawley and
Georg Klein and
David William Murray},
title = {Towards simultaneous recognition, localization and mapping for hand-held
and wearable cameras},
booktitle = {{ICRA}},
pages = {4102--4107},
publisher = {{IEEE}},
year = {2007}
}
@inproceedings{DBLP:conf/rss/ClementeDRNT07,
author = {Laura A. Clemente and
Andrew J. Davison and
Ian D. Reid and
Jos{\'{e}} Neira and
Juan D. Tard{\'{o}}s},
title = {Mapping Large Loops with a Single Hand-Held Camera},
booktitle = {Robotics: Science and Systems},
publisher = {The {MIT} Press},
year = {2007}
}
@article{DBLP:journals/jssc/KhanWKLNYBHGHGW06,
author = {Aurangzeb Khan and
Philip Watson and
George Kuo and
Due Le and
Trung{-}Kien Nguyen and
Steven Yang and
Peter Bennett and
Pokai Huang and
Jaspal Gill and
Chris Hawkins and
John Goodenough and
Demin Wang and
Irfan Ahmed and
Peter Tran and
Helder Mak and
Oanh Kim and
Frank Martin and
Yimu Fan and
David Ge and
Joseph Kung and
Vincent Shek},
title = {A 90-nm Power Optimization Methodology With Application to the {ARM}
1136JF-S Microprocessor},
journal = {{IEEE} J. Solid State Circuits},
volume = {41},
number = {8},
pages = {1707--1717},
year = {2006}
}
@article{DBLP:journals/vr/RobertsHOW06,
author = {David J. Roberts and
Ilona Heldal and
Oliver Otto and
Robin Wolff},
title = {Factors influencing flow of object focussed collaboration in collaborative
virtual environments},
journal = {Virtual Real.},
volume = {10},
number = {2},
pages = {119--133},
year = {2006}
}
@inproceedings{DBLP:conf/eumas/DavidSC06,
author = {Nuno David and
Jaime Sim{\~{a}}o Sichman and
Helder Coelho},
title = {Simulation as Formal and Generative Social Science: The Very Idea},
booktitle = {{EUMAS}},
series = {{CEUR} Workshop Proceedings},
volume = {223},
publisher = {CEUR-WS.org},
year = {2006}
}
@inproceedings{DBLP:conf/icassp/Huggins-DainesKCBRR06,
author = {David Huggins{-}Daines and
Mohit Kumar and
Arthur Chan and
Alan W. Black and
Mosur Ravishankar and
Alexander I. Rudnicky},
title = {Pocketsphinx: {A} Free, Real-Time Continuous Speech Recognition System
for Hand-Held Devices},
booktitle = {{ICASSP} {(1)}},
pages = {185--188},
publisher = {{IEEE}},
year = {2006}
}
@inproceedings{DBLP:conf/iceis/DavidC06,
author = {Nuno David and
Helder Coelho},
title = {Around the Empirical and Intentional References of Agent-Based Simulation
in the Social Sciences},
booktitle = {{ICEIS} {(2)}},
pages = {31--38},
year = {2006}
}
@inproceedings{DBLP:conf/ifip2-5/GroppHHKMSY06,
author = {William Gropp and
Eldad Haber and
Stefan Heldmann and
David E. Keyes and
Neill Miller and
Jennifer M. Schopf and
Tianzhi Yang},
title = {Grid-based Image Registration},
booktitle = {Grid-Based Problem Solving Environments},
series = {{IFIP}},
volume = {239},
pages = {435--448},
publisher = {Springer},
year = {2006}
}
@article{DBLP:journals/heuristics/HeldW05,
author = {Harald Held and
David L. Woodruff},
title = {Heuristics for Multi-Stage Interdiction of Stochastic Networks},
journal = {J. Heuristics},
volume = {11},
number = {5-6},
pages = {483--500},
year = {2005}
}
@article{DBLP:journals/jasss/Coelho05,
author = {Helder Coelho},
title = {The Design of Innovation: Lessons from and for Competent Genetic Algorithms
\emph{by David E. Goldberg}},
journal = {J. Artif. Soc. Soc. Simul.},
volume = {8},
number = {3},
year = {2005}
}
@article{DBLP:journals/jasss/DavidSC05,
author = {Nuno David and
Jaime Sim{\~{a}}o Sichman and
Helder Coelho},
title = {The Logic of the Method of Agent-Based Simulation in the Social Sciences:
Empirical and Intentional Adequacy of Computer Programs},
journal = {J. Artif. Soc. Soc. Simul.},
volume = {8},
number = {4},
year = {2005}
}
@article{DBLP:journals/sigsoft/BudgenK05,
author = {David Budgen and
Barbara A. Kitchenham},
title = {Realising evidence-based software engineering a report from the workshop
held at {ICSE} 2005},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {30},
number = {5},
pages = {1--5},
year = {2005}
}
@inproceedings{DBLP:conf/atal/DavidSC05,
author = {Nuno David and
Jaime Sim{\~{a}}o Sichman and
Helder Coelho},
title = {Intentional adequacy of computer programs as the experimental reference
of agent-based social simulation},
booktitle = {{AAMAS}},
pages = {1359--1360},
publisher = {{ACM}},
year = {2005}
}
@inproceedings{DBLP:conf/mum/LiuDL05,
author = {Xu Liu and
David S. Doermann and
Huiping Li},
title = {Fast camera motion estimation for hand-held devices and applications},
booktitle = {{MUM}},
series = {{ACM} International Conference Proceeding Series},
volume = {154},
pages = {103--108},
publisher = {{ACM}},
year = {2005}
}
@article{DBLP:journals/cphysics/Blanco-ReyAHK04,
author = {Maria Blanco{-}Rey and
Pedro de Andres and
Georg Held and
David A. King},
title = {A {FORTRAN-90} Low-Energy Electron Diffraction program {(LEED90} v1.1)},
journal = {Comput. Phys. Commun.},
volume = {161},
number = {3},
pages = {151--165},
year = {2004}
}
@article{DBLP:journals/cphysics/Blanco-ReyAHK04a,
author = {Maria Blanco{-}Rey and
Pedro de Andres and
Georg Held and
David A. King},
title = {Molecular t-matrices for Low-Energy Electron Diffraction {(TMOL} v1.1)},
journal = {Comput. Phys. Commun.},
volume = {161},
number = {3},
pages = {166--178},
year = {2004}
}
@article{DBLP:journals/jasss/DavidMSC04,
author = {Nuno David and
Maria Bruno Marietto and
Jaime Sim{\~{a}}o Sichman and
Helder Coelho},
title = {The Structure and Logic of Interdisciplinary Research in Agent-Based
Social Simulation},
journal = {J. Artif. Soc. Soc. Simul.},
volume = {7},
number = {3},
year = {2004}
}
@article{DBLP:journals/tgrs/ChanderMH04,
author = {Gyanesh Chander and
David J. Meyer and
Dennis L. Helder},
title = {Cross calibration of the Landsat-7 {ETM+} and {EO-1} {ALI} sensor},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {42},
number = {12},
pages = {2821--2831},
year = {2004}
}
@article{DBLP:journals/tgrs/ThomeHAD04,
author = {Kurtis J. Thome and
Dennis L. Helder and
David Aaron and
James D. Dewald},
title = {Landsat-5 {TM} and Landsat-7 {ETM+} absolute radiometric calibration
using the reflectance-based method},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {42},
number = {12},
pages = {2777--2785},
year = {2004}
}
@inproceedings{DBLP:conf/amcc/JinWWLSFHM04,
author = {Zhipu Jin and
Stephan Waydo and
Elisabeth B. Wildanger and
Michael Lammers and
Hans Scholze and
Peter Foley and
David Held and
Richard M. Murray},
title = {{MVWT-II:} the second generation Caltech Multi-Vehicle Wireless Testbed},
booktitle = {{ACC}},
pages = {5321--5326},
publisher = {{IEEE}},
year = {2004}
}
@inproceedings{DBLP:conf/cicc/KhanRJGLNYYABCC04,
author = {Aurangzeb Khan and
K. Ruparel and
C. Joly and
V. Ghanta and
Due Le and
T. Nguyen and
J. Yu and
Steven Yang and
Irfan Ahmed and
N. Burnside and
V. Chagarlamudi and
M. Cheung and
F. Chiu and
Yimu Fan and
David Ge and
Jaspal Gill and
Pokai Huang and
V. Jayapal and
Oanh Kim and
M. Li and
Helder Mak and
P. McKeever and
S. Nguyen and
K. Rajan and
S. Riley and
Peter Tran and
H. Truong and
A. Tsou and
Demin Wang and
C. Yang and
J. Zhang and
X. Zhong},
title = {Design and development of 130-nanometer ICs for a multi-Gigabit switching
network system},
booktitle = {{CICC}},
pages = {317--320},
publisher = {{IEEE}},
year = {2004}
}
@proceedings{DBLP:conf/esop/2004,
editor = {David A. Schmidt},
title = {Programming Languages and Systems, 13th European Symposium on Programming,
{ESOP} 2004, Held as Part of the Joint European Conferences on Theory
and Practice of Software, {ETAPS} 2004, Barcelona, Spain, March 29
- April 2, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2986},
publisher = {Springer},
year = {2004}
}
@article{DBLP:journals/bib/DevilleGHW03,
author = {Yves Deville and
David R. Gilbert and
Jacques van Helden and
Shoshana J. Wodak},
title = {An overview of data models for the analysis of biochemical pathways},
journal = {Briefings Bioinform.},
volume = {4},
number = {3},
pages = {246--259},
year = {2003}
}
@article{DBLP:journals/mj/JoshiABLMR03,
author = {Yogendra Joshi and
Kaveh Azar and
David L. Blackburn and
Clemens J. M. Lasance and
Ravi Mahajan and
Jukka Rantala},
title = {How well can we assess thermally driven reliability issues in electronic
systems today? Summary of panel held at the Therminic 2002},
journal = {Microelectron. J.},
volume = {34},
number = {12},
pages = {1195--1201},
year = {2003}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003}
}
@inproceedings{DBLP:conf/cmsb/DevilleGHW03,
author = {Yves Deville and
David R. Gilbert and
Jacques van Helden and
Shoshana J. Wodak},
title = {An Overview of Data Models for the Analysis of Biochemical Pathways},
booktitle = {{CMSB}},
series = {Lecture Notes in Computer Science},
volume = {2602},
pages = {174},
publisher = {Springer},
year = {2003}
}
@inproceedings{DBLP:conf/mabs/MariettoDSC03,
author = {Maria Bruno Marietto and
Nuno David and
Jaime Sim{\~{a}}o Sichman and
Helder Coelho},
title = {A Classification of Paradigmatic Models for Agent-Based Social Simulation},
booktitle = {{MABS}},
series = {Lecture Notes in Computer Science},
volume = {2927},
pages = {193--208},
publisher = {Springer},
year = {2003}
}
@inproceedings{DBLP:conf/ccgrid/HelderJ02,
author = {David A. Helder and
Sugih Jamin},
title = {End-Host Multicast Communication Using Switch-Trees Protocols},
booktitle = {{CCGRID}},
pages = {419--424},
publisher = {{IEEE} Computer Society},
year = {2002}
}
@inproceedings{DBLP:conf/mabs/DavidSC02,
author = {Nuno David and
Jaime Sim{\~{a}}o Sichman and
Helder Coelho},
title = {Towards an Emergence-Driven Software Process for Agent-Based Simulatio},
booktitle = {{MABS}},
series = {Lecture Notes in Computer Science},
volume = {2581},
pages = {89--104},
publisher = {Springer},
year = {2002}
}
@inproceedings{DBLP:conf/mabs/MariettoDSC02,
author = {Maria Bruno Marietto and
Nuno David and
Jaime Sim{\~{a}}o Sichman and
Helder Coelho},
title = {Requirements Analysis of Agent-Based Simulation Platforms: State of
the Art and New Prospects},
booktitle = {{MABS}},
series = {Lecture Notes in Computer Science},
volume = {2581},
pages = {125--141},
publisher = {Springer},
year = {2002}
}
@inproceedings{DBLP:conf/ngc/WangHJZ02,
author = {Wenjie Wang and
David A. Helder and
Sugih Jamin and
Lixia Zhang},
title = {Overlay Optimizations for End-host Multicast},
booktitle = {Networked Group Communication},
pages = {154--161},
publisher = {{ACM}},
year = {2002}
}
@inproceedings{DBLP:conf/sbia/DavidSC02,
author = {Nuno David and
Jaime Sim{\~{a}}o Sichman and
Helder Coelho},
title = {Multiple Society Organisations and Social Opacity: When Agents Play
the Role of Observers},
booktitle = {{SBIA}},
series = {Lecture Notes in Computer Science},
volume = {2507},
pages = {63--73},
publisher = {Springer},
year = {2002}
}
@article{DBLP:journals/isci/SchroederGHN01,
author = {Michael Schroeder and
David R. Gilbert and
Jacques van Helden and
Penny Noy},
title = {Approaches to visualisation in bioinformatics: from dendrograms to
Space Explorer},
journal = {Inf. Sci.},
volume = {139},
number = {1-2},
pages = {19--57},
year = {2001}
}
@inproceedings{DBLP:conf/amia/LobachLARTE01,
author = {David F. Lobach and
Richard Low and
Jennifer M. Arbanas and
J. S. Rabold and
Jacqueline L. Tatum and
Susan D. Epstein},
title = {Defining and supporting the diverse information needs of community-based
care using the web and hand-held devices},
booktitle = {{AMIA}},
publisher = {{AMIA}},
year = {2001}
}
@inproceedings{DBLP:conf/amia/LynnNL01,
author = {Thomas E. Lynn and
John O. Naugle and
David F. Lobach},
title = {Delivering Interactive Clinical Practice Guidelines to the Point of
Care Using Hand-held Devices},
booktitle = {{AMIA}},
publisher = {{AMIA}},
year = {2001}
}
@proceedings{DBLP:conf/esop/2001,
editor = {David Sands},
title = {Programming Languages and Systems, 10th European Symposium on Programming,
{ESOP} 2001 Held as Part of the Joint European Conferences on Theory
and Practice of Software, {ETAPS} 2001 Genova, Italy, April 2-6, 2001,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2028},
publisher = {Springer},
year = {2001}
}
@inproceedings{DBLP:conf/jobim/HeldenGWSW00,
author = {Jacques van Helden and
David R. Gilbert and
Lorenz Wernisch and
Michael Schroeder and
Shoshana J. Wodak},
title = {Application of Regulatory Sequence Analysis and Metabolic Network
Analysis to the Interpretation of Gene Expression Data},
booktitle = {{JOBIM}},
series = {Lecture Notes in Computer Science},
volume = {2066},
pages = {147--164},
publisher = {Springer},
year = {2000}
}
@inproceedings{DBLP:conf/mabs/DavidSC00,
author = {Nuno David and
Jaime Sim{\~{a}}o Sichman and
Helder Coelho},
title = {Agent-Based Social Simulation with Coalitions in Social Reasoning},
booktitle = {{MABS}},
series = {Lecture Notes in Computer Science},
volume = {1979},
pages = {244--265},
publisher = {Springer},
year = {2000}
}
@proceedings{DBLP:conf/cc/2000,
editor = {David A. Watt},
title = {Compiler Construction, 9th International Conference, {CC} 2000, Held
as Part of the European Joint Conferences on the Theory and Practice
of Software, {ETAPS} 2000, Berlin, Germany, March 25 - April 2, 2000,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1781},
publisher = {Springer},
year = {2000}
}
@inproceedings{DBLP:conf/gcb/HeldenGWMEDW99,
author = {Jacques van Helden and
David R. Gilbert and
Lorenz Wernisch and
Renato Mancuso and
Matthew D. Eldridge and
Kirill Degtyarenko and
Shoshana J. Wodak},
title = {Logical Tools for Quering and Assisting Annotation of a Biochemical
Pathway Database},
booktitle = {German Conference on Bioinformatics},
pages = {227--229},
year = {1999}
}
@inproceedings{DBLP:conf/maamaw/DavidSC99,
author = {Nuno David and
Jaime Sim{\~{a}}o Sichman and
Helder Coelho},
title = {Extending Social Reasoning to Cope with Multiple Partner Coalitions},
booktitle = {{MAAMAW}},
series = {Lecture Notes in Computer Science},
volume = {1647},
pages = {175--187},
publisher = {Springer},
year = {1999}
}
@article{DBLP:journals/sigmod/BernsteinBCDFGGHHJLMNPSU98,
author = {Philip A. Bernstein and
Michael L. Brodie and
Stefano Ceri and
David J. DeWitt and
Michael J. Franklin and
Hector Garcia{-}Molina and
Jim Gray and
Gerald Held and
Joseph M. Hellerstein and
H. V. Jagadish and
Michael Lesk and
David Maier and
Jeffrey F. Naughton and
Hamid Pirahesh and
Michael Stonebraker and
Jeffrey D. Ullman},
title = {The Asilomar Report on Database Research},
journal = {{SIGMOD} Rec.},
volume = {27},
number = {4},
pages = {74--80},
year = {1998}
}
@proceedings{DBLP:conf/ep/1998,
editor = {Roger D. Hersch and
Jacques Andr{\'{e}} and
Heather Brown},
title = {Electronic Publishing, Artistic Imaging, and Digital Typography, 7th
International Conference on Electronic Publishing, {EP} '98, Held
Jointly with the 4th International Conference on Raster Imaging and
Digital Typography, {RIDT} '98, St. Malo, France, March 30 - April
3, 1998, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1375},
publisher = {Springer},
year = {1998}
}
@article{DBLP:journals/corr/cs-DB-9811013,
author = {Philip A. Bernstein and
Michael L. Brodie and
Stefano Ceri and
David J. DeWitt and
Michael J. Franklin and
Hector Garcia{-}Molina and
Jim Gray and
Gerald Held and
Joseph M. Hellerstein and
H. V. Jagadish and
Michael Lesk and
David Maier and
Jeffrey F. Naughton and
Hamid Pirahesh and
Michael Stonebraker and
Jeffrey D. Ullman},
title = {The Asilomar Report on Database Research},
journal = {CoRR},
volume = {cs.DB/9811013},
year = {1998}
}
@inproceedings{DBLP:conf/siggraph/Small97,
author = {David Small},
title = {Hand held tools for navigating information},
booktitle = {{SIGGRAPH} Visual Proceedings},
pages = {139},
publisher = {{ACM}},
year = {1997}
}
@inproceedings{DBLP:conf/soda/JohnsonMR96,
author = {David S. Johnson and
Lyle A. McGeoch and
Edward E. Rothberg},
title = {Asymptotic Experimental Analysis for the Held-Karp Traveling Salesman
Bound},
booktitle = {{SODA}},
pages = {341--350},
publisher = {{ACM/SIAM}},
year = {1996}
}
@inproceedings{DBLP:journals/oopsm/MonarchiHBJMRW94,
author = {David E. Monarchi and
Brian Henderson{-}Sellers and
Grady Booch and
Ivar Jacobson and
Stephen J. Mellor and
James E. Rumbaugh and
Rebecca Wirfs{-}Brock},
title = {"Methodology standards: help or hindrance?" held at {OOPSIA} 94 October
1994, Portland, Oregon: Report on panel},
booktitle = {{OOPSLA} Addendum},
pages = {54--58},
publisher = {{ACM}},
year = {1994}
}
@article{DBLP:journals/orl/Williamson92,
author = {David P. Williamson},
title = {Analysis of the Held-Karp lower bound for the asymmetric {TSP}},
journal = {Oper. Res. Lett.},
volume = {12},
number = {2},
pages = {83--88},
year = {1992}
}
@article{DBLP:journals/ipl/ShmoysW90,
author = {David B. Shmoys and
David P. Williamson},
title = {Analyzing the Held-Karp {TSP} Bound: {A} Monotonicity Property with
Application},
journal = {Inf. Process. Lett.},
volume = {35},
number = {6},
pages = {281--285},
year = {1990}
}
@article{DBLP:journals/sigmod/JosephTTW89,
author = {John Joseph and
Satish M. Thatte and
Craig W. Thompson and
David L. Wells},
title = {Report on the Object-Oriented Database Workshop, Held in Conjuction
with {OOPSLA} '88},
journal = {{SIGMOD} Rec.},
volume = {18},
number = {3},
pages = {78--101},
year = {1989}
}
@article{DBLP:journals/ibmrd/BajorekCRT74,
author = {Christopher H. Bajorek and
Charles W. Coker Jr. and
Lubomyr T. Romankiw and
David A. Thompson},
title = {Hand-Held Magnetoresistive Transducer},
journal = {{IBM} J. Res. Dev.},
volume = {18},
number = {6},
pages = {541--546},
year = {1974}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-09-05 07:29 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
