default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Stephen Tu"
download as .bib file
@article{DBLP:journals/compsec/TuptukH24,
author = {Nilufer Tuptuk and
Stephen Hailes},
title = {Identifying vulnerabilities of industrial control systems using evolutionary
multiobjective optimisation},
journal = {Comput. Secur.},
volume = {137},
pages = {103593},
year = {2024},
url = {https://doi.org/10.1016/j.cose.2023.103593},
doi = {10.1016/J.COSE.2023.103593},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/compsec/TuptukH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fcomp/TurnerMU24,
author = {Adam Brian Turner and
Stephen James McCombie and
Allon J. Uhlmann},
title = {Editorial: The impacts of cyber threat in the maritime ecosystem},
journal = {Frontiers Comput. Sci.},
volume = {6},
year = {2024},
url = {https://doi.org/10.3389/fcomp.2024.1378160},
doi = {10.3389/FCOMP.2024.1378160},
timestamp = {Mon, 08 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fcomp/TurnerMU24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmlr/TuFS24,
author = {Stephen Tu and
Roy Frostig and
Mahdi Soltanolkotabi},
title = {Learning from many trajectories},
journal = {J. Mach. Learn. Res.},
volume = {25},
pages = {216:1--216:109},
year = {2024},
url = {https://jmlr.org/papers/v25/23-1145.html},
timestamp = {Mon, 16 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmlr/TuFS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jors/PetropoulosLAAAABBBBBCCCCCCDDDEEEF24,
author = {Fotios Petropoulos and
Gilbert Laporte and
Emel Aktas and
Sibel A. Alumur and
Claudia Archetti and
Hayriye Ayhan and
Maria Battarra and
Julia A. Bennell and
Jean{-}Marie Bourjolly and
John E. Boylan and
Mich{\`{e}}le Breton and
David Canca and
Laurent Charlin and
Bo Chen and
Cihan Tugrul Cicek and
Louis Anthony Cox and
Christine S. M. Currie and
Erik Demeulemeester and
Li Ding and
Stephen M. Disney and
Matthias Ehrgott and
Martin J. Eppler and
G{\"{u}}nes Erdogan and
Bernard Fortz and
L. Alberto Franco and
Jens Frische and
Salvatore Greco and
Amanda J. Gregory and
Raimo P. H{\"{a}}m{\"{a}}l{\"{a}}inen and
Willy Herroelen and
Mike Hewitt and
Jan Holmstr{\"{o}}m and
John N. Hooker and
Tug{\c{c}}e Isik and
Jill Johnes and
Bahar Yetis Kara and
{\"{O}}zlem Karsu and
Katherine Kent and
Charlotte K{\"{o}}hler and
Martin H. Kunc and
Yong{-}Hong Kuo and
Adam N. Letchford and
Janny Leung and
Dong Li and
Haitao Li and
Judit Lienert and
Ivana Ljubic and
Andrea Lodi and
Sebasti{\'{a}}n Lozano and
Virginie Lurkin and
Silvano Martello and
Ian G. McHale and
Gerald Midgley and
John D. W. Morecroft and
Akshay Mutha and
Ceyda Oguz and
Sanja Petrovic and
Ulrich Pferschy and
Harilaos N. Psaraftis and
Sam Rose and
Lauri Saarinen and
Sa{\"{\i}}d Salhi and
Jing{-}Sheng Song and
Dimitrios Sotiros and
Kathryn E. Stecke and
Arne K. Strauss and
Isten{\c{c}} Tarhan and
Clemens Thielen and
Paolo Toth and
Tom Van Woensel and
Greet Vanden Berghe and
Christos Vasilakis and
Vikrant Vaze and
Daniele Vigo and
Kai Virtanen and
Xun Wang and
Rafal Weron and
Leroy White and
Mike Yearworth and
E. Alper Yildirim and
Georges Zaccour and
Xuying Zhao},
title = {Operational Research: methods and applications},
journal = {J. Oper. Res. Soc.},
volume = {75},
number = {3},
pages = {423--617},
year = {2024},
url = {https://doi.org/10.1080/01605682.2023.2253852},
doi = {10.1080/01605682.2023.2253852},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jors/PetropoulosLAAAABBBBBCCCCCCDDDEEEF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NishiPTCSZTNWDG24,
author = {Yoshinori Nishi and
John W. Poulton and
Walker J. Turner and
Xi Chen and
Sanquan Song and
Brian Zimmer and
Stephen G. Tell and
Nikola Nedovic and
John M. Wilson and
William J. Dally and
C. Thomas Gray},
title = {A 0.190-pJ/bit 25.2-Gb/s/wire Inverter-Based AC-Coupled Transceiver
for Short-Reach Die-to-Die Interfaces in 5-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {59},
number = {4},
pages = {1146--1157},
year = {2024},
url = {https://doi.org/10.1109/JSSC.2023.3338478},
doi = {10.1109/JSSC.2023.3338478},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/NishiPTCSZTNWDG24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qmi/TullSZC24,
author = {Sean Tull and
Razin A. Shaikh and
Sara Sabrina Zemljic and
Stephen Clark},
title = {From conceptual spaces to quantum concepts: formalising and learning
structured conceptual models},
journal = {Quantum Mach. Intell.},
volume = {6},
number = {1},
pages = {21},
year = {2024},
url = {https://doi.org/10.1007/s42484-023-00134-z},
doi = {10.1007/S42484-023-00134-Z},
timestamp = {Mon, 29 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/qmi/TullSZC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/BelyaevaGWWCSA24,
author = {Irina Belyaeva and
Ben Gabrielson and
Yu{-}Ping Wang and
Tony W. Wilson and
Vince D. Calhoun and
Julia M. Stephen and
T{\"{u}}lay Adali},
title = {Learning Spatiotemporal Brain Dynamics in Adolescents via Multimodal
{MEG} and fMRI Data Fusion Using Joint Tensor/Matrix Decomposition},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {71},
number = {7},
pages = {2189--2200},
year = {2024},
url = {https://doi.org/10.1109/TBME.2024.3364704},
doi = {10.1109/TBME.2024.3364704},
timestamp = {Fri, 02 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/BelyaevaGWWCSA24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/DrummondTD24,
author = {Ross Drummond and
Matthew C. Turner and
Stephen R. Duncan},
title = {Reduced-Order Neural Network Synthesis With Robustness Guarantees},
journal = {{IEEE} Trans. Neural Networks Learn. Syst.},
volume = {35},
number = {1},
pages = {1182--1191},
year = {2024},
url = {https://doi.org/10.1109/TNNLS.2022.3182893},
doi = {10.1109/TNNLS.2022.3182893},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tnn/DrummondTD24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvt/AiZKXNT24,
author = {Zhengyang Ai and
Weiting Zhang and
Jiawen Kang and
Minrui Xu and
Dusit Niyato and
Stephen John Turner},
title = {Identifier-Driven Resource Orchestration With Quantum Computing for
Differentiated Services in IoT-MMEC Networks},
journal = {{IEEE} Trans. Veh. Technol.},
volume = {73},
number = {7},
pages = {9958--9971},
year = {2024},
url = {https://doi.org/10.1109/TVT.2024.3364210},
doi = {10.1109/TVT.2024.3364210},
timestamp = {Thu, 22 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvt/AiZKXNT24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/CurryTCMKSHS24,
author = {Michael J. Curry and
Vinzenz Thoma and
Darshan Chakrabarti and
Stephen McAleer and
Christian Kroer and
Tuomas Sandholm and
Niao He and
Sven Seuken},
editor = {Michael J. Wooldridge and
Jennifer G. Dy and
Sriraam Natarajan},
title = {Automated Design of Affine Maximizer Mechanisms in Dynamic Settings},
booktitle = {Thirty-Eighth {AAAI} Conference on Artificial Intelligence, {AAAI}
2024, Thirty-Sixth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2024, Fourteenth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2014, February 20-27, 2024, Vancouver,
Canada},
pages = {9626--9635},
publisher = {{AAAI} Press},
year = {2024},
url = {https://doi.org/10.1609/aaai.v38i9.28819},
doi = {10.1609/AAAI.V38I9.28819},
timestamp = {Tue, 02 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/CurryTCMKSHS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eucnc/FayeCSSFBCDFFKMMPPST24,
author = {S{\'{e}}bastien Faye and
Miguel Camelo and
Jean{-}S{\'{e}}bastien Sottet and
Christoph Sommer and
Mario Franke and
Julien Baudouin and
German Castellanos and
R{\'{e}}gis Decorme and
Maria Pia Fanti and
Ramin Fuladi and
Gunes Kesik and
Beatriz Mendes and
Chris Murphy and
Stephen Parker and
Simon Pryor and
Sidi Mohammed Senouci and
Ion Turcanu},
title = {Integrating Network Digital Twinning into Future AI-based 6G Systems:
The 6G-TWIN Vision},
booktitle = {Joint European Conference on Networks and Communications {\&}
6G Summit, EuCNC/6G Summit 2024, Antwerp, Belgium, June 3-6, 2024},
pages = {883--888},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/EuCNC/6GSummit60053.2024.10597058},
doi = {10.1109/EUCNC/6GSUMMIT60053.2024.10597058},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eucnc/FayeCSSFBCDFFKMMPPST24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/Belyaeva0WCSA24,
author = {Irina Belyaeva and
Yu{-}Ping Wang and
Tony W. Wilson and
Vince D. Calhoun and
Julia M. Stephen and
T{\"{u}}lay Adali},
title = {Assessing Pediatric Cognitive Development via Multisensory Brain Imaging
Analysis},
booktitle = {32nd European Signal Processing Conference, {EUSIPCO} 2024, Lyon,
France, August 26-30, 2024},
pages = {1362--1366},
publisher = {{IEEE}},
year = {2024},
url = {https://ieeexplore.ieee.org/document/10714926},
timestamp = {Wed, 06 Nov 2024 15:31:16 +0100},
biburl = {https://dblp.org/rec/conf/eusipco/Belyaeva0WCSA24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/EloLTV24,
author = {Jenny Elo and
Juuli Lumivalo and
Tuure Tuunanen and
Stephen L. Vargo},
editor = {Tung X. Bui},
title = {Enabling Value Co-Creation in Partner Collaboration Ecosystems: An
Institutional Work Perspective},
booktitle = {57th Hawaii International Conference on System Sciences, {HICSS} 2024,
Hilton Hawaiian Village Waikiki Beach Resort, Hawaii, USA, January
3-6, 2024},
pages = {308--317},
publisher = {ScholarSpace},
year = {2024},
url = {https://hdl.handle.net/10125/106412},
timestamp = {Thu, 04 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/EloLTV24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hri/JansenMHTYBWL24,
author = {Chipp Jansen and
Zhengtao Ma and
Lissy Hatfield and
Boyuan Tuo and
Elif Ozden Yenigun and
Sharon Baurley and
Stephen Jia Wang and
Kun{-}Pyo Lee},
editor = {Dan Grollman and
Elizabeth Broadbent and
Wendy Ju and
Harold Soh and
Tom Williams},
title = {Textile Robotic Interaction for Designer-Robot Collaboration},
booktitle = {Companion of the 2024 {ACM/IEEE} International Conference on Human-Robot
Interaction, {HRI} 2024, Boulder, CO, USA, March 11-15, 2024},
pages = {563--567},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3610978.3640722},
doi = {10.1145/3610978.3640722},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hri/JansenMHTYBWL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/XieTSELZ24,
author = {Rong Xie and
Anqi Tu and
Chuang Shi and
Stephen Elliott and
Huiyong Li and
Le Zhang},
title = {Cognitive Virtual Sensing Technique for Feedforward Active Noise Control},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2024, Seoul, Republic of Korea, April 14-19, 2024},
pages = {981--985},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ICASSP48485.2024.10446463},
doi = {10.1109/ICASSP48485.2024.10446463},
timestamp = {Mon, 05 Aug 2024 15:26:37 +0200},
biburl = {https://dblp.org/rec/conf/icassp/XieTSELZ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/LiangSZLESHM24,
author = {Yongyuan Liang and
Yanchao Sun and
Ruijie Zheng and
Xiangyu Liu and
Benjamin Eysenbach and
Tuomas Sandholm and
Furong Huang and
Stephen Marcus McAleer},
title = {Game-Theoretic Robust Reinforcement Learning Handles Temporally-Coupled
Perturbations},
booktitle = {The Twelfth International Conference on Learning Representations,
{ICLR} 2024, Vienna, Austria, May 7-11, 2024},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/forum?id=wZWTHU7AsQ},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/LiangSZLESHM24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/McAleerLWBSF24,
author = {Stephen Marcus McAleer and
JB Lanier and
Kevin A. Wang and
Pierre Baldi and
Tuomas Sandholm and
Roy Fox},
title = {Toward Optimal Policy Population Growth in Two-Player Zero-Sum Games},
booktitle = {The Twelfth International Conference on Learning Representations,
{ICLR} 2024, Vienna, Austria, May 7-11, 2024},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/forum?id=J2TZgj3Tac},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/McAleerLWBSF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/MoskovitzSSSSDM24,
author = {Ted Moskovitz and
Aaditya K. Singh and
DJ Strouse and
Tuomas Sandholm and
Ruslan Salakhutdinov and
Anca D. Dragan and
Stephen Marcus McAleer},
title = {Confronting Reward Model Overoptimization with Constrained {RLHF}},
booktitle = {The Twelfth International Conference on Learning Representations,
{ICLR} 2024, Vienna, Austria, May 7-11, 2024},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/forum?id=gkfUvn0fLU},
timestamp = {Mon, 29 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/MoskovitzSSSSDM24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/LiPGYBGLDGMHLJL24,
author = {Nathaniel Li and
Alexander Pan and
Anjali Gopal and
Summer Yue and
Daniel Berrios and
Alice Gatti and
Justin D. Li and
Ann{-}Kathrin Dombrowski and
Shashwat Goel and
Gabriel Mukobi and
Nathan Helm{-}Burger and
Rassin Lababidi and
Lennart Justen and
Andrew B. Liu and
Michael Chen and
Isabelle Barrass and
Oliver Zhang and
Xiaoyuan Zhu and
Rishub Tamirisa and
Bhrugu Bharathi and
Ariel Herbert{-}Voss and
Cort B. Breuer and
Andy Zou and
Mantas Mazeika and
Zifan Wang and
Palash Oswal and
Weiran Lin and
Adam A. Hunt and
Justin Tienken{-}Harder and
Kevin Y. Shih and
Kemper Talley and
John Guan and
Ian Steneker and
David Campbell and
Brad Jokubaitis and
Steven Basart and
Stephen Fitz and
Ponnurangam Kumaraguru and
Kallol Krishna Karmakar and
Uday Kiran Tupakula and
Vijay Varadharajan and
Yan Shoshitaishvili and
Jimmy Ba and
Kevin M. Esvelt and
Alexandr Wang and
Dan Hendrycks},
title = {The {WMDP} Benchmark: Measuring and Reducing Malicious Use with Unlearning},
booktitle = {Forty-first International Conference on Machine Learning, {ICML} 2024,
Vienna, Austria, July 21-27, 2024},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/forum?id=xlr6AUDuJz},
timestamp = {Mon, 02 Sep 2024 16:45:29 +0200},
biburl = {https://dblp.org/rec/conf/icml/LiPGYBGLDGMHLJL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/TuDCGG24,
author = {Weijie Tu and
Weijian Deng and
Dylan Campbell and
Stephen Gould and
Tom Gedeon},
title = {An Empirical Study Into What Matters for Calibrating Vision-Language
Models},
booktitle = {Forty-first International Conference on Machine Learning, {ICML} 2024,
Vienna, Austria, July 21-27, 2024},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/forum?id=qoxuPshrZb},
timestamp = {Mon, 02 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/TuDCGG24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/ZiemannTPM24,
author = {Ingvar M. Ziemann and
Stephen Tu and
George J. Pappas and
Nikolai Matni},
title = {Sharp Rates in Dependent Learning Theory: Avoiding Sample Size Deflation
for the Square Loss},
booktitle = {Forty-first International Conference on Machine Learning, {ICML} 2024,
Vienna, Austria, July 21-27, 2024},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/forum?id=DHtF8Y6PqS},
timestamp = {Mon, 02 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/ZiemannTPM24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/ONeillRMGPLPGMJ24,
author = {Abby O'Neill and
Abdul Rehman and
Abhiram Maddukuri and
Abhishek Gupta and
Abhishek Padalkar and
Abraham Lee and
Acorn Pooley and
Agrim Gupta and
Ajay Mandlekar and
Ajinkya Jain and
Albert Tung and
Alex Bewley and
Alexander Herzog and
Alex Irpan and
Alexander Khazatsky and
Anant Rai and
Anchit Gupta and
Andrew Wang and
Anikait Singh and
Animesh Garg and
Aniruddha Kembhavi and
Annie Xie and
Anthony Brohan and
Antonin Raffin and
Archit Sharma and
Arefeh Yavary and
Arhan Jain and
Ashwin Balakrishna and
Ayzaan Wahid and
Ben Burgess{-}Limerick and
Beomjoon Kim and
Bernhard Sch{\"{o}}lkopf and
Blake Wulfe and
Brian Ichter and
Cewu Lu and
Charles Xu and
Charlotte Le and
Chelsea Finn and
Chen Wang and
Chenfeng Xu and
Cheng Chi and
Chenguang Huang and
Christine Chan and
Christopher Agia and
Chuer Pan and
Chuyuan Fu and
Coline Devin and
Danfei Xu and
Daniel Morton and
Danny Driess and
Daphne Chen and
Deepak Pathak and
Dhruv Shah and
Dieter B{\"{u}}chler and
Dinesh Jayaraman and
Dmitry Kalashnikov and
Dorsa Sadigh and
Edward Johns and
Ethan Paul Foster and
Fangchen Liu and
Federico Ceola and
Fei Xia and
Feiyu Zhao and
Freek Stulp and
Gaoyue Zhou and
Gaurav S. Sukhatme and
Gautam Salhotra and
Ge Yan and
Gilbert Feng and
Giulio Schiavi and
Glen Berseth and
Gregory Kahn and
Guanzhi Wang and
Hao Su and
Haoshu Fang and
Haochen Shi and
Henghui Bao and
Heni Ben Amor and
Henrik I. Christensen and
Hiroki Furuta and
Homer Walke and
Hongjie Fang and
Huy Ha and
Igor Mordatch and
Ilija Radosavovic and
Isabel Leal and
Jacky Liang and
Jad Abou{-}Chakra and
Jaehyung Kim and
Jaimyn Drake and
Jan Peters and
Jan Schneider and
Jasmine Hsu and
Jeannette Bohg and
Jeffrey Bingham and
Jeffrey Wu and
Jensen Gao and
Jiaheng Hu and
Jiajun Wu and
Jialin Wu and
Jiankai Sun and
Jianlan Luo and
Jiayuan Gu and
Jie Tan and
Jihoon Oh and
Jimmy Wu and
Jingpei Lu and
Jingyun Yang and
Jitendra Malik and
Jo{\~{a}}o Silv{\'{e}}rio and
Joey Hejna and
Jonathan Booher and
Jonathan Tompson and
Jonathan Yang and
Jordi Salvador and
Joseph J. Lim and
Junhyek Han and
Kaiyuan Wang and
Kanishka Rao and
Karl Pertsch and
Karol Hausman and
Keegan Go and
Keerthana Gopalakrishnan and
Ken Goldberg and
Kendra Byrne and
Kenneth Oslund and
Kento Kawaharazuka and
Kevin Black and
Kevin Lin and
Kevin Zhang and
Kiana Ehsani and
Kiran Lekkala and
Kirsty Ellis and
Krishan Rana and
Krishnan Srinivasan and
Kuan Fang and
Kunal Pratap Singh and
Kuo{-}Hao Zeng and
Kyle Hatch and
Kyle Hsu and
Laurent Itti and
Lawrence Yunliang Chen and
Lerrel Pinto and
Li Fei{-}Fei and
Liam Tan and
Linxi Jim Fan and
Lionel Ott and
Lisa Lee and
Luca Weihs and
Magnum Chen and
Marion Lepert and
Marius Memmel and
Masayoshi Tomizuka and
Masha Itkina and
Mateo Guaman Castro and
Max Spero and
Maximilian Du and
Michael Ahn and
Michael C. Yip and
Mingtong Zhang and
Mingyu Ding and
Minho Heo and
Mohan Kumar Srirama and
Mohit Sharma and
Moo Jin Kim and
Naoaki Kanazawa and
Nicklas Hansen and
Nicolas Heess and
Nikhil J. Joshi and
Niko S{\"{u}}nderhauf and
Ning Liu and
Norman Di Palo and
Nur Muhammad (Mahi) Shafiullah and
Oier Mees and
Oliver Kroemer and
Osbert Bastani and
Pannag R. Sanketi and
Patrick Tree Miller and
Patrick Yin and
Paul Wohlhart and
Peng Xu and
Peter David Fagan and
Peter Mitrano and
Pierre Sermanet and
Pieter Abbeel and
Priya Sundaresan and
Qiuyu Chen and
Quan Vuong and
Rafael Rafailov and
Ran Tian and
Ria Doshi and
Roberto Mart{\'{\i}}n{-}Mart{\'{\i}}n and
Rohan Baijal and
Rosario Scalise and
Rose Hendrix and
Roy Lin and
Runjia Qian and
Ruohan Zhang and
Russell Mendonca and
Rutav Shah and
Ryan Hoque and
Ryan Julian and
Samuel Bustamante and
Sean Kirmani and
Sergey Levine and
Shan Lin and
Sherry Moore and
Shikhar Bahl and
Shivin Dass and
Shubham D. Sonawani and
Shuran Song and
Sichun Xu and
Siddhant Haldar and
Siddharth Karamcheti and
Simeon Adebola and
Simon Guist and
Soroush Nasiriany and
Stefan Schaal and
Stefan Welker and
Stephen Tian and
Subramanian Ramamoorthy and
Sudeep Dasari and
Suneel Belkhale and
Sungjae Park and
Suraj Nair and
Suvir Mirchandani and
Takayuki Osa and
Tanmay Gupta and
Tatsuya Harada and
Tatsuya Matsushima and
Ted Xiao and
Thomas Kollar and
Tianhe Yu and
Tianli Ding and
Todor Davchev and
Tony Z. Zhao and
Travis Armstrong and
Trevor Darrell and
Trinity Chung and
Vidhi Jain and
Vincent Vanhoucke and
Wei Zhan and
Wenxuan Zhou and
Wolfram Burgard and
Xi Chen and
Xiaolong Wang and
Xinghao Zhu and
Xinyang Geng and
Xiyuan Liu and
Liangwei Xu and
Xuanlin Li and
Yao Lu and
Yecheng Jason Ma and
Yejin Kim and
Yevgen Chebotar and
Yifan Zhou and
Yifeng Zhu and
Yilin Wu and
Ying Xu and
Yixuan Wang and
Yonatan Bisk and
Yoonyoung Cho and
Youngwoon Lee and
Yuchen Cui and
Yue Cao and
Yueh{-}Hua Wu and
Yujin Tang and
Yuke Zhu and
Yunchu Zhang and
Yunfan Jiang and
Yunshuang Li and
Yunzhu Li and
Yusuke Iwasawa and
Yutaka Matsuo and
Zehan Ma and
Zhuo Xu and
Zichen Jeff Cui and
Zichen Zhang and
Zipeng Lin},
title = {Open X-Embodiment: Robotic Learning Datasets and {RT-X} Models : Open
X-Embodiment Collaboration},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2024, Yokohama, Japan, May 13-17, 2024},
pages = {6892--6903},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ICRA57147.2024.10611477},
doi = {10.1109/ICRA57147.2024.10611477},
timestamp = {Tue, 12 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icra/ONeillRMGPLPGMJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/InceBDFG24,
author = {Turker Ince and
Steven Beninati and
Ozer Can Devecioglu and
Stephen J. Frasier and
Moncef Gabbouj},
title = {Water Region Segmentation in {SAR} Images Based on Compact Operational
Unets},
booktitle = {{IGARSS} 2024 - 2024 {IEEE} International Geoscience and Remote Sensing
Symposium, Athens, Greece, July 7-12, 2024},
pages = {8237--8241},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/IGARSS53475.2024.10641981},
doi = {10.1109/IGARSS53475.2024.10641981},
timestamp = {Thu, 26 Sep 2024 12:36:11 +0200},
biburl = {https://dblp.org/rec/conf/igarss/InceBDFG24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/0001ZCDM0SS24,
author = {Paul Friedrich and
Yulun Zhang and
Michael J. Curry and
Ludwig Dierks and
Stephen McAleer and
Jiaoyang Li and
Tuomas Sandholm and
Sven Seuken},
title = {Scalable Mechanism Design for Multi-Agent Path Finding},
booktitle = {Proceedings of the Thirty-Third International Joint Conference on
Artificial Intelligence, {IJCAI} 2024, Jeju, South Korea, August 3-9,
2024},
pages = {58--66},
publisher = {ijcai.org},
year = {2024},
url = {https://www.ijcai.org/proceedings/2024/7},
timestamp = {Fri, 25 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/0001ZCDM0SS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/memea/BuchananTCMF24,
author = {Russell Buchanan and
Shihfan Jack Tu and
Marco Camurri and
Stephen J. Mellon and
Maurice F. Fallon},
title = {3D Freehand Ultrasound using Visual Inertial and Deep Inertial Odometry
for Measuring Patellar Tracking},
booktitle = {{IEEE} International Symposium on Medical Measurements and Applications,
MeMeA 2024, Eindhoven, The Netherlands, June 26-28, 2024},
pages = {1--6},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/MeMeA60663.2024.10596905},
doi = {10.1109/MEMEA60663.2024.10596905},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/memea/BuchananTCMF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mie/TurnerIGBSHHOVK24,
author = {Jonathan Turner and
Sin{\'{e}}ad Impey and
Frances Gibbons and
Anthony M. Bolger and
Gaye Stephens and
Lucy Hederman and
Ramisa Hamed and
Ciara O'Meara and
Ferran de la Varga and
John Kommala and
Matthew Nicholson and
Daniel Farrell and
Miriam Galvin and
Mark Heverin and
{\'{E}}anna Mac Domhnaill and
Robert McFarlane and
Dara Meldrum and
Deirdre Murray and
Orla Hardiman},
editor = {John Mantas and
Arie Hasman and
George Demiris and
Kaija Saranto and
Michael Marschollek and
Theodoros N. Arvanitis and
Ivana Ognjanovic and
Arriel Benis and
Parisis Gallos and
Emmanouil Zoulias and
Elisavet Andrikopoulou},
title = {Data and Process Harmonisation of Multi-National, Multi-Site Research
Data},
booktitle = {Digital Health and Informatics Innovations for Sustainable Health
Care Systems - Proceedings of {MIE} 2024, Athens, Greece, 25-29 August
2024},
series = {Studies in Health Technology and Informatics},
volume = {316},
pages = {1411--1412},
publisher = {{IOS} Press},
year = {2024},
url = {https://doi.org/10.3233/SHTI240675},
doi = {10.3233/SHTI240675},
timestamp = {Tue, 15 Oct 2024 14:17:47 +0200},
biburl = {https://dblp.org/rec/conf/mie/TurnerIGBSHHOVK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigdial/TuPMFCDC24,
author = {Sichang Tu and
Abigail Powers and
Natalie Merrill and
Negar Fani and
Sierra Carter and
Stephen Doogan and
Jinho D. Choi},
editor = {Tatsuya Kawahara and
Vera Demberg and
Stefan Ultes and
Koji Inoue and
Shikib Mehri and
David M. Howcroft and
Kazunori Komatani},
title = {Automating {PTSD} Diagnostics in Clinical Interviews: Leveraging Large
Language Models for Trauma Assessments},
booktitle = {Proceedings of the 25th Annual Meeting of the Special Interest Group
on Discourse and Dialogue, {SIGDIAL} 2024, Kyoto, Japan, September
18 - 20, 2024},
pages = {644--663},
publisher = {Association for Computational Linguistics},
year = {2024},
url = {https://aclanthology.org/2024.sigdial-1.55},
timestamp = {Fri, 04 Oct 2024 16:06:14 +0200},
biburl = {https://dblp.org/rec/conf/sigdial/TuPMFCDC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/VyasMPHKWZDLKMP24,
author = {Pratik B. Vyas and
Ludovico Megalini and
Ashish Pal and
Joshua Holt and
Archana Kumar and
Stephen Weeks and
Charisse Zhao and
Lucien Date and
Hansel Lo and
Michel Khoury and
Safdar Muhammad and
Fabian Piallat and
Ricky Fang and
William Charles and
Pratim Palit and
Jinghe Yang and
Qintao Zhang and
Jang Seok Oh and
Bryan Turner and
Samphy Hong and
Aswin Prathap Pitchiya and
Benjamin Briggs and
Jiao Yang and
Dae Yang and
Fengshou Wang and
Joseph Lee and
Gopal Prabhu and
Dustin Ho and
Carlos Caballero and
Durga Chaturvedula and
Zheng Yuan and
Yi Zheng and
David A. Britz and
Stephen Krause and
Raghav Sreenivasan and
Michael Chudzik and
Subi Kengeri and
Siddarth A. Krishnan and
El Mehdi Bazizi},
title = {Novel Material, Process and Device Innovations for Next Generation
Silicon Carbide (SiC) Trench {MOSFET} Technology},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits 2024, Honolulu,
HI, USA, June 16-20, 2024},
pages = {1--2},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/VLSITechnologyandCir46783.2024.10631445},
doi = {10.1109/VLSITECHNOLOGYANDCIR46783.2024.10631445},
timestamp = {Fri, 18 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/VyasMPHKWZDLKMP24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/VuGHCI24,
author = {Tung T. Vu and
Swaroop Gopalam and
Stephen V. Hanly and
Iain B. Collings and
Hazer Inaltekin},
title = {Minimizing Clearing Time in mmWave Networks with Overlapping Coverage},
booktitle = {99th {IEEE} Vehicular Technology Conference, {VTC} Spring 2024, Singapore,
June 24-27, 2024},
pages = {1--6},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/VTC2024-Spring62846.2024.10683319},
doi = {10.1109/VTC2024-SPRING62846.2024.10683319},
timestamp = {Mon, 07 Oct 2024 22:58:56 +0200},
biburl = {https://dblp.org/rec/conf/vtc/VuGHCI24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-08585,
author = {Sean Tull and
Razin A. Shaikh and
Sara Sabrina Zemljic and
Stephen Clark},
title = {From Conceptual Spaces to Quantum Concepts: Formalising and Learning
Structured Conceptual Models},
journal = {CoRR},
volume = {abs/2401.08585},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2401.08585},
doi = {10.48550/ARXIV.2401.08585},
eprinttype = {arXiv},
eprint = {2401.08585},
timestamp = {Wed, 07 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2401-08585.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-17044,
author = {Paul Friedrich and
Yulun Zhang and
Michael J. Curry and
Ludwig Dierks and
Stephen McAleer and
Jiaoyang Li and
Tuomas Sandholm and
Sven Seuken},
title = {Scalable Mechanism Design for Multi-Agent Path Finding},
journal = {CoRR},
volume = {abs/2401.17044},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2401.17044},
doi = {10.48550/ARXIV.2401.17044},
eprinttype = {arXiv},
eprint = {2401.17044},
timestamp = {Fri, 25 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2401-17044.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-05928,
author = {Ingvar M. Ziemann and
Stephen Tu and
George J. Pappas and
Nikolai Matni},
title = {Sharp Rates in Dependent Learning Theory: Avoiding Sample Size Deflation
for the Square Loss},
journal = {CoRR},
volume = {abs/2402.05928},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.05928},
doi = {10.48550/ARXIV.2402.05928},
eprinttype = {arXiv},
eprint = {2402.05928},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-05928.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-07417,
author = {Weijie Tu and
Weijian Deng and
Dylan Campbell and
Stephen Gould and
Tom Gedeon},
title = {An Empirical Study Into What Matters for Calibrating Vision-Language
Models},
journal = {CoRR},
volume = {abs/2402.07417},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.07417},
doi = {10.48550/ARXIV.2402.07417},
eprinttype = {arXiv},
eprint = {2402.07417},
timestamp = {Fri, 16 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-07417.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-08129,
author = {Michael J. Curry and
Vinzenz Thoma and
Darshan Chakrabarti and
Stephen McAleer and
Christian Kroer and
Tuomas Sandholm and
Niao He and
Sven Seuken},
title = {Automated Design of Affine Maximizer Mechanisms in Dynamic Settings},
journal = {CoRR},
volume = {abs/2402.08129},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.08129},
doi = {10.48550/ARXIV.2402.08129},
eprinttype = {arXiv},
eprint = {2402.08129},
timestamp = {Mon, 19 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-08129.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-03218,
author = {Nathaniel Li and
Alexander Pan and
Anjali Gopal and
Summer Yue and
Daniel Berrios and
Alice Gatti and
Justin D. Li and
Ann{-}Kathrin Dombrowski and
Shashwat Goel and
Long Phan and
Gabriel Mukobi and
Nathan Helm{-}Burger and
Rassin Lababidi and
Lennart Justen and
Andrew B. Liu and
Michael Chen and
Isabelle Barrass and
Oliver Zhang and
Xiaoyuan Zhu and
Rishub Tamirisa and
Bhrugu Bharathi and
Adam Khoja and
Zhenqi Zhao and
Ariel Herbert{-}Voss and
Cort B. Breuer and
Andy Zou and
Mantas Mazeika and
Zifan Wang and
Palash Oswal and
Weiran Liu and
Adam A. Hunt and
Justin Tienken{-}Harder and
Kevin Y. Shih and
Kemper Talley and
John Guan and
Russell Kaplan and
Ian Steneker and
David Campbell and
Brad Jokubaitis and
Alex Levinson and
Jean Wang and
William Qian and
Kallol Krishna Karmakar and
Steven Basart and
Stephen Fitz and
Mindy Levine and
Ponnurangam Kumaraguru and
Uday Kiran Tupakula and
Vijay Varadharajan and
Yan Shoshitaishvili and
Jimmy Ba and
Kevin M. Esvelt and
Alexandr Wang and
Dan Hendrycks},
title = {The {WMDP} Benchmark: Measuring and Reducing Malicious Use With Unlearning},
journal = {CoRR},
volume = {abs/2403.03218},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.03218},
doi = {10.48550/ARXIV.2403.03218},
eprinttype = {arXiv},
eprint = {2403.03218},
timestamp = {Tue, 20 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-03218.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-07953,
author = {Geonhwa Jeong and
Po{-}An Tsai and
Abhimanyu Rajeshkumar Bambhaniya and
Stephen W. Keckler and
Tushar Krishna},
title = {Abstracting Sparse {DNN} Acceleration via Structured Sparse Tensor
Decomposition},
journal = {CoRR},
volume = {abs/2403.07953},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.07953},
doi = {10.48550/ARXIV.2403.07953},
eprinttype = {arXiv},
eprint = {2403.07953},
timestamp = {Thu, 04 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-07953.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-09097,
author = {Naifeng Zhang and
Stephen McAleer and
Tuomas Sandholm},
title = {Faster Game Solving via Hyperparameter Schedules},
journal = {CoRR},
volume = {abs/2404.09097},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2404.09097},
doi = {10.48550/ARXIV.2404.09097},
eprinttype = {arXiv},
eprint = {2404.09097},
timestamp = {Wed, 15 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2404-09097.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-09932,
author = {Usman Anwar and
Abulhair Saparov and
Javier Rando and
Daniel Paleka and
Miles Turpin and
Peter Hase and
Ekdeep Singh Lubana and
Erik Jenner and
Stephen Casper and
Oliver Sourbut and
Benjamin L. Edelman and
Zhaowei Zhang and
Mario G{\"{u}}nther and
Anton Korinek and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Lewis Hammond and
Eric J. Bigelow and
Alexander Pan and
Lauro Langosco and
Tomasz Korbak and
Heidi Zhang and
Ruiqi Zhong and
Se{\'{a}}n {\'{O}} h{\'{E}}igeartaigh and
Gabriel Recchia and
Giulio Corsi and
Alan Chan and
Markus Anderljung and
Lilian Edwards and
Yoshua Bengio and
Danqi Chen and
Samuel Albanie and
Tegan Maharaj and
Jakob N. Foerster and
Florian Tram{\`{e}}r and
He He and
Atoosa Kasirzadeh and
Yejin Choi and
David Krueger},
title = {Foundational Challenges in Assuring Alignment and Safety of Large
Language Models},
journal = {CoRR},
volume = {abs/2404.09932},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2404.09932},
doi = {10.48550/ARXIV.2404.09932},
eprinttype = {arXiv},
eprint = {2404.09932},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2404-09932.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-15847,
author = {Russell Buchanan and
Shihfan Jack Tu and
Marco Camurri and
Stephen J. Mellon and
Maurice F. Fallon},
title = {3D Freehand Ultrasound using Visual Inertial and Deep Inertial Odometry
for Measuring Patellar Tracking},
journal = {CoRR},
volume = {abs/2404.15847},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2404.15847},
doi = {10.48550/ARXIV.2404.15847},
eprinttype = {arXiv},
eprint = {2404.15847},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2404-15847.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-11178,
author = {Sichang Tu and
Abigail Powers and
Natalie Merrill and
Negar Fani and
Sierra Carter and
Stephen Doogan and
Jinho D. Choi},
title = {Automating {PTSD} Diagnostics in Clinical Interviews: Leveraging Large
Language Models for Trauma Assessments},
journal = {CoRR},
volume = {abs/2405.11178},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2405.11178},
doi = {10.48550/ARXIV.2405.11178},
eprinttype = {arXiv},
eprint = {2405.11178},
timestamp = {Wed, 12 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2405-11178.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2406-13868,
author = {Geonhwa Jeong and
Po{-}An Tsai and
Stephen W. Keckler and
Tushar Krishna},
title = {{SDQ:} Sparse Decomposed Quantization for {LLM} Inference},
journal = {CoRR},
volume = {abs/2406.13868},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2406.13868},
doi = {10.48550/ARXIV.2406.13868},
eprinttype = {arXiv},
eprint = {2406.13868},
timestamp = {Fri, 12 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2406-13868.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2406-17583,
author = {Sean Tull and
Robin Lorenz and
Stephen Clark and
Ilyas Khan and
Bob Coecke},
title = {Towards Compositional Interpretability for {XAI}},
journal = {CoRR},
volume = {abs/2406.17583},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2406.17583},
doi = {10.48550/ARXIV.2406.17583},
eprinttype = {arXiv},
eprint = {2406.17583},
timestamp = {Mon, 22 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2406-17583.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2409-12382,
author = {Paul Lutkus and
Deepika Anantharaman and
Stephen Tu and
Lars Lindemann},
title = {Incremental Composition of Learned Control Barrier Functions in Unknown
Environments},
journal = {CoRR},
volume = {abs/2409.12382},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2409.12382},
doi = {10.48550/ARXIV.2409.12382},
eprinttype = {arXiv},
eprint = {2409.12382},
timestamp = {Thu, 17 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2409-12382.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/TurnerKGU23,
author = {Stephen W. Turner and
Murat Karakus and
Evrim Guler and
Suleyman Uludag},
title = {A Promising Integration of {SDN} and Blockchain for IoT Networks:
{A} Survey},
journal = {{IEEE} Access},
volume = {11},
pages = {29800--29822},
year = {2023},
url = {https://doi.org/10.1109/ACCESS.2023.3260777},
doi = {10.1109/ACCESS.2023.3260777},
timestamp = {Sat, 29 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/TurnerKGU23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/CoudertGCPBNSRBBAAAABBNB23,
author = {Elisabeth Coudert and
Sebastien Gehant and
Edouard De Castro and
Monica Pozzato and
Delphine Baratin and
Teresa Batista Neto and
Christian J. A. Sigrist and
Nicole Redaschi and
Alan J. Bridge and
Lucila Aimo and
Ghislaine Argoud{-}Puy and
Andrea H. Auchincloss and
Kristian B. Axelsen and
Parit Bansal and
Marie{-}Claude Blatter and
Jerven T. Bolleman and
Emmanuel Boutet and
Lionel Breuza and
Blanca Cabrera Gil and
Cristina Casals{-}Casas and
Kamal Chikh Echioukh and
B{\'{e}}atrice A. Cuche and
Anne Estreicher and
Maria Livia Famiglietti and
Marc Feuermann and
Elisabeth Gasteiger and
Pascale Gaudet and
Vivienne Baillie Gerritsen and
Arnaud Gos and
Nadine Gruaz{-}Gumowski and
Chantal Hulo and
Nevila Hyka{-}Nouspikel and
Florence Jungo and
Arnaud Kerhornou and
Philippe Le Mercier and
Damien Lieberherr and
Patrick Masson and
Anne Morgat and
Venkatesh Muthukrishnan and
Salvo Paesano and
Ivo Pedruzzi and
Sandrine Pilbout and
Lucille Pourcel and
Sylvain Poux and
Manuela Pruess and
Catherine Rivoire and
Karin Sonesson and
Shyamala Sundaram and
Alex Bateman and
Maria Jesus Martin and
Sandra E. Orchard and
Michele Magrane and
Shadab Ahmad and
Emanuele Alpi and
Emily H. Bowler{-}Barnett and
Ramona Britto and
Hema Bye{-}A{-}Jee and
Austra Cukura and
Paul Denny and
Tunca Dogan and
Thankgod Ebenezer and
Jun Fan and
Penelope Garmiri and
Leonardo Jose da Costa Gonzales and
Emma Hatton{-}Ellis and
Abdulrahman Hussein and
Alexandr Ignatchenko and
Giuseppe Insana and
Rizwan Ishtiaq and
Vishal Joshi and
Dushyanth Jyothi and
Swaathi Kandasamy and
Antonia Lock and
Aurelien Luciani and
Marija Lugaric and
Jie Luo and
Yvonne Lussi and
Alistair MacDougall and
F{\'{a}}bio Madeira and
Mahdi Mahmoudy and
Alok Mishra and
Katie Moulang and
Andrew Nightingale and
Sangya Pundir and
Guoying Qi and
Shriya Raj and
Pedro Raposo and
Daniel Rice and
Rabie Saidi and
Rafael Santos and
Elena Speretta and
James D. Stephenson and
Prabhat Totoo and
Edward Turner and
Nidhi Tyagi and
Preethi Vasudev and
Kate Warner and
Xavier Watkins and
Rossana Zaru and
Hermann Zellner and
Cathy H. Wu and
Cecilia N. Arighi and
Leslie Arminski and
Chuming Chen and
Yongxing Chen and
Hongzhan Huang and
Kati Laiho and
Peter B. McGarvey and
Darren A. Natale and
Karen Ross and
C. R. Vinayaka and
Qinghua Wang and
Yuqi Wang},
title = {Annotation of biologically relevant ligands in UniProtKB using ChEBI},
journal = {Bioinform.},
volume = {39},
number = {1},
year = {2023},
url = {https://doi.org/10.1093/bioinformatics/btac793},
doi = {10.1093/BIOINFORMATICS/BTAC793},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/CoudertGCPBNSRBBAAAABBNB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cphysics/FattebertDPT23,
author = {Jean{-}Luc Fattebert and
Stephen Dewitt and
Aurelien Perron and
John Turner},
title = {Thermo4PFM: Facilitating Phase-field simulations of alloys with thermodynamic
driving forces},
journal = {Comput. Phys. Commun.},
volume = {288},
pages = {108739},
year = {2023},
url = {https://doi.org/10.1016/j.cpc.2023.108739},
doi = {10.1016/J.CPC.2023.108739},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cphysics/FattebertDPT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csm/GuoNRSORYSKIB23,
author = {Jianlin Guo and
Yukimasa Nagai and
Benjamin A. Rolfe and
Takenori Sumi and
Philip V. Orlik and
Joerg Robert and
Kazuto Yano and
Steve Shellhammer and
Shoichi Kitazawa and
Yasuhiko Inoue and
Tuncer Baykas},
title = {{IEEE} 802.19.3 Coexistence Recommendations for {IEEE} 802.11 and
{IEEE} 802.15.4 Based Systems Operating in {SUB-1} GHz Frequency Bands},
journal = {{IEEE} Commun. Stand. Mag.},
volume = {7},
number = {2},
pages = {72--82},
year = {2023},
url = {https://doi.org/10.1109/MCOMSTD.0009.2100046},
doi = {10.1109/MCOMSTD.0009.2100046},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csm/GuoNRSORYSKIB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/KeletiLLLR23,
author = {Tam{\'{a}}s Keleti and
Stephen Lacina and
Changshuo Liu and
Mengzhen Liu and
Jos{\'{e}} Ram{\'{o}}n Tuir{\'{a}}n Rangel},
title = {Tiling of rectangles with squares and related problems via Diophantine
approximation},
journal = {Discret. Math.},
volume = {346},
number = {9},
pages = {113442},
year = {2023},
url = {https://doi.org/10.1016/j.disc.2023.113442},
doi = {10.1016/J.DISC.2023.113442},
timestamp = {Tue, 12 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dm/KeletiLLLR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fini/WangAABDHKLMMPRSTWWT23,
author = {Lei Wang and
Jos{\'{e}} Luis Ambite and
Abhishek M. Appaji and
Janine Bijsterbosch and
J{\'{e}}r{\^{o}}me Dock{\`{e}}s and
Rick Herrick and
Alexander Kogan and
Howard Lander and
Daniel S. Marcus and
Stephen Moore and
Jean{-}Baptiste Poline and
Arcot Rajasekar and
Satya S. Sahoo and
Matthew D. Turner and
Xiaochen Wang and
Yue Wang and
Jessica A. Turner},
title = {NeuroBridge: a prototype platform for discovery of the long-tail neuroimaging
data},
journal = {Frontiers Neuroinformatics},
volume = {17},
year = {2023},
url = {https://doi.org/10.3389/fninf.2023.1215261},
doi = {10.3389/FNINF.2023.1215261},
timestamp = {Tue, 13 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fini/WangAABDHKLMMPRSTWWT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieeesp/TurnerMU23,
author = {Adam Brian Turner and
Stephen McCombie and
Allon J. Uhlmann},
title = {Ransomware-Bitcoin Threat Intelligence Sharing Using Structured Threat
Information Expression},
journal = {{IEEE} Secur. Priv.},
volume = {21},
number = {3},
pages = {47--57},
year = {2023},
url = {https://doi.org/10.1109/MSEC.2022.3166282},
doi = {10.1109/MSEC.2022.3166282},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieeesp/TurnerMU23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ior/AravenaMZPCTWWW23,
author = {Ignacio Aravena and
Daniel K. Molzahn and
Shixuan Zhang and
Cosmin G. Petra and
Frank E. Curtis and
Shenyinying Tu and
Andreas W{\"{a}}chter and
Ermin Wei and
Elizabeth Wong and
Amin Gholami and
Kaizhao Sun and
Xu Andy Sun and
Stephen T. Elbert and
Jesse Holzer and
Arun Veeramany},
title = {Recent Developments in Security-Constrained {AC} Optimal Power Flow:
Overview of Challenge 1 in the {ARPA-E} Grid Optimization Competition},
journal = {Oper. Res.},
volume = {71},
number = {6},
pages = {1997--2014},
year = {2023},
url = {https://doi.org/10.1287/opre.2022.0315},
doi = {10.1287/OPRE.2022.0315},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ior/AravenaMZPCTWWW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/YangVSTG23,
author = {Siyue Yang and
Paul Varghese and
Ellen Stephenson and
Karen Tu and
Jessica L. Gronsbell},
title = {Machine learning approaches for electronic health records phenotyping:
a methodical review},
journal = {J. Am. Medical Informatics Assoc.},
volume = {30},
number = {2},
pages = {367--381},
year = {2023},
url = {https://doi.org/10.1093/jamia/ocac216},
doi = {10.1093/JAMIA/OCAC216},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/YangVSTG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/WoenselTMAAABCEHRKKMMMPRTWP23,
author = {William Van Woensel and
Samson W. Tu and
Wojtek Michalowski and
Syed Sibte Raza Abidi and
Samina Abidi and
Jos{\'{e}} Ram{\'{o}}n Alonso and
Alessio Bottrighi and
Marc Carrier and
Ruth Edry and
Irit Hochberg and
Malvika Rao and
Stephen P. Kingwell and
Alexandra Kogan and
Mar Marcos and
Bego{\~{n}}a Mart{\'{\i}}nez{-}Salvador and
Martin Michalowski and
Luca Piovesan and
David Ria{\~{n}}o and
Paolo Terenziani and
Szymon Wilk and
Mor Peleg},
title = {A community-of-practice-based evaluation methodology for knowledge
intensive computational methods and its application to multimorbidity
decision support},
journal = {J. Biomed. Informatics},
volume = {142},
pages = {104395},
year = {2023},
url = {https://doi.org/10.1016/j.jbi.2023.104395},
doi = {10.1016/J.JBI.2023.104395},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jbi/WoenselTMAAABCEHRKKMMMPRTWP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NishiPTCSZTNWDG23,
author = {Yoshinori Nishi and
John W. Poulton and
Walker J. Turner and
Xi Chen and
Sanquan Song and
Brian Zimmer and
Stephen G. Tell and
Nikola Nedovic and
John M. Wilson and
William J. Dally and
C. Thomas Gray},
title = {A 0.297-pJ/Bit 50.4-Gb/s/Wire Inverter-Based Short-Reach Simultaneous
Bi-Directional Transceiver for Die-to-Die Interface in 5-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {58},
number = {4},
pages = {1062--1073},
year = {2023},
url = {https://doi.org/10.1109/JSSC.2022.3232024},
doi = {10.1109/JSSC.2022.3232024},
timestamp = {Sat, 29 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/NishiPTCSZTNWDG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/KelleherSMYMSNJVSHSPBEMO23,
author = {Keith J. Kelleher and
Timothy Sheils and
Stephen L. Mathias and
Jeremy J. Yang and
Vincent T. Metzger and
Vishal B. Siramshetty and
Dac{-}Trung Nguyen and
Lars Juhl Jensen and
Dusica Vidovic and
Stephan C. Sch{\"{u}}rer and
Jayme Holmes and
Karlie R. Sharma and
Ajay Pillai and
Cristian Bologa and
Jeremy S. Edwards and
Ewy A. Math{\'{e}} and
Tudor I. Oprea},
title = {Pharos 2023: an integrated resource for the understudied human proteome},
journal = {Nucleic Acids Res.},
volume = {51},
number = {{D1}},
pages = {1405--1416},
year = {2023},
url = {https://doi.org/10.1093/nar/gkac1033},
doi = {10.1093/NAR/GKAC1033},
timestamp = {Tue, 08 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/KelleherSMYMSNJVSHSPBEMO23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/MartinAAAABBBBBBBBLBRCCfDDDHNFGGGMG23,
author = {Fergal J. Martin and
M. Ridwan Amode and
Alisha Aneja and
Olanrewaju Austine{-}Orimoloye and
Andrey G. Azov and
If Barnes and
Arne Becker and
Ruth Bennett and
Andrew E. Berry and
Jyothish Bhai and
Simarpreet Kaur Bhurji and
Alexandra Bignell and
Sanjay Boddu and
Paulo R. B. Lins and
Lucy Brooks and
Shashank Budhanuru Ramaraju and
Mehrnaz Charkhchi and
Alexander Cockburn and
Luca Da Rin Fioretto and
Claire Davidson and
Kamalkumar Jayantilal Dodiya and
Sarah M. Donaldson and
Bilal El Houdaigui and
Tamara El Naboulsi and
Reham Fatima and
Carlos Garc{\'{\i}}a{-}Gir{\'{o}}n and
Thiago Augusto Lopes Genez and
Gurpreet S. Ghattaoraya and
Jose Gonzalez Martinez and
Cristi Guijarro and
Matthew Hardy and
Zoe Hollis and
Thibaut Hourlier and
Toby Hunt and
Mike P. Kay and
Vinay Kaykala and
Tuan Le and
Diana Lemos and
Diego Marques{-}Coelho and
Jos{\'{e}} Carlos Marug{\'{a}}n and
Gabriela Alejandra Merino and
Louisse Paola Mirabueno and
Aleena Mushtaq and
Syed Nakib Hossain and
Denye N. Ogeh and
Manoj Pandian Sakthivel and
Anne Parker and
Malcolm Perry and
Ivana Pilizota and
Irina Prosovetskaia and
Jos{\'{e}} G. P{\'{e}}rez{-}Silva and
Ahamed Imran Abdul Salam and
Nuno Saraiva{-}Agostinho and
Helen Schuilenburg and
Dan Sheppard and
Swati Sinha and
Botond Sipos and
William Stark and
Emily Steed and
Ranjit Sukumaran and
Dulika Sumathipala and
Marie{-}Marthe Suner and
Likhitha Surapaneni and
Ky{\"{o}}sti Sutinen and
Michal Szpak and
Francesca Floriana Tricomi and
David Urbina{-}G{\'{o}}mez and
Andres Veidenberg and
Thomas A. Walsh and
Brandon Walts and
Elizabeth Wass and
Natalie L. Willhoft and
Jamie Allen and
Jorge {\'{A}}lvarez{-}Jarreta and
Marc Chakiachvili and
Bethany Flint and
Stefano Giorgetti and
Leanne Haggerty and
Garth R Ilsley and
Jane E. Loveland and
Benjamin Moore and
Jonathan M. Mudge and
John G. Tate and
David Thybert and
Stephen J. Trevanion and
Andrea Winterbottom and
Adam Frankish and
Sarah E. Hunt and
Magali Ruffier and
Fiona Cunningham and
Sarah Dyer and
Robert D. Finn and
Kevin L. Howe and
Peter W. Harrison and
Andrew D. Yates and
Paul Flicek},
title = {Ensembl 2023},
journal = {Nucleic Acids Res.},
volume = {51},
number = {{D1}},
pages = {933--941},
year = {2023},
url = {https://doi.org/10.1093/nar/gkac958},
doi = {10.1093/NAR/GKAC958},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/MartinAAAABBBBBBBBLBRCCfDDDHNFGGGMG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/MankowitzMZGSPL23,
author = {Daniel J. Mankowitz and
Andrea Michi and
Anton Zhernov and
Marco Gelmi and
Marco Selvi and
Cosmin Paduraru and
Edouard Leurent and
Shariq Iqbal and
Jean{-}Baptiste Lespiau and
Alex Ahern and
Thomas K{\"{o}}ppe and
Kevin Millikin and
Stephen Gaffney and
Sophie Elster and
Jackson Broshear and
Chris Gamble and
Kieran Milan and
Robert Tung and
Minjae Hwang and
A. Taylan Cemgil and
Mohammadamin Barekatain and
Yujia Li and
Amol Mandhane and
Thomas Hubert and
Julian Schrittwieser and
Demis Hassabis and
Pushmeet Kohli and
Martin A. Riedmiller and
Oriol Vinyals and
David Silver},
title = {Faster sorting algorithms discovered using deep reinforcement learning},
journal = {Nat.},
volume = {618},
number = {7964},
pages = {257--263},
year = {2023},
url = {https://doi.org/10.1038/s41586-023-06004-9},
doi = {10.1038/S41586-023-06004-9},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/MankowitzMZGSPL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/BelyaevaGWWCSA23,
author = {Irina Belyaeva and
Ben Gabrielson and
Yu{-}Ping Wang and
Tony W. Wilson and
Vince D. Calhoun and
Julia M. Stephen and
T{\"{u}}lay Adali},
title = {Multi-Subject Analysis for Brain Developmental Patterns Discovery
via Tensor Decomposition of {MEG} Data},
journal = {Neuroinformatics},
volume = {21},
number = {1},
pages = {115--141},
year = {2023},
url = {https://doi.org/10.1007/s12021-022-09599-y},
doi = {10.1007/S12021-022-09599-Y},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ni/BelyaevaGWWCSA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/BelyaevaGWWCSA23a,
author = {Irina Belyaeva and
Ben Gabrielson and
Yu{-}Ping Wang and
Tony W. Wilson and
Vince D. Calhoun and
Julia M. Stephen and
T{\"{u}}lay Adali},
title = {Correction to: Multi-Subject Analysis for Brain Developmental Patterns
Discovery via Tensor Decomposition of {MEG} Data},
journal = {Neuroinformatics},
volume = {21},
number = {1},
pages = {143},
year = {2023},
url = {https://doi.org/10.1007/s12021-023-09620-y},
doi = {10.1007/S12021-023-09620-Y},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ni/BelyaevaGWWCSA23a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/KelaherMMSMTB23,
author = {Brendan P. Kelaher and
Kim I. Monteforte and
Stephen G. Morris and
Thomas A. Schlacher and
Duane T. March and
James P. Tucker and
Paul A. Butcher},
title = {Drone-Based Assessment of Marine Megafauna off Wave-Exposed Sandy
Beaches},
journal = {Remote. Sens.},
volume = {15},
number = {16},
pages = {4018},
year = {2023},
url = {https://doi.org/10.3390/rs15164018},
doi = {10.3390/RS15164018},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/KelaherMMSMTB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/TurnerHS23,
author = {Alexander P. Turner and
Stephen Hayes and
Don Sharkey},
title = {The Classification of Movement in Infants for the Autonomous Monitoring
of Neurological Development},
journal = {Sensors},
volume = {23},
number = {10},
pages = {4800},
year = {2023},
url = {https://doi.org/10.3390/s23104800},
doi = {10.3390/S23104800},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/TurnerHS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/BassSSWSTAFGSR23,
author = {Cher Bass and
Mariana da Silva and
Carole H. Sudre and
Logan Z. J. Williams and
Helena S. Sousa and
Petru{-}Daniel Tudosiu and
Fidel Alfaro{-}Almagro and
Sean P. Fitzgibbon and
Matthew F. Glasser and
Stephen M. Smith and
Emma C. Robinson},
title = {ICAM-Reg: Interpretable Classification and Regression With Feature
Attribution for Mapping Neurological Phenotypes in Individual Scans},
journal = {{IEEE} Trans. Medical Imaging},
volume = {42},
number = {4},
pages = {959--970},
year = {2023},
url = {https://doi.org/10.1109/TMI.2022.3221890},
doi = {10.1109/TMI.2022.3221890},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmi/BassSSWSTAFGSR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmlr/SrivastavaRRSAF23,
author = {Aarohi Srivastava and
Abhinav Rastogi and
Abhishek Rao and
Abu Awal Md Shoeb and
Abubakar Abid and
Adam Fisch and
Adam R. Brown and
Adam Santoro and
Aditya Gupta and
Adri{\`{a}} Garriga{-}Alonso and
Agnieszka Kluska and
Aitor Lewkowycz and
Akshat Agarwal and
Alethea Power and
Alex Ray and
Alex Warstadt and
Alexander W. Kocurek and
Ali Safaya and
Ali Tazarv and
Alice Xiang and
Alicia Parrish and
Allen Nie and
Aman Hussain and
Amanda Askell and
Amanda Dsouza and
Ambrose Slone and
Ameet Rahane and
Anantharaman S. Iyer and
Anders Andreassen and
Andrea Madotto and
Andrea Santilli and
Andreas Stuhlm{\"{u}}ller and
Andrew M. Dai and
Andrew La and
Andrew K. Lampinen and
Andy Zou and
Angela Jiang and
Angelica Chen and
Anh Vuong and
Animesh Gupta and
Anna Gottardi and
Antonio Norelli and
Anu Venkatesh and
Arash Gholamidavoodi and
Arfa Tabassum and
Arul Menezes and
Arun Kirubarajan and
Asher Mullokandov and
Ashish Sabharwal and
Austin Herrick and
Avia Efrat and
Aykut Erdem and
Ayla Karakas and
B. Ryan Roberts and
Bao Sheng Loe and
Barret Zoph and
Bartlomiej Bojanowski and
Batuhan {\"{O}}zyurt and
Behnam Hedayatnia and
Behnam Neyshabur and
Benjamin Inden and
Benno Stein and
Berk Ekmekci and
Bill Yuchen Lin and
Blake Howald and
Bryan Orinion and
Cameron Diao and
Cameron Dour and
Catherine Stinson and
Cedrick Argueta and
C{\`{e}}sar Ferri Ram{\'{\i}}rez and
Chandan Singh and
Charles Rathkopf and
Chenlin Meng and
Chitta Baral and
Chiyu Wu and
Chris Callison{-}Burch and
Chris Waites and
Christian Voigt and
Christopher D. Manning and
Christopher Potts and
Cindy Ramirez and
Clara E. Rivera and
Clemencia Siro and
Colin Raffel and
Courtney Ashcraft and
Cristina Garbacea and
Damien Sileo and
Dan Garrette and
Dan Hendrycks and
Dan Kilman and
Dan Roth and
Daniel Freeman and
Daniel Khashabi and
Daniel Levy and
Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and
Danielle Perszyk and
Danny Hernandez and
Danqi Chen and
Daphne Ippolito and
Dar Gilboa and
David Dohan and
David Drakard and
David Jurgens and
Debajyoti Datta and
Deep Ganguli and
Denis Emelin and
Denis Kleyko and
Deniz Yuret and
Derek Chen and
Derek Tam and
Dieuwke Hupkes and
Diganta Misra and
Dilyar Buzan and
Dimitri Coelho Mollo and
Diyi Yang and
Dong{-}Ho Lee and
Dylan Schrader and
Ekaterina Shutova and
Ekin Dogus Cubuk and
Elad Segal and
Eleanor Hagerman and
Elizabeth Barnes and
Elizabeth Donoway and
Ellie Pavlick and
Emanuele Rodol{\`{a}} and
Emma Lam and
Eric Chu and
Eric Tang and
Erkut Erdem and
Ernie Chang and
Ethan A. Chi and
Ethan Dyer and
Ethan J. Jerzak and
Ethan Kim and
Eunice Engefu Manyasi and
Evgenii Zheltonozhskii and
Fanyue Xia and
Fatemeh Siar and
Fernando Mart{\'{\i}}nez{-}Plumed and
Francesca Happ{\'{e}} and
Fran{\c{c}}ois Chollet and
Frieda Rong and
Gaurav Mishra and
Genta Indra Winata and
Gerard de Melo and
Germ{\'{a}}n Kruszewski and
Giambattista Parascandolo and
Giorgio Mariani and
Gloria Wang and
Gonzalo Jaimovitch{-}L{\'{o}}pez and
Gregor Betz and
Guy Gur{-}Ari and
Hana Galijasevic and
Hannah Kim and
Hannah Rashkin and
Hannaneh Hajishirzi and
Harsh Mehta and
Hayden Bogar and
Henry Shevlin and
Hinrich Sch{\"{u}}tze and
Hiromu Yakura and
Hongming Zhang and
Hugh Mee Wong and
Ian Ng and
Isaac Noble and
Jaap Jumelet and
Jack Geissinger and
Jackson Kernion and
Jacob Hilton and
Jaehoon Lee and
Jaime Fern{\'{a}}ndez Fisac and
James B. Simon and
James Koppel and
James Zheng and
James Zou and
Jan Kocon and
Jana Thompson and
Janelle Wingfield and
Jared Kaplan and
Jarema Radom and
Jascha Sohl{-}Dickstein and
Jason Phang and
Jason Wei and
Jason Yosinski and
Jekaterina Novikova and
Jelle Bosscher and
Jennifer Marsh and
Jeremy Kim and
Jeroen Taal and
Jesse H. Engel and
Jesujoba Alabi and
Jiacheng Xu and
Jiaming Song and
Jillian Tang and
Joan Waweru and
John Burden and
John Miller and
John U. Balis and
Jonathan Batchelder and
Jonathan Berant and
J{\"{o}}rg Frohberg and
Jos Rozen and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Joseph Boudeman and
Joseph Guerr and
Joseph Jones and
Joshua B. Tenenbaum and
Joshua S. Rule and
Joyce Chua and
Kamil Kanclerz and
Karen Livescu and
Karl Krauth and
Karthik Gopalakrishnan and
Katerina Ignatyeva and
Katja Markert and
Kaustubh D. Dhole and
Kevin Gimpel and
Kevin Omondi and
Kory Mathewson and
Kristen Chiafullo and
Ksenia Shkaruta and
Kumar Shridhar and
Kyle McDonell and
Kyle Richardson and
Laria Reynolds and
Leo Gao and
Li Zhang and
Liam Dugan and
Lianhui Qin and
Lidia Contreras Ochando and
Louis{-}Philippe Morency and
Luca Moschella and
Lucas Lam and
Lucy Noble and
Ludwig Schmidt and
Luheng He and
Luis Oliveros Col{\'{o}}n and
Luke Metz and
L{\"{u}}tfi Kerem Senel and
Maarten Bosma and
Maarten Sap and
Maartje ter Hoeve and
Maheen Farooqi and
Manaal Faruqui and
Mantas Mazeika and
Marco Baturan and
Marco Marelli and
Marco Maru and
Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and
Marie Tolkiehn and
Mario Giulianelli and
Martha Lewis and
Martin Potthast and
Matthew L. Leavitt and
Matthias Hagen and
M{\'{a}}ty{\'{a}}s Schubert and
Medina Baitemirova and
Melody Arnaud and
Melvin McElrath and
Michael A. Yee and
Michael Cohen and
Michael Gu and
Michael I. Ivanitskiy and
Michael Starritt and
Michael Strube and
Michal Swedrowski and
Michele Bevilacqua and
Michihiro Yasunaga and
Mihir Kale and
Mike Cain and
Mimee Xu and
Mirac Suzgun and
Mitch Walker and
Mo Tiwari and
Mohit Bansal and
Moin Aminnaseri and
Mor Geva and
Mozhdeh Gheini and
Mukund Varma T. and
Nanyun Peng and
Nathan A. Chi and
Nayeon Lee and
Neta Gur{-}Ari Krakover and
Nicholas Cameron and
Nicholas Roberts and
Nick Doiron and
Nicole Martinez and
Nikita Nangia and
Niklas Deckers and
Niklas Muennighoff and
Nitish Shirish Keskar and
Niveditha Iyer and
Noah Constant and
Noah Fiedel and
Nuan Wen and
Oliver Zhang and
Omar Agha and
Omar Elbaghdadi and
Omer Levy and
Owain Evans and
Pablo Antonio Moreno Casares and
Parth Doshi and
Pascale Fung and
Paul Pu Liang and
Paul Vicol and
Pegah Alipoormolabashi and
Peiyuan Liao and
Percy Liang and
Peter Chang and
Peter Eckersley and
Phu Mon Htut and
Pinyu Hwang and
Piotr Milkowski and
Piyush Patil and
Pouya Pezeshkpour and
Priti Oli and
Qiaozhu Mei and
Qing Lyu and
Qinlang Chen and
Rabin Banjade and
Rachel Etta Rudolph and
Raefer Gabriel and
Rahel Habacker and
Ramon Risco and
Rapha{\"{e}}l Milli{\`{e}}re and
Rhythm Garg and
Richard Barnes and
Rif A. Saurous and
Riku Arakawa and
Robbe Raymaekers and
Robert Frank and
Rohan Sikand and
Roman Novak and
Roman Sitelew and
Ronan LeBras and
Rosanne Liu and
Rowan Jacobs and
Rui Zhang and
Ruslan Salakhutdinov and
Ryan Chi and
Ryan Lee and
Ryan Stovall and
Ryan Teehan and
Rylan Yang and
Sahib Singh and
Saif M. Mohammad and
Sajant Anand and
Sam Dillavou and
Sam Shleifer and
Sam Wiseman and
Samuel Gruetter and
Samuel R. Bowman and
Samuel S. Schoenholz and
Sanghyun Han and
Sanjeev Kwatra and
Sarah A. Rous and
Sarik Ghazarian and
Sayan Ghosh and
Sean Casey and
Sebastian Bischoff and
Sebastian Gehrmann and
Sebastian Schuster and
Sepideh Sadeghi and
Shadi Hamdan and
Sharon Zhou and
Shashank Srivastava and
Sherry Shi and
Shikhar Singh and
Shima Asaadi and
Shixiang Shane Gu and
Shubh Pachchigar and
Shubham Toshniwal and
Shyam Upadhyay and
Shyamolima (Shammie) Debnath and
Siamak Shakeri and
Simon Thormeyer and
Simone Melzi and
Siva Reddy and
Sneha Priscilla Makini and
Soo{-}Hwan Lee and
Spencer Torene and
Sriharsha Hatwar and
Stanislas Dehaene and
Stefan Divic and
Stefano Ermon and
Stella Biderman and
Stephanie Lin and
Stephen Prasad and
Steven T. Piantadosi and
Stuart M. Shieber and
Summer Misherghi and
Svetlana Kiritchenko and
Swaroop Mishra and
Tal Linzen and
Tal Schuster and
Tao Li and
Tao Yu and
Tariq Ali and
Tatsu Hashimoto and
Te{-}Lin Wu and
Th{\'{e}}o Desbordes and
Theodore Rothschild and
Thomas Phan and
Tianle Wang and
Tiberius Nkinyili and
Timo Schick and
Timofei Kornev and
Titus Tunduny and
Tobias Gerstenberg and
Trenton Chang and
Trishala Neeraj and
Tushar Khot and
Tyler Shultz and
Uri Shaham and
Vedant Misra and
Vera Demberg and
Victoria Nyamai and
Vikas Raunak and
Vinay V. Ramasesh and
Vinay Uday Prabhu and
Vishakh Padmakumar and
Vivek Srikumar and
William Fedus and
William Saunders and
William Zhang and
Wout Vossen and
Xiang Ren and
Xiaoyu Tong and
Xinran Zhao and
Xinyi Wu and
Xudong Shen and
Yadollah Yaghoobzadeh and
Yair Lakretz and
Yangqiu Song and
Yasaman Bahri and
Yejin Choi and
Yichi Yang and
Yiding Hao and
Yifu Chen and
Yonatan Belinkov and
Yu Hou and
Yufang Hou and
Yuntao Bai and
Zachary Seid and
Zhuoye Zhao and
Zijian Wang and
Zijie J. Wang and
Zirui Wang and
Ziyi Wu},
title = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities
of language models},
journal = {Trans. Mach. Learn. Res.},
volume = {2023},
year = {2023},
url = {https://openreview.net/forum?id=uyTL5Bvosj},
timestamp = {Tue, 06 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmlr/SrivastavaRRSAF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/toms/BestuzhevaBCCDDEGGGGGHHHHKLMMMMPRS23,
author = {Ksenia Bestuzheva and
Mathieu Besan{\c{c}}on and
Weikun Chen and
Antonia Chmiela and
Tim Donkiewicz and
Jasper van Doornmalen and
Leon Eifler and
Oliver Gaul and
Gerald Gamrath and
Ambros M. Gleixner and
Leona Gottwald and
Christoph Graczyk and
Katrin Halbig and
Alexander Hoen and
Christopher Hojny and
Rolf van der Hulst and
Thorsten Koch and
Marco E. L{\"{u}}bbecke and
Stephen J. Maher and
Frederic Matter and
Erik M{\"{u}}hmer and
Benjamin M{\"{u}}ller and
Marc E. Pfetsch and
Daniel Rehfeldt and
Steffan Schlein and
Franziska Schl{\"{o}}sser and
Felipe Serrano and
Yuji Shinano and
Boro Sofranac and
Mark Turner and
Stefan Vigerske and
Fabian Wegscheider and
Philipp Wellner and
Dieter Weninger and
Jakob Witzig},
title = {Enabling Research through the {SCIP} Optimization Suite 8.0},
journal = {{ACM} Trans. Math. Softw.},
volume = {49},
number = {2},
pages = {22:1--22:21},
year = {2023},
url = {https://doi.org/10.1145/3585516},
doi = {10.1145/3585516},
timestamp = {Tue, 16 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/toms/BestuzhevaBCCDDEGGGGGHHHHKLMMMMPRS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acivs/DuongTKNLBN23,
author = {Dat Q. Duong and
Tuan{-}Anh Tran and
Phuong Nhi Nguyen Kieu and
Tien K. Nguyen and
Bao Le and
Stephen Baker and
Binh T. Nguyen},
editor = {Jacques Blanc{-}Talon and
Patrice Delmas and
Wilfried Philips and
Paul Scheunders},
title = {A Deep Learning Approach to Segment High-Content Images of the E.
coli Bacteria},
booktitle = {Advanced Concepts for Intelligent Vision Systems - 21st International
Conference, {ACIVS} 2023 Kumamoto, Japan, August 21-23, 2023 Proceedings},
series = {Lecture Notes in Computer Science},
volume = {14124},
pages = {184--195},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-45382-3\_16},
doi = {10.1007/978-3-031-45382-3\_16},
timestamp = {Tue, 28 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acivs/DuongTKNLBN23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/blockchain2/LiuWTO23,
author = {Liang Liu and
Qiao Wang and
Stephen John Turnbull and
Kazumasa Omote},
title = {The Validator's Dilemma in PoW Blockchain: An Evolutionary Game Perspective},
booktitle = {{IEEE} International Conference on Blockchain, Blockchain 2023, Danzhou,
China, December 17-21, 2023},
pages = {17--24},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/Blockchain60715.2023.00013},
doi = {10.1109/BLOCKCHAIN60715.2023.00013},
timestamp = {Thu, 22 Feb 2024 20:11:26 +0100},
biburl = {https://dblp.org/rec/conf/blockchain2/LiuWTO23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/TullSZC23,
author = {Sean Tull and
Razin A. Shaikh and
Sara Sabrina Zemljic and
Stephen Clark},
editor = {Micah B. Goldwater and
Florencia K. Anggoro and
Brett K. Hayes and
Desmond C. Ong},
title = {A Quantum Model of Concepts},
booktitle = {Proceedings of the 45th Annual Meeting of the Cognitive Science Society,
CogSci 2023, Sydney, NSW, Australia, July 26-29, 2023},
publisher = {cognitivesciencesociety.org},
year = {2023},
url = {https://escholarship.org/uc/item/5vj7c6d8},
timestamp = {Thu, 02 May 2024 16:36:09 +0200},
biburl = {https://dblp.org/rec/conf/cogsci/TullSZC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/corl/RenDBSTBXTXVXSZ23,
author = {Allen Z. Ren and
Anushri Dixit and
Alexandra Bodrova and
Sumeet Singh and
Stephen Tu and
Noah Brown and
Peng Xu and
Leila Takayama and
Fei Xia and
Jake Varley and
Zhenjia Xu and
Dorsa Sadigh and
Andy Zeng and
Anirudha Majumdar},
editor = {Jie Tan and
Marc Toussaint and
Kourosh Darvish},
title = {Robots That Ask For Help: Uncertainty Alignment for Large Language
Model Planners},
booktitle = {Conference on Robot Learning, CoRL 2023, 6-9 November 2023, Atlanta,
GA, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {229},
pages = {661--682},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v229/ren23a.html},
timestamp = {Tue, 12 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/corl/RenDBSTBXTXVXSZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/WangNSLCSZHL23,
author = {Ziyan Wang and
Giljoo Nam and
Tuur Stuyck and
Stephen Lombardi and
Chen Cao and
Jason M. Saragih and
Michael Zollh{\"{o}}fer and
Jessica K. Hodgins and
Christoph Lassner},
title = {NeuWigs: {A} Neural Dynamic Model for Volumetric Hair Capture and
Animation},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023, Vancouver, BC, Canada, June 17-24, 2023},
pages = {8641--8651},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPR52729.2023.00835},
doi = {10.1109/CVPR52729.2023.00835},
timestamp = {Mon, 28 Aug 2023 16:14:07 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/WangNSLCSZHL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/OgundepoGRCRADD23,
author = {Odunayo Ogundepo and
Tajuddeen Gwadabe and
Clara Rivera and
Jonathan H. Clark and
Sebastian Ruder and
David Ifeoluwa Adelani and
Bonaventure Dossou and
Abdou Aziz Diop and
Claytone Sikasote and
Gilles Hacheme and
Happy Buzaaba and
Ignatius Ezeani and
Rooweither Mabuya and
Salomey Osei and
Chris Emezue and
Albert Kahira and
Shamsuddeen Hassan Muhammad and
Akintunde Oladipo and
Abraham Toluwase Owodunni and
Atnafu Lambebo Tonja and
Iyanuoluwa Shode and
Akari Asai and
Aremu Anuoluwapo and
Ayodele Awokoya and
Bernard Opoku and
Chiamaka Chukwuneke and
Christine Mwase and
Clemencia Siro and
Stephen Arthur and
Tunde Ajayi and
Verrah Otiende and
Andre Niyongabo Rubungo and
Boyd Sinkala and
Daniel A. Ajisafe and
Emeka Onwuegbuzia and
Falalu Ibrahim Lawan and
Ibrahim Said Ahmad and
Jesujoba O. Alabi and
Chinedu E. Mbonu and
Mofetoluwa Adeyemi and
Mofya Phiri and
Orevaoghene Ahia and
Ruqayya Nasir Iro and
Sonia Adhiambo},
editor = {Houda Bouamor and
Juan Pino and
Kalika Bali},
title = {Cross-lingual Open-Retrieval Question Answering for African Languages},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2023, Singapore, December 6-10, 2023},
pages = {14957--14972},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.findings-emnlp.997},
doi = {10.18653/V1/2023.FINDINGS-EMNLP.997},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/OgundepoGRCRADD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/KoldovskyCAO23,
author = {Zbynek Koldovsk{\'{y}} and
Jaroslav Cmejla and
T{\"{u}}lay Adali and
Stephen O'Regan},
title = {Independent Vector Extraction Constrained on Manifold of Half-Length
Filters},
booktitle = {31st European Signal Processing Conference, {EUSIPCO} 2023, Helsinki,
Finland, September 4-8, 2023},
pages = {940--944},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.23919/EUSIPCO58844.2023.10289896},
doi = {10.23919/EUSIPCO58844.2023.10289896},
timestamp = {Mon, 06 Nov 2023 12:35:15 +0100},
biburl = {https://dblp.org/rec/conf/eusipco/KoldovskyCAO23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gsi/TumpachP23,
author = {Alice Barbara Tumpach and
Stephen C. Preston},
editor = {Frank Nielsen and
Fr{\'{e}}d{\'{e}}ric Barbaresco},
title = {Three Methods to Put a Riemannian Metric on Shape Space},
booktitle = {Geometric Science of Information - 6th International Conference, {GSI}
2023, St. Malo, France, August 30 - September 1, 2023, Proceedings,
Part {I}},
series = {Lecture Notes in Computer Science},
volume = {14071},
pages = {3--11},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-38271-0\_1},
doi = {10.1007/978-3-031-38271-0\_1},
timestamp = {Mon, 14 Aug 2023 16:16:24 +0200},
biburl = {https://dblp.org/rec/conf/gsi/TumpachP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icacit/TurnerJMU23,
author = {Stephen W. Turner and
Tyler Judd and
Aaron Moore and
Suleyman Uludag},
title = {A Framework for an Automated Assessment System},
booktitle = {International Symposium on Accreditation of Engineering and Computing
Education, {ICACIT} 2023, Lima, Peru, November 2-3, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICACIT59946.2023.10403674},
doi = {10.1109/ICACIT59946.2023.10403674},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icacit/TurnerJMU23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/NikunramMTS23,
author = {Chanikarn Nikunram and
Wasin Meesena and
Stephen John Turner and
Sucha Supittayapornpong},
title = {Minimizing Age of Processed Information in Wireless Networks},
booktitle = {{IEEE} International Conference on Communications, {ICC} 2023, Rome,
Italy, May 28 - June 1, 2023},
pages = {69--75},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICC45041.2023.10278805},
doi = {10.1109/ICC45041.2023.10278805},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icc/NikunramMTS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccps/GaoSCFPGGTP23,
author = {Qitong Gao and
Stephen L. Schmidt and
Afsana Chowdhury and
Guangyu Feng and
Jennifer J. Peters and
Katherine Genty and
Warren M. Grill and
Dennis A. Turner and
Miroslav Pajic},
editor = {Sayan Mitra and
Nalini Venkatasubramanian and
Abhishek Dubey and
Lu Feng and
Mahsa Ghasemi and
Jonathan Sprinkle},
title = {Offline Learning of Closed-Loop Deep Brain Stimulation Controllers
for Parkinson Disease Treatment},
booktitle = {Proceedings of the {ACM/IEEE} 14th International Conference on Cyber-Physical
Systems, {ICCPS} 2023, (with CPS-IoT Week 2023), San Antonio, TX,
USA, May 9-12, 2023},
pages = {44--55},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3576841.3585925},
doi = {10.1145/3576841.3585925},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccps/GaoSCFPGGTP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/McAleerFLS23,
author = {Stephen Marcus McAleer and
Gabriele Farina and
Marc Lanctot and
Tuomas Sandholm},
title = {{ESCHER:} Eschewing Importance Sampling in Games by Computing a History
Value Function to Estimate Regret},
booktitle = {The Eleventh International Conference on Learning Representations,
{ICLR} 2023, Kigali, Rwanda, May 1-5, 2023},
publisher = {OpenReview.net},
year = {2023},
url = {https://openreview.net/forum?id=35QyoZv8cKO},
timestamp = {Wed, 24 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/McAleerFLS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/LanTRHABD23,
author = {Charline Le Lan and
Stephen Tu and
Mark Rowland and
Anna Harutyunyan and
Rishabh Agarwal and
Marc G. Bellemare and
Will Dabney},
editor = {Andreas Krause and
Emma Brunskill and
Kyunghyun Cho and
Barbara Engelhardt and
Sivan Sabato and
Jonathan Scarlett},
title = {Bootstrapped Representations in Reinforcement Learning},
booktitle = {International Conference on Machine Learning, {ICML} 2023, 23-29 July
2023, Honolulu, Hawaii, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {202},
pages = {18686--18713},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v202/le-lan23a.html},
timestamp = {Wed, 02 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/LanTRHABD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/PfrommerSWMT23,
author = {Daniel Pfrommer and
Max Simchowitz and
Tyler Westenbroek and
Nikolai Matni and
Stephen Tu},
editor = {Andreas Krause and
Emma Brunskill and
Kyunghyun Cho and
Barbara Engelhardt and
Sivan Sabato and
Jonathan Scarlett},
title = {The Power of Learned Locally Linear Models for Nonlinear Policy Optimization},
booktitle = {International Conference on Machine Learning, {ICML} 2023, 23-29 July
2023, Honolulu, Hawaii, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {202},
pages = {27737--27821},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v202/pfrommer23a.html},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/PfrommerSWMT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/BrandfonbrenerTSWBMV23,
author = {David Brandfonbrener and
Stephen Tu and
Avi Singh and
Stefan Welker and
Chad Boodoo and
Nikolai Matni and
Jake Varley},
title = {Visual Backtracking Teleoperation: {A} Data Collection Protocol for
Offline Image-Based Reinforcement Learning},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2023, London, UK, May 29 - June 2, 2023},
pages = {11336--11342},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICRA48891.2023.10161096},
doi = {10.1109/ICRA48891.2023.10161096},
timestamp = {Tue, 08 Aug 2023 10:24:29 +0200},
biburl = {https://dblp.org/rec/conf/icra/BrandfonbrenerTSWBMV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsrs/TullinoKBCJ23,
author = {Stephen K. Tullino and
Andrew S. Keys and
Robert A. Bettinger and
Amy M. Cox and
David R. Jacques},
title = {A Conceptual Spacecraft Operational Survivability Estimation Based
on Pre-Launch Test and Evaluation},
booktitle = {7th International Conference on System Reliability and Safety, {ICSRS}
2023, Bologna, Italy, November 22-24, 2023},
pages = {265--271},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICSRS59833.2023.10381447},
doi = {10.1109/ICSRS59833.2023.10381447},
timestamp = {Fri, 09 Feb 2024 20:38:51 +0100},
biburl = {https://dblp.org/rec/conf/icsrs/TullinoKBCJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/ZhangWSWTLPF23,
author = {Yulun Zhang and
Donglai Wei and
Richard Schalek and
Yuelong Wu and
Stephen G. Turney and
Jeff Lichtman and
Hanspeter Pfister and
Yun Fu},
title = {High-Throughput Microscopy Image Deblurring with Graph Reasoning Attention
Network},
booktitle = {20th {IEEE} International Symposium on Biomedical Imaging, {ISBI}
2023, Cartagena, Colombia, April 18-21, 2023},
pages = {1--5},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ISBI53787.2023.10230473},
doi = {10.1109/ISBI53787.2023.10230473},
timestamp = {Fri, 25 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isbi/ZhangWSWTLPF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/AbeyruwanBBCDJS23,
author = {Saminda Abeyruwan and
Alex Bewley and
Nicholas Matthew Boffi and
Krzysztof Marcin Choromanski and
David B. D'Ambrosio and
Deepali Jain and
Pannag R. Sanketi and
Anish Shankar and
Vikas Sindhwani and
Sumeet Singh and
Jean{-}Jacques E. Slotine and
Stephen Tu},
editor = {Nikolai Matni and
Manfred Morari and
George J. Pappas},
title = {Agile Catching with Whole-Body {MPC} and Blackbox Policy Learning},
booktitle = {Learning for Dynamics and Control Conference, {L4DC} 2023, 15-16 June
2023, Philadelphia, PA, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {211},
pages = {851--863},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v211/abeyruwan23a.html},
timestamp = {Fri, 16 Jun 2023 14:48:17 +0200},
biburl = {https://dblp.org/rec/conf/l4dc/AbeyruwanBBCDJS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/ZhangKLTLTM23,
author = {Thomas T. C. K. Zhang and
Katie Kang and
Bruce D. Lee and
Claire J. Tomlin and
Sergey Levine and
Stephen Tu and
Nikolai Matni},
editor = {Nikolai Matni and
Manfred Morari and
George J. Pappas},
title = {Multi-Task Imitation Learning for Linear Dynamical Systems},
booktitle = {Learning for Dynamics and Control Conference, {L4DC} 2023, 15-16 June
2023, Philadelphia, PA, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {211},
pages = {586--599},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v211/zhang23b.html},
timestamp = {Fri, 16 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/l4dc/ZhangKLTLTM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/McAleerFZW0S23,
author = {Stephen McAleer and
Gabriele Farina and
Gaoyue Zhou and
Mingzhi Wang and
Yaodong Yang and
Tuomas Sandholm},
editor = {Alice Oh and
Tristan Naumann and
Amir Globerson and
Kate Saenko and
Moritz Hardt and
Sergey Levine},
title = {Team-PSRO for Learning Approximate TMECor in Large Team Games via
Cooperative Reinforcement Learning},
booktitle = {Advances in Neural Information Processing Systems 36: Annual Conference
on Neural Information Processing Systems 2023, NeurIPS 2023, New Orleans,
LA, USA, December 10 - 16, 2023},
year = {2023},
url = {http://papers.nips.cc/paper\_files/paper/2023/hash/8e4ccc9ca6ae2225c4cbb7782ab48daf-Abstract-Conference.html},
timestamp = {Fri, 01 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/McAleerFZW0S23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ZhangFACMHC0CS23,
author = {Brian Hu Zhang and
Gabriele Farina and
Ioannis Anagnostides and
Federico Cacciamani and
Stephen McAleer and
Andreas A. Haupt and
Andrea Celli and
Nicola Gatti and
Vincent Conitzer and
Tuomas Sandholm},
editor = {Alice Oh and
Tristan Naumann and
Amir Globerson and
Kate Saenko and
Moritz Hardt and
Sergey Levine},
title = {Computing Optimal Equilibria and Mechanisms via Learning in Zero-Sum
Extensive-Form Games},
booktitle = {Advances in Neural Information Processing Systems 36: Annual Conference
on Neural Information Processing Systems 2023, NeurIPS 2023, New Orleans,
LA, USA, December 10 - 16, 2023},
year = {2023},
url = {http://papers.nips.cc/paper\_files/paper/2023/hash/07be1a0850e58ca29e2b6ce31fc0c791-Abstract-Conference.html},
timestamp = {Fri, 01 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/ZhangFACMHC0CS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ZiemannTPM23,
author = {Ingvar M. Ziemann and
Stephen Tu and
George J. Pappas and
Nikolai Matni},
editor = {Alice Oh and
Tristan Naumann and
Amir Globerson and
Kate Saenko and
Moritz Hardt and
Sergey Levine},
title = {The noise level in linear regression with dependent data},
booktitle = {Advances in Neural Information Processing Systems 36: Annual Conference
on Neural Information Processing Systems 2023, NeurIPS 2023, New Orleans,
LA, USA, December 10 - 16, 2023},
year = {2023},
url = {http://papers.nips.cc/paper\_files/paper/2023/hash/ecffd829f90b0a4b6aa017b6df15904f-Abstract-Conference.html},
timestamp = {Fri, 01 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/ZiemannTPM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/BaderBBBCCCCDDF23,
author = {Jonathan Bader and
Jim Belak and
Matthew T. Bement and
Matthew Berry and
Robert Carson and
Daniela Cassol and
Stephen Chan and
John Coleman and
Kastan Day and
Alejandro Duque and
Kjiersten Fagnan and
Jeff Froula and
Shantenu Jha and
Daniel S. Katz and
Piotr Kica and
Volodymyr V. Kindratenko and
Edward Kirton and
Ramani Kothadia and
Daniel E. Laney and
Fabian Lehmann and
Ulf Leser and
Sabina Licholai and
Maciej Malawski and
Mario Melara and
Elais Player Jackson and
Matthew Rolchigo and
Setareh Sarrafan and
Seung{-}Jin Sul and
Abdullah Syed and
Lauritz Thamsen and
Mikhail Titov and
Matteo Turilli and
Silvina Ca{\'{\i}}no{-}Lores and
Anirban Mandal},
title = {Novel Approaches Toward Scalable Composable Workflows in Hyper-Heterogeneous
Computing Environments},
booktitle = {Proceedings of the {SC} '23 Workshops of The International Conference
on High Performance Computing, Network, Storage, and Analysis, {SC-W}
2023, Denver, CO, USA, November 12-17, 2023},
pages = {2097--2108},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3624062.3626283},
doi = {10.1145/3624062.3626283},
timestamp = {Tue, 28 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/BaderBBBCCCCDDF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/LyonsDBFTR23,
author = {Deirdre V. Lyons and
Christopher Lane Davis and
Stephen Butchko and
Whitton Frank and
Brian Tull and
Braden Roy},
editor = {Erik Brunvand and
Anna Carolina Muller Queiroz},
title = {Gumball Dreams: Live Theatre in {VR}},
booktitle = {{ACM} {SIGGRAPH} 2023 Immersive Pavilion, {SIGGRAPH} 2023, Los Angeles,
CA, USA, August 6-10, 2023},
pages = {8:1--8:2},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3588027.3595593},
doi = {10.1145/3588027.3595593},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/siggraph/LyonsDBFTR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/NishiPCSZTTN0DG23,
author = {Yoshinori Nishi and
John W. Poulton and
Xi Chen and
Sanquan Song and
Brian Zimmer and
Walker J. Turner and
Stephen G. Tell and
Nikola Nedovic and
John M. Wilson and
William J. Dally and
C. Thomas Gray},
title = {A 0.190-pJ/bit 25.2-Gb/s/wire Inverter-Based AC-Coupled Transceiver
for Short-Reach Die-to-Die Interfaces in 5-nm {CMOS}},
booktitle = {2023 {IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits), Kyoto, Japan, June 11-16, 2023},
pages = {1--2},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.23919/VLSITechnologyandCir57934.2023.10185334},
doi = {10.23919/VLSITECHNOLOGYANDCIR57934.2023.10185334},
timestamp = {Sun, 30 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/NishiPCSZTTN0DG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/WanigasekaraAGG23,
author = {Prashan Wanigasekara and
Rafid Al{-}Humaimidi and
Turan Gojayev and
Niloofar Gheissari and
Achal Dave and
Stephen Rawls and
Fan Yang and
Kechen Qin and
Nalin Gupta and
Spurthi Sandiri and
Chevanthie Dissanayake and
Zeynab Raeesy and
Emre Barut and
Chengwei Su},
editor = {Ying Ding and
Jie Tang and
Juan F. Sequeda and
Lora Aroyo and
Carlos Castillo and
Geert{-}Jan Houben},
title = {Visual Item Selection With Voice Assistants: {A} systems perspective},
booktitle = {Companion Proceedings of the {ACM} Web Conference 2023, {WWW} 2023,
Austin, TX, USA, 30 April 2023 - 4 May 2023},
pages = {500--507},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3543873.3584655},
doi = {10.1145/3543873.3584655},
timestamp = {Mon, 28 Aug 2023 21:17:11 +0200},
biburl = {https://dblp.org/rec/conf/www/WanigasekaraAGG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-02477,
author = {Qitong Gao and
Stephen L. Schmidt and
Afsana Chowdhury and
Guangyu Feng and
Jennifer J. Peters and
Katherine Genty and
Warren M. Grill and
Dennis A. Turner and
Miroslav Pajic},
title = {Offline Learning of Closed-Loop Deep Brain Stimulation Controllers
for Parkinson Disease Treatment},
journal = {CoRR},
volume = {abs/2302.02477},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.02477},
doi = {10.48550/ARXIV.2302.02477},
eprinttype = {arXiv},
eprint = {2302.02477},
timestamp = {Fri, 10 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-02477.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-14822,
author = {Sean Tull and
Razin A. Shaikh and
Sara Sabrina Zemljic and
Stephen Clark},
title = {Formalising and Learning a Quantum Model of Concepts},
journal = {CoRR},
volume = {abs/2302.14822},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.14822},
doi = {10.48550/ARXIV.2302.14822},
eprinttype = {arXiv},
eprint = {2302.14822},
timestamp = {Thu, 02 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-14822.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-01778,
author = {Zbynek Koldovsk{\'{y}} and
Jaroslav Cmejla and
T{\"{u}}lay Adali and
Stephen O'Regan},
title = {Independent Vector Extraction Constrained on Manifold of Half-Length
Filters},
journal = {CoRR},
volume = {abs/2304.01778},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.01778},
doi = {10.48550/ARXIV.2304.01778},
eprinttype = {arXiv},
eprint = {2304.01778},
timestamp = {Thu, 20 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-01778.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-03949,
author = {Sathya R. Chitturi and
Zhurun Ji and
Alexander Petsch and
Cheng Peng and
Zhantao Chen and
Rajan Plumley and
Mike Dunne and
Sougata Mardanya and
Sugata Chowdhury and
Hongwei Chen and
Arun Bansil and
Adrian E. Feiguin and
Alexander Kolesnikov and
Dharmalingam Prabhakaran and
Stephen Hayden and
Daniel Ratner and
Chunjing Jia and
Youssef Nashed and
Joshua J. Turner},
title = {Capturing dynamical correlations using implicit neural representations},
journal = {CoRR},
volume = {abs/2304.03949},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.03949},
doi = {10.48550/ARXIV.2304.03949},
eprinttype = {arXiv},
eprint = {2304.03949},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-03949.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-04425,
author = {Rakpong Kaewpuang and
Minrui Xu and
Stephen John Turner and
Dusit Niyato and
Han Yu and
Dong In Kim},
title = {Entangled Pair Resource Allocation under Uncertain Fidelity Requirements},
journal = {CoRR},
volume = {abs/2304.04425},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.04425},
doi = {10.48550/ARXIV.2304.04425},
eprinttype = {arXiv},
eprint = {2304.04425},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-04425.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-04640,
author = {Jason Yik and
Soikat Hasan Ahmed and
Zergham Ahmed and
Brian Anderson and
Andreas G. Andreou and
Chiara Bartolozzi and
Arindam Basu and
Douwe den Blanken and
Petrut Bogdan and
Sander M. Boht{\'{e}} and
Younes Bouhadjar and
Sonia M. Buckley and
Gert Cauwenberghs and
Federico Corradi and
Guido de Croon and
Andreea Danielescu and
Anurag Reddy Daram and
Mike Davies and
Yigit Demirag and
Jason Eshraghian and
Jeremy Forest and
Steve B. Furber and
Michael Furlong and
Aditya Gilra and
Giacomo Indiveri and
Siddharth Joshi and
Vedant Karia and
Lyes Khacef and
James C. Knight and
Laura Kriener and
Rajkumar Kubendran and
Dhireesha Kudithipudi and
Gregor Lenz and
Rajit Manohar and
Christian Mayr and
Konstantinos P. Michmizos and
Dylan R. Muir and
Emre Neftci and
Thomas Nowotny and
Fabrizio Ottati and
Ay{\c{c}}a {\"{O}}zcelikkale and
Noah Pacik{-}Nelson and
Priyadarshini Panda and
Pao{-}Sheng Sun and
Melika Payvand and
Christian Pehle and
Mihai A. Petrovici and
Christoph Posch and
Alpha Renner and
Yulia Sandamirskaya and
Clemens JS Schaefer and
Andr{\'{e}} van Schaik and
Johannes Schemmel and
Catherine D. Schuman and
Jae{-}sun Seo and
Sumit Bam Shrestha and
Manolis Sifalakis and
Amos Sironi and
Kenneth Michael Stewart and
Terrence C. Stewart and
Philipp Stratmann and
Guangzhi Tang and
Jonathan Timcheck and
Marian Verhelst and
Craig M. Vineyard and
Bernhard Vogginger and
Amirreza Yousefzadeh and
Biyan Zhou and
Fatima Tuz Zohora and
Charlotte Frenkel and
Vijay Janapa Reddi},
title = {NeuroBench: Advancing Neuromorphic Computing through Collaborative,
Fair and Representative Benchmarking},
journal = {CoRR},
volume = {abs/2304.04640},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.04640},
doi = {10.48550/ARXIV.2304.04640},
eprinttype = {arXiv},
eprint = {2304.04640},
timestamp = {Fri, 18 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-04640.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-05108,
author = {Uchenna Daniel Ani and
Jeremy M. Watson and
Nilufer Tuptuk and
Steve Hailes and
Aslam Jawar},
title = {Socio-Technical Security Modelling: Analysis of State-of-the-Art,
Application, and Maturity in Critical Industrial Infrastructure Environments/Domains},
journal = {CoRR},
volume = {abs/2305.05108},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.05108},
doi = {10.48550/ARXIV.2305.05108},
eprinttype = {arXiv},
eprint = {2305.05108},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-05108.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-09617,
author = {Karan Singhal and
Tao Tu and
Juraj Gottweis and
Rory Sayres and
Ellery Wulczyn and
Le Hou and
Kevin Clark and
Stephen Pfohl and
Heather Cole{-}Lewis and
Darlene Neal and
Mike Schaekermann and
Amy Wang and
Mohamed Amin and
Sami Lachgar and
Philip Andrew Mansfield and
Sushant Prakash and
Bradley Green and
Ewa Dominowska and
Blaise Ag{\"{u}}era y Arcas and
Nenad Tomasev and
Yun Liu and
Renee Wong and
Christopher Semturs and
S. Sara Mahdavi and
Joelle K. Barral and
Dale R. Webster and
Gregory S. Corrado and
Yossi Matias and
Shekoofeh Azizi and
Alan Karthikesalingam and
Vivek Natarajan},
title = {Towards Expert-Level Medical Question Answering with Large Language
Models},
journal = {CoRR},
volume = {abs/2305.09617},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.09617},
doi = {10.48550/ARXIV.2305.09617},
eprinttype = {arXiv},
eprint = {2305.09617},
timestamp = {Wed, 06 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-09617.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-09619,
author = {Daniel Pfrommer and
Max Simchowitz and
Tyler Westenbroek and
Nikolai Matni and
Stephen Tu},
title = {The Power of Learned Locally Linear Models for Nonlinear Policy Optimization},
journal = {CoRR},
volume = {abs/2305.09619},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.09619},
doi = {10.48550/ARXIV.2305.09619},
eprinttype = {arXiv},
eprint = {2305.09619},
timestamp = {Wed, 24 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-09619.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-11165,
author = {Ingvar M. Ziemann and
Stephen Tu and
George J. Pappas and
Nikolai Matni},
title = {The noise level in linear regression with dependent data},
journal = {CoRR},
volume = {abs/2305.11165},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.11165},
doi = {10.48550/ARXIV.2305.11165},
eprinttype = {arXiv},
eprint = {2305.11165},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-11165.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-12284,
author = {Amir Ali Ahmadi and
Abraar Chaudhry and
Vikas Sindhwani and
Stephen Tu},
title = {Safely Learning Dynamical Systems},
journal = {CoRR},
volume = {abs/2305.12284},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.12284},
doi = {10.48550/ARXIV.2305.12284},
eprinttype = {arXiv},
eprint = {2305.12284},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-12284.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-05216,
author = {Brian Hu Zhang and
Gabriele Farina and
Ioannis Anagnostides and
Federico Cacciamani and
Stephen Marcus McAleer and
Andreas Alexander Haupt and
Andrea Celli and
Nicola Gatti and
Vincent Conitzer and
Tuomas Sandholm},
title = {Computing Optimal Equilibria and Mechanisms via Learning in Zero-Sum
Extensive-Form Games},
journal = {CoRR},
volume = {abs/2306.05216},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.05216},
doi = {10.48550/ARXIV.2306.05216},
eprinttype = {arXiv},
eprint = {2306.05216},
timestamp = {Wed, 14 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-05216.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-05221,
author = {Brian Hu Zhang and
Gabriele Farina and
Ioannis Anagnostides and
Federico Cacciamani and
Stephen Marcus McAleer and
Andreas Alexander Haupt and
Andrea Celli and
Nicola Gatti and
Vincent Conitzer and
Tuomas Sandholm},
title = {Steering No-Regret Learners to Optimal Equilibria},
journal = {CoRR},
volume = {abs/2306.05221},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.05221},
doi = {10.48550/ARXIV.2306.05221},
eprinttype = {arXiv},
eprint = {2306.05221},
timestamp = {Wed, 14 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-05221.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-08205,
author = {Saminda Abeyruwan and
Alex Bewley and
Nicholas M. Boffi and
Krzysztof Choromanski and
David B. D'Ambrosio and
Deepali Jain and
Pannag Sanketi and
Anish Shankar and
Vikas Sindhwani and
Sumeet Singh and
Jean{-}Jacques E. Slotine and
Stephen Tu},
title = {Agile Catching with Whole-Body {MPC} and Blackbox Policy Learning},
journal = {CoRR},
volume = {abs/2306.08205},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.08205},
doi = {10.48550/ARXIV.2306.08205},
eprinttype = {arXiv},
eprint = {2306.08205},
timestamp = {Sun, 18 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-08205.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-10171,
author = {Charline Le Lan and
Stephen Tu and
Mark Rowland and
Anna Harutyunyan and
Rishabh Agarwal and
Marc G. Bellemare and
Will Dabney},
title = {Bootstrapped Representations in Reinforcement Learning},
journal = {CoRR},
volume = {abs/2306.10171},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.10171},
doi = {10.48550/ARXIV.2306.10171},
eprinttype = {arXiv},
eprint = {2306.10171},
timestamp = {Wed, 02 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-10171.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-01928,
author = {Allen Z. Ren and
Anushri Dixit and
Alexandra Bodrova and
Sumeet Singh and
Stephen Tu and
Noah Brown and
Peng Xu and
Leila Takayama and
Fei Xia and
Jake Varley and
Zhenjia Xu and
Dorsa Sadigh and
Andy Zeng and
Anirudha Majumdar},
title = {Robots That Ask For Help: Uncertainty Alignment for Large Language
Model Planners},
journal = {CoRR},
volume = {abs/2307.01928},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.01928},
doi = {10.48550/ARXIV.2307.01928},
eprinttype = {arXiv},
eprint = {2307.01928},
timestamp = {Tue, 12 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-01928.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-12062,
author = {Yongyuan Liang and
Yanchao Sun and
Ruijie Zheng and
Xiangyu Liu and
Tuomas Sandholm and
Furong Huang and
Stephen McAleer},
title = {Game-Theoretic Robust Reinforcement Learning Handles Temporally-Coupled
Perturbations},
journal = {CoRR},
volume = {abs/2307.12062},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.12062},
doi = {10.48550/ARXIV.2307.12062},
eprinttype = {arXiv},
eprint = {2307.12062},
timestamp = {Tue, 01 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-12062.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-05803,
author = {Sumeet Singh and
Stephen Tu and
Vikas Sindhwani},
title = {Revisiting Energy Based Models as Policies: Ranking Noise Contrastive
Estimation and Interpolating Energy Models},
journal = {CoRR},
volume = {abs/2309.05803},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2309.05803},
doi = {10.48550/ARXIV.2309.05803},
eprinttype = {arXiv},
eprint = {2309.05803},
timestamp = {Fri, 15 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2309-05803.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-04373,
author = {Ted Moskovitz and
Aaditya K. Singh and
DJ Strouse and
Tuomas Sandholm and
Ruslan Salakhutdinov and
Anca D. Dragan and
Stephen McAleer},
title = {Confronting Reward Model Overoptimization with Constrained {RLHF}},
journal = {CoRR},
volume = {abs/2310.04373},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.04373},
doi = {10.48550/ARXIV.2310.04373},
eprinttype = {arXiv},
eprint = {2310.04373},
timestamp = {Fri, 20 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-04373.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-07843,
author = {Roya Firoozi and
Johnathan Tucker and
Stephen Tian and
Anirudha Majumdar and
Jiankai Sun and
Weiyu Liu and
Yuke Zhu and
Shuran Song and
Ashish Kapoor and
Karol Hausman and
Brian Ichter and
Danny Driess and
Jiajun Wu and
Cewu Lu and
Mac Schwager},
title = {Foundation Models in Robotics: Applications, Challenges, and the Future},
journal = {CoRR},
volume = {abs/2312.07843},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.07843},
doi = {10.48550/ARXIV.2312.07843},
eprinttype = {arXiv},
eprint = {2312.07843},
timestamp = {Wed, 12 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-07843.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/AleneziH22,
author = {Turki Alenezi and
Stephen C. Hirtle},
title = {Normalized Attraction Travel Personality Representation for Improving
Travel Recommender Systems},
journal = {{IEEE} Access},
volume = {10},
pages = {56493--56503},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3178439},
doi = {10.1109/ACCESS.2022.3178439},
timestamp = {Mon, 13 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/AleneziH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/BaruPABCCFFJLLL22,
author = {Chaitanya K. Baru and
Michael Pozmantier and
Ilkay Altintas and
Stephen Baek and
Jonathan Cohen and
Laura E. Condon and
Giulia Fanti and
Raul Castro Fernandez and
Ethan Jackson and
Upmanu Lall and
Bennett A. Landman and
Hai Li and
Claudia Marin and
Beatriz Mart{\'{\i}}nez{-}L{\'{o}}pez and
Dimitris N. Metaxas and
Bradley D. Olsen and
Grier P. Page and
Yelda Turkan and
Jingbo Zhang and
Peng Zhang},
title = {Enabling {AI} Innovation via Data and Model Sharing: An Overview of
the Nsf Convergence Accelerator Track {D}},
journal = {{AI} Mag.},
volume = {43},
number = {1},
pages = {93--104},
year = {2022},
url = {https://doi.org/10.1609/aimag.v43i1.19130},
doi = {10.1609/AIMAG.V43I1.19130},
timestamp = {Wed, 06 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/BaruPABCCFFJLLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fdgth/HabererBTTTTMGDMA22,
author = {Jessica E. Haberer and
Robert Baijuka and
John Bosco Tumuhairwe and
Edna B. Tindimwebwa and
James Tinkamanyire and
Ellyk Tuhanamagyezi and
Lawrence Musoke and
Lindsey E. Garrison and
Marisa Delsignore and
Nicholas Musinguzi and
Stephen Asiimwe},
title = {Implementation of Electronic Adherence Monitors and Associated Interventions
for Routine {HIV} Antiretroviral Therapy in Uganda: Promising Findings},
journal = {Frontiers Digit. Health},
volume = {4},
year = {2022},
url = {https://doi.org/10.3389/fdgth.2022.899643},
doi = {10.3389/FDGTH.2022.899643},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fdgth/HabererBTTTTMGDMA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpca/TurnerBBBCCDFHJ22,
author = {John A. Turner and
James F. Belak and
Nathan Barton and
Matthew T. Bement and
Neil N. Carlson and
Robert Carson and
Stephen Dewitt and
Jean{-}Luc Fattebert and
Neil Eugene Hodge and
Zechariah Jibben and
Wayne E. King and
Lyle Levine and
Christopher K. Newman and
Alex Plotkowski and
Balasubramaniam Radhakrishnan and
Samuel Temple Reeve and
Matthew Rolchigo and
Adrian S. Sabau and
Stuart R. Slattery and
Benjamin Stump},
title = {ExaAM: Metal additive manufacturing simulation at the fidelity of
the microstructure},
journal = {Int. J. High Perform. Comput. Appl.},
volume = {36},
number = {1},
pages = {13--39},
year = {2022},
url = {https://doi.org/10.1177/10943420211042558},
doi = {10.1177/10943420211042558},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhpca/TurnerBBBCCDFHJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iotj/NgoenriangTNS22,
author = {Napat Ngoenriang and
Stephen John Turner and
Dusit Niyato and
Sucha Supittayapornpong},
title = {Joint {UAV} Placement and Data Delivery in Aerial Inspection Under
Uncertainties},
journal = {{IEEE} Internet Things J.},
volume = {9},
number = {9},
pages = {6389--6403},
year = {2022},
url = {https://doi.org/10.1109/JIOT.2021.3113713},
doi = {10.1109/JIOT.2021.3113713},
timestamp = {Wed, 18 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iotj/NgoenriangTNS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcphy/WaltersTF22,
author = {Stephen J. Walters and
Ross J. Turner and
Lawrence K. Forbes},
title = {Computing interfacial flows of viscous fluids},
journal = {J. Comput. Phys.},
volume = {471},
pages = {111626},
year = {2022},
url = {https://doi.org/10.1016/j.jcp.2022.111626},
doi = {10.1016/J.JCP.2022.111626},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcphy/WaltersTF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmlr/BoffiTS22,
author = {Nicholas M. Boffi and
Stephen Tu and
Jean{-}Jacques E. Slotine},
title = {Nonparametric adaptive control and prediction: theory and randomized
algorithms},
journal = {J. Mach. Learn. Res.},
volume = {23},
pages = {281:1--281:46},
year = {2022},
url = {https://jmlr.org/papers/v23/22-0022.html},
timestamp = {Wed, 11 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmlr/BoffiTS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MaiDKTBGCBSK22,
author = {Dawei Mai and
Yann Donnelly and
Michael Peter Kennedy and
Stefano Tulisi and
James Breslin and
Patrick Griffin and
Michael Connor and
Stephen Brookes and
Brian Shelly and
Mike Keaveney},
title = {Wandering Spur Suppression in a 4.9-GHz Fractional-N Frequency Synthesizer},
journal = {{IEEE} J. Solid State Circuits},
volume = {57},
number = {7},
pages = {2011--2023},
year = {2022},
url = {https://doi.org/10.1109/JSSC.2022.3163080},
doi = {10.1109/JSSC.2022.3163080},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MaiDKTBGCBSK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MehtaTTTGG22,
author = {Nandish Mehta and
Stephen G. Tell and
Walker J. Turner and
Lamar Tatro and
Jih Ren Goh and
C. Thomas Gray},
title = {An On-Chip Relaxation Oscillator in 5-nm FinFET Using a Frequency-Error
Feedback Loop},
journal = {{IEEE} J. Solid State Circuits},
volume = {57},
number = {10},
pages = {2898--2908},
year = {2022},
url = {https://doi.org/10.1109/JSSC.2022.3183208},
doi = {10.1109/JSSC.2022.3183208},
timestamp = {Tue, 18 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MehtaTTTGG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/CunninghamAAAAA22,
author = {Fiona Cunningham and
James E. Allen and
Jamie Allen and
Jorge {\'{A}}lvarez{-}Jarreta and
M. Ridwan Amode and
Irina M. Armean and
Olanrewaju Austine{-}Orimoloye and
Andrey G. Azov and
If Barnes and
Ruth Bennett and
Andrew E. Berry and
Jyothish Bhai and
Alexandra Bignell and
Konstantinos Billis and
Sanjay Boddu and
Lucy Brooks and
Mehrnaz Charkhchi and
Carla A. Cummins and
Luca Da Rin Fioretto and
Claire Davidson and
Kamalkumar Jayantilal Dodiya and
Sarah M. Donaldson and
Bilal El Houdaigui and
Tamara El Naboulsi and
Reham Fatima and
Carlos Garc{\'{\i}}a{-}Gir{\'{o}}n and
Thiago A. L. Genez and
Jose Gonzalez Martinez and
Cristina Guijarro{-}Clarke and
Arthur Gymer and
Matthew Hardy and
Zoe Hollis and
Thibaut Hourlier and
Toby Hunt and
Thomas Juettemann and
Vinay Kaikala and
Mike P. Kay and
Ilias Lavidas and
Tuan Le and
Diana Lemos and
Jos{\'{e}} Carlos Marug{\'{a}}n and
Shamika Mohanan and
Aleena Mushtaq and
Marc Naven and
Denye N. Oheh and
Anne Parker and
Andrew Parton and
Malcolm Perry and
Ivana Pilizota and
Irina Prosovetskaia and
Manoj Pandian Sakthivel and
Ahamed Imran Abdul Salam and
Bianca M. Schmitt and
Helen Schuilenburg and
Dan Sheppard and
Jos{\'{e}} G. P{\'{e}}rez{-}Silva and
William Stark and
Emily Steed and
Ky{\"{o}}sti Sutinen and
Ranjit Sukumaran and
Dulika Sumathipala and
Marie{-}Marthe Suner and
Michal Szpak and
Anja Thormann and
Francesca Floriana Tricomi and
David Urbina{-}G{\'{o}}mez and
Andres Veidenberg and
Thomas A. Walsh and
Brandon Walts and
Natalie L. Willhoft and
Andrea Winterbottom and
Elizabeth Wass and
Marc Chakiachvili and
Bethany Flint and
Adam Frankish and
Stefano Giorgetti and
Leanne Haggerty and
Sarah E. Hunt and
Garth IIsley and
Jane E. Loveland and
Fergal J. Martin and
Benjamin Moore and
Jonathan M. Mudge and
Matthieu Muffato and
Emily Perry and
Magali Ruffier and
John G. Tate and
David Thybert and
Stephen J. Trevanion and
Sarah Dyer and
Peter W. Harrison and
Kevin L. Howe and
Andrew D. Yates and
Daniel R. Zerbino and
Paul Flicek},
title = {Ensembl 2022},
journal = {Nucleic Acids Res.},
volume = {50},
number = {{D1}},
pages = {988--995},
year = {2022},
url = {https://doi.org/10.1093/nar/gkab1049},
doi = {10.1093/NAR/GKAB1049},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/CunninghamAAAAA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/VaradiADNNYYSWL22,
author = {Mihaly Varadi and
Stephen Anyango and
Mandar S. Deshpande and
Sreenath Nair and
Cindy Natassia and
Galabina Yordanova and
David Yuan and
Oana Stroe and
Gemma Wood and
Agata Laydon and
Augustin Z{\'{\i}}dek and
Tim Green and
Kathryn Tunyasuvunakool and
Stig Petersen and
John Jumper and
Ellen Clancy and
Richard Green and
Ankur Vora and
Mira Lutfi and
Michael Figurnov and
Andrew Cowie and
Nicole Hobbs and
Pushmeet Kohli and
Gerard J. Kleywegt and
Ewan Birney and
Demis Hassabis and
Sameer Velankar},
title = {AlphaFold Protein Structure Database: massively expanding the structural
coverage of protein-sequence space with high-accuracy models},
journal = {Nucleic Acids Res.},
volume = {50},
number = {{D1}},
pages = {439--444},
year = {2022},
url = {https://doi.org/10.1093/nar/gkab1061},
doi = {10.1093/NAR/GKAB1061},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/VaradiADNNYYSWL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/YatesAAABBBCMCC22,
author = {Andrew D. Yates and
James E. Allen and
M. Ridwan Amode and
Andrey G. Azov and
Matthieu Barba and
Andr{\'{e}}s Becerra and
Jyothish Bhai and
Lahcen I. Campbell and
Manuel Carbajo Martinez and
Marc Chakiachvili and
Kapeel Chougule and
Mikkel B. Christensen and
Bruno Contreras{-}Moreira and
Alayne Cuzick and
Luca Da Rin Fioretto and
Paul Davis and
Nishadi De Silva and
Stavros Diamantakis and
Sarah Dyer and
Justin Elser and
Carla V. Filippi and
Astrid Gall and
Dionysios Grigoriadis and
Cristina Guijarro{-}Clarke and
Parul Gupta and
Kim E. Hammond{-}Kosack and
Kevin L. Howe and
Pankaj Jaiswal and
Vinay Kaikala and
Vivek Kumar and
Sunita Kumari and
Nick Langridge and
Tuan Le and
Manuel Luypaert and
Gareth Maslen and
Thomas Maurel and
Benjamin Moore and
Matthieu Muffato and
Aleena Mushtaq and
Guy Naamati and
Sushma Naithani and
Andrew Olson and
Anne Parker and
Michael Paulini and
Helder Pedro and
Emily Perry and
Justin Preece and
Mark Quinton{-}Tulloch and
Faye Rodgers and
Marc Rosello and
Magali Ruffier and
James Seager and
Vasily Sitnik and
Michal Szpak and
John G. Tate and
Marcela K. Tello{-}Ruiz and
Stephen J. Trevanion and
Martin Urban and
Doreen Ware and
Sharon Wei and
Gary Williams and
Andrea Winterbottom and
Magdalena Zarowiecki and
Robert D. Finn and
Paul Flicek},
title = {Ensembl Genomes 2022: an expanding genome resource for non-vertebrates},
journal = {Nucleic Acids Res.},
volume = {50},
number = {{D1}},
pages = {996--1003},
year = {2022},
url = {https://doi.org/10.1093/nar/gkab1007},
doi = {10.1093/NAR/GKAB1007},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/YatesAAABBBCMCC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/WallacePBMZSMLT22,
author = {Grant Wallace and
Stephen Polcyn and
Paula P. Brooks and
Anne C. Mennen and
Ke Zhao and
Paul S. Scotti and
Sebastian Michelmann and
Kai Li and
Nicholas B. Turk{-}Browne and
Jonathan D. Cohen and
Kenneth A. Norman},
title = {RT-Cloud: {A} cloud-based software framework to simplify and standardize
real-time fMRI},
journal = {NeuroImage},
volume = {257},
pages = {119295},
year = {2022},
url = {https://doi.org/10.1016/j.neuroimage.2022.119295},
doi = {10.1016/J.NEUROIMAGE.2022.119295},
timestamp = {Thu, 30 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/WallacePBMZSMLT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/ZhangCZTXSWCW22,
author = {Gemeng Zhang and
Biao Cai and
Aiying Zhang and
Zhuozhuo Tu and
Li Xiao and
Julia M. Stephen and
Tony W. Wilson and
Vince D. Calhoun and
Yu{-}Ping Wang},
title = {Detecting abnormal connectivity in schizophrenia via a joint directed
acyclic graph estimation model},
journal = {NeuroImage},
volume = {260},
pages = {119451},
year = {2022},
url = {https://doi.org/10.1016/j.neuroimage.2022.119451},
doi = {10.1016/J.NEUROIMAGE.2022.119451},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/ZhangCZTXSWCW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spm/AdaliGHMS22,
author = {T{\"{u}}lay Adali and
Rodrigo Capobianco Guido and
Tin Kam Ho and
Klaus{-}Robert M{\"{u}}ller and
Stephen C. Strother},
title = {Interpretability, Reproducibility, and Replicability [From the Guest
Editors]},
journal = {{IEEE} Signal Process. Mag.},
volume = {39},
number = {4},
pages = {5--7},
year = {2022},
url = {https://doi.org/10.1109/MSP.2022.3170665},
doi = {10.1109/MSP.2022.3170665},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/spm/AdaliGHMS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spm/AdaliKASCA22,
author = {T{\"{u}}lay Adali and
Furkan Kantar and
Mohammad Abu Baker Siddique Akhonda and
Stephen C. Strother and
Vince D. Calhoun and
Evrim Acar},
title = {Reproducibility in Matrix and Tensor Decompositions: Focus on model
match, interpretability, and uniqueness},
journal = {{IEEE} Signal Process. Mag.},
volume = {39},
number = {4},
pages = {8--24},
year = {2022},
url = {https://doi.org/10.1109/MSP.2022.3163870},
doi = {10.1109/MSP.2022.3163870},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/spm/AdaliKASCA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcc/HollimanACDJT22,
author = {Nicolas S. Holliman and
Manu Antony and
James Charlton and
Stephen Dowsland and
Philip James and
Mark Turner},
title = {Petascale Cloud Supercomputing for Terapixel Visualization of a Digital
Twin},
journal = {{IEEE} Trans. Cloud Comput.},
volume = {10},
number = {1},
pages = {583--594},
year = {2022},
url = {https://doi.org/10.1109/TCC.2019.2958087},
doi = {10.1109/TCC.2019.2958087},
timestamp = {Fri, 01 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcc/HollimanACDJT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/KuhrmannTHKMLPF22,
author = {Marco Kuhrmann and
Paolo Tell and
Regina Hebig and
Jil Kl{\"{u}}nder and
J{\"{u}}rgen M{\"{u}}nch and
Oliver Linssen and
Dietmar Pfahl and
Michael Felderer and
Christian R. Prause and
Stephen G. MacDonell and
Joyce Nakatumba{-}Nabende and
David Raffo and
Sarah Beecham and
Eray T{\"{u}}z{\"{u}}n and
Gustavo L{\'{o}}pez and
Nicol{\'{a}}s Paez and
Diego Fontdevila and
Sherlock A. Licorish and
Steffen K{\"{u}}pper and
G{\"{u}}nther Ruhe and
Eric Knauss and
{\"{O}}zden {\"{O}}zcan{-}Top and
Paul M. Clarke and
Fergal McCaffery and
Marcela Genero and
Aurora Vizca{\'{\i}}no and
Mario Piattini and
Marcos Kalinowski and
Tayana Conte and
Rafael Prikladnicki and
Stephan Krusche and
Ahmet Coskun{\c{c}}ay and
Ezequiel Scott and
Fabio Calefato and
Svetlana Pimonova and
Rolf{-}Helge Pfeiffer and
Ulrik Pagh Schultz and
Rogardt Heldal and
Masud Fazal{-}Baqaie and
Craig Anslow and
Maleknaz Nayebi and
Kurt Schneider and
Stefan Sauer and
Dietmar Winkler and
Stefan Biffl and
Mar{\'{\i}}a Cecilia Bastarrica and
Ita Richardson},
title = {What Makes Agile Software Development Agile?},
journal = {{IEEE} Trans. Software Eng.},
volume = {48},
number = {9},
pages = {3523--3539},
year = {2022},
url = {https://doi.org/10.1109/TSE.2021.3099532},
doi = {10.1109/TSE.2021.3099532},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tse/KuhrmannTHKMLPF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acis/Lam0S22,
author = {Yuk Tung Tonnie Lam and
Peter Busch and
Stephen Smith},
title = {Australia's Embrace of a Cashless Society: {A} Quantitative Analysis},
booktitle = {Australasian Conference on Information Systems, {ACIS} 2022, Melbourne,
Australia, December 4-7, 2022},
pages = {24},
year = {2022},
url = {https://aisel.aisnet.org/acis2022/24},
timestamp = {Thu, 16 May 2024 17:06:12 +0200},
biburl = {https://dblp.org/rec/conf/acis/Lam0S22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl-louhi/TuDC22,
author = {Sichang Tu and
Stephen Doogan and
Jinho D. Choi},
editor = {Alberto Lavelli and
Eben Holderness and
Antonio Jimeno{-}Yepes and
Anne{-}Lyse Minard and
James Pustejovsky and
Fabio Rinaldi},
title = {Condition-Treatment Relation Extraction on Disease-related Social
Media Data},
booktitle = {Proceedings of the 13th International Workshop on Health Text Mining
and Information Analysis, LOUHI@EMNLP 2022, Abu Dhabi, United Arab
Emirates (Hybrid), December 7, 2022},
pages = {218--228},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.louhi-1.24},
doi = {10.18653/V1/2022.LOUHI-1.24},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl-louhi/TuDC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aistats/BoffiTS22,
author = {Nicholas M. Boffi and
Stephen Tu and
Jean{-}Jacques E. Slotine},
editor = {Gustau Camps{-}Valls and
Francisco J. R. Ruiz and
Isabel Valera},
title = {The role of optimization geometry in single neuron learning},
booktitle = {International Conference on Artificial Intelligence and Statistics,
{AISTATS} 2022, 28-30 March 2022, Virtual Event},
series = {Proceedings of Machine Learning Research},
volume = {151},
pages = {11528--11549},
publisher = {{PMLR}},
year = {2022},
url = {https://proceedings.mlr.press/v151/boffi22a.html},
timestamp = {Sat, 30 Sep 2023 09:34:08 +0200},
biburl = {https://dblp.org/rec/conf/aistats/BoffiTS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aistats/LanTOAB22,
author = {Charline Le Lan and
Stephen Tu and
Adam Oberman and
Rishabh Agarwal and
Marc G. Bellemare},
editor = {Gustau Camps{-}Valls and
Francisco J. R. Ruiz and
Isabel Valera},
title = {On the Generalization of Representations in Reinforcement Learning},
booktitle = {International Conference on Artificial Intelligence and Statistics,
{AISTATS} 2022, 28-30 March 2022, Virtual Event},
series = {Proceedings of Machine Learning Research},
volume = {151},
pages = {4132--4157},
publisher = {{PMLR}},
year = {2022},
url = {https://proceedings.mlr.press/v151/le-lan22a.html},
timestamp = {Fri, 20 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aistats/LanTOAB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aistats/ShengCCSJ22,
author = {Stephen Sheng and
Keerthi Vasan G. C and
Chi Po P. Choi and
James Sharpnack and
Tucker Jones},
editor = {Gustau Camps{-}Valls and
Francisco J. R. Ruiz and
Isabel Valera},
title = {An Unsupervised Hunt for Gravitational Lenses},
booktitle = {International Conference on Artificial Intelligence and Statistics,
{AISTATS} 2022, 28-30 March 2022, Virtual Event},
series = {Proceedings of Machine Learning Research},
volume = {151},
pages = {9827--9843},
publisher = {{PMLR}},
year = {2022},
url = {https://proceedings.mlr.press/v151/sheng22a.html},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aistats/ShengCCSJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/WangWAALMRTT0S22,
author = {Xiaochen Wang and
Yue Wang and
Jos{\'{e}} Luis Ambite and
Abhishek M. Appaji and
Howard Lander and
Stephen Moore and
Arcot Rajasekar and
Jessica A. D. Turner and
Matthew D. Turner and
Lei Wang and
Satya S. Sahoo},
title = {Enabling Scientific Reproducibility through {FAIR} Data Management:
An ontology-driven deep learning approach in the NeuroBridge Project},
booktitle = {{AMIA} 2022, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 5-9, 2022},
publisher = {{AMIA}},
year = {2022},
url = {https://knowledge.amia.org/76677-amia-1.4637602/f006-1.4642154/f006-1.4642155/1055-1.4642198/1165-1.4642195},
timestamp = {Wed, 14 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/WangWAALMRTT0S22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/corl/XiaoZCLFVTSXXPK22,
author = {Xuesu Xiao and
Tingnan Zhang and
Krzysztof Marcin Choromanski and
Tsang{-}Wei Edward Lee and
Anthony G. Francis and
Jake Varley and
Stephen Tu and
Sumeet Singh and
Peng Xu and
Fei Xia and
Sven Mikael Persson and
Dmitry Kalashnikov and
Leila Takayama and
Roy Frostig and
Jie Tan and
Carolina Parada and
Vikas Sindhwani},
editor = {Karen Liu and
Dana Kulic and
Jeffrey Ichnowski},
title = {Learning Model Predictive Controllers with Real-Time Attention for
Real-World Navigation},
booktitle = {Conference on Robot Learning, CoRL 2022, 14-18 December 2022, Auckland,
New Zealand},
series = {Proceedings of Machine Learning Research},
volume = {205},
pages = {1708--1721},
publisher = {{PMLR}},
year = {2022},
url = {https://proceedings.mlr.press/v205/xiao23a.html},
timestamp = {Tue, 12 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/corl/XiaoZCLFVTSXXPK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/WangNSLZHL22,
author = {Ziyan Wang and
Giljoo Nam and
Tuur Stuyck and
Stephen Lombardi and
Michael Zollh{\"{o}}fer and
Jessica K. Hodgins and
Christoph Lassner},
title = {{HVH:} Learning a Hybrid Neural Volumetric Representation for Dynamic
Hair Performance Capture},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2022, New Orleans, LA, USA, June 18-24, 2022},
pages = {6133--6144},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/CVPR52688.2022.00605},
doi = {10.1109/CVPR52688.2022.00605},
timestamp = {Wed, 05 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/WangNSLZHL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/data/OdebodeTAS22,
author = {Afees Adegoke Odebode and
Allan Tucker and
Mahir Arzoky and
Stephen Swift},
editor = {Alfredo Cuzzocrea and
Oleg Gusikhin and
Wil M. P. van der Aalst and
Slimane Hammoudi},
title = {Estimating the Optimal Number of Clusters from Subsets of Ensembles},
booktitle = {Proceedings of the 11th International Conference on Data Science,
Technology and Applications, {DATA} 2022, Lisbon, Portugal, July 11-13,
2022},
pages = {383--391},
publisher = {{SCITEPRESS}},
year = {2022},
url = {https://doi.org/10.5220/0011275000003269},
doi = {10.5220/0011275000003269},
timestamp = {Tue, 06 Jun 2023 14:58:01 +0200},
biburl = {https://dblp.org/rec/conf/data/OdebodeTAS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/BoonyakitanontG22,
author = {Poomipat Boonyakitanont and
Ben Gabrielson and
Irina Belyaeva and
Parthan Olikkal and
Jitkomut Songsiri and
Yu{-}Ping Wang and
Tony W. Wilson and
Vince D. Calhoun and
Julia M. Stephen and
T{\"{u}}lay Adali},
title = {An ICA-based framework for joint analysis of cognitive scores and
{MEG} event-related fields},
booktitle = {44th Annual International Conference of the {IEEE} Engineering in
Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland,
United Kingdom, July 11-15, 2022},
pages = {3594--3598},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/EMBC48229.2022.9871122},
doi = {10.1109/EMBC48229.2022.9871122},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/embc/BoonyakitanontG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/RojasSCPTW22,
author = {Erick Rojas and
Stephen L. Schmidt and
Afsana Chowdhury and
Miroslav Pajic and
Dennis A. Turner and
Deborah S. Won},
title = {A comparison of an implanted accelerometer with a wearable accelerometer
for closed-loop {DBS}},
booktitle = {44th Annual International Conference of the {IEEE} Engineering in
Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland,
United Kingdom, July 11-15, 2022},
pages = {3439--3442},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/EMBC48229.2022.9871232},
doi = {10.1109/EMBC48229.2022.9871232},
timestamp = {Thu, 22 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/RojasSCPTW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccps/GaoSKTGP22,
author = {Qitong Gao and
Stephen L. Schmidt and
Karthik Kamaravelu and
Dennis A. Turner and
Warren M. Grill and
Miroslav Pajic},
title = {Offline Policy Evaluation for Learning-based Deep Brain Stimulation
Controllers},
booktitle = {13th {ACM/IEEE} International Conference on Cyber-Physical Systems,
{ICCPS} 2022, Milano, Italy, May 4-6, 2022},
pages = {80--91},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICCPS54341.2022.00014},
doi = {10.1109/ICCPS54341.2022.00014},
timestamp = {Wed, 29 Jun 2022 17:24:41 +0200},
biburl = {https://dblp.org/rec/conf/iccps/GaoSKTGP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdh/TurnerSH22,
author = {Alexander P. Turner and
David Scott and
Stephen Hayes},
editor = {Sheikh Iqbal Ahamed and
Claudio Agostino Ardagna and
Hongyi Bian and
Mario A. Bochicchio and
Carl K. Chang and
Rong N. Chang and
Ernesto Damiani and
Lin Liu and
Misha Pavel and
Corrado Priami and
Hossain Shahriar and
Robert Ward and
Fatos Xhafa and
Jia Zhang and
Farhana H. Zulkernine},
title = {The Classification of Multiple Interacting Gait Abnormalities Using
Insole Sensors and Machine Learning},
booktitle = {{IEEE} International Conference on Digital Health, {ICDH} 2022, Barcelona,
Spain, July 10-16, 2022},
pages = {69--76},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICDH55609.2022.00020},
doi = {10.1109/ICDH55609.2022.00020},
timestamp = {Tue, 20 Aug 2024 07:54:45 +0200},
biburl = {https://dblp.org/rec/conf/icdh/TurnerSH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icimth/BranescuaST22,
author = {Marinela Branescu and
Stephen Swift and
Allan Tucker},
editor = {John Mantas and
Parisis Gallos and
Emmanouil Zoulias and
Arie Hasman and
Mowafa S. Househ and
Marianna Diomidous and
Joseph Liaskos and
Martha Charalampidou},
title = {A Comparison of Convolutional Neural Networks and Traditional Feature-Based
Classification Applied to Leukaemia Image Analysis},
booktitle = {Advances in Informatics, Management and Technology in Healthcare,
{ICIMTH} 2022, 20th International Conference on Informatics, Management,
and Technology in Healthcare, Virtual Event / Athens, Greece, 1-3
July 2022},
series = {Studies in Health Technology and Informatics},
volume = {295},
pages = {545--550},
publisher = {{IOS} Press},
year = {2022},
url = {https://doi.org/10.3233/SHTI220786},
doi = {10.3233/SHTI220786},
timestamp = {Wed, 03 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icimth/BranescuaST22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmla/AlLuhaybiSCT22,
author = {Mashael Al{-}Luhaybi and
Stephen Swift and
Steve Counsell and
Allan Tucker},
editor = {M. Arif Wani and
Mehmed M. Kantardzic and
Vasile Palade and
Daniel Neagu and
Longzhi Yang and
Kit Yan Chan},
title = {Exploring the Explicit Modelling of Bias in Machine Learning Classifiers:
{A} Deep Multi-label ConvNet Approach},
booktitle = {21st {IEEE} International Conference on Machine Learning and Applications,
{ICMLA} 2022, Nassau, Bahamas, December 12-14, 2022},
pages = {1799--1806},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICMLA55696.2022.00277},
doi = {10.1109/ICMLA55696.2022.00277},
timestamp = {Wed, 29 Mar 2023 19:23:50 +0200},
biburl = {https://dblp.org/rec/conf/icmla/AlLuhaybiSCT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kdd/FitzGeraldAABBB22,
author = {Jack FitzGerald and
Shankar Ananthakrishnan and
Konstantine Arkoudas and
Davide Bernardi and
Abhishek Bhagia and
Claudio Delli Bovi and
Jin Cao and
Rakesh Chada and
Amit Chauhan and
Luoxin Chen and
Anurag Dwarakanath and
Satyam Dwivedi and
Turan Gojayev and
Karthik Gopalakrishnan and
Thomas Gueudr{\'{e}} and
Dilek Hakkani{-}Tur and
Wael Hamza and
Jonathan J. H{\"{u}}ser and
Kevin Martin Jose and
Haidar Khan and
Beiye Liu and
Jianhua Lu and
Alessandro Manzotti and
Pradeep Natarajan and
Karolina Owczarzak and
Gokmen Oz and
Enrico Palumbo and
Charith Peris and
Chandana Satya Prakash and
Stephen Rawls and
Andy Rosenbaum and
Anjali Shenoy and
Saleh Soltan and
Mukund Harakere Sridhar and
Lizhen Tan and
Fabian Triefenbach and
Pan Wei and
Haiyang Yu and
Shuai Zheng and
G{\"{o}}khan T{\"{u}}r and
Prem Natarajan},
editor = {Aidong Zhang and
Huzefa Rangwala},
title = {Alexa Teacher Model: Pretraining and Distilling Multi-Billion-Parameter
Encoders for Natural Language Understanding Systems},
booktitle = {{KDD} '22: The 28th {ACM} {SIGKDD} Conference on Knowledge Discovery
and Data Mining, Washington, DC, USA, August 14 - 18, 2022},
pages = {2893--2902},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3534678.3539173},
doi = {10.1145/3534678.3539173},
timestamp = {Tue, 06 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/kdd/FitzGeraldAABBB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/DrummondDTPA22,
author = {Ross Drummond and
Stephen Duncan and
Mathew Turner and
Patricia Pauli and
Frank Allg{\"{o}}wer},
editor = {Roya Firoozi and
Negar Mehr and
Esen Yel and
Rika Antonova and
Jeannette Bohg and
Mac Schwager and
Mykel J. Kochenderfer},
title = {Bounding the Difference Between Model Predictive Control and Neural
Networks},
booktitle = {Learning for Dynamics and Control Conference, {L4DC} 2022, 23-24 June
2022, Stanford University, Stanford, CA, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {168},
pages = {817--829},
publisher = {{PMLR}},
year = {2022},
url = {https://proceedings.mlr.press/v168/drummond22a.html},
timestamp = {Fri, 20 May 2022 14:36:40 +0200},
biburl = {https://dblp.org/rec/conf/l4dc/DrummondDTPA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/TuRZM22,
author = {Stephen Tu and
Alexander Robey and
Tingnan Zhang and
Nikolai Matni},
editor = {Roya Firoozi and
Negar Mehr and
Esen Yel and
Rika Antonova and
Jeannette Bohg and
Mac Schwager and
Mykel J. Kochenderfer},
title = {On the Sample Complexity of Stability Constrained Imitation Learning},
booktitle = {Learning for Dynamics and Control Conference, {L4DC} 2022, 23-24 June
2022, Stanford University, Stanford, CA, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {168},
pages = {180--191},
publisher = {{PMLR}},
year = {2022},
url = {https://proceedings.mlr.press/v168/tu22a.html},
timestamp = {Fri, 20 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/l4dc/TuRZM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/ZhangTBSM22,
author = {Thomas T. C. K. Zhang and
Stephen Tu and
Nicholas M. Boffi and
Jean{-}Jacques E. Slotine and
Nikolai Matni},
editor = {Roya Firoozi and
Negar Mehr and
Esen Yel and
Rika Antonova and
Jeannette Bohg and
Mac Schwager and
Mykel J. Kochenderfer},
title = {Adversarially Robust Stability Certificates can be Sample-Efficient},
booktitle = {Learning for Dynamics and Control Conference, {L4DC} 2022, 23-24 June
2022, Stanford University, Stanford, CA, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {168},
pages = {532--545},
publisher = {{PMLR}},
year = {2022},
url = {https://proceedings.mlr.press/v168/zhang22a.html},
timestamp = {Fri, 20 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/l4dc/ZhangTBSM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mibam/ShieldsWVTIBR22,
author = {Allison Shields and
Kyle A. Williams and
Sricharan S. Veeturi and
Vincent M. Tutino and
Ciprian N. Ionita and
Daniel R. Bednarek and
Stephen Rudin},
editor = {Barjor S. Gimi and
Andrzej Kr{\'{o}}l},
title = {Initial evaluation of 2D and 3D simulated high-speed 1000 fps vascular
contrast-flow image sequences using computational fluid dynamics {(CFD)}},
booktitle = {Medical Imaging 2022: Biomedical Applications in Molecular, Structural,
and Functional Imaging, San Diego, CA, USA, February 20-24, 2022 /
Online, March 21-27, 2022},
series = {{SPIE} Proceedings},
volume = {12036},
publisher = {{SPIE}},
year = {2022},
url = {https://doi.org/10.1117/12.2611170},
doi = {10.1117/12.2611170},
timestamp = {Thu, 21 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mibam/ShieldsWVTIBR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mtsr/TuM22,
author = {Wen Ting Maria Tu and
Stephen Makonin},
editor = {Emmanouel Garoufallou and
Andreas Vlachidis},
title = {Designing PIDs for Reproducible Science Using Time-Series Data},
booktitle = {Metadata and Semantic Research - 16th Research Conference, {MTSR}
2022, London, UK, November 7-11, 2022, Revised Selected Papers},
series = {Communications in Computer and Information Science},
volume = {1789},
pages = {295--301},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-39141-5\_25},
doi = {10.1007/978-3-031-39141-5\_25},
timestamp = {Tue, 05 Sep 2023 18:04:38 +0200},
biburl = {https://dblp.org/rec/conf/mtsr/TuM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/PfrommerZTM22,
author = {Daniel Pfrommer and
Thomas T. C. K. Zhang and
Stephen Tu and
Nikolai Matni},
editor = {Sanmi Koyejo and
S. Mohamed and
A. Agarwal and
Danielle Belgrave and
K. Cho and
A. Oh},
title = {TaSIL: Taylor Series Imitation Learning},
booktitle = {Advances in Neural Information Processing Systems 35: Annual Conference
on Neural Information Processing Systems 2022, NeurIPS 2022, New Orleans,
LA, USA, November 28 - December 9, 2022},
year = {2022},
url = {http://papers.nips.cc/paper\_files/paper/2022/hash/7f10c3d66c3b7863a9cda255dcac5bb7-Abstract-Conference.html},
timestamp = {Mon, 08 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/PfrommerZTM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ZiemannT22,
author = {Ingvar M. Ziemann and
Stephen Tu},
editor = {Sanmi Koyejo and
S. Mohamed and
A. Agarwal and
Danielle Belgrave and
K. Cho and
A. Oh},
title = {Learning with little mixing},
booktitle = {Advances in Neural Information Processing Systems 35: Annual Conference
on Neural Information Processing Systems 2022, NeurIPS 2022, New Orleans,
LA, USA, November 28 - December 9, 2022},
year = {2022},
url = {http://papers.nips.cc/paper\_files/paper/2022/hash/1dc9fbdb6b4d9955ad377cb983232c9f-Abstract-Conference.html},
timestamp = {Mon, 08 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/ZiemannT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pkdd/Kara-IsittST22,
author = {Fawzia Zehra Kara{-}Isitt and
Stephen Swift and
Allan Tucker},
editor = {Irena Koprinska and
Paolo Mignone and
Riccardo Guidotti and
Szymon Jaroszewicz and
Holger Fr{\"{o}}ning and
Francesco Gullo and
Pedro M. Ferreira and
Damian Roqueiro and
Gaia Ceddia and
Slawomir Nowaczyk and
Jo{\~{a}}o Gama and
Rita P. Ribeiro and
Ricard Gavald{\`{a}} and
Elio Masciari and
Zbigniew W. Ras and
Ettore Ritacco and
Francesca Naretto and
Andreas Theissler and
Przemyslaw Biecek and
Wouter Verbeke and
Gregor Schiele and
Franz Pernkopf and
Michaela Blott and
Ilaria Bordino and
Ivan Luciano Danesi and
Giovanni Ponti and
Lorenzo Severini and
Annalisa Appice and
Giuseppina Andresini and
Ib{\'{e}}ria Medeiros and
Guilherme Gra{\c{c}}a and
Lee A. D. Cooper and
Naghmeh Ghazaleh and
Jonas Richiardi and
Diego Saldana Miranda and
Konstantinos Sechidis and
Arif Canakoglu and
Sara Pid{\`{o}} and
Pietro Pinoli and
Albert Bifet and
Sepideh Pashami},
title = {Intelligently Detecting Information Online-Weaponisation Trends {(IDIOT)}},
booktitle = {Machine Learning and Principles and Practice of Knowledge Discovery
in Databases - International Workshops of {ECML} {PKDD} 2022, Grenoble,
France, September 19-23, 2022, Proceedings, Part {I}},
series = {Communications in Computer and Information Science},
volume = {1752},
pages = {197--214},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-23618-1\_13},
doi = {10.1007/978-3-031-23618-1\_13},
timestamp = {Fri, 11 Oct 2024 07:47:20 +0200},
biburl = {https://dblp.org/rec/conf/pkdd/Kara-IsittST22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/NishiPCSZTTN0DG22,
author = {Yoshinori Nishi and
John W. Poulton and
Xi Chen and
Sanquan Song and
Brian Zimmer and
Walker J. Turner and
Stephen G. Tell and
Nikola Nedovic and
John M. Wilson and
William J. Dally and
C. Thomas Gray},
title = {A 0.297-pJ/bit 50.4-Gb/s/wire Inverter-Based Short-Reach Simultaneous
Bidirectional Transceiver for Die-to-Die Interface in 5nm {CMOS}},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022},
pages = {154--155},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830174},
doi = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830174},
timestamp = {Fri, 05 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/NishiPCSZTTN0DG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/PerolatVHTSBMCBAMECWGMK22,
author = {Julien P{\'{e}}rolat and
Bart De Vylder and
Daniel Hennes and
Eugene Tarassov and
Florian Strub and
Vincent de Boer and
Paul Muller and
Jerome T. Connor and
Neil Burch and
Thomas Anthony and
Stephen McAleer and
Romuald Elie and
Sarah H. Cen and
Zhe Wang and
Audrunas Gruslys and
Aleksandra Malysheva and
Mina Khan and
Sherjil Ozair and
Finbarr Timbers and
Toby Pohlen and
Tom Eccles and
Mark Rowland and
Marc Lanctot and
Jean{-}Baptiste Lespiau and
Bilal Piot and
Shayegan Omidshafiei and
Edward Lockhart and
Laurent Sifre and
Nathalie Beauguerlange and
R{\'{e}}mi Munos and
David Silver and
Satinder Singh and
Demis Hassabis and
Karl Tuyls},
title = {Figure Data for the paper "Mastering the Game of Stratego with Model-Free
Multiagent Reinforcement Learning" (Version 1)},
publisher = {Zenodo},
year = {2022},
month = oct,
howpublished = {\url{https://doi.org/10.5281/zenodo.7118519}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.7118519},
doi = {10.5281/ZENODO.7118519},
timestamp = {Mon, 28 Oct 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/data/10/PerolatVHTSBMCBAMECWGMK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-07700,
author = {Stephen McAleer and
Kevin Wang and
John B. Lanier and
Marc Lanctot and
Pierre Baldi and
Tuomas Sandholm and
Roy Fox},
title = {Anytime {PSRO} for Two-Player Zero-Sum Games},
journal = {CoRR},
volume = {abs/2201.07700},
year = {2022},
url = {https://arxiv.org/abs/2201.07700},
eprinttype = {arXiv},
eprint = {2201.07700},
timestamp = {Thu, 28 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2201-07700.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-00543,
author = {Charline Le Lan and
Stephen Tu and
Adam Oberman and
Rishabh Agarwal and
Marc G. Bellemare},
title = {On the Generalization of Representations in Reinforcement Learning},
journal = {CoRR},
volume = {abs/2203.00543},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2203.00543},
doi = {10.48550/ARXIV.2203.00543},
eprinttype = {arXiv},
eprint = {2203.00543},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2203-00543.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-11216,
author = {Razin A. Shaikh and
Sara Sabrina Zemljic and
Sean Tull and
Stephen Clark},
title = {The Conceptual {VAE}},
journal = {CoRR},
volume = {abs/2203.11216},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2203.11216},
doi = {10.48550/ARXIV.2203.11216},
eprinttype = {arXiv},
eprint = {2203.11216},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2203-11216.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-17193,
author = {Stephen Tu and
Roy Frostig and
Mahdi Soltanolkotabi},
title = {Learning from many trajectories},
journal = {CoRR},
volume = {abs/2203.17193},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2203.17193},
doi = {10.48550/ARXIV.2203.17193},
eprinttype = {arXiv},
eprint = {2203.17193},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2203-17193.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-06486,
author = {Ross Drummond and
Stephen R. Duncan and
Matthew C. Turner and
Patricia Pauli and
Frank Allg{\"{o}}wer},
title = {Bounding the difference between model predictive control and neural
networks},
journal = {CoRR},
volume = {abs/2204.06486},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2204.06486},
doi = {10.48550/ARXIV.2204.06486},
eprinttype = {arXiv},
eprint = {2204.06486},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2204-06486.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-14812,
author = {Daniel Pfrommer and
Thomas T. C. K. Zhang and
Stephen Tu and
Nikolai Matni},
title = {TaSIL: Taylor Series Imitation Learning},
journal = {CoRR},
volume = {abs/2205.14812},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.14812},
doi = {10.48550/ARXIV.2205.14812},
eprinttype = {arXiv},
eprint = {2205.14812},
timestamp = {Wed, 01 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-14812.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-04122,
author = {Stephen McAleer and
Gabriele Farina and
Marc Lanctot and
Tuomas Sandholm},
title = {{ESCHER:} Eschewing Importance Sampling in Games by Computing a History
Value Function to Estimate Regret},
journal = {CoRR},
volume = {abs/2206.04122},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.04122},
doi = {10.48550/ARXIV.2206.04122},
eprinttype = {arXiv},
eprint = {2206.04122},
timestamp = {Tue, 14 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-04122.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-04615,
author = {Aarohi Srivastava and
Abhinav Rastogi and
Abhishek Rao and
Abu Awal Md Shoeb and
Abubakar Abid and
Adam Fisch and
Adam R. Brown and
Adam Santoro and
Aditya Gupta and
Adri{\`{a}} Garriga{-}Alonso and
Agnieszka Kluska and
Aitor Lewkowycz and
Akshat Agarwal and
Alethea Power and
Alex Ray and
Alex Warstadt and
Alexander W. Kocurek and
Ali Safaya and
Ali Tazarv and
Alice Xiang and
Alicia Parrish and
Allen Nie and
Aman Hussain and
Amanda Askell and
Amanda Dsouza and
Ambrose Slone and
Ameet Rahane and
Anantharaman S. Iyer and
Anders Andreassen and
Andrea Madotto and
Andrea Santilli and
Andreas Stuhlm{\"{u}}ller and
Andrew M. Dai and
Andrew La and
Andrew K. Lampinen and
Andy Zou and
Angela Jiang and
Angelica Chen and
Anh Vuong and
Animesh Gupta and
Anna Gottardi and
Antonio Norelli and
Anu Venkatesh and
Arash Gholamidavoodi and
Arfa Tabassum and
Arul Menezes and
Arun Kirubarajan and
Asher Mullokandov and
Ashish Sabharwal and
Austin Herrick and
Avia Efrat and
Aykut Erdem and
Ayla Karakas and
B. Ryan Roberts and
Bao Sheng Loe and
Barret Zoph and
Bartlomiej Bojanowski and
Batuhan {\"{O}}zyurt and
Behnam Hedayatnia and
Behnam Neyshabur and
Benjamin Inden and
Benno Stein and
Berk Ekmekci and
Bill Yuchen Lin and
Blake Howald and
Bryan Orinion and
Cameron Diao and
Cameron Dour and
Catherine Stinson and
Cedrick Argueta and
C{\`{e}}sar Ferri Ram{\'{\i}}rez and
Chandan Singh and
Charles Rathkopf and
Chenlin Meng and
Chitta Baral and
Chiyu Wu and
Chris Callison{-}Burch and
Chris Waites and
Christian Voigt and
Christopher D. Manning and
Christopher Potts and
Cindy Ramirez and
Clara E. Rivera and
Clemencia Siro and
Colin Raffel and
Courtney Ashcraft and
Cristina Garbacea and
Damien Sileo and
Dan Garrette and
Dan Hendrycks and
Dan Kilman and
Dan Roth and
Daniel Freeman and
Daniel Khashabi and
Daniel Levy and
Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and
Danielle Perszyk and
Danny Hernandez and
Danqi Chen and
Daphne Ippolito and
Dar Gilboa and
David Dohan and
David Drakard and
David Jurgens and
Debajyoti Datta and
Deep Ganguli and
Denis Emelin and
Denis Kleyko and
Deniz Yuret and
Derek Chen and
Derek Tam and
Dieuwke Hupkes and
Diganta Misra and
Dilyar Buzan and
Dimitri Coelho Mollo and
Diyi Yang and
Dong{-}Ho Lee and
Dylan Schrader and
Ekaterina Shutova and
Ekin Dogus Cubuk and
Elad Segal and
Eleanor Hagerman and
Elizabeth Barnes and
Elizabeth Donoway and
Ellie Pavlick and
Emanuele Rodol{\`{a}} and
Emma Lam and
Eric Chu and
Eric Tang and
Erkut Erdem and
Ernie Chang and
Ethan A. Chi and
Ethan Dyer and
Ethan J. Jerzak and
Ethan Kim and
Eunice Engefu Manyasi and
Evgenii Zheltonozhskii and
Fanyue Xia and
Fatemeh Siar and
Fernando Mart{\'{\i}}nez{-}Plumed and
Francesca Happ{\'{e}} and
Fran{\c{c}}ois Chollet and
Frieda Rong and
Gaurav Mishra and
Genta Indra Winata and
Gerard de Melo and
Germ{\'{a}}n Kruszewski and
Giambattista Parascandolo and
Giorgio Mariani and
Gloria Wang and
Gonzalo Jaimovitch{-}L{\'{o}}pez and
Gregor Betz and
Guy Gur{-}Ari and
Hana Galijasevic and
Hannah Kim and
Hannah Rashkin and
Hannaneh Hajishirzi and
Harsh Mehta and
Hayden Bogar and
Henry Shevlin and
Hinrich Sch{\"{u}}tze and
Hiromu Yakura and
Hongming Zhang and
Hugh Mee Wong and
Ian Ng and
Isaac Noble and
Jaap Jumelet and
Jack Geissinger and
Jackson Kernion and
Jacob Hilton and
Jaehoon Lee and
Jaime Fern{\'{a}}ndez Fisac and
James B. Simon and
James Koppel and
James Zheng and
James Zou and
Jan Kocon and
Jana Thompson and
Janelle Wingfield and
Jared Kaplan and
Jarema Radom and
Jascha Sohl{-}Dickstein and
Jason Phang and
Jason Wei and
Jason Yosinski and
Jekaterina Novikova and
Jelle Bosscher and
Jennifer Marsh and
Jeremy Kim and
Jeroen Taal and
Jesse H. Engel and
Jesujoba Alabi and
Jiacheng Xu and
Jiaming Song and
Jillian Tang and
Joan Waweru and
John Burden and
John Miller and
John U. Balis and
Jonathan Batchelder and
Jonathan Berant and
J{\"{o}}rg Frohberg and
Jos Rozen and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Joseph Boudeman and
Joseph Guerr and
Joseph Jones and
Joshua B. Tenenbaum and
Joshua S. Rule and
Joyce Chua and
Kamil Kanclerz and
Karen Livescu and
Karl Krauth and
Karthik Gopalakrishnan and
Katerina Ignatyeva and
Katja Markert and
Kaustubh D. Dhole and
Kevin Gimpel and
Kevin Omondi and
Kory Mathewson and
Kristen Chiafullo and
Ksenia Shkaruta and
Kumar Shridhar and
Kyle McDonell and
Kyle Richardson and
Laria Reynolds and
Leo Gao and
Li Zhang and
Liam Dugan and
Lianhui Qin and
Lidia Contreras Ochando and
Louis{-}Philippe Morency and
Luca Moschella and
Lucas Lam and
Lucy Noble and
Ludwig Schmidt and
Luheng He and
Luis Oliveros Col{\'{o}}n and
Luke Metz and
L{\"{u}}tfi Kerem Senel and
Maarten Bosma and
Maarten Sap and
Maartje ter Hoeve and
Maheen Farooqi and
Manaal Faruqui and
Mantas Mazeika and
Marco Baturan and
Marco Marelli and
Marco Maru and
Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and
Marie Tolkiehn and
Mario Giulianelli and
Martha Lewis and
Martin Potthast and
Matthew L. Leavitt and
Matthias Hagen and
M{\'{a}}ty{\'{a}}s Schubert and
Medina Baitemirova and
Melody Arnaud and
Melvin McElrath and
Michael A. Yee and
Michael Cohen and
Michael Gu and
Michael I. Ivanitskiy and
Michael Starritt and
Michael Strube and
Michal Swedrowski and
Michele Bevilacqua and
Michihiro Yasunaga and
Mihir Kale and
Mike Cain and
Mimee Xu and
Mirac Suzgun and
Mitch Walker and
Mo Tiwari and
Mohit Bansal and
Moin Aminnaseri and
Mor Geva and
Mozhdeh Gheini and
Mukund Varma T. and
Nanyun Peng and
Nathan A. Chi and
Nayeon Lee and
Neta Gur{-}Ari Krakover and
Nicholas Cameron and
Nicholas Roberts and
Nick Doiron and
Nicole Martinez and
Nikita Nangia and
Niklas Deckers and
Niklas Muennighoff and
Nitish Shirish Keskar and
Niveditha Iyer and
Noah Constant and
Noah Fiedel and
Nuan Wen and
Oliver Zhang and
Omar Agha and
Omar Elbaghdadi and
Omer Levy and
Owain Evans and
Pablo Antonio Moreno Casares and
Parth Doshi and
Pascale Fung and
Paul Pu Liang and
Paul Vicol and
Pegah Alipoormolabashi and
Peiyuan Liao and
Percy Liang and
Peter Chang and
Peter Eckersley and
Phu Mon Htut and
Pinyu Hwang and
Piotr Milkowski and
Piyush Patil and
Pouya Pezeshkpour and
Priti Oli and
Qiaozhu Mei and
Qing Lyu and
Qinlang Chen and
Rabin Banjade and
Rachel Etta Rudolph and
Raefer Gabriel and
Rahel Habacker and
Ramon Risco and
Rapha{\"{e}}l Milli{\`{e}}re and
Rhythm Garg and
Richard Barnes and
Rif A. Saurous and
Riku Arakawa and
Robbe Raymaekers and
Robert Frank and
Rohan Sikand and
Roman Novak and
Roman Sitelew and
Ronan LeBras and
Rosanne Liu and
Rowan Jacobs and
Rui Zhang and
Ruslan Salakhutdinov and
Ryan Chi and
Ryan Lee and
Ryan Stovall and
Ryan Teehan and
Rylan Yang and
Sahib Singh and
Saif M. Mohammad and
Sajant Anand and
Sam Dillavou and
Sam Shleifer and
Sam Wiseman and
Samuel Gruetter and
Samuel R. Bowman and
Samuel S. Schoenholz and
Sanghyun Han and
Sanjeev Kwatra and
Sarah A. Rous and
Sarik Ghazarian and
Sayan Ghosh and
Sean Casey and
Sebastian Bischoff and
Sebastian Gehrmann and
Sebastian Schuster and
Sepideh Sadeghi and
Shadi Hamdan and
Sharon Zhou and
Shashank Srivastava and
Sherry Shi and
Shikhar Singh and
Shima Asaadi and
Shixiang Shane Gu and
Shubh Pachchigar and
Shubham Toshniwal and
Shyam Upadhyay and
Shyamolima (Shammie) Debnath and
Siamak Shakeri and
Simon Thormeyer and
Simone Melzi and
Siva Reddy and
Sneha Priscilla Makini and
Soo{-}Hwan Lee and
Spencer Torene and
Sriharsha Hatwar and
Stanislas Dehaene and
Stefan Divic and
Stefano Ermon and
Stella Biderman and
Stephanie Lin and
Stephen Prasad and
Steven T. Piantadosi and
Stuart M. Shieber and
Summer Misherghi and
Svetlana Kiritchenko and
Swaroop Mishra and
Tal Linzen and
Tal Schuster and
Tao Li and
Tao Yu and
Tariq Ali and
Tatsu Hashimoto and
Te{-}Lin Wu and
Th{\'{e}}o Desbordes and
Theodore Rothschild and
Thomas Phan and
Tianle Wang and
Tiberius Nkinyili and
Timo Schick and
Timofei Kornev and
Titus Tunduny and
Tobias Gerstenberg and
Trenton Chang and
Trishala Neeraj and
Tushar Khot and
Tyler Shultz and
Uri Shaham and
Vedant Misra and
Vera Demberg and
Victoria Nyamai and
Vikas Raunak and
Vinay V. Ramasesh and
Vinay Uday Prabhu and
Vishakh Padmakumar and
Vivek Srikumar and
William Fedus and
William Saunders and
William Zhang and
Wout Vossen and
Xiang Ren and
Xiaoyu Tong and
Xinran Zhao and
Xinyi Wu and
Xudong Shen and
Yadollah Yaghoobzadeh and
Yair Lakretz and
Yangqiu Song and
Yasaman Bahri and
Yejin Choi and
Yichi Yang and
Yiding Hao and
Yifu Chen and
Yonatan Belinkov and
Yu Hou and
Yufang Hou and
Yuntao Bai and
Zachary Seid and
Zhuoye Zhao and
Zijian Wang and
Zijie J. Wang and
Zirui Wang and
Ziyi Wu},
title = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities
of language models},
journal = {CoRR},
volume = {abs/2206.04615},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.04615},
doi = {10.48550/ARXIV.2206.04615},
eprinttype = {arXiv},
eprint = {2206.04615},
timestamp = {Mon, 05 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-04615.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-07808,
author = {Jack FitzGerald and
Shankar Ananthakrishnan and
Konstantine Arkoudas and
Davide Bernardi and
Abhishek Bhagia and
Claudio Delli Bovi and
Jin Cao and
Rakesh Chada and
Amit Chauhan and
Luoxin Chen and
Anurag Dwarakanath and
Satyam Dwivedi and
Turan Gojayev and
Karthik Gopalakrishnan and
Thomas Gueudr{\'{e}} and
Dilek Hakkani{-}Tur and
Wael Hamza and
Jonathan J. H{\"{u}}ser and
Kevin Martin Jose and
Haidar Khan and
Beiye Liu and
Jianhua Lu and
Alessandro Manzotti and
Pradeep Natarajan and
Karolina Owczarzak and
Gokmen Oz and
Enrico Palumbo and
Charith Peris and
Chandana Satya Prakash and
Stephen Rawls and
Andy Rosenbaum and
Anjali Shenoy and
Saleh Soltan and
Mukund Harakere Sridhar and
Liz Tan and
Fabian Triefenbach and
Pan Wei and
Haiyang Yu and
Shuai Zheng and
G{\"{o}}khan T{\"{u}}r and
Prem Natarajan},
title = {Alexa Teacher Model: Pretraining and Distilling Multi-Billion-Parameter
Encoders for Natural Language Understanding Systems},
journal = {CoRR},
volume = {abs/2206.07808},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.07808},
doi = {10.48550/ARXIV.2206.07808},
eprinttype = {arXiv},
eprint = {2206.07808},
timestamp = {Tue, 06 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-07808.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-08269,
author = {Ingvar M. Ziemann and
Stephen Tu},
title = {Learning with little mixing},
journal = {CoRR},
volume = {abs/2206.08269},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.08269},
doi = {10.48550/ARXIV.2206.08269},
eprinttype = {arXiv},
eprint = {2206.08269},
timestamp = {Sun, 03 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-08269.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-15378,
author = {Julien P{\'{e}}rolat and
Bart De Vylder and
Daniel Hennes and
Eugene Tarassov and
Florian Strub and
Vincent de Boer and
Paul Muller and
Jerome T. Connor and
Neil Burch and
Thomas W. Anthony and
Stephen McAleer and
Romuald Elie and
Sarah H. Cen and
Zhe Wang and
Audrunas Gruslys and
Aleksandra Malysheva and
Mina Khan and
Sherjil Ozair and
Finbarr Timbers and
Toby Pohlen and
Tom Eccles and
Mark Rowland and
Marc Lanctot and
Jean{-}Baptiste Lespiau and
Bilal Piot and
Shayegan Omidshafiei and
Edward Lockhart and
Laurent Sifre and
Nathalie Beauguerlange and
R{\'{e}}mi Munos and
David Silver and
Satinder Singh and
Demis Hassabis and
Karl Tuyls},
title = {Mastering the Game of Stratego with Model-Free Multiagent Reinforcement
Learning},
journal = {CoRR},
volume = {abs/2206.15378},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.15378},
doi = {10.48550/ARXIV.2206.15378},
eprinttype = {arXiv},
eprint = {2206.15378},
timestamp = {Wed, 02 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-15378.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2207-06541,
author = {Stephen McAleer and
John B. Lanier and
Kevin A. Wang and
Pierre Baldi and
Roy Fox and
Tuomas Sandholm},
title = {Self-Play {PSRO:} Toward Optimal Populations in Two-Player Zero-Sum
Games},
journal = {CoRR},
volume = {abs/2207.06541},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2207.06541},
doi = {10.48550/ARXIV.2207.06541},
eprinttype = {arXiv},
eprint = {2207.06541},
timestamp = {Tue, 19 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2207-06541.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-01448,
author = {Saleh Soltan and
Shankar Ananthakrishnan and
Jack FitzGerald and
Rahul Gupta and
Wael Hamza and
Haidar Khan and
Charith Peris and
Stephen Rawls and
Andy Rosenbaum and
Anna Rumshisky and
Chandana Satya Prakash and
Mukund Sridhar and
Fabian Triefenbach and
Apurv Verma and
G{\"{o}}khan T{\"{u}}r and
Prem Natarajan},
title = {AlexaTM 20B: Few-Shot Learning Using a Large-Scale Multilingual Seq2Seq
Model},
journal = {CoRR},
volume = {abs/2208.01448},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2208.01448},
doi = {10.48550/ARXIV.2208.01448},
eprinttype = {arXiv},
eprint = {2208.01448},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2208-01448.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-07965,
author = {Uchenna Daniel Ani and
Jeremy D. McK. Watson and
Nilufer Tuptuk and
Steve Hailes and
Madeline Carr and
Carsten Maple},
title = {Improving the Cybersecurity of Critical National Infrastructure using
Modelling and Simulation},
journal = {CoRR},
volume = {abs/2208.07965},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2208.07965},
doi = {10.48550/ARXIV.2208.07965},
eprinttype = {arXiv},
eprint = {2208.07965},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2208-07965.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2209-10475,
author = {Wen Ting Maria Tu and
Stephen Makonin},
title = {Designing PIDs for Reproducible Science Using Time-Series Data},
journal = {CoRR},
volume = {abs/2209.10475},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2209.10475},
doi = {10.48550/ARXIV.2209.10475},
eprinttype = {arXiv},
eprint = {2209.10475},
timestamp = {Wed, 28 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2209-10475.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2209-10780,
author = {Xuesu Xiao and
Tingnan Zhang and
Krzysztof Choromanski and
Tsang{-}Wei Edward Lee and
Anthony G. Francis and
Jake Varley and
Stephen Tu and
Sumeet Singh and
Peng Xu and
Fei Xia and
Sven Mikael Persson and
Dmitry Kalashnikov and
Leila Takayama and
Roy Frostig and
Jie Tan and
Carolina Parada and
Vikas Sindhwani},
title = {Learning Model Predictive Controllers with Real-Time Attention for
Real-World Navigation},
journal = {CoRR},
volume = {abs/2209.10780},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2209.10780},
doi = {10.48550/ARXIV.2209.10780},
eprinttype = {arXiv},
eprint = {2209.10780},
timestamp = {Tue, 12 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2209-10780.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-00956,
author = {Chanikarn Nikunram and
Wasin Meesena and
Stephen John Turner and
Sucha Supittayapornpong},
title = {Minimizing Age of Processed Information in Wireless Networks},
journal = {CoRR},
volume = {abs/2210.00956},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.00956},
doi = {10.48550/ARXIV.2210.00956},
eprinttype = {arXiv},
eprint = {2210.00956},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-00956.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-02205,
author = {Luke Marris and
Marc Lanctot and
Ian Gemp and
Shayegan Omidshafiei and
Stephen McAleer and
Jerome T. Connor and
Karl Tuyls and
Thore Graepel},
title = {Game Theoretic Rating in N-player general-sum games with Equilibria},
journal = {CoRR},
volume = {abs/2210.02205},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.02205},
doi = {10.48550/ARXIV.2210.02205},
eprinttype = {arXiv},
eprint = {2210.02205},
timestamp = {Fri, 07 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-02205.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-02343,
author = {David Brandfonbrener and
Stephen Tu and
Avi Singh and
Stefan Welker and
Chad Boodoo and
Nikolai Matni and
Jake Varley},
title = {Visual Backtracking Teleoperation: {A} Data Collection Protocol for
Offline Image-Based Reinforcement Learning},
journal = {CoRR},
volume = {abs/2210.02343},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.02343},
doi = {10.48550/ARXIV.2210.02343},
eprinttype = {arXiv},
eprint = {2210.02343},
timestamp = {Fri, 07 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-02343.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-00186,
author = {Thomas T. C. K. Zhang and
Katie Kang and
Bruce D. Lee and
Claire J. Tomlin and
Sergey Levine and
Stephen Tu and
Nikolai Matni},
title = {Multi-Task Imitation Learning for Linear Dynamical Systems},
journal = {CoRR},
volume = {abs/2212.00186},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.00186},
doi = {10.48550/ARXIV.2212.00186},
eprinttype = {arXiv},
eprint = {2212.00186},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-00186.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-00613,
author = {Ziyan Wang and
Giljoo Nam and
Tuur Stuyck and
Stephen Lombardi and
Chen Cao and
Jason M. Saragih and
Michael Zollh{\"{o}}fer and
Jessica K. Hodgins and
Christoph Lassner},
title = {NeuWigs: {A} Neural Dynamic Model for Volumetric Hair Capture and
Animation},
journal = {CoRR},
volume = {abs/2212.00613},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.00613},
doi = {10.48550/ARXIV.2212.00613},
eprinttype = {arXiv},
eprint = {2212.00613},
timestamp = {Thu, 08 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-00613.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-13138,
author = {Karan Singhal and
Shekoofeh Azizi and
Tao Tu and
S. Sara Mahdavi and
Jason Wei and
Hyung Won Chung and
Nathan Scales and
Ajay Kumar Tanwani and
Heather Cole{-}Lewis and
Stephen Pfohl and
Perry Payne and
Martin Seneviratne and
Paul Gamble and
Chris Kelly and
Nathaneal Sch{\"{a}}rli and
Aakanksha Chowdhery and
Philip Andrew Mansfield and
Blaise Ag{\"{u}}era y Arcas and
Dale R. Webster and
Gregory S. Corrado and
Yossi Matias and
Katherine Chou and
Juraj Gottweis and
Nenad Tomasev and
Yun Liu and
Alvin Rajkomar and
Joelle K. Barral and
Christopher Semturs and
Alan Karthikesalingam and
Vivek Natarajan},
title = {Large Language Models Encode Clinical Knowledge},
journal = {CoRR},
volume = {abs/2212.13138},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.13138},
doi = {10.48550/ARXIV.2212.13138},
eprinttype = {arXiv},
eprint = {2212.13138},
timestamp = {Wed, 06 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-13138.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-13289,
author = {M. I. Sitnov and
G. K. Stephens and
V. G. Merkin and
C.{-}P. Wang and
D. Turner and
K. Genestreti and
M. Argall and
T. Y. Chen and
A. Y. Ukhorskiy and
S. Wing and
Y.{-}H. Liu},
title = {Artificial Intelligence to Enhance Mission Science Output for In-situ
Observations: Dealing with the Sparse Data Challenge},
journal = {CoRR},
volume = {abs/2212.13289},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.13289},
doi = {10.48550/ARXIV.2212.13289},
eprinttype = {arXiv},
eprint = {2212.13289},
timestamp = {Mon, 02 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-13289.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bib/DoranALBTUBM21,
author = {Stephen Doran and
Muhammad Arif and
Simon Lam and
Abdulahad Bayraktar and
Hasan Turkez and
Mathias Uhlen and
Jan Boren and
Adil Mardinoglu},
title = {Multi-omics approaches for revealing the complexity of cardiovascular
disease},
journal = {Briefings Bioinform.},
volume = {22},
number = {5},
year = {2021},
url = {https://doi.org/10.1093/bib/bbab061},
doi = {10.1093/BIB/BBAB061},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bib/DoranALBTUBM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bib/LamDYATNBUM21,
author = {Simon Lam and
Stephen Doran and
Hatice Hilal Yuksel and
Ozlem Altay and
Hasan Turkez and
Jens Nielsen and
Jan Boren and
Mathias Uhlen and
Adil Mardinoglu},
title = {Addressing the heterogeneity in liver diseases using biological networks},
journal = {Briefings Bioinform.},
volume = {22},
number = {2},
pages = {1751--1766},
year = {2021},
url = {https://doi.org/10.1093/bib/bbaa002},
doi = {10.1093/BIB/BBAA002},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bib/LamDYATNBUM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/YangGLBMWWJO21,
author = {Jeremy J. Yang and
Dhouha Grissa and
Christophe G. Lambert and
Cristian Bologa and
Stephen L. Mathias and
Anna Waller and
David J. Wild and
Lars Juhl Jensen and
Tudor I. Oprea},
title = {{TIGA:} target illumination {GWAS} analytics},
journal = {Bioinform.},
volume = {37},
number = {21},
pages = {3865--3873},
year = {2021},
url = {https://doi.org/10.1093/bioinformatics/btab427},
doi = {10.1093/BIOINFORMATICS/BTAB427},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/YangGLBMWWJO21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cce/GangadharanSTFC21,
author = {Nishanthi Gangadharan and
David Sewell and
Richard Turner and
Ray Field and
Matthew Cheeks and
Stephen G. Oliver and
Nigel K. H. Slater and
Duygu Dikicioglu},
title = {Data intelligence for process performance prediction in biologics
manufacturing},
journal = {Comput. Chem. Eng.},
volume = {146},
pages = {107226},
year = {2021},
url = {https://doi.org/10.1016/j.compchemeng.2021.107226},
doi = {10.1016/J.COMPCHEMENG.2021.107226},
timestamp = {Tue, 02 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cce/GangadharanSTFC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ci/YousefiSASCT21,
author = {Leila Yousefi and
Stephen Swift and
Mahir Arzoky and
Lucia Saachi and
Luca Chiovato and
Allan Tucker},
title = {Opening the black box: Personalizing type 2 diabetes patients based
on their latent phenotype and temporal associated complication rules},
journal = {Comput. Intell.},
volume = {37},
number = {4},
pages = {1460--1498},
year = {2021},
url = {https://doi.org/10.1111/coin.12313},
doi = {10.1111/COIN.12313},
timestamp = {Tue, 12 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ci/YousefiSASCT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/FarnellRGZPHHMC21,
author = {Damian J. J. Farnell and
Stephen Richmond and
Jennifer Galloway and
Alexei I. Zhurov and
Pertti Pirttiniemi and
Tuomo H. Heikkinen and
Virpi Harila and
Harold S. Matthews and
Peter Claes},
title = {An exploration of adolescent facial shape changes with age via multilevel
partial least squares regression},
journal = {Comput. Methods Programs Biomed.},
volume = {200},
pages = {105935},
year = {2021},
url = {https://doi.org/10.1016/j.cmpb.2021.105935},
doi = {10.1016/J.CMPB.2021.105935},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmpb/FarnellRGZPHHMC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/concurrency/MullerFABJRTR21,
author = {Juliane M{\"{u}}ller and
Boris Faybishenko and
Deborah A. Agarwal and
Stephen Bailey and
Chongya Jiang and
Youngryel Ryu and
Craig Tull and
Lavanya Ramakrishnan},
title = {Assessing data change in scientific datasets},
journal = {Concurr. Comput. Pract. Exp.},
volume = {33},
number = {16},
year = {2021},
url = {https://doi.org/10.1002/cpe.6245},
doi = {10.1002/CPE.6245},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/concurrency/MullerFABJRTR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/AtwoliBBBGHHLMN21,
author = {Lukoye Atwoli and
Abdullah H. Baqui and
Thomas Benfield and
Raffaella Bosurgi and
Fiona Godlee and
Stephen Hancocks and
Richard Horton and
Laurie Laybourn{-}Langton and
Carlos Augusto Monteiro and
Ian Norman and
Kirsten Patrick and
Nigel Praities and
Marcel G. M. Olde Rikkert and
Eric J. Rubin and
Peush Sahni and
Richard Smith and
Nick Talley and
Sue Turale and
Dami{\'{a}}n V{\'{a}}zquez},
title = {Call for emergency action to limit global temperature increases, restore
biodiversity, and protect health},
journal = {J. Am. Medical Informatics Assoc.},
volume = {28},
number = {10},
pages = {2069--2071},
year = {2021},
url = {https://doi.org/10.1093/jamia/ocab178},
doi = {10.1093/JAMIA/OCAB178},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/AtwoliBBBGHHLMN21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jimaging/EtxegaraiTTVKH21,
author = {Maddi Etxegarai and
Erika Tudisco and
Alessandro Tengattini and
Gioacchino Viggiani and
Nikolay Kardjilov and
Stephen A. Hall},
title = {Characterisation of Single-Phase Fluid-Flow Heterogeneity Due to Localised
Deformation in a Porous Rock Using Rapid Neutron Tomography},
journal = {J. Imaging},
volume = {7},
number = {12},
pages = {275},
year = {2021},
url = {https://doi.org/10.3390/jimaging7120275},
doi = {10.3390/JIMAGING7120275},
timestamp = {Sat, 08 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jimaging/EtxegaraiTTVKH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmlr/TuckBB21,
author = {Jonathan Tuck and
Shane T. Barratt and
Stephen P. Boyd},
title = {A Distributed Method for Fitting Laplacian Regularized Stratified
Models},
journal = {J. Mach. Learn. Res.},
volume = {22},
pages = {60:1--60:37},
year = {2021},
url = {https://jmlr.org/papers/v22/19-345.html},
timestamp = {Wed, 11 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmlr/TuckBB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/CarbonDGUHMBCDH21,
author = {Seth Carbon and
Eric Douglass and
Benjamin M. Good and
Deepak R. Unni and
Nomi L. Harris and
Christopher J. Mungall and
Siddartha Basu and
Rex L. Chisholm and
Robert J. Dodson and
Eric Hartline and
Petra Fey and
Paul D. Thomas and
Laurent{-}Philippe Albou and
Dustin Ebert and
Michael J. Kesling and
Huaiyu Mi and
Anushya Muruganujan and
Xiaosong Huang and
Tremayne Mushayahama and
Sandra A. LaBonte and
Deborah A. Siegele and
Giulia Antonazzo and
Helen Attrill and
Nick H. Brown and
Phani V. Garapati and
Steven J. Marygold and
Vitor Trovisco and
Gilberto dos Santos and
Kathleen Falls and
Christopher J. Tabone and
Pinglei Zhou and
Joshua L. Goodman and
Victor B. Strelets and
Jim Thurmond and
Penelope Garmiri and
Rizwan Ishtiaq and
Milagros Rodr{\'{\i}}guez{-}L{\'{o}}pez and
Marcio Luis Acencio and
Martin Kuiper and
Astrid L{\ae}greid and
Colin Logie and
Ruth C. Lovering and
Barbara Kramarz and
Shirin C. C. Saverimuttu and
Sandra M. Pinheiro and
Heather Gunn and
Renzhi Su and
Katherine E. Thurlow and
Marcus C. Chibucos and
Michelle G. Giglio and
Suvarna Nadendla and
James B. Munro and
Rebecca C. Jackson and
Margaret J. Duesbury and
Noemi del{-}Toro and
Birgit H. M. Meldal and
Kalpana Paneerselvam and
Livia Perfetto and
Pablo Porras and
Sandra E. Orchard and
Anjali Shrivastava and
Hsin{-}Yu Chang and
Robert D. Finn and
Alex L. Mitchell and
Neil D. Rawlings and
Lorna J. Richardson and
Amaia Sangrador{-}Vegas and
Judith A. Blake and
Karen R. Christie and
Mary E. Dolan and
Harold J. Drabkin and
David P. Hill and
Li Ni and
Dmitry M. Sitnikov and
Midori A. Harris and
Stephen G. Oliver and
Kim Rutherford and
Valerie Wood and
Jaqueline Hayles and
J{\"{u}}rg B{\"{a}}hler and
Elizabeth R. Bolton and
Jeffrey DePons and
Melinda R. Dwinell and
G. Thomas Hayman and
Mary L. Kaldunski and
Anne E. Kwitek and
Stanley J. F. Laulederkind and
Cody Plasterer and
Marek Tutaj and
Mahima Vedi and
Shur{-}Jen Wang and
Peter D'Eustachio and
Lisa Matthews and
James P. Balhoff and
Suzi A. Aleksander and
Michael J. Alexander and
J. Michael Cherry and
Stacia R. Engel and
Felix Gondwe and
Kalpana Karra and
Stuart R. Miyasato and
Robert S. Nash and
Matt Simison and
Marek S. Skrzypek and
Shuai Weng and
Edith D. Wong and
Marc Feuermann and
Pascale Gaudet and
Anne Morgat and
Erica Bakker and
Tanya Z. Berardini and
Leonore Reiser and
Shabari Subramaniam and
Eva Huala and
Cecilia N. Arighi and
Andrea H. Auchincloss and
Kristian B. Axelsen and
Ghislaine Argoud{-}Puy and
Alex Bateman and
Marie{-}Claude Blatter and
Emmanuel Boutet and
Emily Bowler and
Lionel Breuza and
Alan J. Bridge and
Ramona Britto and
Hema Bye{-}A{-}Jee and
Cristina Casals{-}Casas and
Elisabeth Coudert and
Paul Denny and
Anne Estreicher and
Maria Livia Famiglietti and
George E. Georghiou and
Arnaud Gos and
Nadine Gruaz{-}Gumowski and
Emma Hatton{-}Ellis and
Chantal Hulo and
Alexandr Ignatchenko and
Florence Jungo and
Kati Laiho and
Philippe Le Mercier and
Damien Lieberherr and
Antonia Lock and
Yvonne Lussi and
Alistair MacDougall and
Michele Magrane and
Maria Jesus Martin and
Patrick Masson and
Darren A. Natale and
Nevila Hyka{-}Nouspikel and
Ivo Pedruzzi and
Lucille Pourcel and
Sylvain Poux and
Sangya Pundir and
Catherine Rivoire and
Elena Speretta and
Shyamala Sundaram and
Nidhi Tyagi and
Kate Warner and
Rossana Zaru and
Cathy H. Wu and
Alexander D. Diehl and
Juancarlos Chan and
Christian A. Grove and
Raymond Y. N. Lee and
Hans{-}Michael M{\"{u}}ller and
Daniela Raciti and
Kimberly Van Auken and
Paul W. Sternberg and
Matthew Berriman and
Michael Paulini and
Kevin L. Howe and
Sibyl Gao and
Adam Wright and
Lincoln Stein and
Douglas G. Howe and
Sabrina Toro and
Monte Westerfield and
Pankaj Jaiswal and
Laurel Cooper and
Justin Elser},
title = {The Gene Ontology resource: enriching a GOld mine},
journal = {Nucleic Acids Res.},
volume = {49},
number = {Database-Issue},
pages = {D325--D334},
year = {2021},
url = {https://doi.org/10.1093/nar/gkaa1113},
doi = {10.1093/NAR/GKAA1113},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/CarbonDGUHMBCDH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/HoweAAAAAAABBBB21,
author = {Kevin L. Howe and
Premanand Achuthan and
James E. Allen and
Jamie Allen and
Jorge {\'{A}}lvarez{-}Jarreta and
M. Ridwan Amode and
Irina M. Armean and
Andrey G. Azov and
Ruth Bennett and
Jyothish Bhai and
Konstantinos Billis and
Sanjay Boddu and
Mehrnaz Charkhchi and
Carla A. Cummins and
Luca Da Rin Fioretto and
Claire Davidson and
Kamalkumar Jayantilal Dodiya and
Bilal El Houdaigui and
Reham Fatima and
Astrid Gall and
Carlos Garc{\'{\i}}a{-}Gir{\'{o}}n and
Tiago Grego and
Cristina Guijarro{-}Clarke and
Leanne Haggerty and
Anmol Hemrom and
Thibaut Hourlier and
Osagie G. Izuogu and
Thomas Juettemann and
Vinay Kaikala and
Mike P. Kay and
Ilias Lavidas and
Tuan Le and
Diana Lemos and
Jose Gonzalez Martinez and
Jos{\'{e}} Carlos Marug{\'{a}}n and
Thomas Maurel and
Aoife C. McMahon and
Shamika Mohanan and
Benjamin Moore and
Matthieu Muffato and
Denye N. Oheh and
Dimitrios Paraschas and
Anne Parker and
Andrew Parton and
Irina Prosovetskaia and
Manoj Pandian Sakthivel and
Ahamed Imran Abdul Salam and
Bianca M. Schmitt and
Helen Schuilenburg and
Dan Sheppard and
Emily Steed and
Michal Szpak and
Marek Szuba and
Kieron R. Taylor and
Anja Thormann and
Glen Threadgold and
Brandon Walts and
Andrea Winterbottom and
Marc Chakiachvili and
Ameya Chaubal and
Nishadi De Silva and
Bethany Flint and
Adam Frankish and
Sarah E. Hunt and
Garth IIsley and
Nick Langridge and
Jane E. Loveland and
Fergal J. Martin and
Jonathan M. Mudge and
Joannella Morales and
Emily Perry and
Magali Ruffier and
John G. Tate and
David Thybert and
Stephen J. Trevanion and
Fiona Cunningham and
Andrew D. Yates and
Daniel R. Zerbino and
Paul Flicek},
title = {Ensembl 2021},
journal = {Nucleic Acids Res.},
volume = {49},
number = {Database-Issue},
pages = {D884--D891},
year = {2021},
url = {https://doi.org/10.1093/nar/gkaa942},
doi = {10.1093/NAR/GKAA942},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/HoweAAAAAAABBBB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/SheilsMKSNBJVKS21,
author = {Timothy Sheils and
Stephen L. Mathias and
Keith J. Kelleher and
Vishal B. Siramshetty and
Dac{-}Trung Nguyen and
Cristian Bologa and
Lars Juhl Jensen and
Dusica Vidovic and
Amar Koleti and
Stephan C. Sch{\"{u}}rer and
Anna Waller and
Jeremy J. Yang and
Jayme Holmes and
Giovanni Bocci and
Noel Southall and
Poorva Dharkar and
Ewy A. Math{\'{e}} and
Anton Simeonov and
Tudor I. Oprea},
title = {{TCRD} and Pharos 2021: mining the human proteome for disease biology},
journal = {Nucleic Acids Res.},
volume = {49},
number = {Database-Issue},
pages = {D1334--D1346},
year = {2021},
url = {https://doi.org/10.1093/nar/gkaa993},
doi = {10.1093/NAR/GKAA993},
timestamp = {Tue, 08 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/SheilsMKSNBJVKS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HuiMZAABBBBBBBB21,
author = {Steve C. N. Hui and
Mark Mikkelsen and
Helge J. Z{\"{o}}llner and
Vishwadeep Ahluwalia and
Sarael Alcauter and
Laima Baltusis and
Deborah A. Barany and
Laura R. Barlow and
Robert Becker and
Jeffrey I. Berman and
Adam Berrington and
Pallab K. Bhattacharyya and
Jakob Udby Blicher and
Wolfgang Bogner and
Mark S. Brown and
Vince D. Calhoun and
Ryan Castillo and
Kim M. Cecil and
Richard A. E. Edden and
Yeo Bi Choi and
Winnie C. W. Chu and
William T. Clarke and
Alexander R. Craven and
Koen Cuypers and
Michael Dacko and
Camilo de la Fuente{-}Sandoval and
Patricia Desmond and
Aleksandra Domagalik and
Julien Dumont and
Niall W. Duncan and
Ulrike Dydak and
Katherine Dyke and
David A. Edmondson and
Gabriele Ende and
Lars Ersland and
C. John Evans and
Alan S. R. Fermin and
Antonio Ferretti and
Ariane Fillmer and
Tao Gong and
Ian Greenhouse and
James T. Grist and
Meng Gu and
Ashley D. Harris and
Katarzyna Hat and
Stefanie Heba and
Eva Heckova and
John P. Hegarty and
Kirstin{-}Friederike Heise and
Shiori Honda and
Aaron Jacobson and
Jacobus F. A. Jansen and
Christopher W. Jenkins and
Stephen J. Johnston and
Christoph Juchem and
Alayar Kangarlu and
Adam B. Kerr and
Karl Landheer and
Thomas Lange and
Phil Lee and
Swati Rane Levendovszky and
Catherine Limperopoulos and
Feng Liu and
William Lloyd and
David J. Lythgoe and
Maro G. Machizawa and
Erin L. MacMillan and
Richard J. Maddock and
Andrei V. Manzhurtsev and
Mar{\'{\i}}a L. Martinez{-}Gudino and
Jack J. Miller and
Heline Mirzakhanian and
Marta Moreno{-}Ortega and
Paul G. Mullins and
Shinichiro Nakajima and
Jamie Near and
Ralph Noeske and
Wibeke Nordh{\o}y and
Georg Oeltzschner and
Raul Osorio{-}Duran and
Mar{\'{\i}}a Concepci{\'{o}}n Garc{\'{\i}}a Otaduy and
Erick H. Pasaye and
Ronald Peeters and
Scott J. Peltier and
Ulrich Pilatus and
Nenad Polomac and
Eric C. Porges and
Subechhya Pradhan and
James Joseph Prisciandaro and
Nicolaas A. Puts and
Caroline D. Rae and
Francisco Reyes{-}Madrigal and
Timothy P. L. Roberts and
Caroline E. Robertson and
Jens T. Rosenberg and
Diana{-}Georgiana Rotaru and
Ruth L. O'Gorman Tuura and
Muhammad G. Saleh and
Kristian Sandberg and
Ryan Sangill and
Keith Schembri and
Anouk Schrantee and
Natalia A. Semenova and
Debra Singel and
Rouslan Sitnikov and
Jolinda Smith and
Yulu Song and
Craig E. L. Stark and
Diederick Stoffers and
Stephan P. Swinnen and
Rongwen Tain and
Costin Tanase and
Sofie Tapper and
Martin Tegenthoff and
Thomas Thiel and
Marc Thioux and
Peter Truong and
Pim van Dijk and
Nolan Vella and
Rishma Vidyasagar and
Andrej Vovk and
Guangbin Wang and
Lars T. Westlye and
Timothy K. Wilbur and
William R. Willoughby and
Martin Wilson and
Hans{-}J{\"{o}}rg Wittsack and
Adam J. Woods and
Yen{-}Chien Wu and
Junqian Xu and
Maria Yanez Lopez and
David Ka Wai Yeung and
Qun Zhao and
Xiaopeng Zhou and
Gasper Zupan},
title = {Frequency drift in {MR} spectroscopy at 3T},
journal = {NeuroImage},
volume = {241},
pages = {118430},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2021.118430},
doi = {10.1016/J.NEUROIMAGE.2021.118430},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/HuiMZAABBBBBBBB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/FehrKOGSGSBMMHK21,
author = {Jana Fehr and
Stefan Konigorski and
Stephen Olivier and
Resign Gunda and
Ashmika Surujdeen and
Dickman Gareta and
Theresa Smit and
Kathy Baisley and
Sashen Moodley and
Yumna Moosa and
Willem Hanekom and
Olivier Koole and
Thumbi Ndung'u and
Deenan Pillay and
Alison D. Grant and
Mark J. Siedner and
Christoph Lippert and
Emily B. Wong and
Anand Ramnanan and
Anele Mkhwanazi and
Antony Rapulana and
Anupa Singh and
Ashentha Govender and
Ayanda Zungu and
Boitsholo Mfolo and
Bongani Magwaza and
Bongumenzi Ndlovu and
Clive Mavimbela and
Costa Criticos and
Day Munatsi and
Dilip Kalyan and
Doctar Mlambo and
Fezeka Mfeka and
Freddy Mabetlela and
Gregory Ording{-}Jespersen and
Hannah Keal and
Hlengiwe Dlamini and
Hlengiwe Khathi and
Hlobisile Chonco and
Hlobisile Gumede and
Hlolisile Khumalo and
Hloniphile Ngubane and
Hollis Shen and
Hosea Kambonde and
Innocentia Mpofana and
Jabu Kwinda and
Jaco Dreyer and
Jade Cousins and
Jaikrishna Kalideen and
Janet Seeley and
Kandaseelan Chetty and
Kayleen Brien and
Kennedy Nyamande and
Kgaugelo Moropane and
Khabonina Malomane and
Khadija Khan and
Khanyisani Buthelezi and
Kimeshree Perumal and
Kobus Herbst and
Lindani Mthembu and
Logan Pillay and
Mandisi Dlamini and
Mandlakayise Zikhali and
Mbali Mbuyisa and
Mbuti Mofokeng and
Melusi Sibiya and
Mlungisi Dube and
Mosa Suleman and
Mpumelelo Steto and
Mzamo Buthelezi and
Nagavelli Padayachi and
Nceba Gqaleni and
Ngcebo Mhlongo and
Nokukhanya Ntshakala and
Nomathamsanqa Majozi and
Nombuyiselo Zondi and
Nomfundo Luthuli and
Nomfundo Ngema and
Nompilo Buthelezi and
Nonceba Mfeka and
Nondumiso Khuluse and
Nondumiso Mabaso and
Nondumiso Zitha and
Nonhlanhla Mfekayi and
Nonhlanhla Mzimela and
Nozipho Mbonambi and
Ntombiyenhlanhla Mkhwanazi and
Ntombiyenkosi Ntombela and
Pamela Ramkalawon and
Pfarelo Tshivase and
Phakamani Mkhwanazi and
Philippa Mathews and
Phumelele Mthethwa and
Phumla Ngcobo and
Ramesh Jackpersad and
Raynold Zondo and
Rochelle Singh and
Rose Myeni and
Sanah Bucibo and
Sandile Mthembu and
Sashin Harilall and
Senamile Makhari and
Seneme Mchunu and
Senzeni Mkhwanazi and
Sibahle Gumbi and
Siboniso Nene and
Sibusiso Mhlongo and
Sibusiso Mkhwanazi and
Sibusiso Nsibande and
Simphiwe Ntshangase and
Siphephelo Dlamini and
Sithembile Ngcobo and
Siyabonga Nsibande and
Siyabonga Nxumalo and
Sizwe Ndlela and
Skhumbuzo Mthombeni and
Smangaliso Zulu and
Sphiwe Clement Mthembu and
Sphiwe Ntuli and
Talente Ntimbane and
Thabile Zondi and
Thandeka Khoza and
Thengokwakhe Nkosi and
Thokozani Bhengu and
Thokozani Simelane and
Tshwaraganang Modise and
Tumi Madolo and
Velile Vellem and
Welcome Petros Mthembu and
Xolani Mkhize and
Zamashandu Mbatha and
Zinhle Buthelezi and
Zinhle Mthembu and
Zizile Sikhosana},
title = {Computer-aided interpretation of chest radiography reveals the spectrum
of tuberculosis in rural South Africa},
journal = {npj Digit. Medicine},
volume = {4},
year = {2021},
url = {https://doi.org/10.1038/s41746-021-00471-y},
doi = {10.1038/S41746-021-00471-Y},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/FehrKOGSGSBMMHK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/FehrKOGSGSBMMHK21a,
author = {Jana Fehr and
Stefan Konigorski and
Stephen Olivier and
Resign Gunda and
Ashmika Surujdeen and
Dickman Gareta and
Theresa Smit and
Kathy Baisley and
Sashen Moodley and
Yumna Moosa and
Willem Hanekom and
Olivier Koole and
Thumbi Ndung'u and
Deenan Pillay and
Alison D. Grant and
Mark J. Siedner and
Christoph Lippert and
Emily B. Wong and
Anand Ramnanan and
Anele Mkhwanazi and
Antony Rapulana and
Anupa Singh and
Ashentha Govender and
Ayanda Zungu and
Boitsholo Mfolo and
Bongani Magwaza and
Bongumenzi Ndlovu and
Clive Mavimbela and
Costa Criticos and
Day Munatsi and
Dilip Kalyan and
Doctar Mlambo and
Fezeka Mfeka and
Freddy Mabetlela and
Gregory Ording{-}Jespersen and
Hannah Keal and
Hlengiwe Dlamini and
Hlengiwe Khathi and
Hlobisile Chonco and
Hlobisile Gumede and
Hlolisile Khumalo and
Hloniphile Ngubane and
Hollis Shen and
Hosea Kambonde and
Innocentia Mpofana and
Jabu Kwinda and
Jaco Dreyer and
Jade Cousins and
Jaikrishna Kalideen and
Janet Seeley and
Kandaseelan Chetty and
Kayleen Brien and
Kennedy Nyamande and
Kgaugelo Moropane and
Khabonina Malomane and
Khadija Khan and
Khanyisani Buthelezi and
Kimeshree Perumal and
Kobus Herbst and
Lindani Mthembu and
Logan Pillay and
Mandisi Dlamini and
Mandlakayise Zikhali and
Mbali Mbuyisa and
Mbuti Mofokeng and
Melusi Sibiya and
Mlungisi Dube and
Mosa Suleman and
Mpumelelo Steto and
Mzamo Buthelezi and
Nagavelli Padayachi and
Nceba Gqaleni and
Ngcebo Mhlongo and
Nokukhanya Ntshakala and
Nomathamsanqa Majozi and
Nombuyiselo Zondi and
Nomfundo Luthuli and
Nomfundo Ngema and
Nompilo Buthelezi and
Nonceba Mfeka and
Nondumiso Khuluse and
Nondumiso Mabaso and
Nondumiso Zitha and
Nonhlanhla Mfekayi and
Nonhlanhla Mzimela and
Nozipho Mbonambi and
Ntombiyenhlanhla Mkhwanazi and
Ntombiyenkosi Ntombela and
Pamela Ramkalawon and
Pfarelo Tshivase and
Phakamani Mkhwanazi and
Philippa Mathews and
Phumelele Mthethwa and
Phumla Ngcobo and
Ramesh Jackpersad and
Raynold Zondo and
Rochelle Singh and
Rose Myeni and
Sanah Bucibo and
Sandile Mthembu and
Sashin Harilall and
Senamile Makhari and
Seneme Mchunu and
Senzeni Mkhwanazi and
Sibahle Gumbi and
Siboniso Nene and
Sibusiso Mhlongo and
Sibusiso Mkhwanazi and
Sibusiso Nsibande and
Simphiwe Ntshangase and
Siphephelo Dlamini and
Sithembile Ngcobo and
Siyabonga Nsibande and
Siyabonga Nxumalo and
Sizwe Ndlela and
Skhumbuzo Mthombeni and
Smangaliso Zulu and
Sphiwe Clement Mthembu and
Sphiwe Ntuli and
Talente Ntimbane and
Thabile Zondi and
Thandeka Khoza and
Thengokwakhe Nkosi and
Thokozani Bhengu and
Thokozani Simelane and
Tshwaraganang Modise and
Tumi Madolo and
Velile Vellem and
Welcome Petros Mthembu and
Xolani Mkhize and
Zamashandu Mbatha and
Zinhle Buthelezi and
Zinhle Mthembu and
Zizile Sikhosana},
title = {Publisher Correction: Computer-aided interpretation of chest radiography
reveals the spectrum of tuberculosis in rural South Africa},
journal = {npj Digit. Medicine},
volume = {4},
year = {2021},
url = {https://doi.org/10.1038/s41746-021-00485-6},
doi = {10.1038/S41746-021-00485-6},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/FehrKOGSGSBMMHK21a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/TunaTDRZM21,
author = {Suha Tuna and
Beh{\c{c}}et Ugur T{\"{o}}reyin and
Metin Demiralp and
Jinchang Ren and
Huimin Zhao and
Stephen Marshall},
title = {Iterative Enhanced Multivariance Products Representation for Effective
Compression of Hyperspectral Images},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {59},
number = {11},
pages = {9569--9584},
year = {2021},
url = {https://doi.org/10.1109/TGRS.2020.3031016},
doi = {10.1109/TGRS.2020.3031016},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/TunaTDRZM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkde/LiCLCG21,
author = {Dongsheng Li and
Chao Chen and
Tun Lu and
Stephen M. Chu and
Ning Gu},
title = {Mixture Matrix Approximation for Collaborative Filtering},
journal = {{IEEE} Trans. Knowl. Data Eng.},
volume = {33},
number = {6},
pages = {2640--2653},
year = {2021},
url = {https://doi.org/10.1109/TKDE.2019.2955100},
doi = {10.1109/TKDE.2019.2955100},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tkde/LiCLCG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/adhs/RobeyLTM21,
author = {Alexander Robey and
Lars Lindemann and
Stephen Tu and
Nikolai Matni},
editor = {Rapha{\"{e}}l M. Jungers and
Necmiye Ozay and
Alessandro Abate},
title = {Learning Robust Hybrid Control Barrier Functions for Uncertain Systems},
booktitle = {7th {IFAC} Conference on Analysis and Design of Hybrid Systems, {ADHS}
2021, Brussels, Belgium, July 7-9, 2021},
series = {IFAC-PapersOnLine},
volume = {54},
number = {5},
pages = {1--6},
publisher = {Elsevier},
year = {2021},
url = {https://doi.org/10.1016/j.ifacol.2021.08.465},
doi = {10.1016/J.IFACOL.2021.08.465},
timestamp = {Tue, 14 Sep 2021 14:28:35 +0200},
biburl = {https://dblp.org/rec/conf/adhs/RobeyLTM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aime/GhoshalGST21,
author = {Bhargab Ghoshal and
Biraja Ghoshal and
Stephen Swift and
Allan Tucker},
editor = {Allan Tucker and
Pedro Henriques Abreu and
Jaime S. Cardoso and
Pedro Pereira Rodrigues and
David Ria{\~{n}}o},
title = {Uncertainty Estimation in SARS-CoV-2 B-Cell Epitope Prediction for
Vaccine Development},
booktitle = {Artificial Intelligence in Medicine - 19th International Conference
on Artificial Intelligence in Medicine, {AIME} 2021, Virtual Event,
June 15-18, 2021, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12721},
pages = {361--366},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-77211-6\_41},
doi = {10.1007/978-3-030-77211-6\_41},
timestamp = {Thu, 10 Jun 2021 07:59:32 +0200},
biburl = {https://dblp.org/rec/conf/aime/GhoshalGST21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aime/GhoshalST21,
author = {Biraja Ghoshal and
Stephen Swift and
Allan Tucker},
editor = {Allan Tucker and
Pedro Henriques Abreu and
Jaime S. Cardoso and
Pedro Pereira Rodrigues and
David Ria{\~{n}}o},
title = {Bayesian Deep Active Learning for Medical Image Analysis},
booktitle = {Artificial Intelligence in Medicine - 19th International Conference
on Artificial Intelligence in Medicine, {AIME} 2021, Virtual Event,
June 15-18, 2021, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12721},
pages = {36--42},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-77211-6\_4},
doi = {10.1007/978-3-030-77211-6\_4},
timestamp = {Wed, 09 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aime/GhoshalST21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/OSullivanWWTMAC21,
author = {Dympna O'Sullivan and
William Van Woensel and
Szymon Wilk and
Samson W. Tu and
Wojtek Michalowski and
Samina Abidi and
Marc Carrier and
Ruth Edry and
Irit Hochberg and
Stephen P. Kingwell and
Alexandra Kogan and
Martin Michalowski and
Hugh O'Sullivan and
Mor Peleg},
title = {Towards a framework for comparing functionalities of multimorbidity
clinical decision support: {A} literature-based feature set and benchmark
cases},
booktitle = {{AMIA} 2021, American Medical Informatics Association Annual Symposium,
San Diego, CA, USA, October 30, 2021 - November 3, 2021},
publisher = {{AMIA}},
year = {2021},
url = {https://knowledge.amia.org/74229-amia-1.4622266/t003-1.4626466/t003-1.4626467/3576930-1.4626582/3572901-1.4626579},
timestamp = {Wed, 17 Apr 2024 11:46:53 +0200},
biburl = {https://dblp.org/rec/conf/amia/OSullivanWWTMAC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asscc/MehtaTTTGG21,
author = {Nandish Mehta and
Stephen G. Tell and
Walker J. Turner and
Lamar Tatro and
Giant Goh and
C. Thomas Gray},
title = {A 77 MHz Relaxation Oscillator in 5nm FinFET with 3ns {TIE} over 10K
cycles and {\(\pm\)}0.3{\%} Thermal Stability using Frequency-Error
Feedback Loop},
booktitle = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2021, Busan,
Korea, Republic of, November 7-10, 2021},
pages = {1--3},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/A-SSCC53895.2021.9634712},
doi = {10.1109/A-SSCC53895.2021.9634712},
timestamp = {Tue, 21 Dec 2021 17:54:16 +0100},
biburl = {https://dblp.org/rec/conf/asscc/MehtaTTTGG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/BoffiTS21,
author = {Nicholas M. Boffi and
Stephen Tu and
Jean{-}Jacques E. Slotine},
title = {Nonparametric Adaptive Control and Prediction: Theory and Randomized
Algorithms},
booktitle = {2021 60th {IEEE} Conference on Decision and Control (CDC), Austin,
TX, USA, December 14-17, 2021},
pages = {2935--2942},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/CDC45484.2021.9682907},
doi = {10.1109/CDC45484.2021.9682907},
timestamp = {Tue, 17 May 2022 15:53:17 +0200},
biburl = {https://dblp.org/rec/conf/cdc/BoffiTS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csci/AllisonTK21,
author = {Mark Allison and
Stephen W. Turner and
Molly Kwasny},
title = {Assessing Cognitive Load for Junior Software Engineers: {A} Mixed-Method
Study},
booktitle = {International Conference on Computational Science and Computational
Intelligence, {CSCI} 2021, Las Vegas, NV, USA, December 15-17, 2021},
pages = {883--888},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/CSCI54926.2021.00206},
doi = {10.1109/CSCI54926.2021.00206},
timestamp = {Sat, 27 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/csci/AllisonTK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/MaiDKTBGCBSK21,
author = {Dawei Mai and
Yann Donnelly and
Michael Peter Kennedy and
Stefano Tulisi and
James Breslin and
Patrick Griffin and
Michael Connor and
Stephen Brookes and
Brian Shelly and
Michael Keaveney},
title = {Experimental Verification of Wandering Spur Suppression Technique
in a 4.9 GHz Fractional-N Frequency Synthesizer},
booktitle = {47th {ESSCIRC} 2021 - European Solid State Circuits Conference, {ESSCIR}
2021, Grenoble, France, September 13-22, 2021},
pages = {439--442},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ESSCIRC53450.2021.9567841},
doi = {10.1109/ESSCIRC53450.2021.9567841},
timestamp = {Thu, 28 Oct 2021 16:11:37 +0200},
biburl = {https://dblp.org/rec/conf/esscirc/MaiDKTBGCBSK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/TurnerMU21,
author = {Adam Brian Turner and
Stephen McCombie and
Allon J. Uhlmann},
title = {Follow the money: Revealing risky nodes in a Ransomware-Bitcoin network},
booktitle = {54th Hawaii International Conference on System Sciences, {HICSS} 2021,
Kauai, Hawaii, USA, January 5, 2021},
pages = {1--13},
publisher = {ScholarSpace},
year = {2021},
url = {https://hdl.handle.net/10125/70801},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hicss/TurnerMU21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ArslanDVARLALTA21,
author = {Ali Nadir Arslan and
Katarzyna Dabrowska{-}Zielinska and
Vesselin Vassilev and
Jos{\'{e}} Manuel {\'{A}}lvarez{-}Mart{\'{\i}}nez and
Kameliya Radeva and
Stanislaw Lewinski and
Iida Autio and
Hannakaisa Lindqvist and
Maria Tenkanen and
Tuula Aalto and
Markus T{\"{o}}rm{\"{a}} and
Lachezar Filchev and
Michal Krupinski and
Stephen Barry and
Tarja Tuomainen and
Premysl Stych and
Abad Chabbi},
title = {Developing Support for Monitoring and Reporting of {GHG} Emissions
and Removals from Land Use, Land Change and Forestry},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2021, Brussels, Belgium, July 11-16, 2021},
pages = {6536--6539},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IGARSS47720.2021.9553360},
doi = {10.1109/IGARSS47720.2021.9553360},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/ArslanDVARLALTA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/AhmadiCST21,
author = {Amir Ali Ahmadi and
Abraar Chaudhry and
Vikas Sindhwani and
Stephen Tu},
editor = {Ali Jadbabaie and
John Lygeros and
George J. Pappas and
Pablo A. Parrilo and
Benjamin Recht and
Claire J. Tomlin and
Melanie N. Zeilinger},
title = {Safely Learning Dynamical Systems from Short Trajectories},
booktitle = {Proceedings of the 3rd Annual Conference on Learning for Dynamics
and Control, {L4DC} 2021, 7-8 June 2021, Virtual Event, Switzerland},
series = {Proceedings of Machine Learning Research},
volume = {144},
pages = {498--509},
publisher = {{PMLR}},
year = {2021},
url = {http://proceedings.mlr.press/v144/ahmadi21a.html},
timestamp = {Mon, 14 Jun 2021 08:02:30 +0200},
biburl = {https://dblp.org/rec/conf/l4dc/AhmadiCST21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/BoffiTS21,
author = {Nicholas M. Boffi and
Stephen Tu and
Jean{-}Jacques E. Slotine},
editor = {Ali Jadbabaie and
John Lygeros and
George J. Pappas and
Pablo A. Parrilo and
Benjamin Recht and
Claire J. Tomlin and
Melanie N. Zeilinger},
title = {Regret Bounds for Adaptive Nonlinear Control},
booktitle = {Proceedings of the 3rd Annual Conference on Learning for Dynamics
and Control, {L4DC} 2021, 7-8 June 2021, Virtual Event, Switzerland},
series = {Proceedings of Machine Learning Research},
volume = {144},
pages = {471--483},
publisher = {{PMLR}},
year = {2021},
url = {http://proceedings.mlr.press/v144/boffi21a.html},
timestamp = {Mon, 14 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/l4dc/BoffiTS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miua/TuMCM21,
author = {Shihfan Jack Tu and
Jules Morel and
Minsi Chen and
Stephen J. Mellon},
editor = {Bartlomiej W. Papiez and
Mohammad Yaqub and
Jianbo Jiao and
Ana I. L. Namburete and
J. Alison Noble},
title = {Fast Automatic Bone Surface Segmentation in Ultrasound Images Without
Machine Learning},
booktitle = {Medical Image Understanding and Analysis - 25th Annual Conference,
{MIUA} 2021, Oxford, United Kingdom, July 12-14, 2021, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12722},
pages = {250--264},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-80432-9\_20},
doi = {10.1007/978-3-030-80432-9\_20},
timestamp = {Thu, 23 Jun 2022 19:58:26 +0200},
biburl = {https://dblp.org/rec/conf/miua/TuMCM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/AnanthaVTLPC21,
author = {Raviteja Anantha and
Svitlana Vakulenko and
Zhucheng Tu and
Shayne Longpre and
Stephen Pulman and
Srinivas Chappidi},
editor = {Kristina Toutanova and
Anna Rumshisky and
Luke Zettlemoyer and
Dilek Hakkani{-}T{\"{u}}r and
Iz Beltagy and
Steven Bethard and
Ryan Cotterell and
Tanmoy Chakraborty and
Yichao Zhou},
title = {Open-Domain Question Answering Goes Conversational via Question Rewriting},
booktitle = {Proceedings of the 2021 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL-HLT} 2021, Online, June 6-11, 2021},
pages = {520--534},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.naacl-main.44},
doi = {10.18653/V1/2021.NAACL-MAIN.44},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/AnanthaVTLPC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/works-ws/Al-SaadiABCCHHJ21,
author = {Aymen Al{-}Saadi and
Dong H. Ahn and
Yadu N. Babuji and
Kyle Chard and
James Corbett and
Mihael Hategan and
Stephen Herbein and
Shantenu Jha and
Daniel E. Laney and
Andr{\'{e}} Merzky and
Todd S. Munson and
Michael Salim and
Mikhail Titov and
Matteo Turilli and
Thomas D. Uram and
Justin M. Wozniak},
title = {ExaWorks: Workflows for Exascale},
booktitle = {2021 {IEEE} Workshop on Workflows in Support of Large-Scale Science
(WORKS), St. Louis, MO, USA, November 15, 2021},
pages = {50--57},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/WORKS54523.2021.00012},
doi = {10.1109/WORKS54523.2021.00012},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/works-ws/Al-SaadiABCCHHJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/coin-ws/2020,
editor = {Andrea Aler Tubella and
Stephen Cranefield and
Christopher Frantz and
Felipe Meneguzzi and
Wamberto Vasconcelos},
title = {Coordination, Organizations, Institutions, Norms, and Ethics for Governance
of Multi-Agent Systems {XIII} - International Workshops {COIN} 2017
and {COINE} 2020, Sao Paulo, Brazil, May 8-9, 2017 and Virtual Event,
May 9, 2020, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {12298},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-72376-7},
doi = {10.1007/978-3-030-72376-7},
isbn = {978-3-030-72375-0},
timestamp = {Thu, 15 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coin-ws/2020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2101-06492,
author = {Alexander Robey and
Lars Lindemann and
Stephen Tu and
Nikolai Matni},
title = {Learning Robust Hybrid Control Barrier Functions for Uncertain Systems},
journal = {CoRR},
volume = {abs/2101.06492},
year = {2021},
url = {https://arxiv.org/abs/2101.06492},
eprinttype = {arXiv},
eprint = {2101.06492},
timestamp = {Fri, 22 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2101-06492.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2101-12383,
author = {Jil Kl{\"{u}}nder and
Regina Hebig and
Paolo Tell and
Marco Kuhrmann and
Joyce Nakatumba{-}Nabende and
Rogardt Heldal and
Stephan Krusche and
Masud Fazal{-}Baqaie and
Michael Felderer and
Marcela Fabiana Genero Bocco and
Steffen K{\"{u}}pper and
Sherlock A. Licorish and
Gustavo L{\'{o}}pez and
Fergal McCaffery and
{\"{O}}zden {\"{O}}zcan Top and
Christian R. Prause and
Rafael Prikladnicki and
Eray T{\"{u}}z{\"{u}}n and
Dietmar Pfahl and
Kurt Schneider and
Stephen G. MacDonell},
title = {Catching up with Method and Process Practice: An Industry-Informed
Baseline for Researchers},
journal = {CoRR},
volume = {abs/2101.12383},
year = {2021},
url = {https://arxiv.org/abs/2101.12383},
eprinttype = {arXiv},
eprint = {2101.12383},
timestamp = {Tue, 02 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2101-12383.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-09161,
author = {Stephen Tu and
Alexander Robey and
Nikolai Matni},
title = {Closing the Closed-Loop Distribution Shift in Safe Imitation Learning},
journal = {CoRR},
volume = {abs/2102.09161},
year = {2021},
url = {https://arxiv.org/abs/2102.09161},
eprinttype = {arXiv},
eprint = {2102.09161},
timestamp = {Wed, 24 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2102-09161.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-09284,
author = {Ross Drummond and
Matthew C. Turner and
Stephen R. Duncan},
title = {Reduced-Order Neural Network Synthesis with Robustness Guarantees},
journal = {CoRR},
volume = {abs/2102.09284},
year = {2021},
url = {https://arxiv.org/abs/2102.09284},
eprinttype = {arXiv},
eprint = {2102.09284},
timestamp = {Wed, 24 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2102-09284.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-02561,
author = {Cher Bass and
Mariana da Silva and
Carole H. Sudre and
Logan Z. J. Williams and
Petru{-}Daniel Tudosiu and
Fidel Alfaro{-}Almagro and
Sean P. Fitzgibbon and
Matthew F. Glasser and
Stephen M. Smith and
Emma C. Robinson},
title = {ICAM-reg: Interpretable Classification and Regression with Feature
Attribution for Mapping Neurological Phenotypes in Individual Scans},
journal = {CoRR},
volume = {abs/2103.02561},
year = {2021},
url = {https://arxiv.org/abs/2103.02561},
eprinttype = {arXiv},
eprint = {2103.02561},
timestamp = {Mon, 22 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2103-02561.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-11214,
author = {Bhargab Ghoshal and
Biraja Ghoshal and
Stephen Swift and
Allan Tucker},
title = {Uncertainty Estimation in SARS-CoV-2 B-cell Epitope Prediction for
Vaccine Development},
journal = {CoRR},
volume = {abs/2103.11214},
year = {2021},
url = {https://arxiv.org/abs/2103.11214},
eprinttype = {arXiv},
eprint = {2103.11214},
timestamp = {Wed, 24 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2103-11214.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-03589,
author = {Nicholas M. Boffi and
Stephen Tu and
Jean{-}Jacques E. Slotine},
title = {Random features for adaptive nonlinear control and prediction},
journal = {CoRR},
volume = {abs/2106.03589},
year = {2021},
url = {https://arxiv.org/abs/2106.03589},
eprinttype = {arXiv},
eprint = {2106.03589},
timestamp = {Fri, 11 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-03589.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-01295,
author = {Stephen Chang and
Michael Ballantyne and
Milo Turner and
William J. Bowman},
title = {Dependent Type Systems as Macros},
journal = {CoRR},
volume = {abs/2107.01295},
year = {2021},
url = {https://arxiv.org/abs/2107.01295},
eprinttype = {arXiv},
eprint = {2107.01295},
timestamp = {Wed, 07 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2107-01295.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2108-08368,
author = {Abu Reyan Ahmed and
Md Asadullah Turja and
Faryad Darabi Sahneh and
Mithun Ghosh and
Keaton Hamm and
Stephen G. Kobourov},
title = {Computing Steiner Trees using Graph Neural Networks},
journal = {CoRR},
volume = {abs/2108.08368},
year = {2021},
url = {https://arxiv.org/abs/2108.08368},
eprinttype = {arXiv},
eprint = {2108.08368},
timestamp = {Mon, 23 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2108-08368.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2108-13521,
author = {Aymen Al{-}Saadi and
Dong H. Ahn and
Yadu N. Babuji and
Kyle Chard and
James Corbett and
Mihael Hategan and
Stephen Herbein and
Shantenu Jha and
Daniel E. Laney and
Andr{\'{e}} Merzky and
Todd S. Munson and
Michael Salim and
Mikhail Titov and
Matteo Turilli and
Justin M. Wozniak},
title = {ExaWorks: Workflows for Exascale},
journal = {CoRR},
volume = {abs/2108.13521},
year = {2021},
url = {https://arxiv.org/abs/2108.13521},
eprinttype = {arXiv},
eprint = {2108.13521},
timestamp = {Sun, 20 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2108-13521.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-11435,
author = {Marco Kuhrmann and
Paolo Tell and
Regina Hebig and
Jil Kl{\"{u}}nder and
J{\"{u}}rgen M{\"{u}}nch and
Oliver Linssen and
Dietmar Pfahl and
Michael Felderer and
Christian R. Prause and
Stephen G. MacDonell and
Joyce Nakatumba{-}Nabende and
David Raffo and
Sarah Beecham and
Eray T{\"{u}}z{\"{u}}n and
Gustavo L{\'{o}}pez and
Nicol{\'{a}}s Paez and
Diego Fontdevila and
Sherlock A. Licorish and
Steffen K{\"{u}}pper and
G{\"{u}}nther Ruhe and
Eric Knauss and
{\"{O}}zden {\"{O}}zcan{-}Top and
Paul M. Clarke and
Fergal McCaffery and
Marcela Genero and
Aurora Vizca{\'{\i}}no and
Mario Piattini and
Marcos Kalinowski and
Tayana Conte and
Rafael Prikladnicki and
Stephan Krusche and
Ahmet Coskun{\c{c}}ay and
Ezequiel Scott and
Fabio Calefato and
Svetlana Pimonova and
Rolf{-}Helge Pfeiffer and
Ulrik Pagh Schultz and
Rogardt Heldal and
Masud Fazal{-}Baqaie and
Craig Anslow and
Maleknaz Nayebi and
Kurt Schneider and
Stefan Sauer and
Dietmar Winkler and
Stefan Biffl and
Mar{\'{\i}}a Cecilia Bastarrica and
Ita Richardson},
title = {What Makes Agile Software Development Agile?},
journal = {CoRR},
volume = {abs/2109.11435},
year = {2021},
url = {https://arxiv.org/abs/2109.11435},
eprinttype = {arXiv},
eprint = {2109.11435},
timestamp = {Mon, 09 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-11435.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-11576,
author = {Tim Hsu and
Nathan Keilbart and
Stephen Weitzner and
James Chapman and
Penghao Xiao and
Tuan Anh Pham and
S. Roger Qiu and
Xiao Chen and
Brandon C. Wood},
title = {Efficient, Interpretable Atomistic Graph Neural Network Representation
for Angle-dependent Properties and its Application to Optical Spectroscopy
Prediction},
journal = {CoRR},
volume = {abs/2109.11576},
year = {2021},
url = {https://arxiv.org/abs/2109.11576},
eprinttype = {arXiv},
eprint = {2109.11576},
timestamp = {Fri, 29 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-11576.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-09971,
author = {Lars Lindemann and
Alexander Robey and
Lejun Jiang and
Stephen Tu and
Nikolai Matni},
title = {Learning Robust Output Control Barrier Functions from Safe Expert
Demonstrations},
journal = {CoRR},
volume = {abs/2111.09971},
year = {2021},
url = {https://arxiv.org/abs/2111.09971},
eprinttype = {arXiv},
eprint = {2111.09971},
timestamp = {Mon, 22 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-09971.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-06904,
author = {Ziyan Wang and
Giljoo Nam and
Tuur Stuyck and
Stephen Lombardi and
Michael Zollh{\"{o}}fer and
Jessica K. Hodgins and
Christoph Lassner},
title = {{HVH:} Learning a Hybrid Neural Volumetric Representation for Dynamic
Hair Performance Capture},
journal = {CoRR},
volume = {abs/2112.06904},
year = {2021},
url = {https://arxiv.org/abs/2112.06904},
eprinttype = {arXiv},
eprint = {2112.06904},
timestamp = {Fri, 21 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-06904.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-10690,
author = {Thomas T. C. K. Zhang and
Stephen Tu and
Nicholas M. Boffi and
Jean{-}Jacques E. Slotine and
Nikolai Matni},
title = {Adversarially Robust Stability Certificates can be Sample-Efficient},
journal = {CoRR},
volume = {abs/2112.10690},
year = {2021},
url = {https://arxiv.org/abs/2112.10690},
eprinttype = {arXiv},
eprint = {2112.10690},
timestamp = {Tue, 04 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-10690.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/FarnellRGZPHHMC20,
author = {Damian J. J. Farnell and
Stephen Richmond and
Jennifer Galloway and
Alexei I. Zhurov and
Pertti Pirttiniemi and
Tuomo H. Heikkinen and
Virpi Harila and
Harold S. Matthews and
Peter Claes},
title = {Multilevel principal components analysis of three-dimensional facial
growth in adolescents},
journal = {Comput. Methods Programs Biomed.},
volume = {188},
pages = {105272},
year = {2020},
url = {https://doi.org/10.1016/j.cmpb.2019.105272},
doi = {10.1016/J.CMPB.2019.105272},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmpb/FarnellRGZPHHMC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/complexity/ShangCKTFK20,
author = {Ke Shang and
Felix T. S. Chan and
Stephen Karungaru and
Kenji Terada and
Zuren Feng and
Liangjun Ke},
title = {Two-Stage Robust Optimization for the Orienteering Problem with Stochastic
Weights},
journal = {Complex.},
volume = {2020},
pages = {5649821:1--5649821:15},
year = {2020},
url = {https://doi.org/10.1155/2020/5649821},
doi = {10.1155/2020/5649821},
timestamp = {Tue, 15 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/complexity/ShangCKTFK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fcomp/TurnerMU20,
author = {Adam Brian Turner and
Stephen McCombie and
Allon J. Uhlmann},
title = {Analysis Techniques for Illicit Bitcoin Transactions},
journal = {Frontiers Comput. Sci.},
volume = {2},
pages = {600596},
year = {2020},
url = {https://doi.org/10.3389/fcomp.2020.600596},
doi = {10.3389/FCOMP.2020.600596},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fcomp/TurnerMU20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/focm/DeanMMRT20,
author = {Sarah Dean and
Horia Mania and
Nikolai Matni and
Benjamin Recht and
Stephen Tu},
title = {On the Sample Complexity of the Linear Quadratic Regulator},
journal = {Found. Comput. Math.},
volume = {20},
number = {4},
pages = {633--679},
year = {2020},
url = {https://doi.org/10.1007/s10208-019-09426-y},
doi = {10.1007/S10208-019-09426-Y},
timestamp = {Fri, 07 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/focm/DeanMMRT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/itcon/LeJGC20,
author = {Tuyen Le and
H. David Jeong and
Stephen B. Gilbert and
Evgeny Chukharev{-}Hudilainen},
title = {Generating partial civil information model views using a semantic
information retrieval approach},
journal = {J. Inf. Technol. Constr.},
volume = {25},
pages = {41--54},
year = {2020},
url = {https://www.itcon.org/paper/2020/2},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/itcon/LeJGC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/PellegriniTJWKS20,
author = {Andrea Pellegrini and
Ashok Kumar Tummala and
Jamshed Jalal and
Mark Werkheiser and
Anitha Kona and
Nigel Stephens and
Magnus Bruce and
Yasuo Ishii and
Joseph Pusdesris and
Abhishek Raja and
Chris Abernathy and
Jinson Koppanalil and
Tushar Ringe},
title = {The Arm Neoverse {N1} Platform: Building Blocks for the Next-Gen Cloud-to-Edge
Infrastructure SoC},
journal = {{IEEE} Micro},
volume = {40},
number = {2},
pages = {53--62},
year = {2020},
url = {https://doi.org/10.1109/MM.2020.2972222},
doi = {10.1109/MM.2020.2972222},
timestamp = {Thu, 09 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/PellegriniTJWKS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/YatesAAAAAAAABB20,
author = {Andrew D. Yates and
Premanand Achuthan and
Wasiu A. Akanni and
James E. Allen and
Jamie Allen and
Jorge {\'{A}}lvarez{-}Jarreta and
M. Ridwan Amode and
Irina M. Armean and
Andrey G. Azov and
Ruth Bennett and
Jyothish Bhai and
Konstantinos Billis and
Sanjay Boddu and
Jos{\'{e}} Carlos Marug{\'{a}}n and
Carla A. Cummins and
Claire Davidson and
Kamalkumar Jayantilal Dodiya and
Reham Fatima and
Astrid Gall and
Carlos Garc{\'{\i}}a{-}Gir{\'{o}}n and
Laurent Gil and
Tiago Grego and
Leanne Haggerty and
Erin Haskell and
Thibaut Hourlier and
Osagie G. Izuogu and
Sophie H. Janacek and
Thomas Juettemann and
Mike P. Kay and
Ilias Lavidas and
Tuan Le and
Diana Lemos and
Jose Gonzalez Martinez and
Thomas Maurel and
Mark D. McDowall and
Aoife McMahon and
Shamika Mohanan and
Benjamin Moore and
Michael Nuhn and
Denye N. Oheh and
Anne Parker and
Andrew Parton and
Mateus Patricio and
Manoj Pandian Sakthivel and
Ahamed Imran Abdul Salam and
Bianca M. Schmitt and
Helen Schuilenburg and
Dan Sheppard and
Mira Sycheva and
Marek Szuba and
Kieron R. Taylor and
Anja Thormann and
Glen Threadgold and
Alessandro Vullo and
Brandon Walts and
Andrea Winterbottom and
Amonida Zadissa and
Marc Chakiachvili and
Bethany Flint and
Adam Frankish and
Sarah E. Hunt and
Garth IIsley and
Myrto Kostadima and
Nick Langridge and
Jane E. Loveland and
Fergal J. Martin and
Joannella Morales and
Jonathan M. Mudge and
Matthieu Muffato and
Emily Perry and
Magali Ruffier and
Stephen J. Trevanion and
Fiona Cunningham and
Kevin L. Howe and
Daniel R. Zerbino and
Paul Flicek},
title = {Ensembl 2020},
journal = {Nucleic Acids Res.},
volume = {48},
number = {Database-Issue},
pages = {D682--D688},
year = {2020},
url = {https://doi.org/10.1093/nar/gkz966},
doi = {10.1093/NAR/GKZ966},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nar/YatesAAAAAAAABB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/CollinsBKZAFKLG20,
author = {Ryan L. Collins and
Harrison Brand and
Konrad J. Karczewski and
Xuefang Zhao and
Jessica Alf{\"{o}}ldi and
Laurent C. Francioli and
Amit V. Khera and
Chelsea Lowther and
Laura D. Gauthier and
Harold Wang and
Nicholas A. Watts and
Matthew Solomonson and
Alexander Baumann and
Ruchi Munshi and
Mark Walker and
Christopher W. Whelan and
Yongqing Huang and
Ted Brookings and
Ted Sharpe and
Matthew R. Stone and
Elise Valkanas and
Jack Fu and
Grace Tiao and
Kristen M. Laricchia and
Valent{\'{\i}}n Ruano{-}Rubio and
Christine Stevens and
Namrata Gupta and
Caroline Cusick and
Lauren Margolin and
Irina M. Armean and
Eric Banks and
Louis Bergelson and
Kristian Cibulskis and
Kristen M. Connolly and
Miguel Covarrubias and
Beryl B. Cummings and
Mark J. Daly and
Stacey Donnelly and
Yossi Farjoun and
Steven Ferriera and
Stacey Gabriel and
Jeff Gentry and
Thibault Jeandet and
Diane Kaplan and
Christopher Llanwarne and
Eric V. Minikel and
Benjamin M. Neale and
Sam Novod and
Anne H. O'Donnell{-}Luria and
Nikelle Petrillo and
Timothy Poterba and
David Roazen and
Andrea Saltzman and
Kaitlin E. Samocha and
Molly Schleicher and
Cotton Seed and
Jos{\'{e}} Soto and
Kathleen Tibbetts and
Charlotte Tolonen and
Christopher Vittal and
Gordon Wade and
Arcturus Wang and
Qingbo Wang and
James S. Ware and
Ben Weisburd and
Nicola Whiffin and
Carlos A. Aguilar Salinas and
Tariq Ahmad and
Christine M. Albert and
Diego Ardissino and
Gil Atzmon and
John Barnard and
Laurent Beaugerie and
Emelia J. Benjamin and
Michael Boehnke and
Lori L. Bonnycastle and
Erwin P. Bottinger and
Donald W. Bowden and
Matthew J. Bown and
John C. Chambers and
Juliana C. Chan and
Daniel Chasman and
Judy Cho and
Mina K. Chung and
Bruce Cohen and
Adolfo Correa and
Dana Dabelea and
Dawood Darbar and
Ravindranath Duggirala and
Jos{\'{e}}e Dupuis and
Patrick T. Ellinor and
Roberto Elosua and
Jeanette Erdmann and
T{\~{o}}nu Esko and
Martti F{\"{a}}rkkil{\"{a}} and
Jose Florez and
Andre Franke and
Gad Getz and
Benjamin Glaser and
Stephen J. Glatt and
David Goldstein and
Clicerio Gonzalez and
Leif Groop and
Christopher A. Haiman and
Craig Hanis and
Matthew Harms and
Mikko Hiltunen and
Matti M. Holi and
Christina M. Hultman and
Mikko Kallela and
Jaakko Kaprio and
Sekar Kathiresan and
Bong{-}Jo Kim and
Young Jin Kim and
George Kirov and
Jaspal Kooner and
Seppo Koskinen and
Harlan M. Krumholz and
Subra Kugathasan and
Soo Heon Kwak and
Markku Laakso and
Terho Lehtim{\"{a}}ki and
Ruth J. F. Loos and
Steven A. Lubitz and
Ronald C. W. Ma and
Daniel G. MacArthur and
Jaume Marrugat and
Kari M. Mattila and
Steven A. McCarroll and
Mark I. McCarthy and
Dermot McGovern and
Ruth McPherson and
James B. Meigs and
Olle Melander and
Andres Metspalu and
Peter M. Nilsson and
Michael C. O'Donovan and
Dost {\"{O}}ng{\"{u}}r and
Lorena Orozco and
Michael J. Owen and
Colin N. A. Palmer and
Aarno Palotie and
Kyong Soo Park and
Carlos Pato and
Ann E. Pulver and
Nazneen Rahman and
Anne M. Remes and
John D. Rioux and
Samuli Ripatti and
Dan M. Roden and
Danish Saleheen and
Veikko Salomaa and
Nilesh J. Samani and
Jeremiah Scharf and
Heribert Schunkert and
Moore B. Shoemaker and
Pamela Sklar and
Hilkka Soininen and
Harry Sokol and
Tim Spector and
Patrick F. Sullivan and
Jaana Suvisaari and
E. Shyong Tai and
Yik Ying Teo and
Tuomi Tiinamaija and
Ming Tsuang and
Dan Turner and
Teresa Tusie{-}Luna and
Erkki Vartiainen and
Hugh Watkins and
Rinse K. Weersma and
Maija Wessman and
James G. Wilson and
Ramnik J. Xavier and
Kent D. Taylor and
Henry J. Lin and
Stephen S. Rich and
Wendy S. Post and
Yii{-}Der Ida Chen and
Jerome I. Rotter and
Chad Nusbaum and
Anthony A. Philippakis and
Eric S. Lander and
Michael E. Talkowski},
title = {A structural variation reference for medical and population genetics},
journal = {Nat.},
volume = {581},
number = {7809},
pages = {444--451},
year = {2020},
url = {https://doi.org/10.1038/s41586-020-2287-8},
doi = {10.1038/S41586-020-2287-8},
timestamp = {Wed, 16 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/CollinsBKZAFKLG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/TurroAMGGSASFTS20,
author = {Ernest Turro and
William J. Astle and
Karyn Megy and
Stefan Gr{\"{a}}f and
Daniel Greene and
Olga Shamardina and
Hana Lango Allen and
Alba Sanchis{-}Juan and
Mattia Frontini and
Chantal Thys and
Jonathan Stephens and
Rutendo Mapeta and
Oliver S. Burren and
Kate Downes and
Matthias Haimel and
Salih Tuna and
Sri V. V. Deevi and
Timothy J. Aitman and
David L. H. Bennett and
Paul Calleja and
Keren Carss and
Mark J. Caulfield and
Patrick F. Chinnery and
Peter H. Dixon and
Daniel P. Gale and
Roger James and
Ania Koziell and
Michael A. Laffan and
Adam P. Levine and
Eamonn R. Maher and
Hugh S. Markus and
Joannella Morales and
Nicholas W. Morrell and
Andrew D. Mumford and
Elizabeth Ormondroyd and
Stuart Rankin and
Augusto Rendon and
Sylvia Richardson and
Irene Roberts and
Noemi B. A. Roy and
Moin A. Saleem and
Kenneth G. C. Smith and
Hannah Stark and
Rhea Y. Y. Tan and
Andreas C. Themistocleous and
Adrian J. Thrasher and
Hugh Watkins and
Andrew R. Webster and
Martin R. Wilkins and
Catherine Williamson and
James Whitworth and
Sean Humphray and
David R. Bentley and
Stephen Abbs and
Lara Abulhoul and
Julian Adlard and
Munaza Ahmed and
Hana Alachkar and
David J. Allsup and
Jeff Almeida{-}King and
Philip Ancliff and
Richard Antrobus and
Ruth Armstrong and
Gavin Arno and
Sofie Ashford and
Anthony Attwood and
Paul Aurora and
Christian Babbs and
Chiara Bacchelli and
Tamam Bakchoul and
Siddharth Banka and
Tadbir Bariana and
Julian Barwell and
Joana Batista and
Helen E. Baxendale and
Phil L. Beales and
Agnieszka Bierzynska and
Tina Biss and
Maria A. K. Bitner{-}Glindzicz and
Graeme C. M. Black and
Marta Bleda and
Iulia Blesneac and
Detlef Bockenhauer and
Harm Bogaard and
Christian J. Bourne and
Sara Boyce and
John R. Bradley and
Eugene Bragin and
Gerome Breen and
Paul Brennan and
Carole Brewer and
Matthew Brown and
Andrew C. Browning and
Michael J. Browning and
Rachel J. Buchan and
Matthew S. Buckland and
Teofila Bueser and
Carmen Bugarin Diz and
John Burn and
Siobhan O. Burns and
Nigel Burrows and
Carolyn Campbell and
Gerald Carr{-}White and
Ruth Casey and
Jenny Chambers and
John Chambers and
Melanie M. Y. Chan and
Calvin Cheah and
Floria Cheng and
Manali Chitre and
Martin T. Christian and
Colin Church and
Jill Clayton{-}Smith and
Maureen Cleary and
Naomi Clements Brod and
Gerry Coghlan and
Elizabeth Colby and
Trevor R. P. Cole and
Janine Collins and
Peter W. Collins and
Camilla Colombo and
Cecilia J. Compton and
Robin Condliffe and
Stuart A. Cook and
H. Terence Cook and
Nichola Cooper and
Paul A. Corris and
Abigail Furnell and
Fiona Cunningham and
Nicola S. Curry and
Antony J. Cutler and
Matthew J. Daniels and
Mehul Dattani and
Louise C. Daugherty and
John Davis and
Anthony De Soyza and
Timothy Dent and
Charu Deshpande and
Eleanor F. Dewhurst and
Sofia Douzgou and
Anna M. Drazyk and
Elizabeth Drewe and
Daniel Duarte and
Tina Dutt and
J. David M. Edgar and
Karen Edwards and
William Egner and
Melanie N. Ekani and
Perry Elliott and
Wendy N. Erber and
Marie Erwood and
Maria C. Estiu and
Dafydd Gareth Evans and
Gillian Evans and
Tamara Everington and
M{\'{e}}lanie Eyries and
Hiva Fassihi and
Remi Favier and
Jack Findhammer and
Debra Fletcher and
Frances A. Flinter and
R. Andres Floto and
Tom Fowler and
James Fox and
Amy J. Frary and
Courtney E. French and
Kathleen Freson and
Henning Gall and
Vijeya Ganesan and
Michael Gattens and
Claire Geoghegan and
Terence S. A. Gerighty and
Ali G. Gharavi and
Stefano Ghio and
Hossein{-}Ardeschir Ghofrani and
J. Simon R. Gibbs and
Kate Gibson and
Kimberly C. Gilmour and
Barbara Girerd and
Nicholas S. Gleadall and
Sarah Goddard and
David B. Goldstein and
Keith Gomez and
Pavels Gordins and
David Gosal and
Jodie Graham and
Luigi Grassi and
Lynn Greenhalgh and
Andreas Greinacher and
Paolo Gresele and
Philip Griffiths and
Sofia Grigoriadou and
Russell J. Grocock and
Detelina Grozeva and
Mark Gurnell and
Scott Hackett and
Charaka Hadinnapola and
William M. Hague and
Rosie Hague and
Matthew Hall and
Helen L. Hanson and
Eshika Haque and
Kirsty Harkness and
Andrew R. Harper and
Claire L. Harris and
Daniel Hart and
Ahamad Hassan and
Grant Hayman and
Alex Henderson and
Archana Herwadkar and
Jonathan Hoffman and
Simon Holden and
Rita Horvath and
Henry Houlden and
Arjan C. Houweling and
Luke S. G. E. Howard and
Fengyuan Hu and
Gavin Hudson and
Joseph Hughes and
Aarnoud P. Huissoon and
Marc Humbert and
Sarah Hunter and
Matthew E. Hurles and
Melita Irving and
Louise Izatt and
Sally A. Johnson and
Stephen Jolles and
Jennifer Jolley and
Dragana Josifova and
Neringa Jurkute and
Tim Karten and
Johannes Karten and
Mary A. Kasanicki and
Hanadi Kazkaz and
Rashid Kazmi and
Peter Kelleher and
Anne M. Kelly and
Wilf Kelsall and
Carly Kempster and
David G. Kiely and
Nathalie Kingston and
Robert Klima and
Nils Koelling and
Myrto Kostadima and
Gabor Kovacs and
Roman Kreuzhuber and
Taco W. Kuijpers and
Ajith Kumar and
Dinakantha Kumararatne and
Manju A. Kurian and
Fiona Lalloo and
Michele Lambert and
Allan Lawrie and
D. Mark Layton and
Nick Lench and
Claire Lentaigne and
Tracy Lester and
Rachel Linger and
Hilary Longhurst and
Lorena E. Lorenzo and
Eleni Louka and
Paul A. Lyons and
Rajiv D. Machado and
Robert V. MacKenzie Ross and
Bella Madan and
Jesmeen Maimaris and
Samantha Malka and
Sarah Mangles and
Kevin J. Marchbank and
Stephen Marks and
Hanns{-}Ulrich Marschall and
Andrew G. Marshall and
Jennifer Martin and
Mary Mathias and
Emma Matthews and
Heather Maxwell and
Paul McAlinden and
Mark I. McCarthy and
Harriet McKinney and
Aoife McMahon and
Stuart Meacham and
Adam J. Mead and
Ignacio Medina Castello and
Sarju G. Mehta and
Michel Michaelides and
Carolyn Millar and
Shehla N. Mohammed and
Shahin Moledina and
David Montani and
Anthony T. Moore and
Monika Mozere and
Keith W. Muir and
Andrea H. Nemeth and
William G. Newman and
Michael Newnham and
Sadia Noorani and
Paquita Nurden and
Jennifer O'Sullivan and
Samya Obaji and
Chris Odhams and
Steven Okoli and
Andrea Olschewski and
Horst Olschewski and
Kai Ren Ong and
S. Helen Oram and
Willem H. Ouwehand and
Claire Palles and
Sofia Papadia and
Soo{-}Mi Park and
David Parry and
Smita Patel and
Joan Paterson and
Andrew Peacock and
Simon H. Pearce and
John Peden and
Kathelijne Peerlinck and
Christopher J. Penkett and
Joanna Pepke{-}Zaba and
Romina Petersen and
Clarissa Pilkington and
Kenneth E. S. Poole and
Radhika Prathalingam and
Bethan Psaila and
Angela Pyle and
Richard Quinton and
Shamima Rahman and
Anupama Rao and
F. Lucy Raymond and
Paula J. Rayner{-}Matthews and
Christine Rees and
Tara Renton and
Christopher J. Rhodes and
Andrew S. C. Rice and
Alex Richter and
Leema Robert and
Anthony Rogers and
Sarah J. Rose and
Robert Ross{-}Russell and
Catherine Roughley and
Deborah M. Ruddy and
Omid Sadeghi{-}Alavijeh and
Nilesh J. Samani and
Crina Samarghitean and
Ravishankar B. Sargur and
Robert N. Sarkany and
Simon Satchell and
Sinisa Savic and
John A. Sayer and
Genevieve Sayer and
Laura Scelsi and
Andrew M. Schaefer and
Sol Schulman and
Richard Scott and
Marie Scully and
Claire Searle and
Werner Seeger and
Arjune Sen and
W. A. Carrock Sewell and
Denis Seyres and
Neil Shah and
Susan E. Shapiro and
Adam C. Shaw and
Patrick J. Short and
Keith Sibson and
Lucy Side and
Ilenia Simeoni and
Michael A. Simpson and
Matthew C. Sims and
Suthesh Sivapalaratnam and
Damian Smedley and
Katherine R. Smith and
Katie Snape and
Nicole Soranzo and
Florent Soubrier and
Laura Southgate and
Olivera Spasic{-}Boskovic and
Simon Staines and
Emily Staples and
Charles A. Steward and
Kathleen E. Stirrups and
Alex Stuckey and
Jay Suntharalingam and
Emilia M. Swietlik and
Petros Syrris and
R. Campbell Tait and
Kate Talks and
Katie Tate and
John M. Taylor and
Jenny C. Taylor and
James E. Thaventhiran and
Ellen Thomas and
David Thomas and
Moira J. Thomas and
Patrick Thomas and
Kate Thomson and
Glen Threadgold and
Tobias Tilly and
Marc Tischkowitz and
Catherine Titterton and
John A. Todd and
Cheng{-}Hock Toh and
Bas Tolhuis and
Ian P. Tomlinson and
Mark Toshner and
Matthew Traylor and
Carmen Treacy and
Paul Treadaway and
Richard Trembath and
Wojciech Turek and
Philip Twiss and
Tom Vale and
Chris Van Geet and
Natalie van Zuydam and
Maarten Vandekuilen and
Anthony M. Vandersteen and
Marta Vazquez{-}Lopez and
Julie von Ziegenweidt and
Anton Vonk{-}Noordegraaf and
Annette Wagner and
Quinten Waisfisz and
Suellen M. Walker and
Neil Walker and
Klaudia Walter and
James S. Ware and
Christopher Watt and
Lucy Wedderburn and
Wei Wei and
Steven B. Welch and
Julie Wessels and
Sarah K. Westbury and
John{-}Paul Westwood and
John Wharton and
Deborah Whitehorn and
Andrew O. M. Wilkie and
Brian T. Wilson and
Edwin K. S. Wong and
Nicholas W. Wood and
Yvette Wood and
Christopher Geoffrey Woods and
Emma R. Woodward and
Stephen J. Wort and
Austen Worth and
Michael Wright and
Katherine Yates and
Patrick F. K. Yong and
Timothy Young and
Ping Yu and
Patrick Yu{-}Wai{-}Man and
Eliska Zlamalova},
title = {Whole-genome sequencing of patients with rare diseases in a national
health system},
journal = {Nat.},
volume = {583},
number = {7814},
pages = {96--102},
year = {2020},
url = {https://doi.org/10.1038/s41586-020-2434-2},
doi = {10.1038/S41586-020-2434-2},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/TurroAMGGSASFTS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmpl/ChangBTB20,
author = {Stephen Chang and
Michael Ballantyne and
Milo Turner and
William J. Bowman},
title = {Dependent type systems as macros},
journal = {Proc. {ACM} Program. Lang.},
volume = {4},
number = {{POPL}},
pages = {3:1--3:29},
year = {2020},
url = {https://doi.org/10.1145/3371071},
doi = {10.1145/3371071},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pacmpl/ChangBTB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/AngelTPMLM20,
author = {Yoseline Angel and
Darren Turner and
Stephen Parkes and
Yoann Malb{\'{e}}teau and
Arko Lucieer and
Matthew F. McCabe},
title = {Automated Georectification and Mosaicking of UAV-Based Hyperspectral
Imagery from Push-Broom Sensors},
journal = {Remote. Sens.},
volume = {12},
number = {1},
pages = {34},
year = {2020},
url = {https://doi.org/10.3390/rs12010034},
doi = {10.3390/RS12010034},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/AngelTPMLM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/AragonJPMAAATLM20,
author = {Bruno Aragon and
Kasper Johansen and
Stephen Parkes and
Yoann Malb{\'{e}}teau and
Samer Al{-}Mashharawi and
Talal Al{-}Amoudi and
Cristhian F. Andrade and
Darren Turner and
Arko Lucieer and
Matthew F. McCabe},
title = {A Calibration Procedure for Field and UAV-Based Uncooled Thermal Infrared
Instruments},
journal = {Sensors},
volume = {20},
number = {11},
pages = {3316},
year = {2020},
url = {https://doi.org/10.3390/s20113316},
doi = {10.3390/S20113316},
timestamp = {Thu, 04 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/AragonJPMAAATLM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/BaniAABBBBBBBBC20,
author = {Lukas B{\"{a}}ni and
Andreas Alexopoulos and
Marina Artuso and
Felix Bachmair and
Marcin Bartosik and
Helge Beck and
Vincenzo Bellini and
Vladimir Belyaev and
Benjamin Bentele and
Alexandre Bes and
Jean{-}Marie Brom and
Gabriele Chiodini and
Dominik Chren and
Vladimir Cindro and
Gilles Claus and
Johann Collot and
John Cumalat and
S{\'{e}}bastien Curtoni and
Anne Dabrowski and
Raffaello D'Alessandro and
Denis Dauvergne and
Wim de Boer and
Christian Dorfer and
Marc D{\"{u}}nser and
Gerald Eigen and
Vladimir Eremin and
Jacopo Forneris and
Laurent Gallin{-}Martel and
Marie{-}Laure Gallin{-}Martel and
Kock Gan and
Martin Gastal and
Abderrahman Ghimouz and
Mathieu Goffe and
Joel Goldstein and
Alexander Golubev and
Andrej Gorisek and
Eugene Grigoriev and
J{\"{o}}rn Grosse{-}Knetter and
Aidan Grummer and
Bojan Hiti and
Dmitry Hits and
Martin Hoeferkamp and
J{\'{e}}r{\^{o}}me Hosselet and
Fabian H{\"{u}}gging and
Chris Hutson and
Jens Janssen and
Harris Kagan and
Keida Kanxheri and
Richard Kass and
Mladen Kis and
Gregor Kramberger and
Sergey Kuleshov and
Ana Lacoste and
Stefano Lagomarsino and
Alessandro Lo Giudice and
Ivan L{\'{o}}pez Paz and
Eric Lukosi and
Chaker Maazouzi and
Igor Mandic and
Sara Marcatili and
Alysia Marino and
C{\'{e}}dric Mathieu and
Mauro Menichelli and
Marko Mikuz and
Arianna Morozzi and
Francesco Moscatelli and
Joshua Moss and
Raymond Mountain and
Alexander Oh and
Paolo Olivero and
Daniele Passeri and
Heinz Pernegger and
Roberto Perrino and
Federico Picollo and
Michal Pomorski and
Renato Potenza and
Arnulf Quadt and
Fatah Rarbi and
Alessandro Re and
Michael Reichmann and
Shaun Roe and
Olivier Rossetto and
Diego Sanz Becerra and
Christian J. Schmidt and
Stephen Schnetzer and
Silvio Sciortino and
Andrea Scorzoni and
Sally Seidel and
Leonello Servoli and
Dale Smith and
Bruno Sopko and
Vit Sopko and
Stefania Spagnolo and
Stefan Spanier and
Kevin Stenson and
Robert Stone and
Bjarne Stugu and
Concetta Sutera and
Michael Tr{\"{a}}ger and
William Trischuk and
Marco Truccato and
Cristina Tuv{\`{e}} and
Jaap Velthuis and
Stephen Wagner and
Rainer Wallny and
Jianchun Wang and
Norbert Wermes and
Jayashani Wickramasinghe and
Mahfoud Yamouni and
Justas Zalieckas and
Marko Zavrtanik and
Kazuhiko Hara and
Yoichi Ikegami and
Osamu Jinnouchi and
Takashi Kohriki and
Shingo Mitsui and
Ryo Nagai and
Susumu Terada and
Yoshinobu Unno},
title = {A Study of the Radiation Tolerance of {CVD} Diamond to 70 MeV Protons,
Fast Neutrons and 200 MeV Pions},
journal = {Sensors},
volume = {20},
number = {22},
pages = {6648},
year = {2020},
url = {https://doi.org/10.3390/s20226648},
doi = {10.3390/S20226648},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/BaniAABBBBBBBBC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LiTNWBTY20,
author = {Menglong Li and
Russel N. Torah and
Helga Nunes{-}Matos and
Yang Wei and
Stephen P. Beeby and
John Tudor and
Kai Yang},
title = {Integration and Testing of a Three-Axis Accelerometer in a Woven E-Textile
Sleeve for Wearable Movement Monitoring},
journal = {Sensors},
volume = {20},
number = {18},
pages = {5033},
year = {2020},
url = {https://doi.org/10.3390/s20185033},
doi = {10.3390/S20185033},
timestamp = {Tue, 18 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/LiTNWBTY20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/RahamanMLJMAASM20,
author = {Md Abdur Rahaman and
Daniel H. Mathalon and
Hyo Jong Lee and
Wenhao Jiang and
Bryon A. Mueller and
Ole A. Andreassen and
Ingrid Agartz and
Scott R. Sponheim and
Andrew R. Mayer and
Julia M. Stephen and
Rex E. Jung and
Jessica A. Turner and
Jos{\'{e}} M. Ca{\~{n}}ive and
Juan R. Bustillo and
Vince D. Calhoun and
Cota Navin Gupta and
Srinivas Rachakonda and
Jiayu Chen and
Jingyu Liu and
Theo G. M. van Erp and
Steven G. Potkin and
Judith M. Ford},
title = {N-BiC: {A} Method for Multi-Component and Symptom Biclustering of
Structural {MRI} Data: Application to Schizophrenia},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {67},
number = {1},
pages = {110--121},
year = {2020},
url = {https://doi.org/10.1109/TBME.2019.2908815},
doi = {10.1109/TBME.2019.2908815},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/RahamanMLJMAASM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcst/Narvaez-ArocheM20,
author = {Octavio Narvaez{-}Aroche and
Pierre{-}Jean Meyer and
Stephen Tu and
Andrew K. Packard and
Murat Arcak},
title = {Robust Control of the Sit-to-Stand Movement for a Powered Lower Limb
Orthosis},
journal = {{IEEE} Trans. Control. Syst. Technol.},
volume = {28},
number = {6},
pages = {2390--2403},
year = {2020},
url = {https://doi.org/10.1109/TCST.2019.2945908},
doi = {10.1109/TCST.2019.2945908},
timestamp = {Fri, 30 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcst/Narvaez-ArocheM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/FuXLWBMAL20,
author = {Huazhu Fu and
Yanwu Xu and
Stephen Lin and
Damon Wing Kee Wong and
Mani Baskaran and
Meenakshi Mahesh and
Tin Aung and
Jiang Liu},
title = {Angle-Closure Detection in Anterior Segment {OCT} Based on Multilevel
Deep Network},
journal = {{IEEE} Trans. Cybern.},
volume = {50},
number = {7},
pages = {3358--3366},
year = {2020},
url = {https://doi.org/10.1109/TCYB.2019.2897162},
doi = {10.1109/TCYB.2019.2897162},
timestamp = {Thu, 19 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcyb/FuXLWBMAL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/RocadenboschBFW20,
author = {Francesc Rocadenbosch and
Rub{\'{e}}n Barrag{\'{a}}n and
Stephen J. Frasier and
Joseph Waldinger and
David D. Turner and
Robin Tanamachi and
Daniel T. Dawson},
title = {Ceilometer-Based Rain-Rate Estimation: {A} Case-Study Comparison With
S-Band Radar and Disdrometer Retrievals in the Context of {VORTEX-SE}},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {58},
number = {12},
pages = {8268--8284},
year = {2020},
url = {https://doi.org/10.1109/TGRS.2020.2984458},
doi = {10.1109/TGRS.2020.2984458},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/RocadenboschBFW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmbmc/McGuinessGTM20,
author = {Daniel Tun{\c{c}} McGuiness and
Stamatios Giannoukos and
Stephen Taylor and
Alan Marshall},
title = {Analysis of Multi-Chemical Transmission in the Macro-Scale},
journal = {{IEEE} Trans. Mol. Biol. Multi Scale Commun.},
volume = {6},
number = {2},
pages = {93--106},
year = {2020},
url = {https://doi.org/10.1109/TMBMC.2020.3012874},
doi = {10.1109/TMBMC.2020.3012874},
timestamp = {Thu, 16 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmbmc/McGuinessGTM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acis/Lam0020,
author = {Yuk Tung Tonnie Lam and
Peter Busch and
Stephen Smith},
title = {Australia's Embrace of a Cashless Society},
booktitle = {Australasian Conference on Information Systems, {ACIS} 2020, Wellington,
New Zealand, December 1-4, 2020},
pages = {70},
year = {2020},
url = {https://aisel.aisnet.org/acis2020/70},
timestamp = {Thu, 16 May 2024 17:06:12 +0200},
biburl = {https://dblp.org/rec/conf/acis/Lam0020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aicv2/AbdulrasoolT20,
author = {Fatema Abdulrasool and
Stephen Turnbull},
editor = {Aboul Ella Hassanien and
Ahmad Taher Azar and
Tarek Gaber and
Diego Oliva and
Mohamed Fahmy Tolba},
title = {The Role of {IT} Governance in Enhancing the Performance of Smart
Universities},
booktitle = {Proceedings of the International Conference on Artificial Intelligence
and Computer Vision, {AICV} 2020, Cairo, Egypt, 8-10 April, 2020},
series = {Advances in Intelligent Systems and Computing},
volume = {1153},
pages = {708--720},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-44289-7\_66},
doi = {10.1007/978-3-030-44289-7\_66},
timestamp = {Wed, 25 Mar 2020 12:15:32 +0100},
biburl = {https://dblp.org/rec/conf/aicv2/AbdulrasoolT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/RobeyHLZDTM20,
author = {Alexander Robey and
Haimin Hu and
Lars Lindemann and
Hanwen Zhang and
Dimos V. Dimarogonas and
Stephen Tu and
Nikolai Matni},
title = {Learning Control Barrier Functions from Expert Demonstrations},
booktitle = {59th {IEEE} Conference on Decision and Control, {CDC} 2020, Jeju Island,
South Korea, December 14-18, 2020},
pages = {3717--3724},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/CDC42340.2020.9303785},
doi = {10.1109/CDC42340.2020.9303785},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cdc/RobeyHLZDTM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/corl/BoffiTMSS20,
author = {Nicholas M. Boffi and
Stephen Tu and
Nikolai Matni and
Jean{-}Jacques E. Slotine and
Vikas Sindhwani},
editor = {Jens Kober and
Fabio Ramos and
Claire J. Tomlin},
title = {Learning Stability Certificates from Data},
booktitle = {4th Conference on Robot Learning, CoRL 2020, 16-18 November 2020,
Virtual Event / Cambridge, MA, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {155},
pages = {1341--1350},
publisher = {{PMLR}},
year = {2020},
url = {https://proceedings.mlr.press/v155/boffi21a.html},
timestamp = {Tue, 18 Oct 2022 08:35:37 +0200},
biburl = {https://dblp.org/rec/conf/corl/BoffiTMSS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/corl/LindemannHRZDTM20,
author = {Lars Lindemann and
Haimin Hu and
Alexander Robey and
Hanwen Zhang and
Dimos V. Dimarogonas and
Stephen Tu and
Nikolai Matni},
editor = {Jens Kober and
Fabio Ramos and
Claire J. Tomlin},
title = {Learning Hybrid Control Barrier Functions from Data},
booktitle = {4th Conference on Robot Learning, CoRL 2020, 16-18 November 2020,
Virtual Event / Cambridge, MA, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {155},
pages = {1351--1370},
publisher = {{PMLR}},
year = {2020},
url = {https://proceedings.mlr.press/v155/lindemann21a.html},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/corl/LindemannHRZDTM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ease/CapiluppiAAACDM20,
author = {Andrea Capiluppi and
Nemitari Ajienka and
Nour Ali and
Mahir Arzoky and
Steve Counsell and
Giuseppe Destefanis and
Alina Dana Miron and
Bhaveet Nagaria and
Rumyana Neykova and
Martin J. Shepperd and
Stephen Swift and
Allan Tucker},
editor = {Jingyue Li and
Letizia Jaccheri and
Torgeir Dings{\o}yr and
Ruzanna Chitchyan},
title = {Using the Lexicon from Source Code to Determine Application Domain},
booktitle = {{EASE} '20: Evaluation and Assessment in Software Engineering, Trondheim,
Norway, April 15-17, 2020},
pages = {110--119},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3383219.3383231},
doi = {10.1145/3383219.3383231},
timestamp = {Wed, 16 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ease/CapiluppiAAACDM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecai/BellaEDPTRG20,
author = {G{\'{a}}bor Bella and
Liz Elliot and
Subhashis Das and
Stephen Pavis and
Ettore Turra and
David Robertson and
Fausto Giunchiglia},
editor = {Giuseppe De Giacomo and
Alejandro Catal{\'{a}} and
Bistra Dilkina and
Michela Milano and
Sen{\'{e}}n Barro and
Alberto Bugar{\'{\i}}n and
J{\'{e}}r{\^{o}}me Lang},
title = {Cross-Border Medical Research Using Multi-Layered and Distributed
Knowledge},
booktitle = {{ECAI} 2020 - 24th European Conference on Artificial Intelligence,
29 August-8 September 2020, Santiago de Compostela, Spain, August
29 - September 8, 2020 - Including 10th Conference on Prestigious
Applications of Artificial Intelligence {(PAIS} 2020)},
series = {Frontiers in Artificial Intelligence and Applications},
volume = {325},
pages = {2956--2963},
publisher = {{IOS} Press},
year = {2020},
url = {https://doi.org/10.3233/FAIA200469},
doi = {10.3233/FAIA200469},
timestamp = {Thu, 12 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ecai/BellaEDPTRG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/DoPTSCWETD20,
author = {Tu Mai Anh Do and
Lo{\"{\i}}c Pottier and
Stephen Thomas and
Rafael Ferreira da Silva and
Michel A. Cuendet and
Harel Weinstein and
Trilce Estrada and
Michela Taufer and
Ewa Deelman},
editor = {Valeria V. Krzhizhanovskaya and
G{\'{a}}bor Z{\'{a}}vodszky and
Michael Harold Lees and
Jack J. Dongarra and
Peter M. A. Sloot and
S{\'{e}}rgio Brissos and
Jo{\~{a}}o Teixeira},
title = {A Novel Metric to Evaluate In Situ Workflows},
booktitle = {Computational Science - {ICCS} 2020 - 20th International Conference,
Amsterdam, The Netherlands, June 3-5, 2020, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {12137},
pages = {538--553},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-50371-0\_40},
doi = {10.1007/978-3-030-50371-0\_40},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccS/DoPTSCWETD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/SongJTDN20,
author = {Xingyou Song and
Yiding Jiang and
Stephen Tu and
Yilun Du and
Behnam Neyshabur},
title = {Observational Overfitting in Reinforcement Learning},
booktitle = {8th International Conference on Learning Representations, {ICLR} 2020,
Addis Ababa, Ethiopia, April 26-30, 2020},
publisher = {OpenReview.net},
year = {2020},
url = {https://openreview.net/forum?id=HJli2hNKDH},
timestamp = {Thu, 07 May 2020 17:11:47 +0200},
biburl = {https://dblp.org/rec/conf/iclr/SongJTDN20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/MajumdarKMMT20,
author = {Somdeb Majumdar and
Shauharda Khadka and
Santiago Miret and
Stephen McAleer and
Kagan Tumer},
title = {Evolutionary Reinforcement Learning for Sample-Efficient Multiagent
Coordination},
booktitle = {Proceedings of the 37th International Conference on Machine Learning,
{ICML} 2020, 13-18 July 2020, Virtual Event},
series = {Proceedings of Machine Learning Research},
volume = {119},
pages = {6651--6660},
publisher = {{PMLR}},
year = {2020},
url = {http://proceedings.mlr.press/v119/majumdar20a.html},
timestamp = {Tue, 15 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icml/MajumdarKMMT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/0001NOST20,
author = {Simon Foster and
Yakoub Nemouchi and
Colin O'Halloran and
Karen Stephenson and
Nick Tudor},
editor = {Kyungmin Bae and
Domenico Bianculli and
Stefania Gnesi and
Nico Plat},
title = {Formal Model-Based Assurance Cases in Isabelle/SACM: An Autonomous
Underwater Vehicle Case Study},
booktitle = {FormaliSE@ICSE 2020: 8th International Conference on Formal Methods
in Software Engineering, Seoul, Republic of Korea, July 13, 2020},
pages = {11--21},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3372020.3391559},
doi = {10.1145/3372020.3391559},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icse/0001NOST20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/0033NTKZGPST0G20,
author = {Xi Chen and
Nikola Nedovic and
Stephen G. Tell and
Sudhir S. Kudva and
Brian Zimmer and
Thomas H. Greer and
John W. Poulton and
Sanquan Song and
Walker J. Turner and
John M. Wilson and
C. Thomas Gray},
title = {6.6 Reference-Noise Compensation Scheme for Single-Ended Package-to-Package
Links},
booktitle = {2020 {IEEE} International Solid- State Circuits Conference, {ISSCC}
2020, San Francisco, CA, USA, February 16-20, 2020},
pages = {126--128},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISSCC19947.2020.9063140},
doi = {10.1109/ISSCC19947.2020.9063140},
timestamp = {Sat, 18 Apr 2020 17:41:44 +0200},
biburl = {https://dblp.org/rec/conf/isscc/0033NTKZGPST0G20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/BassSSTSR20,
author = {Cher Bass and
Mariana da Silva and
Carole H. Sudre and
Petru{-}Daniel Tudosiu and
Stephen M. Smith and
Emma C. Robinson},
editor = {Hugo Larochelle and
Marc'Aurelio Ranzato and
Raia Hadsell and
Maria{-}Florina Balcan and
Hsuan{-}Tien Lin},
title = {{ICAM:} Interpretable Classification via Disentangled Representations
and Feature Attribution Mapping},
booktitle = {Advances in Neural Information Processing Systems 33: Annual Conference
on Neural Information Processing Systems 2020, NeurIPS 2020, December
6-12, 2020, virtual},
year = {2020},
url = {https://proceedings.neurips.cc/paper/2020/hash/56f9f88906aebf4ad985aaec7fa01313-Abstract.html},
timestamp = {Mon, 22 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/BassSSTSR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/LedentsovSKLCTH30,
author = {Nikolay N. Ledentsov and
V. A. Shchukin and
Vladimir P. Kalosha and
Nikolay Ledentsov Jr. and
Lukasz Chorchos and
Jaroslaw P. Turkiewicz and
Urs Hecht and
Patrick Kurth and
Friedel Gerfers and
Justin Lavrencik and
Siddharth Varughese and
Stephen E. Ralph},
title = {Optical Interconnects using Single-Mode and Multi-Mode {VCSEL} and
Multi-Mode Fiber},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2020,
San Diego, CA, USA, March 8-12, 2020},
pages = {1--3},
publisher = {{IEEE}},
year = {2020},
url = {https://ieeexplore.ieee.org/document/9083589},
timestamp = {Tue, 11 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/LedentsovSKLCTH30.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/plans/TurnerWEK20,
author = {Michael Turner and
Stephen Wimbush and
Christoph Enneking and
Andriy Konovaltsev},
title = {Spoofing Detection by Distortion of the Correlation Function},
booktitle = {{IEEE/ION} Position, Location and Navigation Symposium, {PLANS} 2020,
Portland, OR, USA, April 20-23, 2020},
pages = {566--574},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/PLANS46316.2020.9110173},
doi = {10.1109/PLANS46316.2020.9110173},
timestamp = {Tue, 16 Jun 2020 12:24:43 +0200},
biburl = {https://dblp.org/rec/conf/plans/TurnerWEK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/hci/FrostDGTLB20,
author = {Dennis Frost and
Suzanne Dillon and
Stephen Grady and
Jeffrey Thurlow and
Tuck Wah Leong and
Jeanette Bell},
editor = {Rens Brankaert and
Gail Kenning},
title = {Approaches for Authentic Engagement: Younger Onset Dementia},
booktitle = {{HCI} and Design in the Context of Dementia},
series = {Human-Computer Interaction Series},
pages = {77--93},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-32835-1\_6},
doi = {10.1007/978-3-030-32835-1\_6},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/series/hci/FrostDGTLB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/miccai/2020asmus,
editor = {Yipeng Hu and
Roxane Licandro and
J. Alison Noble and
Jana Hutter and
Stephen R. Aylward and
Andrew Melbourne and
Esra Abaci Turk and
Jordina Torrents{-}Barrena},
title = {Medical Ultrasound, and Preterm, Perinatal and Paediatric Image Analysis
- First International Workshop, {ASMUS} 2020, and 5th International
Workshop, {PIPPI} 2020, Held in Conjunction with {MICCAI} 2020, Lima,
Peru, October 4-8, 2020, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12437},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-60334-2},
doi = {10.1007/978-3-030-60334-2},
isbn = {978-3-030-60333-5},
timestamp = {Tue, 06 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miccai/2020asmus.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2001-10389,
author = {Jonathan Tuck and
Stephen P. Boyd},
title = {Eigen-Stratified Models},
journal = {CoRR},
volume = {abs/2001.10389},
year = {2020},
url = {https://arxiv.org/abs/2001.10389},
eprinttype = {arXiv},
eprint = {2001.10389},
timestamp = {Thu, 30 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2001-10389.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-03315,
author = {Alexander Robey and
Haimin Hu and
Lars Lindemann and
Hanwen Zhang and
Dimos V. Dimarogonas and
Stephen Tu and
Nikolai Matni},
title = {Learning Control Barrier Functions from Expert Demonstrations},
journal = {CoRR},
volume = {abs/2004.03315},
year = {2020},
url = {https://arxiv.org/abs/2004.03315},
eprinttype = {arXiv},
eprint = {2004.03315},
timestamp = {Wed, 08 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2004-03315.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-01752,
author = {Jonathan Tuck and
Stephen P. Boyd},
title = {Fitting Laplacian Regularized Stratified Gaussian Models},
journal = {CoRR},
volume = {abs/2005.01752},
year = {2020},
url = {https://arxiv.org/abs/2005.01752},
eprinttype = {arXiv},
eprint = {2005.01752},
timestamp = {Sun, 10 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-01752.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-13095,
author = {Nilufer Tuptuk and
Stephen Hailes},
title = {Identifying Vulnerabilities of Industrial Control Systems using Evolutionary
Multiobjective Optimisation},
journal = {CoRR},
volume = {abs/2005.13095},
year = {2020},
url = {https://arxiv.org/abs/2005.13095},
eprinttype = {arXiv},
eprint = {2005.13095},
timestamp = {Thu, 28 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-13095.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-08287,
author = {Cher Bass and
Mariana da Silva and
Carole H. Sudre and
Petru{-}Daniel Tudosiu and
Stephen M. Smith and
Emma C. Robinson},
title = {{ICAM:} Interpretable Classification via Disentangled Representations
and Feature Attribution Mapping},
journal = {CoRR},
volume = {abs/2006.08287},
year = {2020},
url = {https://arxiv.org/abs/2006.08287},
eprinttype = {arXiv},
eprint = {2006.08287},
timestamp = {Mon, 22 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2006-08287.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-05952,
author = {Nicholas M. Boffi and
Stephen Tu and
Nikolai Matni and
Jean{-}Jacques E. Slotine and
Vikas Sindhwani},
title = {Learning Stability Certificates from Data},
journal = {CoRR},
volume = {abs/2008.05952},
year = {2020},
url = {https://arxiv.org/abs/2008.05952},
eprinttype = {arXiv},
eprint = {2008.05952},
timestamp = {Mon, 17 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2008-05952.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-04898,
author = {Raviteja Anantha and
Svitlana Vakulenko and
Zhucheng Tu and
Shayne Longpre and
Stephen Pulman and
Srinivas Chappidi},
title = {Open-Domain Question Answering Goes Conversational via Question Rewriting},
journal = {CoRR},
volume = {abs/2010.04898},
year = {2020},
url = {https://arxiv.org/abs/2010.04898},
eprinttype = {arXiv},
eprint = {2010.04898},
timestamp = {Tue, 20 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-04898.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-04112,
author = {Lars Lindemann and
Haimin Hu and
Alexander Robey and
Hanwen Zhang and
Dimos V. Dimarogonas and
Stephen Tu and
Nikolai Matni},
title = {Learning Hybrid Control Barrier Functions from Data},
journal = {CoRR},
volume = {abs/2011.04112},
year = {2020},
url = {https://arxiv.org/abs/2011.04112},
eprinttype = {arXiv},
eprint = {2011.04112},
timestamp = {Thu, 12 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-04112.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-12257,
author = {Amir Ali Ahmadi and
Abraar Chaudhry and
Vikas Sindhwani and
Stephen Tu},
title = {Safely Learning Dynamical Systems from Short Trajectories},
journal = {CoRR},
volume = {abs/2011.12257},
year = {2020},
url = {https://arxiv.org/abs/2011.12257},
eprinttype = {arXiv},
eprint = {2011.12257},
timestamp = {Thu, 26 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-12257.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-13101,
author = {Nicholas M. Boffi and
Stephen Tu and
Jean{-}Jacques E. Slotine},
title = {Regret Bounds for Adaptive Nonlinear Control},
journal = {CoRR},
volume = {abs/2011.13101},
year = {2020},
url = {https://arxiv.org/abs/2011.13101},
eprinttype = {arXiv},
eprint = {2011.13101},
timestamp = {Tue, 01 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-13101.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/us/Tu19,
author = {Stephen Tu},
title = {Sample Complexity Bounds for the Linear Quadratic Regulator},
school = {University of California, Berkeley, {USA}},
year = {2019},
url = {https://www.escholarship.org/uc/item/4zw591fq},
timestamp = {Wed, 22 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/us/Tu19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/McGuinessGMT19,
author = {Daniel Tunc McGuiness and
Stamatios Giannoukos and
Alan Marshall and
Stephen Taylor},
title = {Modulation Analysis in Macro-Molecular Communications},
journal = {{IEEE} Access},
volume = {7},
pages = {11049--11065},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2019.2892850},
doi = {10.1109/ACCESS.2019.2892850},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/McGuinessGMT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cphysics/HawkesVPKCT19,
author = {James Nicholas Hawkes and
Guilherme Vaz and
Alexander B. Phillips and
Christiaan M. Klaij and
S. J. Cox and
Stephen R. Turnock},
title = {Chaotic multigrid methods for the solution of elliptic equations},
journal = {Comput. Phys. Commun.},
volume = {237},
pages = {26--36},
year = {2019},
url = {https://doi.org/10.1016/j.cpc.2018.10.031},
doi = {10.1016/J.CPC.2018.10.031},
timestamp = {Mon, 15 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cphysics/HawkesVPKCT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/heuristics/JilaniTS19,
author = {Mohd Zairul Mazwan Bin Jilani and
Allan Tucker and
Stephen Swift},
title = {An application of generalised simulated annealing towards the simultaneous
modelling and clustering of glaucoma},
journal = {J. Heuristics},
volume = {25},
number = {6},
pages = {933--957},
year = {2019},
url = {https://doi.org/10.1007/s10732-019-09415-y},
doi = {10.1007/S10732-019-09415-Y},
timestamp = {Thu, 07 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/heuristics/JilaniTS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieeejas/TuckHB19,
author = {Jonathan Tuck and
David Hallac and
Stephen P. Boyd},
title = {Distributed majorization-minimization for Laplacian regularized problems},
journal = {{IEEE} {CAA} J. Autom. Sinica},
volume = {6},
number = {1},
pages = {45--52},
year = {2019},
url = {https://doi.org/10.1109/JAS.2019.1911321},
doi = {10.1109/JAS.2019.1911321},
timestamp = {Fri, 18 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieeejas/TuckHB19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcphy/ZengTBW19,
author = {Fanhai Zeng and
Ian W. Turner and
Kevin Burrage and
Stephen J. Wright},
title = {A discrete least squares collocation method for two-dimensional nonlinear
time-dependent partial differential equations},
journal = {J. Comput. Phys.},
volume = {394},
pages = {177--199},
year = {2019},
url = {https://doi.org/10.1016/j.jcp.2019.05.044},
doi = {10.1016/J.JCP.2019.05.044},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcphy/ZengTBW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/SchillaiTRP19,
author = {Sophia M. Schillai and
Stephen R. Turnock and
Eric Rogers and
Alexander B. Phillips},
title = {Experimental analysis of low-altitude terrain following for hover-capable
flight-style autonomous underwater vehicles},
journal = {J. Field Robotics},
volume = {36},
number = {8},
pages = {1399--1421},
year = {2019},
url = {https://doi.org/10.1002/rob.21910},
doi = {10.1002/ROB.21910},
timestamp = {Tue, 26 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jfr/SchillaiTRP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jossw/Brummel-SmithBB19,
author = {Corey Brummel{-}Smith and
Greg Bryan and
Iryna Butsky and
Lauren Corlies and
Andrew Emerick and
John Forbes and
Yusuke Fujimoto and
Nathan J. Goldbaum and
Philipp Grete and
Cameron Hummels and
Ji{-}hoon Kim and
Daegene Koh and
Miao Li and
Yuan Li and
Xinyu Li and
Brian W. O'Shea and
Molly Peeples and
John Regan and
Munier Salem and
Wolfram Schmidt and
Christine Simpson and
Britton Smith and
Jason Tumlinson and
Matthew J. Turk and
John H. Wise and
Tom Abel and
James Bordner and
Renyue Cen and
David Collins and
Brian Crosby and
Philipp V. F. Edelmann and
Oliver Hahn and
Robert Harkness and
Elizabeth Harper{-}Clark and
Shuo Kong and
Alexei G. Kritsuk and
Michael Kuhlen and
James Larrue and
Eve Lee and
Greg Meece and
Michael L. Norman and
Jeffrey S. Oishi and
Pascal Paschos and
Carolyn Peruta and
Alex Razoumov and
Daniel R. Reynolds and
Devin Silvia and
Samuel W. Skillman and
Stephen Skory and
Geoffrey So and
Elizabeth J. Tasker and
Rick Wagner and
Peng Wang and
Hao Xu and
Fen Zhao},
title = {{ENZO:} An Adaptive Mesh Refinement Code for Astrophysics (Version
2.6)},
journal = {J. Open Source Softw.},
volume = {4},
number = {42},
pages = {1636},
year = {2019},
url = {https://doi.org/10.21105/joss.01636},
doi = {10.21105/JOSS.01636},
timestamp = {Thu, 31 Oct 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jossw/Brummel-SmithBB19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/PoultonWTZCKSTN19,
author = {John W. Poulton and
John M. Wilson and
Walker J. Turner and
Brian Zimmer and
Xi Chen and
Sudhir S. Kudva and
Sanquan Song and
Stephen G. Tell and
Nikola Nedovic and
Wenxu Zhao and
Sunil R. Sudhakaran and
C. Thomas Gray and
William J. Dally},
title = {A 1.17-pJ/b, 25-Gb/s/pin Ground-Referenced Single-Ended Serial Link
for Off- and On-Package Communication Using a Process- and Temperature-Adaptive
Voltage Regulator},
journal = {{IEEE} J. Solid State Circuits},
volume = {54},
number = {1},
pages = {43--54},
year = {2019},
url = {https://doi.org/10.1109/JSSC.2018.2875092},
doi = {10.1109/JSSC.2018.2875092},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/PoultonWTZCKSTN19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/UrsuHBYMSNSO19,
author = {Oleg Ursu and
Jayme Holmes and
Cristian Bologa and
Jeremy J. Yang and
Stephen L. Mathias and
Vasileios Stathias and
Dac{-}Trung Nguyen and
Stephan C. Sch{\"{u}}rer and
Tudor I. Oprea},
title = {DrugCentral 2018: an update},
journal = {Nucleic Acids Res.},
volume = {47},
number = {Database-Issue},
pages = {D963--D970},
year = {2019},
url = {https://doi.org/10.1093/nar/gky963},
doi = {10.1093/NAR/GKY963},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/UrsuHBYMSNSO19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/ChitnisGGHSSDPT19,
author = {Tanuja Chitnis and
Bonnie I. Glanz and
Cindy Gonzalez and
Brian C. Healy and
Taylor J. Saraceno and
Neda Sattarnezhad and
Camilo Diaz{-}Cruz and
Mariann Polgar{-}Turcsanyi and
Subhash Tummala and
Rohit Bakshi and
Vikram Bajaj and
David Ben Shimol and
Nikhil Bikhchandani and
Alexander W. Blocker and
Joshua Burkart and
Raphael Cendrillon and
Michael P. Cusack and
Emre Demiralp and
Sarel Kobus Jooste and
Alaa Kharbouch and
Amy A. Lee and
Joseph Lehar and
Manway Liu and
Swaminathan Mahadevan and
Mark Murphy and
Linda C. Norton and
Tushar Anil Parlikar and
Anupam Pathak and
Ali Shoeb and
Erin Soderberg and
Philip Stephens and
Aaron H. Stoertz and
Florence Thng and
Kashyap R. Tumkur and
Hongsheng Wang and
Jane Rhodes and
Richard A. Rudick and
Richard M. Ransohoff and
Glenn A. Phillips and
Effie Bruzik and
William J. Marks and
Howard L. Weiner and
Thomas M. Snyder},
title = {Quantifying neurologic disease using biosensor measurements in-clinic
and in free-living settings in multiple sclerosis},
journal = {npj Digit. Medicine},
volume = {2},
year = {2019},
url = {https://doi.org/10.1038/s41746-019-0197-7},
doi = {10.1038/S41746-019-0197-7},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/ChitnisGGHSSDPT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/NetoPPTSBTFMO19,
author = {Elias Chaibub Neto and
Abhishek Pratap and
Thanneer M. Perumal and
Meghasyam Tummalacherla and
Phil Snyder and
Brian M. Bot and
Andrew D. Trister and
Stephen H. Friend and
Lara M. Mangravite and
Larsson Omberg},
title = {Detecting the impact of subject characteristics on machine learning-based
diagnostic applications},
journal = {npj Digit. Medicine},
volume = {2},
year = {2019},
url = {https://doi.org/10.1038/s41746-019-0178-x},
doi = {10.1038/S41746-019-0178-X},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/NetoPPTSBTFMO19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/TurkPAJWFLHFCKN19,
author = {F. Joseph Turk and
Ramon Padull{\'{e}}s and
Chi O. Ao and
Manuel de la Torre Ju{\'{a}}rez and
Kuo{-}Nung Wang and
Garth W. Franklin and
Stephen T. Lowe and
Svetla M. Hristova{-}Veleva and
Eric J. Fetzer and
Estel Cardellach and
Yi{-}Hung Kuo and
J. David Neelin},
title = {Benefits of a Closely-Spaced Satellite Constellation of Atmospheric
Polarimetric Radio Occultation Measurements},
journal = {Remote. Sens.},
volume = {11},
number = {20},
pages = {2399},
year = {2019},
url = {https://doi.org/10.3390/rs11202399},
doi = {10.3390/RS11202399},
timestamp = {Wed, 15 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/remotesensing/TurkPAJWFLHFCKN19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/TurnerH19,
author = {Alexander P. Turner and
Stephen Hayes},
title = {The Classification of Minor Gait Alterations Using Wearable Sensors
and Deep Learning},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {66},
number = {11},
pages = {3136--3145},
year = {2019},
url = {https://doi.org/10.1109/TBME.2019.2900863},
doi = {10.1109/TBME.2019.2900863},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbe/TurnerH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmbmc/McGuinessGTM19,
author = {Daniel Tun{\c{c}} McGuiness and
Stamatios Giannoukos and
Stephen Taylor and
Alan Marshall},
title = {Experimental and Analytical Analysis of Macro-Scale Molecular Communications
Within Closed Boundaries},
journal = {{IEEE} Trans. Mol. Biol. Multi Scale Commun.},
volume = {5},
number = {1},
pages = {44--55},
year = {2019},
url = {https://doi.org/10.1109/TMBMC.2019.2955094},
doi = {10.1109/TMBMC.2019.2955094},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmbmc/McGuinessGTM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/NovotnyTTGDFL19,
author = {Johannes Novotny and
Joshua Tveite and
Morgan L. Turner and
Stephen M. Gatesy and
Fritz Drury and
Peter Falkingham and
David H. Laidlaw},
title = {Developing Virtual Reality Visualizations for Unsteady Flow Analysis
of Dinosaur Track Formation using Scientific Sketching},
journal = {{IEEE} Trans. Vis. Comput. Graph.},
volume = {25},
number = {5},
pages = {2145--2154},
year = {2019},
url = {https://doi.org/10.1109/TVCG.2019.2898796},
doi = {10.1109/TVCG.2019.2898796},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvcg/NovotnyTTGDFL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aied/Al-LuhaybiYSCT19,
author = {Mashael Al{-}Luhaybi and
Leila Yousefi and
Stephen Swift and
Steve Counsell and
Allan Tucker},
editor = {Seiji Isotani and
Eva Mill{\'{a}}n and
Amy Ogan and
Peter M. Hastings and
Bruce M. McLaren and
Rose Luckin},
title = {Predicting Academic Performance: {A} Bootstrapping Approach for Learning
Dynamic Bayesian Networks},
booktitle = {Artificial Intelligence in Education - 20th International Conference,
{AIED} 2019, Chicago, IL, USA, June 25-29, 2019, Proceedings, Part
{I}},
series = {Lecture Notes in Computer Science},
volume = {11625},
pages = {26--36},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-23204-7\_3},
doi = {10.1007/978-3-030-23204-7\_3},
timestamp = {Mon, 15 Jun 2020 17:12:49 +0200},
biburl = {https://dblp.org/rec/conf/aied/Al-LuhaybiYSCT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/DeanTMR19,
author = {Sarah Dean and
Stephen Tu and
Nikolai Matni and
Benjamin Recht},
title = {Safely Learning to Control the Constrained Linear Quadratic Regulator},
booktitle = {2019 American Control Conference, {ACC} 2019, Philadelphia, PA, USA,
July 10-12, 2019},
pages = {5582--5588},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.23919/ACC.2019.8814865},
doi = {10.23919/ACC.2019.8814865},
timestamp = {Sun, 08 Aug 2021 01:40:57 +0200},
biburl = {https://dblp.org/rec/conf/amcc/DeanTMR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/DrummondTD19,
author = {Ross Drummond and
Matthew C. Turner and
Stephen R. Duncan},
title = {External Positivity of Linear Systems by Weak Majorisation},
booktitle = {2019 American Control Conference, {ACC} 2019, Philadelphia, PA, USA,
July 10-12, 2019},
pages = {5191--5196},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.23919/ACC.2019.8814408},
doi = {10.23919/ACC.2019.8814408},
timestamp = {Sun, 08 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amcc/DrummondTD19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/TuBR19,
author = {Stephen Tu and
Ross Boczar and
Benjamin Recht},
title = {Minimax Lower Bounds for H{\(\infty\)}-Norm Estimation},
booktitle = {2019 American Control Conference, {ACC} 2019, Philadelphia, PA, USA,
July 10-12, 2019},
pages = {3538--3543},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.23919/ACC.2019.8814311},
doi = {10.23919/ACC.2019.8814311},
timestamp = {Sun, 08 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amcc/TuBR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/YousefiSASCT19,
author = {Leila Yousefi and
Stephen Swift and
Mahir Arzoky and
Lucia Sacchi and
Luca Chiovato and
Allan Tucker},
title = {Opening the Black Box: Exploring Temporal Pattern of Type 2 Diabetes
Complications in Patient Clustering Using Association Rules and Hidden
Variable Discovery},
booktitle = {32nd {IEEE} International Symposium on Computer-Based Medical Systems,
{CBMS} 2019, Cordoba, Spain, June 5-7, 2019},
pages = {198--203},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CBMS.2019.00048},
doi = {10.1109/CBMS.2019.00048},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cbms/YousefiSASCT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/MatniPRT19,
author = {Nikolai Matni and
Alexandre Prouti{\`{e}}re and
Anders Rantzer and
Stephen Tu},
title = {From self-tuning regulators to reinforcement learning and back again},
booktitle = {58th {IEEE} Conference on Decision and Control, {CDC} 2019, Nice,
France, December 11-13, 2019},
pages = {3724--3740},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CDC40024.2019.9029916},
doi = {10.1109/CDC40024.2019.9029916},
timestamp = {Fri, 04 Mar 2022 13:30:46 +0100},
biburl = {https://dblp.org/rec/conf/cdc/MatniPRT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/MatniT19,
author = {Nikolai Matni and
Stephen Tu},
title = {A Tutorial on Concentration Bounds for System Identification},
booktitle = {58th {IEEE} Conference on Decision and Control, {CDC} 2019, Nice,
France, December 11-13, 2019},
pages = {3741--3749},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CDC40024.2019.9029621},
doi = {10.1109/CDC40024.2019.9029621},
timestamp = {Mon, 27 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cdc/MatniT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/SongP0ZTTKNWGD19,
author = {Sanquan Song and
John Poulton and
Xi Chen and
Brian Zimmer and
Stephen G. Tell and
Walker J. Turner and
Sudhir S. Kudva and
Nikola Nedovic and
John M. Wilson and
C. Thomas Gray and
William J. Dally},
title = {A 2-to-20 GHz Multi-Phase Clock Generator with Phase Interpolators
Using Injection-Locked Oscillation Buffers for High-Speed IOs in 16nm
FinFET},
booktitle = {{IEEE} Custom Integrated Circuits Conference, {CICC} 2019, Austin,
TX, USA, April 14-17, 2019},
pages = {1--4},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CICC.2019.8780177},
doi = {10.1109/CICC.2019.8780177},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cicc/SongP0ZTTKNWGD19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/colt/TuR19,
author = {Stephen Tu and
Benjamin Recht},
editor = {Alina Beygelzimer and
Daniel Hsu},
title = {The Gap Between Model-Based and Model-Free Methods on the Linear Quadratic
Regulator: An Asymptotic Viewpoint},
booktitle = {Conference on Learning Theory, {COLT} 2019, 25-28 June 2019, Phoenix,
AZ, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {99},
pages = {3036--3083},
publisher = {{PMLR}},
year = {2019},
url = {http://proceedings.mlr.press/v99/tu19a.html},
timestamp = {Mon, 08 Jul 2019 16:13:41 +0200},
biburl = {https://dblp.org/rec/conf/colt/TuR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eScience/TauferDTWDPSWCE19,
author = {Michela Taufer and
Ewa Deelman and
Stephen Thomas and
Michael R. Wyatt II and
Tu Mai Anh Do and
Lo{\"{\i}}c Pottier and
Rafael Ferreira da Silva and
Harel Weinstein and
Michel A. Cuendet and
Trilce Estrada},
title = {Characterizing In Situ and In Transit Analytics of Molecular Dynamics
Simulations for Next-Generation Supercomputers},
booktitle = {15th International Conference on eScience, eScience 2019, San Diego,
CA, USA, September 24-27, 2019},
pages = {188--198},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/eScience.2019.00027},
doi = {10.1109/ESCIENCE.2019.00027},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eScience/TauferDTWDPSWCE19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/BraunPTW19,
author = {G{\'{a}}bor Braun and
Sebastian Pokutta and
Dan Tu and
Stephen J. Wright},
editor = {Kamalika Chaudhuri and
Ruslan Salakhutdinov},
title = {Blended Conditonal Gradients},
booktitle = {Proceedings of the 36th International Conference on Machine Learning,
{ICML} 2019, 9-15 June 2019, Long Beach, California, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {97},
pages = {735--743},
publisher = {{PMLR}},
year = {2019},
url = {http://proceedings.mlr.press/v97/braun19a.html},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icml/BraunPTW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/KlunderHTKNHKFF19,
author = {Jil Kl{\"{u}}nder and
Regina Hebig and
Paolo Tell and
Marco Kuhrmann and
Joyce Nakatumba{-}Nabende and
Rogardt Heldal and
Stephan Krusche and
Masud Fazal{-}Baqaie and
Michael Felderer and
Marcela Fabiana Genero Bocco and
Steffen K{\"{u}}pper and
Sherlock A. Licorish and
Gustavo L{\'{o}}pez and
Fergal McCaffery and
{\"{O}}zden {\"{O}}zcan Top and
Christian R. Prause and
Rafael Prikladnicki and
Eray T{\"{u}}z{\"{u}}n and
Dietmar Pfahl and
Kurt Schneider and
Stephen G. MacDonell},
editor = {Helen Sharp and
Mike Whalen},
title = {Catching up with method and process practice: an industry-informed
baseline for researchers},
booktitle = {Proceedings of the 41st International Conference on Software Engineering:
Software Engineering in Practice, {ICSE} {(SEIP)} 2019, Montreal,
QC, Canada, May 25-31, 2019},
pages = {255--264},
publisher = {{IEEE} / {ACM}},
year = {2019},
url = {https://doi.org/10.1109/ICSE-SEIP.2019.00036},
doi = {10.1109/ICSE-SEIP.2019.00036},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icse/KlunderHTKNHKFF19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ideal/ShepperdGLACCDS19,
author = {Martin J. Shepperd and
Yuchen Guo and
Ning Li and
Mahir Arzoky and
Andrea Capiluppi and
Steve Counsell and
Giuseppe Destefanis and
Stephen Swift and
Allan Tucker and
Leila Yousefi},
editor = {Hujun Yin and
David Camacho and
Peter Ti{\~{n}}o and
Antonio J. Tall{\'{o}}n{-}Ballesteros and
Ronaldo Menezes and
Richard Allmendinger},
title = {The Prevalence of Errors in Machine Learning Experiments},
booktitle = {Intelligent Data Engineering and Automated Learning - {IDEAL} 2019
- 20th International Conference, Manchester, UK, November 14-16, 2019,
Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {11871},
pages = {102--109},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-33607-3\_12},
doi = {10.1007/978-3-030-33607-3\_12},
timestamp = {Thu, 08 Oct 2020 17:51:06 +0200},
biburl = {https://dblp.org/rec/conf/ideal/ShepperdGLACCDS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/KennedyDBTPCBSG19,
author = {Michael Peter Kennedy and
Yann Donnelly and
James Breslin and
Stefano Tulisi and
Sanganagouda Patil and
Ciaran Curtin and
Stephen Brookes and
Brian Shelly and
Patrick Griffin and
Michael Keaveney},
title = {4.48GHz 0.18{\(\mu\)}m SiGe BiCMOS Exact-Frequency Fractional-N Frequency
Synthesizer with Spurious-Tone Suppression Yielding a -80dBc In-Band
Fractional Spur},
booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2019,
San Francisco, CA, USA, February 17-21, 2019},
pages = {272--274},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISSCC.2019.8662327},
doi = {10.1109/ISSCC.2019.8662327},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/KennedyDBTPCBSG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nanocom/McGuinessGTM19,
author = {Daniel Tun{\c{c}} McGuiness and
Stamatios Giannoukos and
Stephen Taylor and
Alan Marshall},
title = {Experimental Study of the Flush Dynamics of Macro-Scale Molecular
Communications},
booktitle = {Proceedings of the Sixth Annual {ACM} International Conference on
Nanoscale Computing and Communication, {NANOCOM} 2019, Dublin, Ireland,
September 25-27, 2019},
pages = {35:1--35:2},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3345312.3345489},
doi = {10.1145/3345312.3345489},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nanocom/McGuinessGTM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/KrauthTR19,
author = {Karl Krauth and
Stephen Tu and
Benjamin Recht},
editor = {Hanna M. Wallach and
Hugo Larochelle and
Alina Beygelzimer and
Florence d'Alch{\'{e}}{-}Buc and
Emily B. Fox and
Roman Garnett},
title = {Finite-time Analysis of Approximate Policy Iteration for the Linear
Quadratic Regulator},
booktitle = {Advances in Neural Information Processing Systems 32: Annual Conference
on Neural Information Processing Systems 2019, NeurIPS 2019, December
8-14, 2019, Vancouver, BC, Canada},
pages = {8512--8522},
year = {2019},
url = {https://proceedings.neurips.cc/paper/2019/hash/aaebdb8bb6b0e73f6c3c54a0ab0c6415-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/KrauthTR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ManiaTR19,
author = {Horia Mania and
Stephen Tu and
Benjamin Recht},
editor = {Hanna M. Wallach and
Hugo Larochelle and
Alina Beygelzimer and
Florence d'Alch{\'{e}}{-}Buc and
Emily B. Fox and
Roman Garnett},
title = {Certainty Equivalence is Efficient for Linear Quadratic Control},
booktitle = {Advances in Neural Information Processing Systems 32: Annual Conference
on Neural Information Processing Systems 2019, NeurIPS 2019, December
8-14, 2019, Vancouver, BC, Canada},
pages = {10154--10164},
year = {2019},
url = {https://proceedings.neurips.cc/paper/2019/hash/5dbc8390f17e019d300d5a162c3ce3bc-Abstract.html},
timestamp = {Thu, 21 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/ManiaTR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rfidta/TurkiZHBPYBH19,
author = {Badredin Turki and
M. Ali Ziai and
Aaron J. R. Hillier and
Kate Belsey and
Adam Parry and
Stephen G. Yeates and
John C. Batchelor and
Simon J. Holder},
title = {Chemical Vapor Detecting Passive {RFID} Tag},
booktitle = {{IEEE} International Conference on {RFID} Technology and Applications,
{RFID-TA} 2019, Pisa, Italy, September 25-27, 2019},
pages = {113--115},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/RFID-TA.2019.8892161},
doi = {10.1109/RFID-TA.2019.8892161},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/rfidta/TurkiZHBPYBH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sdm/LiCGLCG19,
author = {Dongsheng Li and
Chao Chen and
Zhilin Gong and
Tun Lu and
Stephen M. Chu and
Ning Gu},
editor = {Tanya Y. Berger{-}Wolf and
Nitesh V. Chawla},
title = {Collaborative Filtering with Noisy Ratings},
booktitle = {Proceedings of the 2019 {SIAM} International Conference on Data Mining,
{SDM} 2019, Calgary, Alberta, Canada, May 2-4, 2019},
pages = {747--755},
publisher = {{SIAM}},
year = {2019},
url = {https://doi.org/10.1137/1.9781611975673.84},
doi = {10.1137/1.9781611975673.84},
timestamp = {Sat, 21 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sdm/LiCGLCG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1902-03585,
author = {Huazhu Fu and
Yanwu Xu and
Stephen Lin and
Damon Wing Kee Wong and
Mani Baskaran and
Meenakshi Mahesh and
Tin Aung and
Jiang Liu},
title = {Angle-Closure Detection in Anterior Segment {OCT} based on Multi-Level
Deep Network},
journal = {CoRR},
volume = {abs/1902.03585},
year = {2019},
url = {http://arxiv.org/abs/1902.03585},
eprinttype = {arXiv},
eprint = {1902.03585},
timestamp = {Thu, 19 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1902-03585.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1902-04820,
author = {Nicolas S. Holliman and
Manu Antony and
James Charlton and
Stephen Dowsland and
Philip James and
Mark Turner},
title = {Petascale Cloud Supercomputing for Terapixel Visualization of a Digital
Twin},
journal = {CoRR},
volume = {abs/1902.04820},
year = {2019},
url = {http://arxiv.org/abs/1902.04820},
eprinttype = {arXiv},
eprint = {1902.04820},
timestamp = {Thu, 20 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1902-04820.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1902-07826,
author = {Horia Mania and
Stephen Tu and
Benjamin Recht},
title = {Certainty Equivalent Control of {LQR} is Efficient},
journal = {CoRR},
volume = {abs/1902.07826},
year = {2019},
url = {http://arxiv.org/abs/1902.07826},
eprinttype = {arXiv},
eprint = {1902.07826},
timestamp = {Tue, 21 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1902-07826.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1903-11441,
author = {Daniel Ahlin and
Boris Bauermeister and
Jan Conrad and
Robert W. Gardner and
Luca Grandi and
Benedikt Riedel and
Evan Shockley and
Judith Stephen and
Ragnar Sundblad and
Suchandra Thapa and
Christopher D. Tunnell},
title = {The {XENON1T} Data Distribution and Processing Scheme},
journal = {CoRR},
volume = {abs/1903.11441},
year = {2019},
url = {http://arxiv.org/abs/1903.11441},
eprinttype = {arXiv},
eprint = {1903.11441},
timestamp = {Fri, 13 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1903-11441.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1904-12017,
author = {Jonathan Tuck and
Shane T. Barratt and
Stephen P. Boyd},
title = {A Distributed Method for Fitting Laplacian Regularized Stratified
Models},
journal = {CoRR},
volume = {abs/1904.12017},
year = {2019},
url = {http://arxiv.org/abs/1904.12017},
eprinttype = {arXiv},
eprint = {1904.12017},
timestamp = {Mon, 09 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1904-12017.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1905-12842,
author = {Karl Krauth and
Stephen Tu and
Benjamin Recht},
title = {Finite-time Analysis of Approximate Policy Iteration for the Linear
Quadratic Regulator},
journal = {CoRR},
volume = {abs/1905.12842},
year = {2019},
url = {http://arxiv.org/abs/1905.12842},
eprinttype = {arXiv},
eprint = {1905.12842},
timestamp = {Mon, 03 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1905-12842.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1906-11392,
author = {Nikolai Matni and
Alexandre Prouti{\`{e}}re and
Anders Rantzer and
Stephen Tu},
title = {From self-tuning regulators to reinforcement learning and back again},
journal = {CoRR},
volume = {abs/1906.11392},
year = {2019},
url = {http://arxiv.org/abs/1906.11392},
eprinttype = {arXiv},
eprint = {1906.11392},
timestamp = {Mon, 01 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1906-11392.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1906-11395,
author = {Nikolai Matni and
Stephen Tu},
title = {A Tutorial on Concentration Bounds for System Identification},
journal = {CoRR},
volume = {abs/1906.11395},
year = {2019},
url = {http://arxiv.org/abs/1906.11395},
eprinttype = {arXiv},
eprint = {1906.11395},
timestamp = {Mon, 01 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1906-11395.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-04436,
author = {Martin J. Shepperd and
Yuchen Guo and
Ning Li and
Mahir Arzoky and
Andrea Capiluppi and
Steve Counsell and
Giuseppe Destefanis and
Stephen Swift and
Allan Tucker and
Leila Yousefi},
title = {The Prevalence of Errors in Machine Learning Experiments},
journal = {CoRR},
volume = {abs/1909.04436},
year = {2019},
url = {http://arxiv.org/abs/1909.04436},
eprinttype = {arXiv},
eprint = {1909.04436},
timestamp = {Thu, 01 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-04436.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-12474,
author = {Yossi Bokor and
Daniel Grixti{-}Cheng and
Markus Hegland and
Stephen G. Roberts and
Katharine Turner},
title = {Stratified Space Learning: Reconstructing Embedded Graphs},
journal = {CoRR},
volume = {abs/1909.12474},
year = {2019},
url = {http://arxiv.org/abs/1909.12474},
eprinttype = {arXiv},
eprint = {1909.12474},
timestamp = {Sat, 23 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-12474.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1911-07929,
author = {Jessica Velasco and
Cherry Pascion and
Jean Wilmar Alberio and
Jonathan Apuang and
John Stephen Cruz and
Mark Angelo Gomez and
Benjamin Molina Jr. and
Lyndon Tuala and
August Thio{-}ac and
Romeo Jorda Jr.},
title = {A Smartphone-Based Skin Disease Classification Using MobileNet {CNN}},
journal = {CoRR},
volume = {abs/1911.07929},
year = {2019},
url = {http://arxiv.org/abs/1911.07929},
eprinttype = {arXiv},
eprint = {1911.07929},
timestamp = {Mon, 02 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1911-07929.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1912-02975,
author = {Xingyou Song and
Yiding Jiang and
Stephen Tu and
Yilun Du and
Behnam Neyshabur},
title = {Observational Overfitting in Reinforcement Learning},
journal = {CoRR},
volume = {abs/1912.02975},
year = {2019},
url = {http://arxiv.org/abs/1912.02975},
eprinttype = {arXiv},
eprint = {1912.02975},
timestamp = {Thu, 02 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1912-02975.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/McGuinessGMT18,
author = {Daniel Tunc McGuiness and
Stamatios Giannoukos and
Alan Marshall and
Stephen Taylor},
title = {Parameter Analysis in Macro-Scale Molecular Communications Using Advection-Diffusion},
journal = {{IEEE} Access},
volume = {6},
pages = {46706--46717},
year = {2018},
url = {https://doi.org/10.1109/ACCESS.2018.2866679},
doi = {10.1109/ACCESS.2018.2866679},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/McGuinessGMT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/AmatoBCKKKLRO0T18,
author = {Christopher Amato and
Haitham Bou{-}Ammar and
Elizabeth F. Churchill and
Erez Karpas and
Takashi Kido and
Mike Kuniavsky and
William F. Lawless and
Francesca Rossi and
Frans A. Oliehoek and
Stephen Russell and
Keiki Takadama and
Siddharth Srivastava and
Karl Tuyls and
Philip van Allen and
Kristen Brent Venable and
Peter Vrancx and
Shiqi Zhang},
title = {Reports on the 2018 {AAAI} Spring Symposium Series},
journal = {{AI} Mag.},
volume = {39},
number = {4},
pages = {29--35},
year = {2018},
url = {https://doi.org/10.1609/aimag.v39i4.2824},
doi = {10.1609/AIMAG.V39I4.2824},
timestamp = {Tue, 23 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aim/AmatoBCKKKLRO0T18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/LinHCTSPEEKOBMG18,
author = {Hui{-}Yi Lin and
Po{-}Yu Huang and
Dung{-}Tsa Chen and
Heng{-}Yuan Tung and
Thomas A. Sellers and
Julio M. Pow{-}Sang and
Rosalind A. Eeles and
Doug Easton and
Zsofia Kote{-}Jarai and
Ali Amin Al Olama and
Sara Benlloch and
Kenneth Muir and
Graham G. Giles and
Fredrik Wiklund and
Henrik Gronberg and
Christopher A. Haiman and
Johanna Schleutker and
B{\o}rge G. Nordestgaard and
Ruth C. Travis and
Freddie Hamdy and
David E. Neal and
Nora Pashayan and
Kay{-}Tee Khaw and
Janet L. Stanford and
William J. Blot and
Stephen N. Thibodeau and
Christiane Maier and
Adam S. Kibel and
Cezary Cybulski and
Lisa A. Cannon{-}Albright and
Hermann Brenner and
Radka Kaneva and
Jyotsna Batra and
Manuel R. Teixeira and
Hardev Pandha and
Yong{-}Jie Lu and
The PRACTICAL Consortium and
Jong Y. Park},
title = {AA9int: {SNP} interaction pattern search using non-hierarchical additive
model set},
journal = {Bioinform.},
volume = {34},
number = {24},
pages = {4141--4150},
year = {2018},
url = {https://doi.org/10.1093/bioinformatics/bty461},
doi = {10.1093/BIOINFORMATICS/BTY461},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/LinHCTSPEEKOBMG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cce/BankoleJBTZ18,
author = {Temitayo Bankole and
Dustin Jones and
Debangsu Bhattacharyya and
Richard Turton and
Stephen E. Zitney},
title = {Optimal scheduling and its Lyapunov stability for advanced load-following
energy plants with CO\({}_{\mbox{2}}\) capture},
journal = {Comput. Chem. Eng.},
volume = {109},
pages = {30--47},
year = {2018},
url = {https://doi.org/10.1016/j.compchemeng.2017.10.025},
doi = {10.1016/J.COMPCHEMENG.2017.10.025},
timestamp = {Mon, 18 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cce/BankoleJBTZ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cgf/ZhaoCT18,
author = {Mingbi Zhao and
Wentong Cai and
Stephen John Turner},
title = {{CLUST:} Simulating Realistic Crowd Behaviour by Mining Pattern from
Crowd Videos},
journal = {Comput. Graph. Forum},
volume = {37},
number = {1},
pages = {184--201},
year = {2018},
url = {https://doi.org/10.1111/cgf.13259},
doi = {10.1111/CGF.13259},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cgf/ZhaoCT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/data/MakoninWT18,
author = {Stephen Makonin and
Z. Jane Wang and
Chris Tumpach},
title = {{RAE:} The Rainforest Automation Energy Dataset for Smart Grid Meter
Data Analysis},
journal = {Data},
volume = {3},
number = {1},
pages = {8},
year = {2018},
url = {https://doi.org/10.3390/data3010008},
doi = {10.3390/DATA3010008},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/data/MakoninWT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/icl/McGuinessGMT18,
author = {Daniel Tunc McGuiness and
Stamatios Giannoukos and
Alan Marshall and
Stephen Taylor},
title = {Experimental Results on the Open-Air Transmission of Macro-Molecular
Communication Using Membrane Inlet Mass Spectrometry},
journal = {{IEEE} Commun. Lett.},
volume = {22},
number = {12},
pages = {2567--2570},
year = {2018},
url = {https://doi.org/10.1109/LCOMM.2018.2875445},
doi = {10.1109/LCOMM.2018.2875445},
timestamp = {Thu, 20 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/icl/McGuinessGMT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/ValentaBBDEFGGJ18,
author = {Annette L. Valenta and
Eta S. Berner and
Suzanne Austin Boren and
Gloria J. Deckard and
Christina Eldredge and
Douglas B. Fridsma and
Cynthia S. Gadd and
Yang Gong and
Todd R. Johnson and
Josette Jones and
E. LaVerne Manos and
Kirk T. Phillips and
Nancy K. Roderer and
Douglas Rosendale and
Anne M. Turner and
G{\"{u}}nter Tusch and
Jeffrey J. Williamson and
Stephen B. Johnson},
title = {{AMIA} Board White Paper: {AMIA} 2017 core competencies for applied
health informatics education at the master's degree level},
journal = {J. Am. Medical Informatics Assoc.},
volume = {25},
number = {12},
pages = {1657--1668},
year = {2018},
url = {https://doi.org/10.1093/jamia/ocy132},
doi = {10.1093/JAMIA/OCY132},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jamia/ValentaBBDEFGGJ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jeric/TurnerPE18,
author = {Scott Alexander Turner and
Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and
Stephen H. Edwards},
title = {Peer Review in {CS2:} Conceptual Learning and High-Level Thinking},
journal = {{ACM} Trans. Comput. Educ.},
volume = {18},
number = {3},
pages = {13:1--13:37},
year = {2018},
url = {https://doi.org/10.1145/3152715},
doi = {10.1145/3152715},
timestamp = {Fri, 06 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jeric/TurnerPE18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/TanakitkornWTP18,
author = {Kantapon Tanakitkorn and
Philip A. Wilson and
Stephen R. Turnock and
Alexander B. Phillips},
title = {Sliding mode heading control of an overactuated, hover-capable autonomous
underwater vehicle with experimental verification},
journal = {J. Field Robotics},
volume = {35},
number = {3},
pages = {396--415},
year = {2018},
url = {https://doi.org/10.1002/rob.21766},
doi = {10.1002/ROB.21766},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfr/TanakitkornWTP18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jossw/Turner18,
author = {Stephen D. Turner},
title = {qqman: an {R} package for visualizing {GWAS} results using {Q-Q} and
manhattan plots},
journal = {J. Open Source Softw.},
volume = {3},
number = {25},
pages = {731},
year = {2018},
url = {https://doi.org/10.21105/joss.00731},
doi = {10.21105/JOSS.00731},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jossw/Turner18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neco/VerziRPQMVJA18,
author = {Stephen J. Verzi and
Fredrick H. Rothganger and
Ojas Parekh and
Tu{-}Thach Quach and
Nadine E. Miner and
Craig M. Vineyard and
Conrad D. James and
James B. Aimone},
title = {Computing with Spikes: The Advantage of Fine-Grained Timing},
journal = {Neural Comput.},
volume = {30},
number = {10},
year = {2018},
url = {https://doi.org/10.1162/neco\_a\_01113},
doi = {10.1162/NECO\_A\_01113},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neco/VerziRPQMVJA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/AllozaCCRWRMHTL18,
author = {Clara Alloza and
Simon R. Cox and
Manuel Blesa Cabez and
Paul Redmond and
Heather Whalley and
Stuart J. Ritchie and
Susana Mu{\~{n}}oz Maniega and
Maria del C. Vald{\'{e}}s Hern{\'{a}}ndez and
Elliot Tucker{-}Drob and
Stephen M. Lawrie and
Joanna M. Wardlaw and
Ian J. Deary and
Mark E. Bastin},
title = {Polygenic risk score for schizophrenia and structural brain connectivity
in older age: {A} longitudinal connectome and tractography study},
journal = {NeuroImage},
volume = {183},
pages = {884--896},
year = {2018},
url = {https://doi.org/10.1016/j.neuroimage.2018.08.075},
doi = {10.1016/J.NEUROIMAGE.2018.08.075},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/AllozaCCRWRMHTL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/RobinsonGGCCMBW18,
author = {Emma C. Robinson and
Kara Garcia and
Matthew F. Glasser and
Zhengdao Chen and
Timothy S. Coalson and
Antonios Makropoulos and
Jelena Bozek and
Robert Wright and
Andreas Schuh and
Matthew A. Webster and
Jana Hutter and
Anthony Price and
Lucilio Cordero{-}Grande and
Emer J. Hughes and
Nora Tusor and
Philip V. Bayly and
David C. Van Essen and
Stephen M. Smith and
Daniel Rueckert},
title = {Multimodal surface matching with higher-order smoothness constraints},
journal = {NeuroImage},
volume = {167},
pages = {453--465},
year = {2018},
url = {https://doi.org/10.1016/j.neuroimage.2017.10.037},
doi = {10.1016/J.NEUROIMAGE.2017.10.037},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/RobinsonGGCCMBW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/YangMFGHWTGBT18,
author = {Kai Yang and
Katie L. Meadmore and
Chris T. Freeman and
Neil J. Grabham and
Ann{-}Marie Hughes and
Yang Wei and
Russel N. Torah and
Monika Glanc{-}Gostkiewicz and
Steve P. Beeby and
John Tudor},
title = {Development of User-Friendly Wearable Electronic Textiles for Healthcare
Applications},
journal = {Sensors},
volume = {18},
number = {8},
pages = {2410},
year = {2018},
url = {https://doi.org/10.3390/s18082410},
doi = {10.3390/S18082410},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/YangMFGHWTGBT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tci/EldalyAPKCDM18,
author = {Ahmed Karam Eldaly and
Yoann Altmann and
Antonios Perperidis and
Nikola Krstajic and
Tushar Choudhary and
Kevin Dhaliwal and
Steve McLaughlin},
title = {Deconvolution and Restoration of Optical Endomicroscopy Images},
journal = {{IEEE} Trans. Computational Imaging},
volume = {4},
number = {2},
pages = {194--205},
year = {2018},
url = {https://doi.org/10.1109/TCI.2018.2811939},
doi = {10.1109/TCI.2018.2811939},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tci/EldalyAPKCDM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/TuSVEWHPPYWP18,
author = {Liyun Tu and
Martin Styner and
Jared Vicory and
Shireen Y. Elhabian and
Rui Wang and
Jun{-}Pyo Hong and
Beatriz Paniagua and
Juan{-}Carlos Prieto and
Dan Yang and
Ross T. Whitaker and
Stephen M. Pizer},
title = {Skeletal Shape Correspondence Through Entropy},
journal = {{IEEE} Trans. Medical Imaging},
volume = {37},
number = {1},
pages = {1--11},
year = {2018},
url = {https://doi.org/10.1109/TMI.2017.2755550},
doi = {10.1109/TMI.2017.2755550},
timestamp = {Thu, 06 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmi/TuSVEWHPPYWP18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/TuBR18,
author = {Stephen Tu and
Ross Boczar and
Benjamin Recht},
title = {On the Approximation of Toeplitz Operators for Nonparametric H\({}_{\mbox{{\(\infty\)}}}\)-norm
Estimation},
booktitle = {2018 Annual American Control Conference, {ACC} 2018, Milwaukee, WI,
USA, June 27-29, 2018},
pages = {1867--1872},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.23919/ACC.2018.8431846},
doi = {10.23919/ACC.2018.8431846},
timestamp = {Sun, 08 Aug 2021 01:40:57 +0200},
biburl = {https://dblp.org/rec/conf/amcc/TuBR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atal/AlanLSPRWTR18,
author = {Alper Turan Alan and
Chang Liu and
Elliot Salisbury and
Stephen D. Prior and
Sarvapali D. Ramchurn and
Feng Wu and
Kerry Tatlock and
Gareth Rees},
editor = {Elisabeth Andr{\'{e}} and
Sven Koenig and
Mehdi Dastani and
Gita Sukthankar},
title = {Human-UAV Teaming in Dynamic and Uncertain Environments},
booktitle = {Proceedings of the 17th International Conference on Autonomous Agents
and MultiAgent Systems, {AAMAS} 2018, Stockholm, Sweden, July 10-15,
2018},
pages = {1791--1793},
publisher = {International Foundation for Autonomous Agents and Multiagent Systems
Richland, SC, {USA} / {ACM}},
year = {2018},
url = {http://dl.acm.org/citation.cfm?id=3237979},
timestamp = {Sat, 30 Sep 2023 09:34:53 +0200},
biburl = {https://dblp.org/rec/conf/atal/AlanLSPRWTR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibm/YousefiSASCT18,
author = {Leila Yousefi and
Stephen Swift and
Mahir Arzoky and
Lucia Sacchi and
Luca Chiovato and
Allan Tucker},
editor = {Huiru Jane Zheng and
Zoraida Callejas and
David Griol and
Haiying Wang and
Xiaohua Hu and
Harald H. H. W. Schmidt and
Jan Baumbach and
Julie Dickerson and
Le Zhang},
title = {Opening the Black Box: Discovering and Explaining Hidden Variables
in Type 2 Diabetic Patient Modelling},
booktitle = {{IEEE} International Conference on Bioinformatics and Biomedicine,
{BIBM} 2018, Madrid, Spain, December 3-6, 2018},
pages = {1040--1044},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.ieeecomputersociety.org/10.1109/BIBM.2018.8621484},
doi = {10.1109/BIBM.2018.8621484},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bibm/YousefiSASCT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccece/CatafordGTB18,
author = {Andrew Cataford and
S. Andrew Gadsden and
Kevin Turpie and
Mohammad Biglarbegian},
title = {Air-LUSI: Estimation, Filtering, and {PID} Tracking Simulation},
booktitle = {2018 {IEEE} Canadian Conference on Electrical {\&} Computer Engineering,
{CCECE} 2018, Quebec, QC, Canada, May 13-16, 2018},
pages = {1--6},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/CCECE.2018.8447850},
doi = {10.1109/CCECE.2018.8447850},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/ccece/CatafordGTB18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/TurnerP0CTFGZSN18,
author = {Walker J. Turner and
John W. Poulton and
John M. Wilson and
Xi Chen and
Stephen G. Tell and
Matthew Fojtik and
Thomas H. Greer and
Brian Zimmer and
Sanquan Song and
Nikola Nedovic and
Sudhir S. Kudva and
Sunil R. Sudhakaran and
Rizwan Bashirullah and
Wenxu Zhao and
William J. Dally and
C. Thomas Gray},
title = {Ground-referenced signaling for intra-chip and short-reach chip-to-chip
interconnects},
booktitle = {2018 {IEEE} Custom Integrated Circuits Conference, {CICC} 2018, San
Diego, CA, USA, April 8-11, 2018},
pages = {1--8},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/CICC.2018.8357077},
doi = {10.1109/CICC.2018.8357077},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cicc/TurnerP0CTFGZSN18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/colt/SimchowitzMTJR18,
author = {Max Simchowitz and
Horia Mania and
Stephen Tu and
Michael I. Jordan and
Benjamin Recht},
editor = {S{\'{e}}bastien Bubeck and
Vianney Perchet and
Philippe Rigollet},
title = {Learning Without Mixing: Towards {A} Sharp Analysis of Linear System
Identification},
booktitle = {Conference On Learning Theory, {COLT} 2018, Stockholm, Sweden, 6-9
July 2018},
series = {Proceedings of Machine Learning Research},
volume = {75},
pages = {439--473},
publisher = {{PMLR}},
year = {2018},
url = {http://proceedings.mlr.press/v75/simchowitz18a.html},
timestamp = {Wed, 03 Apr 2019 18:17:23 +0200},
biburl = {https://dblp.org/rec/conf/colt/SimchowitzMTJR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/CaoLLLTC18,
author = {Kris Cao and
Angeliki Lazaridou and
Marc Lanctot and
Joel Z. Leibo and
Karl Tuyls and
Stephen Clark},
title = {Emergent Communication through Negotiation},
booktitle = {6th International Conference on Learning Representations, {ICLR} 2018,
Vancouver, BC, Canada, April 30 - May 3, 2018, Conference Track Proceedings},
publisher = {OpenReview.net},
year = {2018},
url = {https://openreview.net/forum?id=Hk6WhagRW},
timestamp = {Thu, 25 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/CaoLLLTC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/LazaridouHTC18,
author = {Angeliki Lazaridou and
Karl Moritz Hermann and
Karl Tuyls and
Stephen Clark},
title = {Emergence of Linguistic Communication from Referential Games with
Symbolic and Pixel Input},
booktitle = {6th International Conference on Learning Representations, {ICLR} 2018,
Vancouver, BC, Canada, April 30 - May 3, 2018, Conference Track Proceedings},
publisher = {OpenReview.net},
year = {2018},
url = {https://openreview.net/forum?id=HJGv1Z-AW},
timestamp = {Thu, 04 Apr 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/LazaridouHTC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/TuR18,
author = {Stephen Tu and
Benjamin Recht},
editor = {Jennifer G. Dy and
Andreas Krause},
title = {Least-Squares Temporal Difference Learning for the Linear Quadratic
Regulator},
booktitle = {Proceedings of the 35th International Conference on Machine Learning,
{ICML} 2018, Stockholmsm{\"{a}}ssan, Stockholm, Sweden, July
10-15, 2018},
series = {Proceedings of Machine Learning Research},
volume = {80},
pages = {5012--5021},
publisher = {{PMLR}},
year = {2018},
url = {http://proceedings.mlr.press/v80/tu18a.html},
timestamp = {Wed, 03 Apr 2019 18:17:30 +0200},
biburl = {https://dblp.org/rec/conf/icml/TuR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/TomaBRG18,
author = {Tudor Toma and
Kaustav Basu and
Wilder Rodrigues and
Stephen J. Galsworthy},
title = {A Deep Learning Based Method for Heat Pump Dryer User Classification},
booktitle = {{IECON} 2018 - 44th Annual Conference of the {IEEE} Industrial Electronics
Society, Washington, DC, USA, October 21-23, 2018},
pages = {3455--3460},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IECON.2018.8591328},
doi = {10.1109/IECON.2018.8591328},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iecon/TomaBRG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/intellisys/AyedASCT18,
author = {Samy Ayed and
Mahir Arzoky and
Stephen Swift and
Steve Counsell and
Allan Tucker},
editor = {Kohei Arai and
Supriya Kapoor and
Rahul Bhatia},
title = {An Exploratory Study of the Inputs for Ensemble Clustering Technique
as a Subset Selection Problem},
booktitle = {Intelligent Systems and Applications - Proceedings of the 2018 Intelligent
Systems Conference, IntelliSys 2018, London, UK, September 6-7, 2018,
Volume 1},
series = {Advances in Intelligent Systems and Computing},
volume = {868},
pages = {1041--1055},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-01054-6\_72},
doi = {10.1007/978-3-030-01054-6\_72},
timestamp = {Mon, 18 Feb 2019 09:18:28 +0100},
biburl = {https://dblp.org/rec/conf/intellisys/AyedASCT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/0002TPZCKSTNZSG18,
author = {John M. Wilson and
Walker J. Turner and
John W. Poulton and
Brian Zimmer and
Xi Chen and
Sudhir S. Kudva and
Sanquan Song and
Stephen G. Tell and
Nikola Nedovic and
Wenxu Zhao and
Sunil R. Sudhakaran and
C. Thomas Gray and
William J. Dally},
title = {A 1.17pJ/b 25Gb/s/pin ground-referenced single-ended serial link for
off- and on-package communication in 16nm {CMOS} using a process-
and temperature-adaptive voltage regulator},
booktitle = {2018 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2018, San Francisco, CA, USA, February 11-15, 2018},
pages = {276--278},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ISSCC.2018.8310291},
doi = {10.1109/ISSCC.2018.8310291},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/0002TPZCKSTNZSG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/FuXLWBMAL18,
author = {Huazhu Fu and
Yanwu Xu and
Stephen Lin and
Damon Wing Kee Wong and
Mani Baskaran and
Meenakshi Mahesh and
Tin Aung and
Jiang Liu},
editor = {Alejandro F. Frangi and
Julia A. Schnabel and
Christos Davatzikos and
Carlos Alberola{-}L{\'{o}}pez and
Gabor Fichtinger},
title = {Multi-context Deep Network for Angle-Closure Glaucoma Screening in
Anterior Segment {OCT}},
booktitle = {Medical Image Computing and Computer Assisted Intervention - {MICCAI}
2018 - 21st International Conference, Granada, Spain, September 16-20,
2018, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {11071},
pages = {356--363},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-00934-2\_40},
doi = {10.1007/978-3-030-00934-2\_40},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miccai/FuXLWBMAL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nanocom/McGuinessMTG18,
author = {Daniel Tunc McGuiness and
Alan Marshall and
Stephen Taylor and
Stamatios Giannoukos},
editor = {J{\'{o}}n Atli Benediktsson and
Falko Dressler},
title = {Asymmetrical inter-symbol interference in macro-scale molecular communications},
booktitle = {Proceedings of the 5th {ACM} International Conference on Nanoscale
Computing and Communication, {NANOCOM} 2018, Reykjavik, Iceland, September
05-07, 2018},
pages = {13:1--13:6},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3233188.3233194},
doi = {10.1145/3233188.3233194},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nanocom/McGuinessMTG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/DeanMMRT18,
author = {Sarah Dean and
Horia Mania and
Nikolai Matni and
Benjamin Recht and
Stephen Tu},
editor = {Samy Bengio and
Hanna M. Wallach and
Hugo Larochelle and
Kristen Grauman and
Nicol{\`{o}} Cesa{-}Bianchi and
Roman Garnett},
title = {Regret Bounds for Robust Adaptive Control of the Linear Quadratic
Regulator},
booktitle = {Advances in Neural Information Processing Systems 31: Annual Conference
on Neural Information Processing Systems 2018, NeurIPS 2018, December
3-8, 2018, Montr{\'{e}}al, Canada},
pages = {4192--4201},
year = {2018},
url = {https://proceedings.neurips.cc/paper/2018/hash/0ae3f79a30234b6c45a6f7d298ba1310-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/DeanMMRT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/LiCLGLSGC18,
author = {Dongsheng Li and
Chao Chen and
Qin Lv and
Hansu Gu and
Tun Lu and
Li Shang and
Ning Gu and
Stephen M. Chu},
editor = {Pierre{-}Antoine Champin and
Fabien Gandon and
Mounia Lalmas and
Panagiotis G. Ipeirotis},
title = {AdaError: An Adaptive Learning Rate Method for Matrix Approximation-based
Collaborative Filtering},
booktitle = {Proceedings of the 2018 World Wide Web Conference on World Wide Web,
{WWW} 2018, Lyon, France, April 23-27, 2018},
pages = {741--751},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3178876.3186155},
doi = {10.1145/3178876.3186155},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/www/LiCLGLSGC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/xsede/Ananthakrishnan18,
author = {Rachana Ananthakrishnan and
Ben Blaiszik and
Kyle Chard and
Ryan Chard and
Brendan McCollam and
Jim Pruyne and
Stephen Rosen and
Steven Tuecke and
Ian T. Foster},
editor = {Sergiu Sanielevici},
title = {Globus Platform Services for Data Publication},
booktitle = {Proceedings of the Practice and Experience on Advanced Research Computing,
{PEARC} 2018, Pittsburgh, PA, USA, July 22-26, 2018},
pages = {14:1--14:7},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3219104.3219127},
doi = {10.1145/3219104.3219127},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/xsede/Ananthakrishnan18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/xsede/RiedelBBCPGGLRS18,
author = {Benedikt Riedel and
Boris Bauermeister and
Lincoln Bryant and
Jan Conrad and
Patrick de Perio and
Robert W. Gardner and
Luca Grandi and
Francesco Lombardi and
Alfio Rizzo and
Gabriella Sartorelli and
Marco Selvi and
Evan Shockley and
Judith Stephen and
Suchandra Thapa and
Christopher D. Tunnell},
editor = {Sergiu Sanielevici},
title = {Distributed Data and Job Management for the {XENON1T} Experiment},
booktitle = {Proceedings of the Practice and Experience on Advanced Research Computing,
{PEARC} 2018, Pittsburgh, PA, USA, July 22-26, 2018},
pages = {9:1--9:8},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3219104.3219155},
doi = {10.1145/3219104.3219155},
timestamp = {Fri, 13 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/xsede/RiedelBBCPGGLRS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/isvc/2018,
editor = {George Bebis and
Richard Boyle and
Bahram Parvin and
Darko Koracin and
Matt Turek and
Srikumar Ramalingam and
Kai Xu and
Stephen Lin and
Bilal Alsallakh and
Jing Yang and
Eduardo Cuervo and
Jonathan Ventura},
title = {Advances in Visual Computing - 13th International Symposium, {ISVC}
2018, Las Vegas, NV, USA, November 19-21, 2018, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {11241},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-03801-4},
doi = {10.1007/978-3-030-03801-4},
isbn = {978-3-030-03800-7},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isvc/2018.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1802-08334,
author = {Max Simchowitz and
Horia Mania and
Stephen Tu and
Michael I. Jordan and
Benjamin Recht},
title = {Learning Without Mixing: Towards {A} Sharp Analysis of Linear System
Identification},
journal = {CoRR},
volume = {abs/1802.08334},
year = {2018},
url = {http://arxiv.org/abs/1802.08334},
eprinttype = {arXiv},
eprint = {1802.08334},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1802-08334.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1803-09166,
author = {Phil Weir and
Roland Ellerweg and
Stephen J. Payne and
Dominic Reuter and
Tuomas Alhonnoro and
Philip Voglreiter and
Panchatcharam Mariappan and
Mika Pollari and
Chang{-}Sub Park and
Peter Voigt and
Tim van Oostenbrugge and
Sebastian Fischer and
Peter Kalmar and
Jurgen J. F{\"{u}}tterer and
Philipp Stiegler and
Stephan Zangos and
Ronan Flanagan and
Michael Moche and
Marina Kolesnik},
title = {Go-Smart: Open-Ended, Web-Based Modelling of Minimally Invasive Cancer
Treatments via a Clinical Domain Approach},
journal = {CoRR},
volume = {abs/1803.09166},
year = {2018},
url = {http://arxiv.org/abs/1803.09166},
eprinttype = {arXiv},
eprint = {1803.09166},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1803-09166.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1804-03980,
author = {Kris Cao and
Angeliki Lazaridou and
Marc Lanctot and
Joel Z. Leibo and
Karl Tuyls and
Stephen Clark},
title = {Emergent Communication through Negotiation},
journal = {CoRR},
volume = {abs/1804.03980},
year = {2018},
url = {http://arxiv.org/abs/1804.03980},
eprinttype = {arXiv},
eprint = {1804.03980},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1804-03980.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1804-03984,
author = {Angeliki Lazaridou and
Karl Moritz Hermann and
Karl Tuyls and
Stephen Clark},
title = {Emergence of Linguistic Communication from Referential Games with
Symbolic and Pixel Input},
journal = {CoRR},
volume = {abs/1804.03984},
year = {2018},
url = {http://arxiv.org/abs/1804.03984},
eprinttype = {arXiv},
eprint = {1804.03984},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1804-03984.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1804-04878,
author = {Vikas Sindhwani and
Stephen Tu and
Mohi Khansari},
title = {Learning Contracting Vector Fields For Stable Imitation Learning},
journal = {CoRR},
volume = {abs/1804.04878},
year = {2018},
url = {http://arxiv.org/abs/1804.04878},
eprinttype = {arXiv},
eprint = {1804.04878},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1804-04878.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-07311,
author = {G{\'{a}}bor Braun and
Sebastian Pokutta and
Dan Tu and
Stephen J. Wright},
title = {Blended Conditional Gradients: the unconditioning of conditional gradients},
journal = {CoRR},
volume = {abs/1805.07311},
year = {2018},
url = {http://arxiv.org/abs/1805.07311},
eprinttype = {arXiv},
eprint = {1805.07311},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-07311.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-09388,
author = {Sarah Dean and
Horia Mania and
Nikolai Matni and
Benjamin Recht and
Stephen Tu},
title = {Regret Bounds for Robust Adaptive Control of the Linear Quadratic
Regulator},
journal = {CoRR},
volume = {abs/1805.09388},
year = {2018},
url = {http://arxiv.org/abs/1805.09388},
eprinttype = {arXiv},
eprint = {1805.09388},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-09388.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-03239,
author = {Huazhu Fu and
Yanwu Xu and
Stephen Lin and
Damon Wing Kee Wong and
Mani Baskaran and
Meenakshi Mahesh and
Tin Aung and
Jiang Liu},
title = {Multi-Context Deep Network for Angle-Closure Glaucoma Screening in
Anterior Segment {OCT}},
journal = {CoRR},
volume = {abs/1809.03239},
year = {2018},
url = {http://arxiv.org/abs/1809.03239},
eprinttype = {arXiv},
eprint = {1809.03239},
timestamp = {Thu, 19 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1809-03239.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-10121,
author = {Sarah Dean and
Stephen Tu and
Nikolai Matni and
Benjamin Recht},
title = {Safely Learning to Control the Constrained Linear Quadratic Regulator},
journal = {CoRR},
volume = {abs/1809.10121},
year = {2018},
url = {http://arxiv.org/abs/1809.10121},
eprinttype = {arXiv},
eprint = {1809.10121},
timestamp = {Fri, 05 Oct 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1809-10121.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-10855,
author = {Stephen Tu and
Ross Boczar and
Benjamin Recht},
title = {Minimax Lower Bounds for {\(\mathscr{H}\)}\({}_{\mbox{{\(\infty\)}}}\)-Norm
Estimation},
journal = {CoRR},
volume = {abs/1809.10855},
year = {2018},
url = {http://arxiv.org/abs/1809.10855},
eprinttype = {arXiv},
eprint = {1809.10855},
timestamp = {Fri, 05 Oct 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1809-10855.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-07011,
author = {Octavio Narvaez{-}Aroche and
Pierre{-}Jean Meyer and
Stephen Tu and
Andrew K. Packard and
Murat Arcak},
title = {Robust Control of the Sit-to-Stand Movement for a Powered Lower Limb
Orthosis},
journal = {CoRR},
volume = {abs/1811.07011},
year = {2018},
url = {http://arxiv.org/abs/1811.07011},
eprinttype = {arXiv},
eprint = {1811.07011},
timestamp = {Fri, 30 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1811-07011.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1812-03565,
author = {Stephen Tu and
Benjamin Recht},
title = {The Gap Between Model-Based and Model-Free Methods on the Linear Quadratic
Regulator: An Asymptotic Viewpoint},
journal = {CoRR},
volume = {abs/1812.03565},
year = {2018},
url = {http://arxiv.org/abs/1812.03565},
eprinttype = {arXiv},
eprint = {1812.03565},
timestamp = {Tue, 01 Jan 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1812-03565.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aci/MalmasiSHGST17,
author = {Shervin Malmasi and
Nicolae L. Sandor and
Naoshi Hosomura and
Matt Goldberg and
Stephen Skentzos and
Alexander Turchin},
title = {Canary: An {NLP} Platform for Clinicians and Researchers},
journal = {Appl. Clin. Inform.},
volume = {08},
number = {02},
pages = {447--453},
year = {2017},
url = {https://doi.org/10.4338/aci-2017-01-ie-0018},
doi = {10.4338/ACI-2017-01-IE-0018},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aci/MalmasiSHGST17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/CannonYMUMWSJSB17,
author = {Daniel Cannon and
Jeremy J. Yang and
Stephen L. Mathias and
Oleg Ursu and
Subramani Mani and
Anna Waller and
Stephan C. Sch{\"{u}}rer and
Lars Juhl Jensen and
Larry A. Sklar and
Cristian Bologa and
Tudor I. Oprea},
title = {{TIN-X:} target importance and novelty explorer},
journal = {Bioinform.},
volume = {33},
number = {16},
pages = {2601--2603},
year = {2017},
url = {https://doi.org/10.1093/bioinformatics/btx200},
doi = {10.1093/BIOINFORMATICS/BTX200},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/CannonYMUMWSJSB17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biomedsem/LinMKTVFKNJGMUS17,
author = {Yu Lin and
Saurabh Mehta and
Hande K{\"{u}}{\c{c}}{\"{u}}k{-}McGinty and
John Paul Turner and
Dusica Vidovic and
Michele Forlin and
Amar Koleti and
Dac{-}Trung Nguyen and
Lars Juhl Jensen and
Rajarshi Guha and
Stephen L. Mathias and
Oleg Ursu and
Vasileios Stathias and
Jianbin Duan and
Nooshin Nabizadeh and
Caty Chung and
Christopher Mader and
Ubbo Visser and
Jeremy J. Yang and
Cristian Bologa and
Tudor I. Oprea and
Stephan C. Sch{\"{u}}rer},
title = {Drug target ontology to classify and integrate drug discovery data},
journal = {J. Biomed. Semant.},
volume = {8},
number = {1},
pages = {50:1--50:16},
year = {2017},
url = {https://doi.org/10.1186/s13326-017-0161-x},
doi = {10.1186/S13326-017-0161-X},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/biomedsem/LinMKTVFKNJGMUS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcsb/AquinoHJLHCEHJS17,
author = {Patricia Aquino and
Brent Honda and
Suma Jaini and
Anna Lyubetskaya and
Krutika Hosur and
Joanna G. Chiu and
Iriny Ekladious and
Dongjian Hu and
Lin Jin and
Marianna K. Sayeg and
Arion Stettner and
Julia Wang and
Brandon G. Wong and
Winnie S. Wong and
Stephen L. Alexander and
Cong Ba and
Seth I. Bensussen and
David B. Bernstein and
Dana Braff and
Susie Cha and
Daniel I. Cheng and
Jang{-}Hwan Cho and
Kenny Chou and
James Chuang and
Daniel E. Gastler and
Daniel J. Grasso and
John S. Greifenberger and
Chen Guo and
Anna K. Hawes and
Divya V. Israni and
Saloni R. Jain and
Jessica Kim and
Junyu Lei and
Hao Li and
David Li and
Qian Li and
Christopher P. Mancuso and
Ning Mao and
Salwa F. Masud and
Cari L. Meisel and
Jing Mi and
Christine S. Nykyforchyn and
Minhee Park and
Hannah M. Peterson and
Alfred K. Ramirez and
Daniel S. Reynolds and
Nae Gyune Rim and
Jared C. Saffie and
Hang Su and
Wendell R. Su and
Yaqing Su and
Meng Sun and
Meghan M. Thommes and
Tao Tu and
Nitinun Varongchayakul and
Tyler E. Wagner and
Benjamin H. Weinberg and
Rouhui Yang and
Anastasia Yaroslavsky and
Christine Yoon and
Yanyu Zhao and
Alicia J. Zollinger and
Anne M. Stringer and
John W. Foster and
Joseph Wade and
Sahadaven Raman and
Natasha Broude and
Wilson W. Wong and
James E. Galagan},
title = {Coordinated regulation of acid resistance in Escherichia coli},
journal = {{BMC} Syst. Biol.},
volume = {11},
number = {1},
pages = {1:1--1:15},
year = {2017},
url = {https://doi.org/10.1186/s12918-016-0376-y},
doi = {10.1186/S12918-016-0376-Y},
timestamp = {Wed, 06 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcsb/AquinoHJLHCEHJS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/braininf/HighsmithWTSE17,
author = {Jonathan M. Highsmith and
Karl L. Wuensch and
Tuan Tran and
Alexandra J. Stephenson and
Daniel E. Everhart},
title = {It's not what you expect: feedback negativity is independent of reward
expectation and affective responsivity in a non-probabilistic task},
journal = {Brain Informatics},
volume = {4},
number = {1},
pages = {51--63},
year = {2017},
url = {https://doi.org/10.1007/s40708-016-0050-6},
doi = {10.1007/S40708-016-0050-6},
timestamp = {Wed, 13 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/braininf/HighsmithWTSE17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bspc/NapoliGWTO17,
author = {Alessandro Napoli and
Stephen M. Glassd and
Christian R. Ward and
Carole A. Tucker and
Iyad Obeid},
title = {Performance analysis of a generalized motion capture system using
microsoft kinect 2.0},
journal = {Biomed. Signal Process. Control.},
volume = {38},
pages = {265--280},
year = {2017},
url = {https://doi.org/10.1016/j.bspc.2017.06.006},
doi = {10.1016/J.BSPC.2017.06.006},
timestamp = {Fri, 26 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bspc/NapoliGWTO17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-wss/MrugalaTH17,
author = {Kinga Mrugala and
Nilufer Tuptuk and
Stephen Hailes},
title = {Evolving attackers against wireless sensor networks using genetic
programming},
journal = {{IET} Wirel. Sens. Syst.},
volume = {7},
number = {4},
pages = {113--122},
year = {2017},
url = {https://doi.org/10.1049/iet-wss.2016.0090},
doi = {10.1049/IET-WSS.2016.0090},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iet-wss/MrugalaTH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/NelsonOUBZHYMMT17,
author = {Stuart J. Nelson and
Tudor I. Oprea and
Oleg Ursu and
Cristian Bologa and
Amrapali Zaveri and
Jayme Holmes and
Jeremy J. Yang and
Stephen L. Mathias and
Subramani Mani and
Mark S. Tuttle and
Michel Dumontier},
title = {Formalizing drug indications on the road to therapeutic intent},
journal = {J. Am. Medical Informatics Assoc.},
volume = {24},
number = {6},
pages = {1169--1172},
year = {2017},
url = {https://doi.org/10.1093/jamia/ocx064},
doi = {10.1093/JAMIA/OCX064},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/NelsonOUBZHYMMT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/TunnecliffWGKM17,
author = {Jacqueline Tunnecliff and
John Weiner and
James E. Gaida and
Jennifer L. Keating and
Prue Morgan and
Dragan Ilic and
Lyn Clearihan and
David Davies and
Sivalal Sadasivan and
Patitapaban Mohanty and
Shankar Ganesh and
John Reynolds and
Stephen Maloney},
title = {Translating evidence to practice in the health professions: a randomized
trial of Twitter vs Facebook},
journal = {J. Am. Medical Informatics Assoc.},
volume = {24},
number = {2},
pages = {403--408},
year = {2017},
url = {https://doi.org/10.1093/jamia/ocw085},
doi = {10.1093/JAMIA/OCW085},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/TunnecliffWGKM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/WongBKGTW17,
author = {David Wong and
Timothy Bonnici and
Julia Knight and
Stephen Gerry and
James Turton and
Peter J. Watkinson},
title = {A ward-based time study of paper and electronic documentation for
recording vital sign observations},
journal = {J. Am. Medical Informatics Assoc.},
volume = {24},
number = {4},
pages = {717--721},
year = {2017},
url = {https://doi.org/10.1093/jamia/ocw186},
doi = {10.1093/JAMIA/OCW186},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jamia/WongBKGTW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/ManiCOOMBUB17,
author = {Subramani Mani and
Daniel Cannon and
Robin Ohls and
Tudor I. Oprea and
Stephen L. Mathias and
Karri Ballard and
Oleg Ursu and
Cristian Bologa},
title = {Protein biomarker druggability profiling},
journal = {J. Biomed. Informatics},
volume = {66},
pages = {241--247},
year = {2017},
url = {https://doi.org/10.1016/j.jbi.2017.01.014},
doi = {10.1016/J.JBI.2017.01.014},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/ManiCOOMBUB17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/LonesACDJNTS17,
author = {Michael A. Lones and
Jane E. Alty and
Jeremy Cosgrove and
Philippa Duggan{-}Carter and
Stuart Jamieson and
Rebecca F. Naylor and
Andrew James Turner and
Stephen L. Smith},
title = {A New Evolutionary Algorithm-Based Home Monitoring Device for Parkinson's
Dyskinesia},
journal = {J. Medical Syst.},
volume = {41},
number = {11},
pages = {176:1--176:8},
year = {2017},
url = {https://doi.org/10.1007/s10916-017-0811-7},
doi = {10.1007/S10916-017-0811-7},
timestamp = {Tue, 12 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jms/LonesACDJNTS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/NguyenMBBFGHHJK17,
author = {Dac{-}Trung Nguyen and
Stephen L. Mathias and
Cristian Bologa and
S{\o}ren Brunak and
Nicolas F. Fernandez and
Anna Gaulton and
Anne Hersey and
Jayme Holmes and
Lars Juhl Jensen and
Anneli Karlsson and
Guixia Liu and
Avi Ma'ayan and
Geetha Mandava and
Subramani Mani and
Saurabh Mehta and
John P. Overington and
Juhee Patel and
Andrew D. Rouillard and
Stephan C. Sch{\"{u}}rer and
Timothy Sheils and
Anton Simeonov and
Larry A. Sklar and
Noel Southall and
Oleg Ursu and
Dusica Vidovic and
Anna Waller and
Jeremy J. Yang and
Ajit Jadhav and
Tudor I. Oprea and
Rajarshi Guha},
title = {Pharos: Collating protein information to shed light on the druggable
genome},
journal = {Nucleic Acids Res.},
volume = {45},
number = {Database-Issue},
pages = {D995--D1002},
year = {2017},
url = {https://doi.org/10.1093/nar/gkw1072},
doi = {10.1093/NAR/GKW1072},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/NguyenMBBFGHHJK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/UrsuHKBYMNO17,
author = {Oleg Ursu and
Jayme Holmes and
Jeffrey Knockel and
Cristian Bologa and
Jeremy J. Yang and
Stephen L. Mathias and
Stuart J. Nelson and
Tudor I. Oprea},
title = {DrugCentral: online drug compendium},
journal = {Nucleic Acids Res.},
volume = {45},
number = {Database-Issue},
pages = {D932--D939},
year = {2017},
url = {https://doi.org/10.1093/nar/gkw993},
doi = {10.1093/NAR/GKW993},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/UrsuHKBYMNO17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/LiKTDDCHZSSLGBM17,
author = {Xin Li and
Yungil Kim and
Emily K. Tsang and
Joe R. Davis and
Farhan N. Damani and
Colby Chiang and
Gaelen T. Hess and
Zachary Zappala and
Benjamin J. Strober and
Alexandra J. Scott and
Amy Li and
Andrea Ganna and
Michael C. Bassik and
Jason D. Merker and
Fran{\c{c}}ois Aguet and
Kristin G. Ardlie and
Beryl B. Cummings and
Ellen T. Gelfand and
Gad Getz and
Kane Hadley and
Robert E. Handsaker and
Katherine H. Huang and
Seva Kashin and
Konrad J. Karczewski and
Monkol Lek and
Xiao Li and
Daniel G. MacArthur and
Jared L. Nedzel and
Duyen T. Nguyen and
Michael S. Noble and
Ayellet V. Segr{\`{e}} and
Casandra A. Trowbridge and
Taru Tukiainen and
Nathan S. Abell and
Brunilda Balliu and
Ruth Barshir and
Omer Basha and
Alexis J. Battle and
Gireesh K. Bogu and
Andrew Brown and
Christopher D. Brown and
Stephane E. Castel and
Lin S. Chen and
Donald F. Conrad and
Nancy J. Cox and
Olivier Delaneau and
Emmanouil T. Dermitzakis and
Barbara E. Engelhardt and
Eleazar Eskin and
Pedro G. Ferreira and
Laure Fr{\'{e}}sard and
Eric R. Gamazon and
Diego Garrido{-}Mart{\'{\i}}n and
Ariel D. H. Gewirtz and
Genna Gliner and
Michael J. Gloudemans and
Roderic Guig{\'{o}} and
Ira M. Hall and
Buhm Han and
Yuan He and
Farhad Hormozdiari and
Cedric Howald and
Hae Kyung Im and
Brian Jo and
Eun Yong Kang and
Sarah Kim{-}Hellmuth and
Tuuli Lappalainen and
Gen Li and
Boxiang Liu and
Serghei Mangul and
Mark I. McCarthy and
Ian C. McDowell and
Pejman Mohammadi and
Jean Monlong and
Stephen B. Montgomery},
title = {The impact of rare variation on gene expression across tissues},
journal = {Nat.},
volume = {550},
number = {7675},
pages = {239--243},
year = {2017},
url = {https://doi.org/10.1038/nature24267},
doi = {10.1038/NATURE24267},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/LiKTDDCHZSSLGBM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/AineBBCCGHHJLLM17,
author = {C. J. Aine and
Henry Jeremy Bockholt and
Juan R. Bustillo and
Jos{\'{e}} M. Ca{\~{n}}ive and
Arvind Caprihan and
Charles Gasparovic and
Faith M. Hanlon and
Jon M. Houck and
Rex E. Jung and
John Lauriello and
Jingyu Liu and
Andy R. Mayer and
Nora I. Perrone{-}Bizzozero and
Stefan Posse and
Julia M. Stephen and
Jessica A. Turner and
Vincent P. Clark and
Vince D. Calhoun},
title = {Multimodal Neuroimaging in Schizophrenia: Description and Dissemination},
journal = {Neuroinformatics},
volume = {15},
number = {4},
pages = {343--364},
year = {2017},
url = {https://doi.org/10.1007/s12021-017-9338-9},
doi = {10.1007/S12021-017-9338-9},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ni/AineBBCCGHHJLLM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/softx/TudiscoACH17,
author = {Erika Tudisco and
Edward And{\`{o}} and
R{\'{e}}mi Cailletaud and
Stephen A. Hall},
title = {TomoWarp2: {A} local digital volume correlation code},
journal = {SoftwareX},
volume = {6},
pages = {267--270},
year = {2017},
url = {https://doi.org/10.1016/j.softx.2017.10.002},
doi = {10.1016/J.SOFTX.2017.10.002},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/softx/TudiscoACH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/FuXLZWLFBA17,
author = {Huazhu Fu and
Yanwu Xu and
Stephen Lin and
Xiaoqin Zhang and
Damon Wing Kee Wong and
Jiang Liu and
Alejandro F. Frangi and
Mani Baskaran and
Tin Aung},
title = {Segmentation and Quantification for Angle-Closure Glaucoma Assessment
in Anterior Segment {OCT}},
journal = {{IEEE} Trans. Medical Imaging},
volume = {36},
number = {9},
pages = {1930--1938},
year = {2017},
url = {https://doi.org/10.1109/TMI.2017.2703147},
doi = {10.1109/TMI.2017.2703147},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmi/FuXLZWLFBA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/LiCT17,
author = {Xiaosong Li and
Wentong Cai and
Stephen John Turner},
title = {Cloning Agent-Based Simulation},
journal = {{ACM} Trans. Model. Comput. Simul.},
volume = {27},
number = {2},
pages = {15},
year = {2017},
url = {https://doi.org/10.1145/3013529},
doi = {10.1145/3013529},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tomacs/LiCT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/MalmasiHCBST17,
author = {Shervin Malmasi and
Naoshi Hosomura and
Lee{-}Shing Chang and
C. J. Brown and
Stephen Skentzos and
Alexander Turchin},
title = {Extracting Healthcare Quality Information from Unstructured Data},
booktitle = {{AMIA} 2017, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 4-8, 2017},
publisher = {{AMIA}},
year = {2017},
url = {https://knowledge.amia.org/65881-amiab-1.4254737/t003-1.4258387/f003-1.4258388/2732186-1.4258608/2732196-1.4258605},
timestamp = {Wed, 17 Apr 2024 11:47:24 +0200},
biburl = {https://dblp.org/rec/conf/amia/MalmasiHCBST17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/MalmasiSHGST17,
author = {Shervin Malmasi and
Nicolae L. Sandor and
Naoshi Hosomura and
Matt Goldberg and
Stephen Skentzos and
Alexander Turchin},
title = {Canary: An Information Extraction Platform for Clinical Researchers},
booktitle = {{AMIA} 2017, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 4-8, 2017},
publisher = {{AMIA}},
year = {2017},
url = {https://knowledge.amia.org/65881-amiab-1.4254737/t006-1.4257302/f006-1.4257303/2728680-1.4257334/2730400-1.4257331},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/MalmasiSHGST17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/CounsellST17,
author = {Steve Counsell and
Stephen Swift and
Allan Tucker},
editor = {Panagiotis D. Bamidis and
Stathis Th. Konstantinidis and
Pedro Pereira Rodrigues},
title = {A Deconstructed Replication of a Time of Test Study Using the {AGIS}
Metric},
booktitle = {30th {IEEE} International Symposium on Computer-Based Medical Systems,
{CBMS} 2017, Thessaloniki, Greece, June 22-24, 2017},
pages = {103--104},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/CBMS.2017.60},
doi = {10.1109/CBMS.2017.60},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cbms/CounsellST17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eScience/SimpsonWHSDTH017,
author = {Mike Simpson and
Simon Woodman and
Hugo Hiden and
Sebastian Stein and
Stephen Dowsland and
Mark Turner and
Vicki L. Hanson and
Paul Watson},
title = {A Platform for the Analysis of Qualitative and Quantitative Data about
the Built Environment and Its Users},
booktitle = {13th {IEEE} International Conference on e-Science, e-Science 2017,
Auckland, New Zealand, October 24-27, 2017},
pages = {228--237},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/eScience.2017.36},
doi = {10.1109/ESCIENCE.2017.36},
timestamp = {Tue, 15 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eScience/SimpsonWHSDTH017.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ei-sda/Holliman0DCP17,
author = {Nicolas S. Holliman and
Mark Turner and
Stephen Dowsland and
Richard Cloete and
Thomas Picton},
editor = {Andrew J. Woods and
Gregg E. Favalora and
Nicolas S. Holliman and
Takashi Kawai},
title = {Designing a Cloud-based 3D Visualization Engine for Smart Cities},
booktitle = {Stereoscopic Displays and Applications XXVIII, Burlingame, CA, USA,
January 29 - February 2, 2017},
pages = {173--178},
publisher = {Society for Imaging Science and Technology},
year = {2017},
url = {https://doi.org/10.2352/ISSN.2470-1173.2017.5.SDA-105},
doi = {10.2352/ISSN.2470-1173.2017.5.SDA-105},
timestamp = {Wed, 26 Jul 2023 17:17:16 +0200},
biburl = {https://dblp.org/rec/conf/ei-sda/Holliman0DCP17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/TuVWGJR17,
author = {Stephen Tu and
Shivaram Venkataraman and
Ashia C. Wilson and
Alex Gittens and
Michael I. Jordan and
Benjamin Recht},
editor = {Doina Precup and
Yee Whye Teh},
title = {Breaking Locality Accelerates Block Gauss-Seidel},
booktitle = {Proceedings of the 34th International Conference on Machine Learning,
{ICML} 2017, Sydney, NSW, Australia, 6-11 August 2017},
series = {Proceedings of Machine Learning Research},
volume = {70},
pages = {3482--3491},
publisher = {{PMLR}},
year = {2017},
url = {http://proceedings.mlr.press/v70/tu17a.html},
timestamp = {Wed, 29 May 2019 08:41:45 +0200},
biburl = {https://dblp.org/rec/conf/icml/TuVWGJR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/MannucciLDYFMEA17,
author = {Anthony J. Mannucci and
Stephen T. Lowe and
Jeffrey Dickson and
Larry E. Young and
Garth W. Franklin and
Thomas K. Meehan and
Stephan Esterhuizen and
Chi O. Ao and
Panagiotis Vergados and
Clara C. Chew and
Son V. Kim and
Son V. Nghiem and
F. Joseph Turk and
Cinzia Zuffada and
Rashmi Shah and
Attila Komjathy},
title = {High-value remote sensing for the geosciences: Opportunistic use of
navigation satellite signals},
booktitle = {2017 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2017, Fort Worth, TX, USA, July 23-28, 2017},
pages = {2686--2689},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/IGARSS.2017.8127549},
doi = {10.1109/IGARSS.2017.8127549},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/MannucciLDYFMEA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medinfo/GraySTWMTTGSHNM17,
author = {Kathleen Gray and
Remya Stephen and
Bronwyn Terrill and
Brenda Wilson and
Anna Middleton and
Rigan Tytherleigh and
Erin Turbitt and
Clara Gaff and
Jacqueline Savard and
Chriselle Hickerton and
Ainsley J. Newson and
Sylvia Metcalfe},
editor = {Adi V. Gundlapalli and
Marie{-}Christine Jaulent and
Dongsheng Zhao},
title = {Consumer Health Informatics Aspects of Direct-to-Consumer Personal
Genomic Testing},
booktitle = {{MEDINFO} 2017: Precision Healthcare through Informatics - Proceedings
of the 16th World Congress on Medical and Health Informatics, Hangzhou,
China, 21-25 August 2017},
series = {Studies in Health Technology and Informatics},
volume = {245},
pages = {89--93},
publisher = {{IOS} Press},
year = {2017},
url = {https://doi.org/10.3233/978-1-61499-830-3-89},
doi = {10.3233/978-1-61499-830-3-89},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/medinfo/GraySTWMTTGSHNM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LiCLLGC17,
author = {Dongsheng Li and
Chao Chen and
Wei Liu and
Tun Lu and
Ning Gu and
Stephen M. Chu},
editor = {Isabelle Guyon and
Ulrike von Luxburg and
Samy Bengio and
Hanna M. Wallach and
Rob Fergus and
S. V. N. Vishwanathan and
Roman Garnett},
title = {Mixture-Rank Matrix Approximation for Collaborative Filtering},
booktitle = {Advances in Neural Information Processing Systems 30: Annual Conference
on Neural Information Processing Systems 2017, December 4-9, 2017,
Long Beach, CA, {USA}},
pages = {477--485},
year = {2017},
url = {https://proceedings.neurips.cc/paper/2017/hash/3dd48ab31d016ffcbf3314df2b3cb9ce-Abstract.html},
timestamp = {Thu, 21 Jan 2021 13:58:27 +0100},
biburl = {https://dblp.org/rec/conf/nips/LiCLLGC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2017,
editor = {Tudor Jebelean and
Viorel Negru and
Dana Petcu and
Daniela Zaharie and
Tetsuo Ida and
Stephen M. Watt},
title = {19th International Symposium on Symbolic and Numeric Algorithms for
Scientific Computing, {SYNASC} 2017, Timisoara, Romania, September
21-24, 2017},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://ieeexplore.ieee.org/xpl/conhome/8528958/proceeding},
isbn = {978-1-5386-2626-9},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/synasc/2017.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/EldalyAPKCD017,
author = {Ahmed Karam Eldaly and
Yoann Altmann and
Antonios Perperidis and
Nikola Krstajic and
Tushar Choudhary and
Kevin Dhaliwal and
Stephen McLaughlin},
title = {Deconvolution and Restoration of Optical Endomicroscopy Images},
journal = {CoRR},
volume = {abs/1701.08107},
year = {2017},
url = {http://arxiv.org/abs/1701.08107},
eprinttype = {arXiv},
eprint = {1701.08107},
timestamp = {Fri, 25 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/EldalyAPKCD017.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/MakoninWT17,
author = {Stephen Makonin and
Z. Jane Wang and
Chris Tumpach},
title = {{RAE:} The Rainforest Automation Energy Dataset for Smart Grid Meter
Data Analysis},
journal = {CoRR},
volume = {abs/1705.05767},
year = {2017},
url = {http://arxiv.org/abs/1705.05767},
eprinttype = {arXiv},
eprint = {1705.05767},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/MakoninWT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/TuBPR17,
author = {Stephen Tu and
Ross Boczar and
Andrew K. Packard and
Benjamin Recht},
title = {Non-Asymptotic Analysis of Robust Control from Coarse-Grained Identification},
journal = {CoRR},
volume = {abs/1707.04791},
year = {2017},
url = {http://arxiv.org/abs/1707.04791},
eprinttype = {arXiv},
eprint = {1707.04791},
timestamp = {Fri, 30 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/TuBPR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1709-10203,
author = {Stephen Tu and
Ross Boczar and
Benjamin Recht},
title = {On the Approximation of Toeplitz Operators for Nonparametric {\textdollar}{\textbackslash}mathcal\{H\}{\_}{\textbackslash}infty{\textdollar}-norm
Estimation},
journal = {CoRR},
volume = {abs/1709.10203},
year = {2017},
url = {http://arxiv.org/abs/1709.10203},
eprinttype = {arXiv},
eprint = {1709.10203},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1709-10203.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1710-01688,
author = {Sarah Dean and
Horia Mania and
Nikolai Matni and
Benjamin Recht and
Stephen Tu},
title = {On the Sample Complexity of the Linear Quadratic Regulator},
journal = {CoRR},
volume = {abs/1710.01688},
year = {2017},
url = {http://arxiv.org/abs/1710.01688},
eprinttype = {arXiv},
eprint = {1710.01688},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1710-01688.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1712-08642,
author = {Stephen Tu and
Benjamin Recht},
title = {Least-Squares Temporal Difference Learning for the Linear Quadratic
Regulator},
journal = {CoRR},
volume = {abs/1712.08642},
year = {2017},
url = {http://arxiv.org/abs/1712.08642},
eprinttype = {arXiv},
eprint = {1712.08642},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1712-08642.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc8209,
author = {Mark C. Reynolds and
Sean Turner and
Stephen T. Kent},
title = {A Profile for BGPsec Router Certificates, Certificate Revocation Lists,
and Certification Requests},
journal = {{RFC}},
volume = {8209},
pages = {1--15},
year = {2017},
url = {https://doi.org/10.17487/RFC8209},
doi = {10.17487/RFC8209},
timestamp = {Thu, 15 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/rfc/rfc8209.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/SuzukiKTTTQIYYT16,
author = {Yuta Suzuki and
Jonas Korlach and
Stephen W. Turner and
Tatsuya Tsukahara and
Junko Taniguchi and
Wei Qu and
Kazuki Ichikawa and
Jun Yoshimura and
Hideaki Yurino and
Yuji Takahashi and
Jun Mitsui and
Hiroyuki Ishiura and
Shoji Tsuji and
Hiroyuki Takeda and
Shinichi Morishita},
title = {AgIn: measuring the landscape of CpG methylation of individual repetitive
elements},
journal = {Bioinform.},
volume = {32},
number = {19},
pages = {2911--2919},
year = {2016},
url = {https://doi.org/10.1093/bioinformatics/btw360},
doi = {10.1093/BIOINFORMATICS/BTW360},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/SuzukiKTTTQIYYT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biomedsem/CheungKRSRSAGGA16,
author = {Kei{-}Hoi Cheung and
Shivakumar Keerthikumar and
Paola Roncaglia and
Sai Lakshmi Subramanian and
Matthew E. Roth and
Monisha Samuel and
Sushma Anand and
Lahiru Gangoda and
Stephen Gould and
Roger Alexander and
David Galas and
Mark B. Gerstein and
Andrew F. Hill and
Robert R. Kitchen and
Jan L{\"{o}}tvall and
Tushar Patel},
title = {Extending gene ontology in the context of extracellular {RNA} and
vesicle communication},
journal = {J. Biomed. Semant.},
volume = {7},
pages = {19},
year = {2016},
url = {https://doi.org/10.1186/s13326-016-0061-5},
doi = {10.1186/S13326-016-0061-5},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/biomedsem/CheungKRSRSAGGA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biosystems/TurnerLTSJACT16,
author = {Alexander P. Turner and
Michael A. Lones and
Martin A. Trefzer and
Stephen L. Smith and
Stuart Jamieson and
Jane E. Alty and
Jeremy Cosgrove and
Andy M. Tyrrell},
title = {Using epigenetic networks for the analysis of movement associated
with levodopa therapy for Parkinson's disease},
journal = {Biosyst.},
volume = {146},
pages = {35--42},
year = {2016},
url = {https://doi.org/10.1016/j.biosystems.2016.05.005},
doi = {10.1016/J.BIOSYSTEMS.2016.05.005},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/biosystems/TurnerLTSJACT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cais/PetersMBHMSTVWD16,
author = {Christoph Peters and
Paul P. Maglio and
Ralph Badinelli and
Robert R. Harmon and
Roger S. Maull and
James C. Spohrer and
Tuure Tuunanen and
Stephen L. Vargo and
Jeffrey J. Welser and
Haluk Demirkan and
Terri L. Griffith and
Yassi Moghaddam},
title = {Emerging Digital Frontiers for Service Innovation},
journal = {Commun. Assoc. Inf. Syst.},
volume = {39},
pages = {8},
year = {2016},
url = {https://doi.org/10.17705/1cais.03908},
doi = {10.17705/1CAIS.03908},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cais/PetersMBHMSTVWD16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cce/PaulBTZ16,
author = {Prokash Paul and
Debangsu Bhattacharyya and
Richard Turton and
Stephen E. Zitney},
title = {Dynamic model-based sensor network design algorithm for system efficiency
maximization},
journal = {Comput. Chem. Eng.},
volume = {89},
pages = {27--40},
year = {2016},
url = {https://doi.org/10.1016/j.compchemeng.2016.01.018},
doi = {10.1016/J.COMPCHEMENG.2016.01.018},
timestamp = {Mon, 18 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cce/PaulBTZ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chb/WattsMTBSWBAMJ16,
author = {Christina M. Watts and
Patricia S. Moyer{-}Packenham and
Stephen I. Tucker and
Emma P. Bullock and
Jessica F. Shumway and
Arla Westenskow and
Jennifer Boyer{-}Thurgood and
Katie Anderson{-}Pence and
Salif Mahamane and
Kerry Jordan},
title = {An examination of children's learning progression shifts while using
touch screen virtual manipulative mathematics apps},
journal = {Comput. Hum. Behav.},
volume = {64},
pages = {814--828},
year = {2016},
url = {https://doi.org/10.1016/j.chb.2016.07.029},
doi = {10.1016/J.CHB.2016.07.029},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/chb/WattsMTBSWBAMJ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/compsec/FlowerdayT16,
author = {Stephen V. Flowerday and
Tite Tuyikeze},
title = {Information security policy development and implementation: The what,
how and who},
journal = {Comput. Secur.},
volume = {61},
pages = {169--183},
year = {2016},
url = {https://doi.org/10.1016/j.cose.2016.06.002},
doi = {10.1016/J.COSE.2016.06.002},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/compsec/FlowerdayT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/concurrency/LiCT16,
author = {Xiaosong Li and
Wentong Cai and
Stephen John Turner},
title = {Supporting efficient execution of continuous space agent-based simulation
on {GPU}},
journal = {Concurr. Comput. Pract. Exp.},
volume = {28},
number = {12},
pages = {3313--3332},
year = {2016},
url = {https://doi.org/10.1002/cpe.3808},
doi = {10.1002/CPE.3808},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/concurrency/LiCT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cviu/TuVEPPDWSP16,
author = {Liyun Tu and
Jared Vicory and
Shireen Y. Elhabian and
Beatriz Paniagua and
Juan{-}Carlos Prieto and
James N. Damon and
Ross T. Whitaker and
Martin Styner and
Stephen M. Pizer},
title = {Entropy-based correspondence improvement of interpolated skeletal
models},
journal = {Comput. Vis. Image Underst.},
volume = {151},
pages = {72--79},
year = {2016},
url = {https://doi.org/10.1016/j.cviu.2015.11.002},
doi = {10.1016/J.CVIU.2015.11.002},
timestamp = {Thu, 06 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cviu/TuVEPPDWSP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/BoothQCSCKLMST16,
author = {Eric G. Booth and
Jiangxiao Qiu and
Stephen R. Carpenter and
Jason Schatz and
Xi Chen and
Christopher J. Kucharik and
Steven P. Loheide II and
Melissa M. Motew and
Jenny M. Seifert and
Monica G. Turner},
title = {From qualitative to quantitative environmental scenarios: Translating
storylines into biophysical modeling inputs at the watershed scale},
journal = {Environ. Model. Softw.},
volume = {85},
pages = {80--97},
year = {2016},
url = {https://doi.org/10.1016/j.envsoft.2016.08.008},
doi = {10.1016/J.ENVSOFT.2016.08.008},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/envsoft/BoothQCSCKLMST16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/FrancoHSNT16,
author = {Chiara Franco and
Leanne Appleby Hepburn and
David J. Smith and
Stephen Nimrod and
Allan Tucker},
title = {A Bayesian Belief Network to assess rate of changes in coral reef
ecosystems},
journal = {Environ. Model. Softw.},
volume = {80},
pages = {132--142},
year = {2016},
url = {https://doi.org/10.1016/j.envsoft.2016.02.029},
doi = {10.1016/J.ENVSOFT.2016.02.029},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/envsoft/FrancoHSNT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/ShakeriLTL16,
author = {Mojtaba Shakeri and
Malcolm Yoke Hean Low and
Stephen John Turner and
Eng Wah Lee},
title = {An efficient incremental evaluation function for optimizing truck
scheduling in a resource-constrained crossdock using metaheuristics},
journal = {Expert Syst. Appl.},
volume = {45},
pages = {172--184},
year = {2016},
url = {https://doi.org/10.1016/j.eswa.2015.09.041},
doi = {10.1016/J.ESWA.2015.09.041},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eswa/ShakeriLTL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamsc/TuminaroPTSP16,
author = {Ray S. Tuminaro and
Mauro Perego and
Irina K. Tezaur and
Andrew G. Salinger and
Stephen F. Price},
title = {A Matrix Dependent/Algebraic Multigrid Approach for Extruded Meshes
with Applications to Ice Sheet Modeling},
journal = {{SIAM} J. Sci. Comput.},
volume = {38},
number = {5},
year = {2016},
url = {https://doi.org/10.1137/15M1040839},
doi = {10.1137/15M1040839},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamsc/TuminaroPTSP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simpra/LiCTQG16,
author = {Zengxiang Li and
Wentong Cai and
Stephen John Turner and
Zheng Qin and
Rick Siow Mong Goh},
title = {Transparent three-phase Byzantine fault tolerance for parallel and
distributed simulations},
journal = {Simul. Model. Pract. Theory},
volume = {60},
pages = {90--107},
year = {2016},
url = {https://doi.org/10.1016/j.simpat.2015.09.012},
doi = {10.1016/J.SIMPAT.2015.09.012},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simpra/LiCTQG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/synthese/OlenT16,
author = {Peter Olen and
Stephen P. Turner},
title = {Was Sellars an error theorist?},
journal = {Synth.},
volume = {193},
number = {7},
pages = {2053--2075},
year = {2016},
url = {https://doi.org/10.1007/s11229-015-0829-7},
doi = {10.1007/S11229-015-0829-7},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/synthese/OlenT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/TullyC16,
author = {Stephen Tully and
Howie Choset},
title = {A Filtering Approach for Image-Guided Surgery With a Highly Articulated
Surgical Snake Robot},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {63},
number = {2},
pages = {392--402},
year = {2016},
url = {https://doi.org/10.1109/TBME.2015.2461531},
doi = {10.1109/TBME.2015.2461531},
timestamp = {Wed, 02 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/TullyC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkl/TuckerMWJ16,
author = {Stephen I. Tucker and
Patricia S. Moyer{-}Packenham and
Arla Westenskow and
Kerry Jordan},
title = {The Complexity of the Affordance-Ability Relationship When Second-Grade
Children Interact with Mathematics Virtual Manipulative Apps},
journal = {Technol. Knowl. Learn.},
volume = {21},
number = {3},
pages = {341--360},
year = {2016},
url = {https://doi.org/10.1007/s10758-016-9276-x},
doi = {10.1007/S10758-016-9276-X},
timestamp = {Tue, 10 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tkl/TuckerMWJ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ACMicec/TumibayLYS16,
author = {Gilbert M. Tumibay and
Fernand T. Layug and
Daisy S. Yap and
Mar Stephen M. Sembrano},
editor = {Toru Ishida and
Norman M. Sadeh and
Jae Kyu Lee and
Federico Casalegno and
Wooju Kim and
Sohyeong Kim and
Sung{-}Byung Yang},
title = {Increasing the value of farm products: connecting farmers and consumers
through an E-commerce system},
booktitle = {Proceedings of the 18th Annual International Conference on Electronic
Commerce - e-Commerce in Smart connected World, {ICEC} '16, Suwon,
Republic of Korea, August 17-19, 2016},
pages = {5:1--5:5},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2971603.2971608},
doi = {10.1145/2971603.2971608},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ACMicec/TumibayLYS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/CounsellST16,
author = {Steve Counsell and
Stephen Swift and
Allan Tucker},
title = {The {AGIS} Metric and Time of Test: {A} Replication Study},
booktitle = {29th {IEEE} International Symposium on Computer-Based Medical Systems,
{CBMS} 2016, Belfast, {UK} and Dublin, Ireland, June 20-24, 2016},
pages = {269--270},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/CBMS.2016.80},
doi = {10.1109/CBMS.2016.80},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cbms/CounsellST16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/JilaniTS16,
author = {Mohd Zairul Mazwan Bin Jilani and
Allan Tucker and
Stephen Swift},
title = {Simultaneous Modelling and Clustering of Visual Field Data},
booktitle = {29th {IEEE} International Symposium on Computer-Based Medical Systems,
{CBMS} 2016, Belfast, {UK} and Dublin, Ireland, June 20-24, 2016},
pages = {213--218},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/CBMS.2016.66},
doi = {10.1109/CBMS.2016.66},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cbms/JilaniTS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eScience/TueckeACLMRF16,
author = {Steven Tuecke and
Rachana Ananthakrishnan and
Kyle Chard and
Mattias Lidman and
Brendan McCollam and
Stephen Rosen and
Ian T. Foster},
title = {Globus auth: {A} research identity and access management platform},
booktitle = {12th {IEEE} International Conference on e-Science, e-Science 2016,
Baltimore, MD, USA, October 23-27, 2016},
pages = {203--212},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/eScience.2016.7870901},
doi = {10.1109/ESCIENCE.2016.7870901},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eScience/TueckeACLMRF16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/NapoliWGTO16,
author = {Alessandro Napoli and
Christian R. Ward and
Stephen M. Glassd and
Carole A. Tucker and
Iyad Obeid},
title = {Automated assessment of postural stability system},
booktitle = {38th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2016, Orlando, FL, USA, August
16-20, 2016},
pages = {6090--6093},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/EMBC.2016.7592118},
doi = {10.1109/EMBC.2016.7592118},
timestamp = {Fri, 26 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/embc/NapoliWGTO16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/MrugalaTH16,
author = {Kinga Mrugala and
Nilufer Tuptuk and
Stephen Hailes},
editor = {Tobias Friedrich and
Frank Neumann and
Andrew M. Sutton},
title = {Evolving Attackers against Wireless Sensor Networks},
booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2016, Denver,
CO, USA, July 20-24, 2016, Companion Material Proceedings},
pages = {107--108},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2908961.2908974},
doi = {10.1145/2908961.2908974},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gecco/MrugalaTH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icbo/UtechtJBCORRAHB16,
author = {Joseph Utecht and
John Judkins and
Mathias Brochhausen and
Terra Colvin Jr. and
J. Neil Otte and
Nicholas Rogers and
Robert Rose and
Maria Alvi and
Amanda Hicks and
Jane Ball and
Stephen M. Bowman and
Robert T. Maxson and
Rosemary Nabaweesi and
Rohit Pradhan and
Nels D. Sanddal and
M. Eduard Tudoreanu and
Robert J. Winchell},
editor = {Pankaj Jaiswal and
Robert Hoehndorf and
Cecilia N. Arighi and
Austin Meier},
title = {{OOSTT:} a Resource for Analyzing the Organizational Structures of
Trauma Centers and Trauma Systems},
booktitle = {Proceedings of the Joint International Conference on Biological Ontology
and BioCreative, Corvallis, Oregon, United States, August 1-4, 2016},
series = {{CEUR} Workshop Proceedings},
volume = {1747},
publisher = {CEUR-WS.org},
year = {2016},
url = {https://ceur-ws.org/Vol-1747/IT504\_ICBO2016.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:23 +0100},
biburl = {https://dblp.org/rec/conf/icbo/UtechtJBCORRAHB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/TuBSSR16,
author = {Stephen Tu and
Ross Boczar and
Max Simchowitz and
Mahdi Soltanolkotabi and
Ben Recht},
editor = {Maria{-}Florina Balcan and
Kilian Q. Weinberger},
title = {Low-rank Solutions of Linear Matrix Equations via Procrustes Flow},
booktitle = {Proceedings of the 33nd International Conference on Machine Learning,
{ICML} 2016, New York City, NY, USA, June 19-24, 2016},
series = {{JMLR} Workshop and Conference Proceedings},
volume = {48},
pages = {964--973},
publisher = {JMLR.org},
year = {2016},
url = {http://proceedings.mlr.press/v48/tu16.html},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icml/TuBSSR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/noms/TurnerU16,
author = {Stephen W. Turner and
Suleyman Uludag},
editor = {Sema Oktug and
Mehmet Ulema and
Cicek Cavdar and
Lisandro Zambenedetti Granville and
Carlos Raniery Paula dos Santos},
title = {Intelligent transportation as the key enabler of smart cities},
booktitle = {2016 {IEEE/IFIP} Network Operations and Management Symposium, {NOMS}
2016, Istanbul, Turkey, April 25-29, 2016},
pages = {1261--1264},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/NOMS.2016.7502999},
doi = {10.1109/NOMS.2016.7502999},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/noms/TurnerU16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/xpu/McCaldenTB16,
author = {Stephen McCalden and
Mark Tumilty and
David W. Bustard},
editor = {Helen Sharp and
Tracy Hall},
title = {Smoothing the Transition from Agile Software Development to Agile
Software Maintenance},
booktitle = {Agile Processes, in Software Engineering, and Extreme Programming
- 17th International Conference, {XP} 2016, Edinburgh, UK, May 24-27,
2016, Proceedings},
series = {Lecture Notes in Business Information Processing},
volume = {251},
pages = {209--216},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-33515-5\_18},
doi = {10.1007/978-3-319-33515-5\_18},
timestamp = {Tue, 26 Jun 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/xpu/McCaldenTB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2016,
editor = {James H. Davenport and
Viorel Negru and
Tetsuo Ida and
Tudor Jebelean and
Dana Petcu and
Stephen M. Watt and
Daniela Zaharie},
title = {18th International Symposium on Symbolic and Numeric Algorithms for
Scientific Computing, {SYNASC} 2016, Timisoara, Romania, September
24-27, 2016},
publisher = {{IEEE}},
year = {2016},
url = {https://ieeexplore.ieee.org/xpl/conhome/7827704/proceeding},
isbn = {978-1-5090-5707-8},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/synasc/2016.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/PanLTPZJRRR16,
author = {Xinghao Pan and
Maximilian Lam and
Stephen Tu and
Dimitris S. Papailiopoulos and
Ce Zhang and
Michael I. Jordan and
Kannan Ramchandran and
Christopher R{\'{e}} and
Benjamin Recht},
title = {{CYCLADES:} Conflict-free Asynchronous Machine Learning},
journal = {CoRR},
volume = {abs/1605.09721},
year = {2016},
url = {http://arxiv.org/abs/1605.09721},
eprinttype = {arXiv},
eprint = {1605.09721},
timestamp = {Tue, 12 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/PanLTPZJRRR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/TuRVR16,
author = {Stephen Tu and
Rebecca Roelofs and
Shivaram Venkataraman and
Benjamin Recht},
title = {Large Scale Kernel Learning using Block Coordinate Descent},
journal = {CoRR},
volume = {abs/1602.05310},
year = {2016},
url = {http://arxiv.org/abs/1602.05310},
eprinttype = {arXiv},
eprint = {1602.05310},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/TuRVR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcsc/KusetogullariSL15,
author = {Huseyin Kusetogullari and
Md. Haidar Sharif and
Mark S. Leeson and
Turgay {\c{C}}elik},
title = {A Reduced Uncertainty-Based Hybrid Evolutionary Algorithm for Solving
Dynamic Shortest-Path Routing Problem},
journal = {J. Circuits Syst. Comput.},
volume = {24},
number = {5},
pages = {1550067:1--1550067:42},
year = {2015},
url = {https://doi.org/10.1142/S021812661550067X},
doi = {10.1142/S021812661550067X},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcsc/KusetogullariSL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocnet/ZhuPLMWPCTFWWE15,
author = {Jiannan Zhu and
Stephan Pachnicke and
Mirko Lawin and
Stephen Mayne and
Adrian Wonfor and
Richard V. Penty and
Rosie Cush and
Richard Turner and
Paul Firth and
Mike J. Wale and
Ian H. White and
J{\"{o}}rg{-}Peter Elbers},
title = {First Demonstration of a {WDM-PON} System Using Full C-band Tunable
{SFP+} Transceiver Modules [Invited]},
journal = {{JOCN}},
volume = {7},
number = {1},
pages = {A28--A36},
year = {2015},
url = {https://doi.org/10.1364/jocn.7.000a28},
doi = {10.1364/JOCN.7.000A28},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jocnet/ZhuPLMWPCTFWWE15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/WilsonFTGCYZ15,
author = {Carlene Wilson and
Ingrid H. K. Flight and
Deborah Turnbull and
Tess Gregory and
Stephen R. Cole and
Graeme P. Young and
Ian T. Zajac},
title = {A randomised controlled trial of personalised decision support delivered
via the internet for bowel cancer screening with a faecal occult blood
test: the effects of tailoring of messages according to social cognitive
variables on participation},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {15},
pages = {25},
year = {2015},
url = {https://doi.org/10.1186/s12911-015-0147-5},
doi = {10.1186/S12911-015-0147-5},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/midm/WilsonFTGCYZ15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/ChiuYZMPNTR15,
author = {Tsu{-}Pei Chiu and
Lin Yang and
Tianyin Zhou and
Bradley J. Main and
Stephen C. J. Parker and
Sergey V. Nuzhdin and
Thomas D. Tullius and
Remo Rohs},
title = {GBshape: a genome browser database for {DNA} shape annotations},
journal = {Nucleic Acids Res.},
volume = {43},
number = {Database-Issue},
pages = {103--109},
year = {2015},
url = {https://doi.org/10.1093/nar/gku977},
doi = {10.1093/NAR/GKU977},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/ChiuYZMPNTR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/EichnerCCMTSW15,
author = {Cornelius Eichner and
Stephen F. Cauley and
Julien Cohen{-}Adad and
Harald E. M{\"{o}}ller and
Robert Turner and
Kawin Setsompop and
Lawrence L. Wald},
title = {Real diffusion-weighted {MRI} enabling true signal averaging and increased
diffusion contrast},
journal = {NeuroImage},
volume = {122},
pages = {373--384},
year = {2015},
url = {https://doi.org/10.1016/j.neuroimage.2015.07.074},
doi = {10.1016/J.NEUROIMAGE.2015.07.074},
timestamp = {Wed, 19 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/EichnerCCMTSW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spl/TuYVZPS15,
author = {Liyun Tu and
Dan Yang and
Jared Vicory and
Xiaohong Zhang and
Stephen M. Pizer and
Martin Andreas Styner},
title = {Fitting Skeletal Object Models Using Spherical Harmonics Based Template
Warping},
journal = {{IEEE} Signal Process. Lett.},
volume = {22},
number = {12},
pages = {2269--2273},
year = {2015},
url = {https://doi.org/10.1109/LSP.2015.2476366},
doi = {10.1109/LSP.2015.2476366},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/spl/TuYVZPS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/te/ScottCLSTSG15,
author = {Michael James Scott and
Steve Counsell and
Stanislao Lauria and
Stephen Swift and
Allan Tucker and
Martin J. Shepperd and
Gheorghita Ghinea},
title = {Enhancing Practice and Achievement in Introductory Programming With
a Robot Olympics},
journal = {{IEEE} Trans. Educ.},
volume = {58},
number = {4},
pages = {249--254},
year = {2015},
url = {https://doi.org/10.1109/TE.2014.2382567},
doi = {10.1109/TE.2014.2382567},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/te/ScottCLSTSG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/MenzeJBKFKBPSWL15,
author = {Bjoern H. Menze and
Andr{\'{a}}s Jakab and
Stefan Bauer and
Jayashree Kalpathy{-}Cramer and
Keyvan Farahani and
Justin S. Kirby and
Yuliya Burren and
Nicole Porz and
Johannes Slotboom and
Roland Wiest and
Levente Lanczi and
Elizabeth R. Gerstner and
Marc{-}Andr{\'{e}} Weber and
Tal Arbel and
Brian B. Avants and
Nicholas Ayache and
Patricia Buendia and
D. Louis Collins and
Nicolas Cordier and
Jason J. Corso and
Antonio Criminisi and
Tilak Das and
Herve Delingette and
{\c{C}}agatay Demiralp and
Christopher R. Durst and
Michel Dojat and
Senan Doyle and
Joana Festa and
Florence Forbes and
Ezequiel Geremia and
Ben Glocker and
Polina Golland and
Xiaotao Guo and
Andac Hamamci and
Khan M. Iftekharuddin and
Raj Jena and
Nigel M. John and
Ender Konukoglu and
Danial Lashkari and
Jos{\'{e}} Antonio Mariz and
Raphael Meier and
S{\'{e}}rgio Pereira and
Doina Precup and
Stephen J. Price and
Tammy Riklin Raviv and
Syed M. S. Reza and
Michael T. Ryan and
Duygu Sarikaya and
Lawrence H. Schwartz and
Hoo{-}Chang Shin and
Jamie Shotton and
Carlos A. Silva and
Nuno J. Sousa and
Nagesh K. Subbanna and
G{\'{a}}bor Sz{\'{e}}kely and
Thomas J. Taylor and
Owen M. Thomas and
Nicholas J. Tustison and
G{\"{o}}zde B. {\"{U}}nal and
Flor Vasseur and
Max Wintermark and
Dong Hye Ye and
Liang Zhao and
Binsheng Zhao and
Darko Zikic and
Marcel Prastawa and
Mauricio Reyes and
Koen Van Leemput},
title = {The Multimodal Brain Tumor Image Segmentation Benchmark {(BRATS)}},
journal = {{IEEE} Trans. Medical Imaging},
volume = {34},
number = {10},
pages = {1993--2024},
year = {2015},
url = {https://doi.org/10.1109/TMI.2014.2377694},
doi = {10.1109/TMI.2014.2377694},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmi/MenzeJBKFKBPSWL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tocs/PellauerPAAACFG15,
author = {Michael Pellauer and
Angshuman Parashar and
Michael Adler and
Bushra Ahsan and
Randy L. Allmon and
Neal Clayton Crago and
Kermin Fleming and
Mohit Gambhir and
Aamer Jaleel and
Tushar Krishna and
Daniel Lustig and
Stephen Maresh and
Vladimir Pavlov and
Rachid Rayess and
Antonia Zhai and
Joel S. Emer},
title = {Efficient Control and Communication Paradigms for Coarse-Grained Spatial
Architectures},
journal = {{ACM} Trans. Comput. Syst.},
volume = {33},
number = {3},
pages = {10:1--10:32},
year = {2015},
url = {https://doi.org/10.1145/2754930},
doi = {10.1145/2754930},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tocs/PellauerPAAACFG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/LiCTLDG15,
author = {Zengxiang Li and
Wentong Cai and
Stephen John Turner and
Xiaorong Li and
Ta Nguyen Binh Duong and
Rick Siow Mong Goh},
title = {Adaptive Resource Provisioning Mechanism in VEEs for Improving Performance
of HLA-Based Simulations},
journal = {{ACM} Trans. Model. Comput. Simul.},
volume = {26},
number = {1},
pages = {1:1--1:25},
year = {2015},
url = {https://doi.org/10.1145/2717309},
doi = {10.1145/2717309},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tomacs/LiCTLDG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tpds/TanTGTW15,
author = {Wen Jun Tan and
Wai Teng Tang and
Rick Siow Mong Goh and
Stephen John Turner and
Weng{-}Fai Wong},
title = {A Code Generation Framework for Targeting Optimized Library Calls
for Multiple Platforms},
journal = {{IEEE} Trans. Parallel Distributed Syst.},
volume = {26},
number = {7},
pages = {1789--1799},
year = {2015},
url = {https://doi.org/10.1109/TPDS.2014.2329494},
doi = {10.1109/TPDS.2014.2329494},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tpds/TanTGTW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tpds/TangTGTW15,
author = {Wai Teng Tang and
Wen Jun Tan and
Rick Siow Mong Goh and
Stephen John Turner and
Weng{-}Fai Wong},
title = {A Family of Bit-Representation-Optimized Formats for Fast Sparse Matrix-Vector
Multiplication on the {GPU}},
journal = {{IEEE} Trans. Parallel Distributed Syst.},
volume = {26},
number = {9},
pages = {2373--2385},
year = {2015},
url = {https://doi.org/10.1109/TPDS.2014.2357437},
doi = {10.1109/TPDS.2014.2357437},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tpds/TangTGTW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/adaEurope/PinhoMMT15,
author = {Lu{\'{\i}}s Miguel Pinho and
Brad Moore and
Stephen Michell and
S. Tucker Taft},
editor = {Juan Antonio de la Puente and
Tullio Vardanega},
title = {An Execution Model for Fine-Grained Parallelism in Ada},
booktitle = {Reliable Software Technologies - Ada-Europe 2015 - 20th Ada-Europe
International Conference on Reliable Software Technologies, Madrid
Spain, June 22-26, 2015, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9111},
pages = {196--211},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-19584-1\_13},
doi = {10.1007/978-3-319-19584-1\_13},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/adaEurope/PinhoMMT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/ManiCOMUB15,
author = {Subramani Mani and
Daniel Cannon and
Tudor I. Oprea and
Stephen L. Mathias and
Oleg Ursu and
Cristian Bologa},
title = {Protein Drug Target Prioritization for Illumination},
booktitle = {{AMIA} 2015, American Medical Informatics Association Annual Symposium,
San Francisco, CA, USA, November 14-18, 2015},
publisher = {{AMIA}},
year = {2015},
url = {https://knowledge.amia.org/59310-amia-1.2741865/t001-1.2745946/f001-1.2745947/2247351-1.2746059/2248806-1.2746056},
timestamp = {Wed, 17 Apr 2024 11:47:40 +0200},
biburl = {https://dblp.org/rec/conf/amia/ManiCOMUB15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/SandorST15,
author = {Nicolae L. Sandor and
Stephen Skentzos and
Alexander Turchin},
title = {Canary - a Graphic User Interface to a Heuristic {NLP} Engine},
booktitle = {{AMIA} 2015, American Medical Informatics Association Annual Symposium,
San Francisco, CA, USA, November 14-18, 2015},
publisher = {{AMIA}},
year = {2015},
url = {https://knowledge.amia.org/59310-amia-1.2741865/t005-1.2744350/f005-1.2744351/2248348-1.2744622/2244203-1.2744619},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/SandorST15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/TuluALOEP15,
author = {Bengisu Tulu and
Emmanuel Agu and
Stephenie C. Lemon and
Jessica Oleski and
Martinus Evans and
Sherry Pagoto},
title = {Smart Coach: {A} Problem-Solving Mobile App to Support Weight Loss
Management},
booktitle = {{AMIA} 2015, American Medical Informatics Association Annual Symposium,
San Francisco, CA, USA, November 14-18, 2015},
publisher = {{AMIA}},
year = {2015},
url = {https://knowledge.amia.org/59310-amia-1.2741865/t005-1.2744350/f005-1.2744351/2247766-1.2744472/2247987-1.2744469},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/TuluALOEP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/WarrenJBST15,
author = {Judith J. Warren and
Stephen B. Johnson and
Suzanne Austin Boren and
Stuart M. Speedie and
G{\"{u}}nter Tusch},
title = {Health Informatics Graduate Program Accreditation: {CAHIIM} Process
and Standards Update},
booktitle = {{AMIA} 2015, American Medical Informatics Association Annual Symposium,
San Francisco, CA, USA, November 14-18, 2015},
publisher = {{AMIA}},
year = {2015},
url = {https://knowledge.amia.org/59310-amia-1.2741865/t003-1.2745834/f003-1.2745835/2248640-1.2745842/2248831-1.2745839},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/WarrenJBST15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/KonradBCTNDPW15,
author = {Artie Konrad and
Victoria Bellotti and
Nicole Crenshaw and
Simon Tucker and
Les Nelson and
Honglu Du and
Peter Pirolli and
Steve Whittaker},
editor = {Bo Begole and
Jinwoo Kim and
Kori Inkpen and
Woontack Woo},
title = {Finding the Adaptive Sweet Spot: Balancing Compliance and Achievement
in Automated Stress Reduction},
booktitle = {Proceedings of the 33rd Annual {ACM} Conference on Human Factors in
Computing Systems, {CHI} 2015, Seoul, Republic of Korea, April 18-23,
2015},
pages = {3829--3838},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2702123.2702512},
doi = {10.1145/2702123.2702512},
timestamp = {Mon, 11 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/KonradBCTNDPW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/WartelKGBSTQLMB15,
author = {Franck Wartel and
Leonidas Kosmidis and
Adriana Gogonel and
Andrea Baldovin and
Zo{\"{e}} R. Stephenson and
Benoit Triquet and
Eduardo Qui{\~{n}}ones and
Code Lo and
Enrico Mezzetti and
Ian Broster and
Jaume Abella and
Liliana Cucu{-}Grosjean and
Tullio Vardanega and
Francisco J. Cazorla},
editor = {Wolfgang Nebel and
David Atienza},
title = {Timing analysis of an avionics case study on complex hardware/software
platforms},
booktitle = {Proceedings of the 2015 Design, Automation {\&} Test in Europe
Conference {\&} Exhibition, {DATE} 2015, Grenoble, France, March
9-13, 2015},
pages = {397--402},
publisher = {{ACM}},
year = {2015},
url = {http://dl.acm.org/citation.cfm?id=2755843},
timestamp = {Mon, 09 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/date/WartelKGBSTQLMB15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/ZhaoCT15,
author = {Mingbi Zhao and
Wentong Cai and
Stephen John Turner},
title = {Evaluation of Crowd Models in Low Density Scenarios Using Real-World
Crowd Data},
booktitle = {19th {IEEE/ACM} International Symposium on Distributed Simulation
and Real Time Applications, {DS-RT} 2015, Chengdu, China, October
14-16, 2015},
pages = {1--9},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/DS-RT.2015.25},
doi = {10.1109/DS-RT.2015.25},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsrt/ZhaoCT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eScience/WoodmanHTDW15,
author = {Simon Woodman and
Hugo Hiden and
Mark Turner and
Stephen Dowsland and
Paul Watson},
title = {Monitoring of Upper Limb Rehabilitation and Recovery after Stroke:
An Architecture for a Cloud-Based Therapy Platform},
booktitle = {11th {IEEE} International Conference on e-Science, e-Science 2015,
Munich, Germany, August 31 - September 4, 2015},
pages = {381--390},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/eScience.2015.29},
doi = {10.1109/ESCIENCE.2015.29},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eScience/WoodmanHTDW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoc/EllisPTSMKIPFGL15,
author = {Andrew D. Ellis and
Ian D. Phillips and
Mingming Tan and
Marc F. C. Stephens and
Mary E. McCarthy and
M. A. Z. Al Kahteeb and
Md. Asif Iqbal and
Andreas Perentos and
Simon Fabbri and
Vladimir Gordienko and
Domani{\c{c}} Lavery and
Gabriele Liga and
M. G. Saavedra and
Robert Maher and
Stelios Sygletos and
Paul Harper and
Nick J. Doran and
Polina Bayvel and
Sergey K. Turitsyn},
title = {Enhanced superchannel transmission using phase conjugation},
booktitle = {European Conference on Optical Communication, {ECOC} 2015, Valencia,
Spain, September 27 - October 1, 2015},
pages = {1--3},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ECOC.2015.7341993},
doi = {10.1109/ECOC.2015.7341993},
timestamp = {Mon, 02 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ecoc/EllisPTSMKIPFGL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/TurnerASF15,
author = {Stephen W. Turner and
Mark Allison and
Zahid A. Syed and
Michael Farmer},
title = {Towards a flipped cyber classroom to facilitate active learning strategies},
booktitle = {2015 {IEEE} Frontiers in Education Conference, {FIE} 2015, El Paso,
TX, USA, October 21-24, 2015},
pages = {1--4},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/FIE.2015.7344136},
doi = {10.1109/FIE.2015.7344136},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fie/TurnerASF15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/TezaurTPSP15,
author = {Irina K. Tezaur and
Raymond S. Tuminaro and
Mauro Perego and
Andrew G. Salinger and
Stephen F. Price},
editor = {Slawomir Koziel and
Leifur {\TH}. Leifsson and
Michael Lees and
Valeria V. Krzhizhanovskaya and
Jack J. Dongarra and
Peter M. A. Sloot},
title = {On the Scalability of the Albany/FELIX first-order Stokes Approximation
ice Sheet Solver for Large-Scale Simulations of the Greenland and
Antarctic ice Sheets},
booktitle = {Proceedings of the International Conference on Computational Science,
{ICCS} 2015, Computational Science at the Gates of Nature, Reykjav{\'{\i}}k,
Iceland, 1-3 June, 2015, 2014},
series = {Procedia Computer Science},
volume = {51},
pages = {2026--2035},
publisher = {Elsevier},
year = {2015},
url = {https://doi.org/10.1016/j.procs.2015.05.467},
doi = {10.1016/J.PROCS.2015.05.467},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccS/TezaurTPSP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/memsys/JogKKPBCKKD15,
author = {Adwait Jog and
Onur Kayiran and
Tuba Kesten and
Ashutosh Pattnaik and
Evgeny Bolotin and
Niladrish Chatterjee and
Stephen W. Keckler and
Mahmut T. Kandemir and
Chita R. Das},
editor = {Bruce L. Jacob},
title = {Anatomy of {GPU} Memory System for Multi-Application Execution},
booktitle = {Proceedings of the 2015 International Symposium on Memory Systems,
{MEMSYS} 2015, Washington DC, DC, USA, October 5-8, 2015},
pages = {223--234},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2818950.2818979},
doi = {10.1145/2818950.2818979},
timestamp = {Fri, 13 Nov 2020 09:24:44 +0100},
biburl = {https://dblp.org/rec/conf/memsys/JogKKPBCKKD15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/PaniaguaZOAGNE15,
author = {Beatriz Paniagua and
Dzenan Zukic and
Ricardo Ortiz and
Stephen R. Aylward and
Brent Golden and
Tung Nguyen and
Andinet Enquobahrie},
editor = {Cristian A. Linte and
Ziv Yaniv and
Pascal Fallavollita},
title = {Ultrasound-Guided Navigation System for Orthognathic Surgery},
booktitle = {Augmented Environments for Computer-Assisted Interventions - 10th
International Workshop, {AE-CAI} 2015 Held in Conjunction with {MICCAI}
2015, Munich, Germany, October 9, 2015, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9365},
pages = {1--10},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-24601-7\_1},
doi = {10.1007/978-3-319-24601-7\_1},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miccai/PaniaguaZOAGNE15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miip/TuSVPPYP15,
author = {Liyun Tu and
Martin Styner and
Jared Vicory and
Beatriz Paniagua and
Juan{-}Carlos Prieto and
Dan Yang and
Stephen M. Pizer},
editor = {S{\'{e}}bastien Ourselin and
Martin Andreas Styner},
title = {Skeletal shape correspondence via entropy minimization},
booktitle = {Medical Imaging 2015: Image Processing, Orlando, Florida, USA, February
24-26, 2015},
series = {{SPIE} Proceedings},
volume = {9413},
pages = {94130U},
publisher = {{SPIE}},
year = {2015},
url = {https://doi.org/10.1117/12.2081245},
doi = {10.1117/12.2081245},
timestamp = {Thu, 06 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miip/TuSVPPYP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ndss/BostPTG15,
author = {Raphael Bost and
Raluca Ada Popa and
Stephen Tu and
Shafi Goldwasser},
title = {Machine Learning Classification over Encrypted Data},
booktitle = {22nd Annual Network and Distributed System Security Symposium, {NDSS}
2015, San Diego, California, USA, February 8-11, 2015},
publisher = {The Internet Society},
year = {2015},
url = {https://www.ndss-symposium.org/ndss2015/machine-learning-classification-over-encrypted-data},
timestamp = {Mon, 01 Feb 2021 08:42:14 +0100},
biburl = {https://dblp.org/rec/conf/ndss/BostPTG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/PachnickeMQSSZW15,
author = {Stephan Pachnicke and
Stephen Mayne and
B. Quemeneur and
D. Sayles and
H. Schwuchow and
Jiannan Zhu and
Adrian Wonfor and
P. Marx and
Mirko Lawin and
M. Fellhofer and
Richard Turner and
P. Neuber and
M. Dietrich and
Mike J. Wale and
Richard V. Penty and
Ian H. White and
J{\"{o}}rg{-}Peter Elbers},
title = {Field demonstration of a tunable {WDM-PON} system with novel {SFP+}
modules and centralized wavelength control},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2015,
Los Angeles, CA, USA, March 22-26, 2015},
pages = {1--3},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1364/OFC.2015.M2A.6},
doi = {10.1364/OFC.2015.M2A.6},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ofc/PachnickeMQSSZW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/LiCT15,
author = {Xiaosong Li and
Wentong Cai and
Stephen John Turner},
editor = {Simon J. E. Taylor and
Navonil Mustafee and
Young{-}Jun Son},
title = {Cloning Agent-based Simulation on {GPU}},
booktitle = {Proceedings of the 3rd {ACM} Conference on SIGSIM-Principles of Advanced
Discrete Simulation, London, United Kingdom, June 10 - 12, 2015},
pages = {173--182},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2769458.2769470},
doi = {10.1145/2769458.2769470},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/LiCT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/percom/TuptukH15,
author = {Nilufer Tuptuk and
Stephen Hailes},
title = {Covert channel attacks in pervasive computing},
booktitle = {2015 {IEEE} International Conference on Pervasive Computing and Communications,
PerCom 2015, St. Louis, MO, USA, 23-27 March, 2015},
pages = {236--242},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/PERCOM.2015.7146534},
doi = {10.1109/PERCOM.2015.7146534},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/percom/TuptukH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rtss/PinhoMMT15,
author = {Lu{\'{\i}}s Miguel Pinho and
Brad Moore and
Stephen Michell and
S. Tucker Taft},
title = {Real-Time Support in the Proposal for Fine-Grained Parallelism in
Ada},
booktitle = {2015 {IEEE} Real-Time Systems Symposium, {RTSS} 2015, San Antonio,
Texas, USA, December 1-4, 2015},
pages = {374},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/RTSS.2015.43},
doi = {10.1109/RTSS.2015.43},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/rtss/PinhoMMT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/15/TuckerLCS15,
author = {Allan Tucker and
Yuanxi Li and
Stefano Ceccon and
Stephen Swift},
editor = {Arjen Hommersom and
Peter J. F. Lucas},
title = {Trajectories Through the Disease Process: Cross Sectional and Longitudinal
Studies},
booktitle = {Foundations of Biomedical Knowledge Representation - Methods and Applications},
series = {Lecture Notes in Computer Science},
volume = {9521},
pages = {189--205},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-28007-3\_12},
doi = {10.1007/978-3-319-28007-3\_12},
timestamp = {Sat, 30 Sep 2023 09:32:43 +0200},
biburl = {https://dblp.org/rec/books/sp/15/TuckerLCS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2015,
editor = {Laura Kov{\'{a}}cs and
Viorel Negru and
Tetsuo Ida and
Tudor Jebelean and
Dana Petcu and
Stephen M. Watt and
Daniela Zaharie},
title = {17th International Symposium on Symbolic and Numeric Algorithms for
Scientific Computing, {SYNASC} 2015, Timisoara, Romania, September
21-24, 2015},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://ieeexplore.ieee.org/xpl/conhome/7425657/proceeding},
isbn = {978-1-5090-0461-4},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/synasc/2015.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/WeirREAPVMFPPSV15,
author = {Phil Weir and
Dominic Reuter and
Roland Ellerweg and
Tuomas Alhonnoro and
Mika Pollari and
Philip Voglreiter and
Panchatcharam Mariappan and
Ronan Flanagan and
Chang{-}Sub Park and
Stephen J. Payne and
Elmar Staerk and
Peter Voigt and
Michael Moche and
Marina Kolesnik},
title = {Go-Smart: Web-based Computational Modeling of Minimally Invasive Cancer
Treatments},
journal = {CoRR},
volume = {abs/1511.03418},
year = {2015},
url = {http://arxiv.org/abs/1511.03418},
eprinttype = {arXiv},
eprint = {1511.03418},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/WeirREAPVMFPPSV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/artmed/SacchiTCGS14,
author = {Lucia Sacchi and
Allan Tucker and
Steve Counsell and
David Garway{-}Heath and
Stephen Swift},
title = {Improving predictive models of glaucoma severity by incorporating
quality indicators},
journal = {Artif. Intell. Medicine},
volume = {60},
number = {2},
pages = {103--112},
year = {2014},
url = {https://doi.org/10.1016/j.artmed.2013.12.002},
doi = {10.1016/J.ARTMED.2013.12.002},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/artmed/SacchiTCGS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cce/JonesBTZ14,
author = {Dustin Jones and
Debangsu Bhattacharyya and
Richard Turton and
Stephen E. Zitney},
title = {Plant-wide control system design: Primary controlled variable selection},
journal = {Comput. Chem. Eng.},
volume = {71},
pages = {220--234},
year = {2014},
url = {https://doi.org/10.1016/j.compchemeng.2014.08.004},
doi = {10.1016/J.COMPCHEMENG.2014.08.004},
timestamp = {Mon, 18 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cce/JonesBTZ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cce/JonesBTZ14a,
author = {Dustin Jones and
Debangsu Bhattacharyya and
Richard Turton and
Stephen E. Zitney},
title = {Plant-wide control system design: Secondary controlled variable selection},
journal = {Comput. Chem. Eng.},
volume = {71},
pages = {253--262},
year = {2014},
url = {https://doi.org/10.1016/j.compchemeng.2014.08.007},
doi = {10.1016/J.COMPCHEMENG.2014.08.007},
timestamp = {Mon, 18 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cce/JonesBTZ14a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dhq/SturmT14,
author = {Sean Sturm and
Stephen Francis Turner},
title = {Digital Caricature},
journal = {Digit. Humanit. Q.},
volume = {8},
number = {3},
year = {2014},
url = {http://www.digitalhumanities.org/dhq/vol/8/3/000182/000182.html},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dhq/SturmT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejc/StephensTZ14,
author = {D. Christopher Stephens and
Thomas W. Tucker and
Xiaoya Zha},
title = {Representativity of Cayley maps},
journal = {Eur. J. Comb.},
volume = {39},
pages = {207--222},
year = {2014},
url = {https://doi.org/10.1016/j.ejc.2013.12.006},
doi = {10.1016/J.EJC.2013.12.006},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ejc/StephensTZ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-wss/MatikoBT14,
author = {Joseph W. Matiko and
Stephen P. Beeby and
John Tudor},
title = {Real time emotion detection within a wireless sensor network and its
impact on power consumption},
journal = {{IET} Wirel. Sens. Syst.},
volume = {4},
number = {4},
pages = {183--190},
year = {2014},
url = {https://doi.org/10.1049/iet-wss.2014.0056},
doi = {10.1049/IET-WSS.2014.0056},
timestamp = {Fri, 18 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iet-wss/MatikoBT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijitpm/IskinDNB14,
author = {Ibrahim Iskin and
Tugrul U. Daim and
Stephen Noble and
Angie Baltz},
title = {Approaching {IT} Automation Decisions using Analytic Hierarchy Process
{(AHP)}},
journal = {Int. J. Inf. Technol. Proj. Manag.},
volume = {5},
number = {1},
pages = {77--89},
year = {2014},
url = {https://doi.org/10.4018/ijitpm.2014010107},
doi = {10.4018/IJITPM.2014010107},
timestamp = {Thu, 01 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijitpm/IskinDNB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jos/AydtCT14,
author = {Heiko Aydt and
Wentong Cai and
Stephen John Turner},
title = {Dynamic specialization for symbiotic simulation-based operational
decision support using the evolutionary computing modelling language
{(ECML)}},
journal = {J. Simulation},
volume = {8},
number = {2},
pages = {105--114},
year = {2014},
url = {https://doi.org/10.1057/jos.2013.15},
doi = {10.1057/JOS.2013.15},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jos/AydtCT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/KecklerT14,
author = {Stephen W. Keckler and
Dean M. Tullsen},
title = {2014 International Symposium on Computer Architecture Influential
Paper Award; 2014 Maurice Wilkes Award Given to Ravi Rajwar},
journal = {{IEEE} Micro},
volume = {34},
number = {6},
pages = {95--97},
year = {2014},
url = {https://doi.org/10.1109/MM.2014.91},
doi = {10.1109/MM.2014.91},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/KecklerT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WangSZWHCSGB14,
author = {Yanli Wang and
Tugba O. Suzek and
Jian Zhang and
Jiyao Wang and
Siqian He and
Tiejun Cheng and
Benjamin A. Shoemaker and
Asta Gindulyte and
Stephen H. Bryant},
title = {PubChem BioAssay: 2014 update},
journal = {Nucleic Acids Res.},
volume = {42},
number = {Database-Issue},
pages = {1075--1082},
year = {2014},
url = {https://doi.org/10.1093/nar/gkt978},
doi = {10.1093/NAR/GKT978},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/WangSZWHCSGB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/HoJLALISMTAPGKR14,
author = {Joshua Wing Kei Ho and
Youngsook L. Jung and
Tao Liu and
Burak Han Alver and
Soohyun Lee and
Kohta Ikegami and
Kyung{-}Ah Sohn and
Aki Minoda and
Michael Y. Tolstorukov and
Alex Appert and
Stephen C. J. Parker and
Tingting Gu and
Anshul Kundaje and
Nicole C. Riddle and
Eric Bishop and
Thea A. Egelhofer and
Sheng'en Shawn Hu and
Artyom A. Alekseyenko and
Andreas Rechtsteiner and
Dalal Asker and
Jason A. Belsky and
Sarah K. Bowman and
Q. Brent Chen and
Ron A.{-}J. Chen and
Daniel S. Day and
Yan Dong and
Andrea C. Dose and
Xikun Duan and
Charles B. Epstein and
Sevinc Ercan and
Elise A. Feingold and
Francesco Ferrari and
Jacob M. Garrigues and
Nils Gehlenborg and
Peter J. Good and
Psalm Haseley and
Daniel He and
Moritz Herrmann and
Michael M. Hoffman and
Tess E. Jeffers and
Peter V. Kharchenko and
Paulina Kolasinska{-}Zwierz and
Chitra V. Kotwaliwale and
Nischay Kumar and
Sasha A. Langley and
Erica Larschan and
Isabel Latorre and
Maxwell W. Libbrecht and
Xueqiu Lin and
Richard Park and
Michael J. Pazin and
Hoang N. Pham and
Annette Plachetka and
Bo Qin and
Yuri B. Schwartz and
Noam Shoresh and
Przemyslaw Stempor and
Anne Vielle and
Chengyang Wang and
Christina M. Whittle and
Huiling Xue and
Robert E. Kingston and
Ju Han Kim and
Bradley E. Bernstein and
Abby F. Dernburg and
Vincenzo Pirrotta and
Mitzi I. Kuroda and
William S. Noble and
Thomas D. Tullius and
Manolis Kellis and
David M. MacAlpine and
Susan Strome and
Sarah C. R. Elgin and
Xiaole Shirley Liu and
Jason D. Lieb and
Julie Ahringer and
Gary H. Karpen and
Peter J. Park},
title = {Comparative analysis of metazoan chromatin organization Open},
journal = {Nat.},
volume = {512},
number = {7515},
pages = {449--452},
year = {2014},
url = {https://doi.org/10.1038/nature13415},
doi = {10.1038/NATURE13415},
timestamp = {Tue, 12 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/HoJLALISMTAPGKR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simpra/LiCT14,
author = {Zengxiang Li and
Wentong Cai and
Stephen John Turner},
title = {Un-identical federate replication structure for improving performance
of HLA-based simulations},
journal = {Simul. Model. Pract. Theory},
volume = {48},
pages = {112--128},
year = {2014},
url = {https://doi.org/10.1016/j.simpat.2014.06.016},
doi = {10.1016/J.SIMPAT.2014.06.016},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simpra/LiCT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tec/LonesFTCSST14,
author = {Michael A. Lones and
Luis A. Fuente and
Alexander P. Turner and
Leo S. D. Caves and
Susan Stepney and
Stephen L. Smith and
Andy M. Tyrrell},
title = {Artificial Biochemical Networks: Evolving Dynamical Systems to Control
Dynamical Systems},
journal = {{IEEE} Trans. Evol. Comput.},
volume = {18},
number = {2},
pages = {145--166},
year = {2014},
url = {https://doi.org/10.1109/TEVC.2013.2243732},
doi = {10.1109/TEVC.2013.2243732},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tec/LonesFTCSST14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cgames/AlskheliwiJLPS14,
author = {Turki Alskheliwi and
Carol Jim and
Khalid Lateef and
Stephen Penn and
Ahmed Salem},
title = {Applying game theory rules to enhance decision support systems in
credit and financial applications},
booktitle = {Computer Games: AI, Animation, Mobile, Multimedia, Educational and
Serious Games, {CGAMES} 2014, Louisville, KY, USA, July 28-30, 2014},
pages = {1--10},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/CGames.2014.6934138},
doi = {10.1109/CGAMES.2014.6934138},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cgames/AlskheliwiJLPS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/TurnbullZSHWSMJ14,
author = {Douglas R. Turnbull and
Justin A. Zupnick and
Kristofer B. Stensland and
Andrew R. Horwitz and
Alexander J. Wolf and
Alexander E. Spirgel and
Stephen P. Meyerhofer and
Thorsten Joachims},
editor = {Matt Jones and
Philippe A. Palanque and
Albrecht Schmidt and
Tovi Grossman},
title = {Using personalized radio to enhance local music discovery},
booktitle = {{CHI} Conference on Human Factors in Computing Systems, CHI'14, Toronto,
ON, Canada - April 26 - May 01, 2014, Extended Abstracts},
pages = {2023--2028},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2559206.2581246},
doi = {10.1145/2559206.2581246},
timestamp = {Mon, 08 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/TurnbullZSHWSMJ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/LiCT14,
author = {Xiaosong Li and
Wentong Cai and
Stephen John Turner},
title = {Efficient Neighbor Searching for Agent-Based Simulation on {GPU}},
booktitle = {18th {IEEE/ACM} International Symposium on Distributed Simulation
and Real Time Applications, {DS-RT} 2014, Toulouse, France, October
1-3, 2014},
pages = {87--96},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/DS-RT.2014.19},
doi = {10.1109/DS-RT.2014.19},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dsrt/LiCT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoc/SygletosMFSSPGS14,
author = {Stelios Sygletos and
Mary E. McCarthy and
Simon Fabbri and
Mariia Sorokina and
Marc F. C. Stephens and
Ian D. Phillips and
Elias G. Giacoumidis and
Naoise Mac Suibhne and
Paul Harper and
Nick J. Doran and
Sergei K. Turitsyn and
Andrew D. Ellis},
title = {Multichannel regeneration of dual quadrature signals},
booktitle = {The European Conference on Optical Communication, {ECOC} 2014, Cannes,
France, September 21-25, 2014},
pages = {1--3},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ECOC.2014.6964110},
doi = {10.1109/ECOC.2014.6964110},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ecoc/SygletosMFSSPGS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/LonesADTJS14,
author = {Michael A. Lones and
Jane E. Alty and
Philippa Duggan{-}Carter and
Andrew James Turner and
D. R. Stuart Jamieson and
Stephen L. Smith},
editor = {Dirk V. Arnold and
Enrique Alba},
title = {Classification and characterisation of movement patterns during levodopa
therapy for parkinson's disease},
booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} '14, Vancouver,
BC, Canada, July 12-16, 2014, Companion Material Proceedings},
pages = {1321--1328},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2598394.2609852},
doi = {10.1145/2598394.2609852},
timestamp = {Wed, 13 Jul 2022 16:15:15 +0200},
biburl = {https://dblp.org/rec/conf/gecco/LonesADTJS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/haisa/TuyikezeF14,
author = {Tite Tuyikeze and
Stephen Flowerday},
editor = {Nathan L. Clarke and
Steven Furnell},
title = {Information Security Policy Development and Implementation: {A} Content
Analysis Approach},
booktitle = {Eighth International Symposium on Human Aspects of Information Security
{\&} Assurance, {HAISA} 2014 ,Plymouth, UK, July 8-9, 2014. Proceedings},
pages = {11--20},
publisher = {University of Plymouth},
year = {2014},
url = {http://www.cscan.org/openaccess/?paperid=233},
timestamp = {Tue, 06 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/haisa/TuyikezeF14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/MatikoBT14,
author = {Joseph W. Matiko and
Stephen P. Beeby and
John Tudor},
title = {Fuzzy logic based emotion classification},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2014, Florence, Italy, May 4-9, 2014},
pages = {4389--4393},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ICASSP.2014.6854431},
doi = {10.1109/ICASSP.2014.6854431},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icassp/MatikoBT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ida/CounsellTSFP14,
author = {Steve Counsell and
Allan Tucker and
Stephen Swift and
Guy Fitzgerald and
Jason Peters},
editor = {Hendrik Blockeel and
Matthijs van Leeuwen and
Veronica Vinciotti},
title = {Comparing Pre-defined Software Engineering Metrics with Free-Text
for the Prediction of Code 'Ripples'},
booktitle = {Advances in Intelligent Data Analysis {XIII} - 13th International
Symposium, {IDA} 2014, Leuven, Belgium, October 30 - November 1, 2014.
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8819},
pages = {61--71},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-12571-8\_6},
doi = {10.1007/978-3-319-12571-8\_6},
timestamp = {Mon, 03 Jan 2022 22:18:10 +0100},
biburl = {https://dblp.org/rec/conf/ida/CounsellTSFP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/KainzVSWMKPKSAHSFBMOPPRSMKSP14,
author = {Bernhard Kainz and
Philip Voglreiter and
Michael Sereinigg and
Iris Wiederstein{-}Grasser and
Ursula Mayrhauser and
Sonja Kostenbauer and
Mika Pollari and
Rostislav Khlebnikov and
Matthias Seise and
Tuomas Alhonnoro and
Yrj{\"{o}} H{\"{a}}me and
Daniel Seider and
Ronan Flanagan and
Claire Bost and
Judith Muehl and
David O'Neill and
Tingying Peng and
Stephen J. Payne and
Daniel Rueckert and
Dieter Schmalstieg and
Michael Moche and
Marina Kolesnik and
Philipp Stiegler and
Rupert H. Portugaller},
title = {High-resolution contrast enhanced multi-phase hepatic Computed Tomography
data fromaporcine Radio-Frequency Ablation study},
booktitle = {{IEEE} 11th International Symposium on Biomedical Imaging, {ISBI}
2014, April 29 - May 2, 2014, Beijing, Chin, Beijing, China},
pages = {81--84},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISBI.2014.6867814},
doi = {10.1109/ISBI.2014.6867814},
timestamp = {Wed, 04 Oct 2023 17:01:25 +0200},
biburl = {https://dblp.org/rec/conf/isbi/KainzVSWMKPKSAHSFBMOPPRSMKSP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/issre/TurkayMGC14,
author = {Cagatay Turkay and
Stephen Mason and
Ilir Gashi and
Bojan Cukic},
title = {Supporting Decision-Making for Biometric System Deployment through
Visual Analysis},
booktitle = {25th {IEEE} International Symposium on Software Reliability Engineering
Workshops, {ISSRE} Workshops, Naples, Italy, November 3-6, 2014},
pages = {347--352},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/ISSREW.2014.78},
doi = {10.1109/ISSREW.2014.78},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/issre/TurkayMGC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jcdl/RoseT14,
author = {Stephen Rose and
Sandra Tuppen},
editor = {Ben Fields and
Kevin R. Page},
title = {Prospects for a Big Data History of Music},
booktitle = {Proceedings of the 1st International Workshop on Digital Libraries
for Musicology, DLfM@JCDL 2014, London, United Kingdom, September
12, 2014},
pages = {1--3},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2660168.2660177},
doi = {10.1145/2660168.2660177},
timestamp = {Tue, 06 Nov 2018 16:59:02 +0100},
biburl = {https://dblp.org/rec/conf/jcdl/RoseT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/LeKMGPSTDET14,
author = {Son T. Le and
Thavamaran Kanesan and
Mary E. McCarthy and
Elias G. Giacoumidis and
Ian D. Phillips and
Marc F. C. Stephens and
Mingming Tan and
Nick J. Doran and
Andrew D. Ellis and
S. K. Turitsyn},
title = {Experimental demonstration of data-dependent pilot-aided phase noise
estimation for {CO-OFDM}},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2014,
San Francisco, CA, USA, March 9-13, 2014},
pages = {1--3},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1364/OFC.2014.Tu3G.4},
doi = {10.1364/OFC.2014.TU3G.4},
timestamp = {Fri, 14 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/LeKMGPSTDET14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/PhillipsTSMGSRF14,
author = {Ian D. Phillips and
Mingming Tan and
Marc F. C. Stephens and
Mary E. McCarthy and
Elias G. Giacoumidis and
Stelios Sygletos and
Pawel Rosa and
Simon Fabbri and
Son Thai Le and
Thavamaran Kanesan and
Sergey K. Turitsyn and
Nick J. Doran and
Paul Harper and
Andrew D. Ellis},
title = {Exceeding the nonlinear-shannon limit using raman laser based amplification
and optical phase conjugation},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2014,
San Francisco, CA, USA, March 9-13, 2014},
pages = {1--3},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1364/OFC.2014.M3C.1},
doi = {10.1364/OFC.2014.M3C.1},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/PhillipsTSMGSRF14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/osdi/ZhengTKL14,
author = {Wenting Zheng and
Stephen Tu and
Eddie Kohler and
Barbara Liskov},
editor = {Jason Flinn and
Hank Levy},
title = {Fast Databases with Fast Durability and Recovery Through Multicore
Parallelism},
booktitle = {11th {USENIX} Symposium on Operating Systems Design and Implementation,
{OSDI} '14, Broomfield, CO, USA, October 6-8, 2014},
pages = {465--477},
publisher = {{USENIX} Association},
year = {2014},
url = {https://www.usenix.org/conference/osdi14/technical-sessions/presentation/zheng\_wenting},
timestamp = {Tue, 02 Feb 2021 08:05:58 +0100},
biburl = {https://dblp.org/rec/conf/osdi/ZhengTKL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rss/SananTBSC14,
author = {Siddharth Sanan and
Stephen Tully and
Andrea Bajo and
Nabil Simaan and
Howie Choset},
editor = {Dieter Fox and
Lydia E. Kavraki and
Hanna Kurniawati},
title = {Simultaneous Compliance and Registration Estimation for Robotic Surgery},
booktitle = {Robotics: Science and Systems X, University of California, Berkeley,
USA, July 12-16, 2014},
year = {2014},
url = {http://www.roboticsproceedings.org/rss10/p51.html},
doi = {10.15607/RSS.2014.X.051},
timestamp = {Fri, 29 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/rss/SananTBSC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigada/TaftMPM14,
author = {S. Tucker Taft and
Brad Moore and
Lu{\'{\i}}s Miguel Pinho and
Stephen Michell},
editor = {Michael B. Feldman and
S. Tucker Taft},
title = {Safe parallel programming in ada with language extensions},
booktitle = {Proceedings of the 2014 {ACM} SIGAda annual conference on High integrity
language technology, {HILT} 2014, Portland, Oregon, USA, October 18-21,
2014},
pages = {87--96},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2663171.2663181},
doi = {10.1145/2663171.2663181},
timestamp = {Fri, 02 Jun 2023 17:16:28 +0200},
biburl = {https://dblp.org/rec/conf/sigada/TaftMPM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uist/RetelnyRTLPRDVB14,
author = {Daniela Retelny and
S{\'{e}}bastien Robaszkiewicz and
Alexandra To and
Walter S. Lasecki and
Jay Patel and
Negar Rahmati and
Tulsee Doshi and
Melissa A. Valentine and
Michael S. Bernstein},
editor = {Hrvoje Benko and
Mira Dontcheva and
Daniel Wigdor},
title = {Expert crowdsourcing with flash teams},
booktitle = {The 27th Annual {ACM} Symposium on User Interface Software and Technology,
{UIST} '14, Honolulu, HI, USA, October 5-8, 2014},
pages = {75--85},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2642918.2647409},
doi = {10.1145/2642918.2647409},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uist/RetelnyRTLPRDVB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/asiasim/2014,
editor = {Satoshi Tanaka and
Kyoko Hasegawa and
Rui Xu and
Naohisa Sakamoto and
Stephen John Turner},
title = {AsiaSim 2014 - 14th International Conference on Systems Simulation,
Kitakyushu, Japan, October 26-30, 2014. Proceedings},
series = {Communications in Computer and Information Science},
volume = {474},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-662-45289-9},
doi = {10.1007/978-3-662-45289-9},
isbn = {978-3-662-45288-2},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asiasim/2014.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2014,
editor = {Franz Winkler and
Viorel Negru and
Tetsuo Ida and
Tudor Jebelean and
Dana Petcu and
Stephen M. Watt and
Daniela Zaharie},
title = {16th International Symposium on Symbolic and Numeric Algorithms for
Scientific Computing, {SYNASC} 2014, Timisoara, Romania, September
22-25, 2014},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://ieeexplore.ieee.org/xpl/conhome/7031476/proceeding},
isbn = {978-1-4799-8447-3},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/synasc/2014.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/BostPTG14,
author = {Raphael Bost and
Raluca Ada Popa and
Stephen Tu and
Shafi Goldwasser},
title = {Machine Learning Classification over Encrypted Data},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {331},
year = {2014},
url = {http://eprint.iacr.org/2014/331},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/BostPTG14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biodb/MathiasHYZBUO13,
author = {Stephen L. Mathias and
Jarrett Hines{-}Kay and
Jeremy J. Yang and
Gergely Zahor{\'{a}}nszky{-}K{\"{o}}halmi and
Cristian Bologa and
Oleg Ursu and
Tudor I. Oprea},
title = {The {CARLSBAD} Database: {A} Confederated Database of Chemical Bioactivities},
journal = {Database J. Biol. Databases Curation},
volume = {2013},
year = {2013},
url = {https://doi.org/10.1093/database/bat044},
doi = {10.1093/DATABASE/BAT044},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/biodb/MathiasHYZBUO13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cgf/JeongSHLTFHNYLP13,
author = {Won{-}Ki Jeong and
Jens Schneider and
Axel Hansen and
Manhee Lee and
Stephen G. Turney and
Beverly E. Faulkner{-}Jones and
Jonathan L. Hecht and
R. Najarian and
Eric Yee and
Jeff W. Lichtman and
Hanspeter Pfister},
title = {A Collaborative Digital Pathology System for Multi-Touch Mobile and
Desktop Computing Platforms},
journal = {Comput. Graph. Forum},
volume = {32},
number = {6},
pages = {227--242},
year = {2013},
url = {https://doi.org/10.1111/cgf.12137},
doi = {10.1111/CGF.12137},
timestamp = {Thu, 11 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cgf/JeongSHLTFHNYLP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/NorthCSCET13,
author = {Frederick North and
Sarah J. Crane and
Robert J. Stroebel and
Stephen S. Cha and
Eric S. Edell and
Sidna M. Tulledge{-}Scheitel},
title = {Research and applications: Patient-generated secure messages and eVisits
on a patient portal: are patients at risk?},
journal = {J. Am. Medical Informatics Assoc.},
volume = {20},
number = {6},
pages = {1143--1149},
year = {2013},
url = {https://doi.org/10.1136/amiajnl-2012-001208},
doi = {10.1136/AMIAJNL-2012-001208},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/NorthCSCET13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/LiST13,
author = {Yuanxi Li and
Stephen Swift and
Allan Tucker},
title = {Modelling and analysing the dynamics of disease progression from cross-sectional
studies},
journal = {J. Biomed. Informatics},
volume = {46},
number = {2},
pages = {266--274},
year = {2013},
url = {https://doi.org/10.1016/j.jbi.2012.11.003},
doi = {10.1016/J.JBI.2012.11.003},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/LiST13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jphonetics/GengTSMHRWPBCDD13,
author = {Christian Geng and
Alice Turk and
James M. Scobbie and
Cedric Macmartin and
Philip Hoole and
Korin Richmond and
Alan Wrench and
Marianne Pouplier and
Ellen Gurman Bard and
Ziggy Campbell and
Catherine Dickie and
Eddie Dubourg and
William J. Hardcastle and
Evia Kainada and
Simon King and
Robin J. Lickley and
Satsuki Nakai and
Steve Renals and
Kevin White and
Ronny Wiegand},
title = {Recording speech articulation in dialogue: Evaluating a synchronized
double electromagnetic articulography setup},
journal = {J. Phonetics},
volume = {41},
number = {6},
pages = {421--431},
year = {2013},
url = {https://doi.org/10.1016/j.wocn.2013.07.002},
doi = {10.1016/J.WOCN.2013.07.002},
timestamp = {Mon, 29 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jphonetics/GengTSMHRWPBCDD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mansci/BaliBD13,
author = {Turan G. Bali and
Stephen J. Brown and
K. Ozgur Demirtas},
title = {Do Hedge Funds Outperform Stocks and Bonds?},
journal = {Manag. Sci.},
volume = {59},
number = {8},
pages = {1887--1903},
year = {2013},
url = {https://doi.org/10.1287/mnsc.1120.1689},
doi = {10.1287/MNSC.1120.1689},
timestamp = {Tue, 30 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mansci/BaliBD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BarchBHPSCGCDFNBHFBPSJSE13,
author = {Deanna M. Barch and
Gregory C. Burgess and
Michael P. Harms and
Steven E. Petersen and
Bradley L. Schlaggar and
Maurizio Corbetta and
Matthew F. Glasser and
Sandra W. Curtiss and
Sachin Dixit and
Cindy Feldt and
Dan Nolan and
Edward Bryant and
Tucker Hartley and
Owen Footer and
James M. Bjork and
Russell A. Poldrack and
Steve M. Smith and
Heidi Johansen{-}Berg and
Abraham Z. Snyder and
David C. Van Essen},
title = {Function in the human connectome: Task-fMRI and individual differences
in behavior},
journal = {NeuroImage},
volume = {80},
pages = {169--189},
year = {2013},
url = {https://doi.org/10.1016/j.neuroimage.2013.05.033},
doi = {10.1016/J.NEUROIMAGE.2013.05.033},
timestamp = {Mon, 22 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/BarchBHPSCGCDFNBHFBPSJSE13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pvldb/DeBrabantPTSZ13,
author = {Justin A. DeBrabant and
Andrew Pavlo and
Stephen Tu and
Michael Stonebraker and
Stanley B. Zdonik},
title = {Anti-Caching: {A} New Approach to Database Management System Architecture},
journal = {Proc. {VLDB} Endow.},
volume = {6},
number = {14},
pages = {1942--1953},
year = {2013},
url = {http://www.vldb.org/pvldb/vol6/p1942-debrabant.pdf},
doi = {10.14778/2556549.2556575},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pvldb/DeBrabantPTSZ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pvldb/TuKMZ13,
author = {Stephen Tu and
M. Frans Kaashoek and
Samuel Madden and
Nickolai Zeldovich},
title = {Processing Analytical Queries over Encrypted Data},
journal = {Proc. {VLDB} Endow.},
volume = {6},
number = {5},
pages = {289--300},
year = {2013},
url = {http://www.vldb.org/pvldb/vol6/p289-tu.pdf},
doi = {10.14778/2535573.2488336},
timestamp = {Wed, 09 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pvldb/TuKMZ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/GuoGLTND13,
author = {Liang Guo and
Gareth S. Guvanasen and
Xi Liu and
Christopher Tuthill and
T. Richard Nichols and
Stephen P. DeWeerth},
title = {A PDMS-Based Integrated Stretchable Microelectrode Array (isMEA) for
Neural and Muscular Surface Interfacing},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {7},
number = {1},
pages = {1--10},
year = {2013},
url = {https://doi.org/10.1109/TBCAS.2012.2192932},
doi = {10.1109/TBCAS.2012.2192932},
timestamp = {Wed, 17 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbcas/GuoGLTND13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/JonesBTZ13,
author = {Dustin Jones and
Debangsu Bhattacharyya and
Richard Turton and
Stephen E. Zitney},
title = {Optimal selection of primary controlled variables for an acid gas
removal unit as part of an {IGCC} plant with {CO2} capture},
booktitle = {American Control Conference, {ACC} 2013, Washington, DC, USA, June
17-19, 2013},
pages = {5035--5040},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ACC.2013.6580620},
doi = {10.1109/ACC.2013.6580620},
timestamp = {Sun, 08 Aug 2021 01:40:56 +0200},
biburl = {https://dblp.org/rec/conf/amcc/JonesBTZ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/PaulBTZ13,
author = {Prokash Paul and
Debangsu Bhattacharyya and
Richard Turton and
Stephen E. Zitney},
title = {Adaptive Kalman filter for estimation of environmental performance
variables in an acid gas removal process},
booktitle = {American Control Conference, {ACC} 2013, Washington, DC, USA, June
17-19, 2013},
pages = {2717--2721},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ACC.2013.6580245},
doi = {10.1109/ACC.2013.6580245},
timestamp = {Sun, 08 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amcc/PaulBTZ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/MartinsTMRFLFSDG13,
author = {Susana B. Martins and
Samson W. Tu and
Richard Martinello and
Michael Rubin and
Philip Foulis and
Stephen Luther and
Tyler Forbush and
Matthew Scotch and
Brad Doebbelling and
Mary K. Goldstein},
title = {Creating a {MRSA} Ontology to Support Categorization of {MRSA} Infections},
booktitle = {{AMIA} 2013, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 16-20, 2013},
publisher = {{AMIA}},
year = {2013},
url = {https://knowledge.amia.org/amia-55142-a2013e-1.580047/t-06-1.582200/f-006-1.582201/a-333-1.582989/a-335-1.582983},
timestamp = {Wed, 17 Apr 2024 11:47:55 +0200},
biburl = {https://dblp.org/rec/conf/amia/MartinsTMRFLFSDG13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/JinTLZH13,
author = {Jiangming Jin and
Stephen John Turner and
Bu{-}Sung Lee and
Jianlong Zhong and
Bingsheng He},
title = {Simulation of Information Propagation over Complex Networks: Performance
Studies on Multi-GPU},
booktitle = {17th {IEEE/ACM} International Symposium on Distributed Simulation
and Real Time Applications, {DS-RT} 2013, Delft, The Netherlands,
October 30 - November 1, 2013},
pages = {179--188},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/DS-RT.2013.27},
doi = {10.1109/DS-RT.2013.27},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dsrt/JinTLZH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/ZhaoTC13,
author = {Mingbi Zhao and
Stephen John Turner and
Wentong Cai},
title = {A Data-Driven Crowd Simulation Model Based on Clustering and Classification},
booktitle = {17th {IEEE/ACM} International Symposium on Distributed Simulation
and Real Time Applications, {DS-RT} 2013, Delft, The Netherlands,
October 30 - November 1, 2013},
pages = {125--134},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/DS-RT.2013.21},
doi = {10.1109/DS-RT.2013.21},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsrt/ZhaoTC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/AnsaloniKZBBT13,
author = {Danilo Ansaloni and
Stephen Kell and
Yudi Zheng and
Lubom{\'{\i}}r Bulej and
Walter Binder and
Petr Tuma},
editor = {Giuseppe Castagna},
title = {Enabling Modularity and Re-use in Dynamic Program Analysis Tools for
the Java Virtual Machine},
booktitle = {{ECOOP} 2013 - Object-Oriented Programming - 27th European Conference,
Montpellier, France, July 1-5, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7920},
pages = {352--377},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-39038-8\_15},
doi = {10.1007/978-3-642-39038-8\_15},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ecoop/AnsaloniKZBBT13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/MatikoBT13,
author = {Joseph W. Matiko and
Stephen P. Beeby and
John Tudor},
title = {Real time eye blink noise removal from {EEG} signals using morphological
component analysis},
booktitle = {35th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2013, Osaka, Japan, July 3-7,
2013},
pages = {13--16},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/EMBC.2013.6609425},
doi = {10.1109/EMBC.2013.6609425},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/embc/MatikoBT13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/enase/KamalakarED13,
author = {Sunil Kamalakar and
Stephen H. Edwards and
Tung M. Dao},
editor = {Leszek A. Maciaszek and
Joaquim Filipe},
title = {Automatically Generating Tests from Natural Language Descriptions
of Software Behavior},
booktitle = {{ENASE} 2013 - Proceedings of the 8th International Conference on
Evaluation of Novel Approaches to Software Engineering, Angers, France,
4-6 July, 2013},
pages = {238--245},
publisher = {SciTePress},
year = {2013},
url = {https://doi.org/10.5220/0004566002380245},
doi = {10.5220/0004566002380245},
timestamp = {Fri, 19 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/enase/KamalakarED13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/TurnerU13,
author = {Stephen W. Turner and
Suleyman Uludag},
editor = {Randa L. Shehab and
James J. Sluss and
Deborah Anne Trytten},
title = {Student perceptions of cheating in online and traditional classes},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2013, Oklahoma City,
Oklahoma, USA, October 23-26, 2013},
pages = {1131--1137},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/FIE.2013.6685007},
doi = {10.1109/FIE.2013.6685007},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fie/TurnerU13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gpce/MarekKZBBTASS13,
author = {Luk{\'{a}}s Marek and
Stephen Kell and
Yudi Zheng and
Lubom{\'{\i}}r Bulej and
Walter Binder and
Petr Tuma and
Danilo Ansaloni and
Aibek Sarimbekov and
Andreas Sewe},
editor = {Jaakko J{\"{a}}rvi and
Christian K{\"{a}}stner},
title = {ShadowVM: robust and comprehensive dynamic program analysis for the
java platform},
booktitle = {Generative Programming: Concepts and Experiences, GPCE'13, Indianapolis,
IN, {USA} - October 27 - 28, 2013},
pages = {105--114},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2517208.2517219},
doi = {10.1145/2517208.2517219},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gpce/MarekKZBBTASS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hotcloud/LeeLPTBSS13,
author = {Jeongkeun Lee and
Myungjin Lee and
Lucian Popa and
Yoshio Turner and
Sujata Banerjee and
Puneet Sharma and
Bryan Stephenson},
editor = {Dilma Da Silva and
George Porter},
title = {CloudMirror: Application-Aware Bandwidth Reservations in the Cloud},
booktitle = {5th {USENIX} Workshop on Hot Topics in Cloud Computing, HotCloud'13,
San Jose, CA, USA, June 25-26, 2013},
publisher = {{USENIX} Association},
year = {2013},
url = {https://www.usenix.org/conference/hotcloud13/workshop-program/presentations/lee},
timestamp = {Tue, 09 Feb 2021 08:31:36 +0100},
biburl = {https://dblp.org/rec/conf/hotcloud/LeeLPTBSS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icaisc/KeithW13,
author = {Tureiti Keith and
Stephen John Weddell},
editor = {Leszek Rutkowski and
Marcin Korytkowski and
Rafal Scherer and
Ryszard Tadeusiewicz and
Lotfi A. Zadeh and
Jacek M. Zurada},
title = {The Echo State Network on the Graphics Processing Unit},
booktitle = {Artificial Intelligence and Soft Computing - 12th International Conference,
{ICAISC} 2013, Zakopane, Poland, June 9-13, 2013, Proceedings, Part
{I}},
series = {Lecture Notes in Computer Science},
volume = {7894},
pages = {96--107},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-38658-9\_9},
doi = {10.1007/978-3-642-38658-9\_9},
timestamp = {Wed, 13 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icaisc/KeithW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/CharlesAJCTD13,
author = {Adam Charles and
Ali Ahmed and
Aditya Joshi and
Stephen Conover and
Christopher K. Turnes and
Mark A. Davenport},
title = {Cleaning up toxic waste: Removing nefarious contributions to recommendation
systems},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2013, Vancouver, BC, Canada, May 26-31, 2013},
pages = {6571--6575},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICASSP.2013.6638932},
doi = {10.1109/ICASSP.2013.6638932},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icassp/CharlesAJCTD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccabs/KinserLTRB13,
author = {Jason M. Kinser and
Stephen J. Lockett and
Thomas Turbyville and
Karlyne M. Reilly and
John Beutler},
title = {Comparing analysis engines for generated micro-patterned, actin images},
booktitle = {{IEEE} 3rd International Conference on Computational Advances in Bio
and Medical Sciences, {ICCABS} 2013, New Orleans, LA, USA, June 12-14,
2013},
pages = {1--5},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/ICCABS.2013.6629198},
doi = {10.1109/ICCABS.2013.6629198},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccabs/KinserLTRB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/TullyKC13,
author = {Stephen Tully and
George Kantor and
Howie Choset},
title = {Monocular feature-based periodic motion estimation for surgical guidance},
booktitle = {2013 {IEEE} International Conference on Robotics and Automation, Karlsruhe,
Germany, May 6-10, 2013},
pages = {4403--4408},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICRA.2013.6631201},
doi = {10.1109/ICRA.2013.6631201},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/icra/TullyKC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ida/PavlidisSTC13,
author = {Stelios Pavlidis and
Stephen Swift and
Allan Tucker and
Steve Counsell},
editor = {Allan Tucker and
Frank H{\"{o}}ppner and
Arno Siebes and
Stephen Swift},
title = {The Modelling of Glaucoma Progression through the Use of Cellular
Automata},
booktitle = {Advances in Intelligent Data Analysis {XII} - 12th International Symposium,
{IDA} 2013, London, UK, October 17-19, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8207},
pages = {322--332},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-41398-8\_28},
doi = {10.1007/978-3-642-41398-8\_28},
timestamp = {Tue, 14 May 2019 10:00:49 +0200},
biburl = {https://dblp.org/rec/conf/ida/PavlidisSTC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/indin/StephensonAV13,
author = {Zo{\"{e}} R. Stephenson and
Jaume Abella and
Tullio Vardanega},
title = {Supporting industrial use of probabilistic timing analysis with explicit
argumentation},
booktitle = {11th {IEEE} International Conference on Industrial Informatics, {INDIN}
2013, Bochum, Germany, July 29-31, 2013},
pages = {734--740},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/INDIN.2013.6622975},
doi = {10.1109/INDIN.2013.6622975},
timestamp = {Tue, 18 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/indin/StephensonAV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/TangTKWKGTW13,
author = {Wai Teng Tang and
Wen Jun Tan and
Ratna Krishnamoorthy and
Yi Wen Wong and
Shyh{-}Hao Kuo and
Rick Siow Mong Goh and
Stephen John Turner and
Weng{-}Fai Wong},
title = {Optimizing and Auto-Tuning Iterative Stencil Loops for GPUs with the
In-Plane Method},
booktitle = {27th {IEEE} International Symposium on Parallel and Distributed Processing,
{IPDPS} 2013, Cambridge, MA, USA, May 20-24, 2013},
pages = {452--462},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/IPDPS.2013.79},
doi = {10.1109/IPDPS.2013.79},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ipps/TangTKWKGTW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/LiCT13,
author = {Xiaosong Li and
Wentong Cai and
Stephen John Turner},
editor = {Margaret L. Loper and
Gabriel A. Wainer},
title = {{GPU} accelerated three-stage execution model for event-parallel simulation},
booktitle = {{SIGSIM} Principles of Advanced Discrete Simulation, {SIGSIM-PADS}
'13, Montreal, QC, Canada, May 19-22, 2013},
pages = {57--66},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2486092.2486100},
doi = {10.1145/2486092.2486100},
timestamp = {Wed, 10 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/LiCT13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/LiLDCT13,
author = {Zengxiang Li and
Xiaorong Li and
Ta Nguyen Binh Duong and
Wentong Cai and
Stephen John Turner},
editor = {Margaret L. Loper and
Gabriel A. Wainer},
title = {Accelerating optimistic HLA-based simulations in virtual execution
environments},
booktitle = {{SIGSIM} Principles of Advanced Discrete Simulation, {SIGSIM-PADS}
'13, Montreal, QC, Canada, May 19-22, 2013},
pages = {211--220},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2486092.2486119},
doi = {10.1145/2486092.2486119},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/LiLDCT13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/TangTRWCKGTW13,
author = {Wai Teng Tang and
Wen Jun Tan and
Rajarshi Ray and
Yi Wen Wong and
Weiguang Chen and
Shyh{-}Hao Kuo and
Rick Siow Mong Goh and
Stephen John Turner and
Weng{-}Fai Wong},
editor = {William Gropp and
Satoshi Matsuoka},
title = {Accelerating sparse matrix-vector multiplication on GPUs using bit-representation-optimized
schemes},
booktitle = {International Conference for High Performance Computing, Networking,
Storage and Analysis, SC'13, Denver, CO, {USA} - November 17 - 21,
2013},
pages = {26:1--26:12},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2503210.2503234},
doi = {10.1145/2503210.2503234},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sc/TangTRWCKGTW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sosp/TuZKLM13,
author = {Stephen Tu and
Wenting Zheng and
Eddie Kohler and
Barbara Liskov and
Samuel Madden},
editor = {Michael Kaminsky and
Mike Dahlin},
title = {Speedy transactions in multicore in-memory databases},
booktitle = {{ACM} {SIGOPS} 24th Symposium on Operating Systems Principles, {SOSP}
'13, Farmington, PA, USA, November 3-6, 2013},
pages = {18--32},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2517349.2522713},
doi = {10.1145/2517349.2522713},
timestamp = {Wed, 09 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sosp/TuZKLM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/supercomputer/PattersonPHMTCMB13,
author = {Michael K. Patterson and
Stephen W. Poole and
Chung{-}Hsing Hsu and
Don E. Maxwell and
William Tschudi and
Henry Coles and
David J. Martinez and
Natalie J. Bates},
editor = {Julian M. Kunkel and
Thomas Ludwig and
Hans Werner Meuer},
title = {TUE, a New Energy-Efficiency Metric Applied at ORNL's Jaguar},
booktitle = {Supercomputing - 28th International Supercomputing Conference, {ISC}
2013, Leipzig, Germany, June 16-20, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7905},
pages = {372--382},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-38750-0\_28},
doi = {10.1007/978-3-642-38750-0\_28},
timestamp = {Tue, 14 May 2019 10:00:40 +0200},
biburl = {https://dblp.org/rec/conf/supercomputer/PattersonPHMTCMB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/JinTLZH13,
author = {Jiangming Jin and
Stephen John Turner and
Bu{-}Sung Lee and
Jianlong Zhong and
Bingsheng He},
title = {Simulation studies of viral advertisement diffusion on multi-GPU},
booktitle = {Winter Simulations Conference: Simulation Making Decisions in a Complex
World, {WSC} 2013, Washington, DC, USA, December 8-11, 2013},
pages = {1592--1603},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/WSC.2013.6721542},
doi = {10.1109/WSC.2013.6721542},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/JinTLZH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:conf/dagstuhl/BroersenCEGGLPTTTS13,
author = {Jan M. Broersen and
Stephen Cranefield and
Yehia Elrakaiby and
Dov M. Gabbay and
Davide Grossi and
Emiliano Lorini and
Xavier Parent and
Leendert W. N. van der Torre and
Luca Tummolini and
Paolo Turrini and
Fran{\c{c}}ois Schwarzentruber},
editor = {Giulia Andrighetto and
Guido Governatori and
Pablo Noriega and
Leendert W. N. van der Torre},
title = {Normative Reasoning and Consequence},
booktitle = {Normative Multi-Agent Systems},
series = {Dagstuhl Follow-Ups},
volume = {4},
pages = {33--70},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2013},
url = {https://doi.org/10.4230/DFU.Vol4.12111.33},
doi = {10.4230/DFU.VOL4.12111.33},
timestamp = {Mon, 27 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dagstuhl/BroersenCEGGLPTTTS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/asiasim/2013,
editor = {Gary S. H. Tan and
Gee Kin Yeo and
Stephen John Turner and
Yong Meng Teo},
title = {AsiaSim 2013 - 13th International Conference on Systems Simulation,
Singapore, November 6-8, 2013. Proceedings},
series = {Communications in Computer and Information Science},
volume = {402},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-45037-2},
doi = {10.1007/978-3-642-45037-2},
isbn = {978-3-642-45036-5},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asiasim/2013.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ida/2013,
editor = {Allan Tucker and
Frank H{\"{o}}ppner and
Arno Siebes and
Stephen Swift},
title = {Advances in Intelligent Data Analysis {XII} - 12th International Symposium,
{IDA} 2013, London, UK, October 17-19, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8207},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-41398-8},
doi = {10.1007/978-3-642-41398-8},
isbn = {978-3-642-41397-1},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ida/2013.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2013,
editor = {Nikolaj S. Bj{\o}rner and
Viorel Negru and
Tetsuo Ida and
Tudor Jebelean and
Dana Petcu and
Stephen M. Watt and
Daniela Zaharie},
title = {15th International Symposium on Symbolic and Numeric Algorithms for
Scientific Computing, {SYNASC} 2013, Timisoara, Romania, September
23-26, 2013},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://ieeexplore.ieee.org/xpl/conhome/6820820/proceeding},
isbn = {978-1-4799-3035-7},
timestamp = {Thu, 14 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/synasc/2013.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc6916,
author = {Roque Gagliano and
Stephen T. Kent and
Sean Turner},
title = {Algorithm Agility Procedure for the Resource Public Key Infrastructure
{(RPKI)}},
journal = {{RFC}},
volume = {6916},
pages = {1--20},
year = {2013},
url = {https://doi.org/10.17487/RFC6916},
doi = {10.17487/RFC6916},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rfc/rfc6916.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc7093,
author = {Sean Turner and
Stephen T. Kent and
James Manger},
title = {Additional Methods for Generating Key Identifiers Values},
journal = {{RFC}},
volume = {7093},
pages = {1--5},
year = {2013},
url = {https://doi.org/10.17487/RFC7093},
doi = {10.17487/RFC7093},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rfc/rfc7093.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/basesearch/Sachs12,
author = {Stephen Sachs},
title = {Multigrid Methods applied to Fluid-Structure Interaction},
school = {{TU} Darmstadt, Germany},
year = {2012},
url = {http://tuprints.ulb.tu-darmstadt.de/2917/},
timestamp = {Wed, 20 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/phd/basesearch/Sachs12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/artmed/ZhuGTRD12,
author = {Vivienne J. Zhu and
Shaun J. Grannis and
Wanzhu Tu and
Marc B. Rosenman and
Stephen M. Downs},
title = {Evaluation of a clinical decision support algorithm for patient-specific
childhood immunization},
journal = {Artif. Intell. Medicine},
volume = {56},
number = {1},
pages = {51--57},
year = {2012},
url = {https://doi.org/10.1016/j.artmed.2012.04.004},
doi = {10.1016/J.ARTMED.2012.04.004},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/artmed/ZhuGTRD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmig/WongSTWMA12,
author = {Kelvin Kian Loong Wong and
Zhonghua Sun and
Jiyuan Tu and
Stephen G. Worthley and
Jagannath Mazumdar and
Derek Abbott},
title = {Medical image diagnostics based on computer-aided flow analysis using
magnetic resonance images},
journal = {Comput. Medical Imaging Graph.},
volume = {36},
number = {7},
pages = {527--541},
year = {2012},
url = {https://doi.org/10.1016/j.compmedimag.2012.04.003},
doi = {10.1016/J.COMPMEDIMAG.2012.04.003},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmig/WongSTWMA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/ShakeriLTL12,
author = {Mojtaba Shakeri and
Malcolm Yoke Hean Low and
Stephen John Turner and
Eng Wah Lee},
title = {A robust two-phase heuristic algorithm for the truck scheduling problem
in a resource-constrained crossdock},
journal = {Comput. Oper. Res.},
volume = {39},
number = {11},
pages = {2564--2577},
year = {2012},
url = {https://doi.org/10.1016/j.cor.2012.01.002},
doi = {10.1016/J.COR.2012.01.002},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cor/ShakeriLTL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esticas/YooTNLBSWGREC12,
author = {Juhwan Yoo and
Christopher K. Turnes and
Eric B. Nakamura and
Chi K. Le and
Stephen Becker and
Emilio A. Sovero and
Michael B. Wakin and
Michael C. Grant and
Justin K. Romberg and
Azita Emami{-}Neyestanak and
Emmanuel J. Cand{\`{e}}s},
title = {A Compressed Sensing Parameter Extraction Platform for Radar Pulse
Signal Acquisition},
journal = {{IEEE} J. Emerg. Sel. Topics Circuits Syst.},
volume = {2},
number = {3},
pages = {626--638},
year = {2012},
url = {https://doi.org/10.1109/JETCAS.2012.2214634},
doi = {10.1109/JETCAS.2012.2214634},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/esticas/YooTNLBSWGREC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijrr/TullyKC12,
author = {Stephen Tully and
George Kantor and
Howie Choset},
title = {A unified Bayesian framework for global localization and {SLAM} in
hybrid metric/topological maps},
journal = {Int. J. Robotics Res.},
volume = {31},
number = {3},
pages = {271--288},
year = {2012},
url = {https://doi.org/10.1177/0278364911433617},
doi = {10.1177/0278364911433617},
timestamp = {Thu, 17 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijrr/TullyKC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jot/ArzokySTC12,
author = {Mahir Arzoky and
Stephen Swift and
Allan Tucker and
James Cain},
title = {A Seeded Search for the Modularisation of Sequential Software Versions},
journal = {J. Object Technol.},
volume = {11},
number = {2},
pages = {6: 1--27},
year = {2012},
url = {https://doi.org/10.5381/jot.2012.11.2.a6},
doi = {10.5381/JOT.2012.11.2.A6},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jot/ArzokySTC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WangXSZWZHKDSBGB12,
author = {Yanli Wang and
Jewen Xiao and
Tugba O. Suzek and
Jian Zhang and
Jiyao Wang and
Zhigang Zhou and
Lianyi Han and
Karen Karapetyan and
Svetlana Dracheva and
Benjamin A. Shoemaker and
Evan Bolton and
Asta Gindulyte and
Stephen H. Bryant},
title = {PubChem's BioAssay Database},
journal = {Nucleic Acids Res.},
volume = {40},
number = {Database-Issue},
pages = {400--412},
year = {2012},
url = {https://doi.org/10.1093/nar/gkr1132},
doi = {10.1093/NAR/GKR1132},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nar/WangXSZWZHKDSBGB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/LiGFZCYLDJZHZML12,
author = {Kaiming Li and
Lei Guo and
Carlos Faraco and
Dajiang Zhu and
Hanbo Chen and
Yixuan Yuan and
Jinglei Lv and
Fan Deng and
Xi Jiang and
Tuo Zhang and
Xintao Hu and
Degang Zhang and
L. Stephen Miller and
Tianming Liu},
title = {Visual analytics of brain networks},
journal = {NeuroImage},
volume = {61},
number = {1},
pages = {82--97},
year = {2012},
url = {https://doi.org/10.1016/j.neuroimage.2012.02.075},
doi = {10.1016/J.NEUROIMAGE.2012.02.075},
timestamp = {Thu, 07 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/LiGFZCYLDJZHZML12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/TurnerLW12,
author = {Darren Turner and
Arko Lucieer and
Christopher S. Watson},
title = {An Automated Technique for Generating Georectified Mosaics from Ultra-High
Resolution Unmanned Aerial Vehicle {(UAV)} Imagery, Based on Structure
from Motion (SfM) Point Clouds},
journal = {Remote. Sens.},
volume = {4},
number = {5},
pages = {1392--1410},
year = {2012},
url = {https://doi.org/10.3390/rs4051392},
doi = {10.3390/RS4051392},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/TurnerLW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/WallaceLWT12,
author = {Luke Wallace and
Arko Lucieer and
Christopher S. Watson and
Darren Turner},
title = {Development of a UAV-LiDAR System with Application to Forest Inventory},
journal = {Remote. Sens.},
volume = {4},
number = {6},
pages = {1519--1543},
year = {2012},
url = {https://doi.org/10.3390/rs4061519},
doi = {10.3390/RS4061519},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/WallaceLWT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamam/ShipmanT12,
author = {Stephen P. Shipman and
Hairui Tu},
title = {Total Resonant Transmission and Reflection by Periodic Structures},
journal = {{SIAM} J. Appl. Math.},
volume = {72},
number = {1},
pages = {216--239},
year = {2012},
url = {https://doi.org/10.1137/110834196},
doi = {10.1137/110834196},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/siamam/ShipmanT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/TaylorTSM12,
author = {Simon J. E. Taylor and
Stephen John Turner and
Steffen Stra{\ss}burger and
Navonil Mustafee},
title = {Bridging the gap: {A} standards-based approach to {OR/MS} distributed
simulation},
journal = {{ACM} Trans. Model. Comput. Simul.},
volume = {22},
number = {4},
pages = {18:1--18:23},
year = {2012},
url = {https://doi.org/10.1145/2379810.2379811},
doi = {10.1145/2379810.2379811},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tomacs/TaylorTSM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wc/BaykasKCKKPRSS12,
author = {Tuncer Baykas and
Mika Kasslin and
Mark Cummings and
Hyunduk Kang and
Joe Kwak and
Richard Paine and
Alex Reznik and
Rashid A. Saeed and
Stephen J. Shellhammer},
title = {Developing a standard for {TV} white space coexistence: technical
challenges and solution approaches},
journal = {{IEEE} Wirel. Commun.},
volume = {19},
number = {1},
pages = {10--22},
year = {2012},
url = {https://doi.org/10.1109/MWC.2012.6155872},
doi = {10.1109/MWC.2012.6155872},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/wc/BaykasKCKKPRSS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asiasim/TanTA12,
author = {Wen Jun Tan and
Stephen John Turner and
Heiko Aydt},
editor = {Tianyuan Xiao and
Lin Zhang and
Minrui Fei},
title = {A Comparison of Multi-objective Evolutionary Algorithms for Simulation-Based
Optimization},
booktitle = {AsiaSim 2012 - Asia Simulation Conference 2012, Shanghai, China, October
27-30, 2012. Proceedings, Part {III}},
series = {Communications in Computer and Information Science},
volume = {325},
pages = {60--72},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-34387-2\_8},
doi = {10.1007/978-3-642-34387-2\_8},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asiasim/TanTA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/europar/WongDTTDGKTW12,
author = {Yi Wen Wong and
Tomasz Dubrownik and
Wai Teng Tang and
Wen Jun Tan and
Rubing Duan and
Rick Siow Mong Goh and
Shyh{-}Hao Kuo and
Stephen John Turner and
Weng{-}Fai Wong},
editor = {Christos Kaklamanis and
Theodore S. Papatheodorou and
Paul G. Spirakis},
title = {Tulipse: {A} Visualization Framework for User-Guided Parallelization},
booktitle = {Euro-Par 2012 Parallel Processing - 18th International Conference,
Euro-Par 2012, Rhodes Island, Greece, August 27-31, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7484},
pages = {4--15},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-32820-6\_3},
doi = {10.1007/978-3-642-32820-6\_3},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/europar/WongDTTDGKTW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ewgdss/TurnerW12,
author = {Simon Turner and
Stephen Wilmott},
editor = {Jorge E. Hern{\'{a}}ndez and
Shaofeng Liu and
Boris Delibasic and
Pascale Zarat{\'{e}} and
F{\'{a}}tima C. C. Dargam and
Rita A. Ribeiro},
title = {Decision Analysis in Magnox Limited: Developments in Techniques and
Stakeholder Engagement Processes},
booktitle = {Decision Support Systems {II} - Recent Developments Applied to {DSS}
Network Environments - Euro Working Group Workshop, {EWG-DSS} 2012,
Liverpool, UK, April 12-13, 2012, and Vilnius, Lithuania, July 8-11,
2012, Revised Selected and Extended Papers},
series = {Lecture Notes in Business Information Processing},
volume = {164},
pages = {115--125},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-41077-2\_9},
doi = {10.1007/978-3-642-41077-2\_9},
timestamp = {Wed, 20 Sep 2023 13:32:42 +0200},
biburl = {https://dblp.org/rec/conf/ewgdss/TurnerW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/UludagKGTK12,
author = {Suleyman Uludag and
Murat Karakus and
Evrim Guler and
Stephen W. Turner and
Afelete Kita},
editor = {Richard J. LeBlanc and
Ann E. K. Sobel},
title = {Assessment of a frugal, virtual and green computing lab infrastructure
of the future},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2012, Seattle, WA,
USA, October 3-6, 2012},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/FIE.2012.6462470},
doi = {10.1109/FIE.2012.6462470},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fie/UludagKGTK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpads/RajaseharanTTTKGW12,
author = {Chandrasehar Rajaseharan and
Wen Jun Tan and
Wai Teng Tang and
Stephen John Turner and
Shyh{-}Hao Kuo and
Rick Siow Mong Goh and
Weng{-}Fai Wong},
title = {Automatic Refactoring of Legacy Fortran Code to the Array Slicing
Notation},
booktitle = {18th {IEEE} International Conference on Parallel and Distributed Systems,
{ICPADS} 2012, Singapore, December 17-19, 2012},
pages = {698--699},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/ICPADS.2012.101},
doi = {10.1109/ICPADS.2012.101},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icpads/RajaseharanTTTKGW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/DeganiTZC12,
author = {Amir Degani and
Stephen Tully and
Brett Zubiate and
Howie Choset},
title = {Over-tube apparatus for increasing the capabilities of an articulated
robotic probe},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2012, 14-18 May, 2012, St. Paul, Minnesota, {USA}},
pages = {3533--3534},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICRA.2012.6224668},
doi = {10.1109/ICRA.2012.6224668},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/icra/DeganiTZC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/GongTKC12,
author = {Chaohui Gong and
Stephen Tully and
George Kantor and
Howie Choset},
title = {Multi-agent deterministic graph mapping via robot rendezvous},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2012, 14-18 May, 2012, St. Paul, Minnesota, {USA}},
pages = {1278--1283},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICRA.2012.6225274},
doi = {10.1109/ICRA.2012.6225274},
timestamp = {Mon, 22 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/GongTKC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/TullyBKCS12,
author = {Stephen Tully and
Andrea Bajo and
George Kantor and
Howie Choset and
Nabil Simaan},
title = {Constrained filtering with contact detection data for the localization
and registration of continuum robots in flexible environments},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2012, 14-18 May, 2012, St. Paul, Minnesota, {USA}},
pages = {3388--3394},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICRA.2012.6225080},
doi = {10.1109/ICRA.2012.6225080},
timestamp = {Mon, 22 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/TullyBKCS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ithet/GulerUKT12,
author = {Evrim Guler and
Suleyman Uludag and
Murat Karakus and
Stephen W. Turner},
title = {Virtualized lab infrastructure on a budget for various computing and
engineering courses},
booktitle = {2012 International Conference on Information Technology Based Higher
Education and Training, {ITHET} 2012, Istanbul, Turkey, June 21-23,
2012},
pages = {1--7},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ITHET.2012.6246028},
doi = {10.1109/ITHET.2012.6246028},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ithet/GulerUKT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ithet/KarakusUGTU12,
author = {Murat Karakus and
Suleyman Uludag and
Evrim Guler and
Stephen W. Turner and
Ahmet Ugur},
title = {Teaching computing and programming fundamentals via App Inventor for
Android},
booktitle = {2012 International Conference on Information Technology Based Higher
Education and Training, {ITHET} 2012, Istanbul, Turkey, June 21-23,
2012},
pages = {1--8},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ITHET.2012.6246020},
doi = {10.1109/ITHET.2012.6246020},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ithet/KarakusUGTU12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/XuLLXCAW12,
author = {Yanwu Xu and
Jiang Liu and
Stephen Lin and
Dong Xu and
Carol Yim{-}lui Cheung and
Tin Aung and
Tien Yin Wong},
editor = {Nicholas Ayache and
Herv{\'{e}} Delingette and
Polina Golland and
Kensaku Mori},
title = {Efficient Optic Cup Detection from Intra-image Learning with Retinal
Structure Priors},
booktitle = {Medical Image Computing and Computer-Assisted Intervention - {MICCAI}
2012 - 15th International Conference, Nice, France, October 1-5, 2012,
Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {7510},
pages = {58--65},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-33415-3\_8},
doi = {10.1007/978-3-642-33415-3\_8},
timestamp = {Mon, 01 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miccai/XuLLXCAW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/ZhaoPYQWGOPMET12,
author = {Haiping Zhao and
Iain Proctor and
Minghui Yang and
Xin Qi and
Mark Williams and
Qi Gao and
Guilherme Ottoni and
Andrew Paroski and
Scott MacVicar and
Jason Evans and
Stephen Tu},
editor = {Gary T. Leavens and
Matthew B. Dwyer},
title = {The HipHop compiler for {PHP}},
booktitle = {Proceedings of the 27th Annual {ACM} {SIGPLAN} Conference on Object-Oriented
Programming, Systems, Languages, and Applications, {OOPSLA} 2012,
part of {SPLASH} 2012, Tucson, AZ, USA, October 21-25, 2012},
pages = {575--586},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2384616.2384658},
doi = {10.1145/2384616.2384658},
timestamp = {Sat, 21 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/ZhaoPYQWGOPMET12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/LiTCT12,
author = {Zengxiang Li and
Xueyan Tang and
Wentong Cai and
Stephen John Turner},
title = {Fair and Efficient Dead Reckoning-Based Update Dissemination for Distributed
Virtual Environments},
booktitle = {26th {ACM/IEEE/SCS} Workshop on Principles of Advanced and Distributed
Simulation, {PADS} 2012, Zhangjiajie, China, July 15-19, 2012},
pages = {13--22},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/PADS.2012.18},
doi = {10.1109/PADS.2012.18},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/LiTCT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tpcg/LongshawTF12,
author = {Stephen M. Longshaw and
Martin J. Turner and
Emma Finch},
editor = {Hamish A. Carr and
Silvester Czanner},
title = {Visualizing a Spherical Geological Discrete Element Model of Fault
Evolution},
booktitle = {Theory and Practice of Computer Graphics, Rutherford, United Kingdom,
2012. Proceedings},
pages = {77--84},
publisher = {Eurographics Association},
year = {2012},
url = {https://doi.org/10.2312/LocalChapterEvents/TPCG/TPCG12/077-084},
doi = {10.2312/LOCALCHAPTEREVENTS/TPCG/TPCG12/077-084},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tpcg/LongshawTF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:journals/procedia/JinTLZH12,
author = {Jiangming Jin and
Stephen John Turner and
Bu{-}Sung Lee and
Jianlong Zhong and
Bingsheng He},
editor = {Hesham H. Ali and
Yong Shi and
Deepak Khazanchi and
Michael Lees and
G. Dick van Albada and
Jack J. Dongarra and
Peter M. A. Sloot},
title = {{HPC} Simulations of Information Propagation Over Social Networks},
booktitle = {Proceedings of the International Conference on Computational Science,
{ICCS} 2012, Omaha, Nebraska, USA, 4-6 June, 2012},
series = {Procedia Computer Science},
volume = {9},
pages = {292--301},
publisher = {Elsevier},
year = {2012},
url = {https://doi.org/10.1016/j.procs.2012.04.031},
doi = {10.1016/J.PROCS.2012.04.031},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/procedia/JinTLZH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2012,
editor = {Andrei Voronkov and
Viorel Negru and
Tetsuo Ida and
Tudor Jebelean and
Dana Petcu and
Stephen M. Watt and
Daniela Zaharie},
title = {14th International Symposium on Symbolic and Numeric Algorithms for
Scientific Computing, {SYNASC} 2012, Timisoara, Romania, September
26-29, 2012},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://ieeexplore.ieee.org/xpl/conhome/6480928/proceeding},
isbn = {978-1-4673-5026-6},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/synasc/2012.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dsp/DavisHTB11,
author = {Linda M. Davis and
Stephen V. Hanly and
Paul Tune and
Sibi Raj Bhaskaran},
title = {Channel estimation and user selection in the {MIMO} broadcast channel},
journal = {Digit. Signal Process.},
volume = {21},
number = {5},
pages = {608--618},
year = {2011},
url = {https://doi.org/10.1016/j.dsp.2011.01.003},
doi = {10.1016/J.DSP.2011.01.003},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dsp/DavisHTB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijrr/SmithTBR11,
author = {Stephen L. Smith and
Jana Tumova and
Calin Belta and
Daniela Rus},
title = {Optimal path planning for surveillance with temporal-logic constraints},
journal = {Int. J. Robotics Res.},
volume = {30},
number = {14},
pages = {1695--1708},
year = {2011},
url = {https://doi.org/10.1177/0278364911417911},
doi = {10.1177/0278364911417911},
timestamp = {Thu, 17 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijrr/SmithTBR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocn/LairdFETRMGBSF11,
author = {Angela R. Laird and
P. Mickle Fox and
Simon B. Eickhoff and
Jessica A. Turner and
Kimberly L. Ray and
David Reese McKay and
David C. Glahn and
Christian F. Beckmann and
Stephen M. Smith and
Peter T. Fox},
title = {Behavioral Interpretations of Intrinsic Connectivity Networks},
journal = {J. Cogn. Neurosci.},
volume = {23},
number = {12},
pages = {4022--4037},
year = {2011},
url = {https://doi.org/10.1162/jocn\_a\_00077},
doi = {10.1162/JOCN\_A\_00077},
timestamp = {Mon, 22 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jocn/LairdFETRMGBSF11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/MillerSDJSBJCEVJATJM11,
author = {Karla L. Miller and
Charlotte J. Stagg and
Gwena{\"{e}}lle Douaud and
Sa{\^{a}}d Jbabdi and
Stephen M. Smith and
Timothy Edward John Behrens and
Mark Jenkinson and
Steven A. Chance and
Margaret M. Esiri and
Natalie L. Voets and
Ned Jenkinson and
Tipu Z. Aziz and
Martin R. Turner and
Heidi Johansen{-}Berg and
Jennifer A. McNab},
title = {Diffusion imaging of whole, post-mortem human brains on a clinical
{MRI} scanner},
journal = {NeuroImage},
volume = {57},
number = {1},
pages = {167--181},
year = {2011},
url = {https://doi.org/10.1016/j.neuroimage.2011.03.070},
doi = {10.1016/J.NEUROIMAGE.2011.03.070},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/MillerSDJSBJCEVJATJM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/WilliamsTDWMBHLSHAKLTGVCF11,
author = {Tim D. Williams and
Nil Turan and
Amer M. Diab and
Huifeng Wu and
Carolynn Mackenzie and
Katie L. Bartie and
Olga Hrydziuszko and
Brett P. Lyons and
Grant D. Stentiford and
John M. Herbert and
Joseph K. Abraham and
Ioanna Katsiadaki and
Michael J. Leaver and
John B. Taggart and
Stephen G. George and
Mark R. Viant and
Kevin J. Chipman and
Francesco Falciani},
title = {Towards a System Level Understanding of Non-Model Organisms Sampled
from the Environment: {A} Network Biology Approach},
journal = {PLoS Comput. Biol.},
volume = {7},
number = {8},
year = {2011},
url = {https://doi.org/10.1371/journal.pcbi.1002126},
doi = {10.1371/JOURNAL.PCBI.1002126},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/WilliamsTDWMBHLSHAKLTGVCF11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/presence/SmithCDCBPCTBBGHMWC11,
author = {Cameron G. Smith and
Nigel T. Crook and
Simon Dobnik and
Daniel Charlton and
Johan Boye and
Stephen G. Pulman and
Ra{\'{u}}l Santos de la C{\'{a}}mara and
Markku Turunen and
David Benyon and
Jay Bradley and
Bj{\"{o}}rn Gamb{\"{a}}ck and
Preben Hansen and
Oli H. Mival and
Nick Webb and
Marc Cavazza},
title = {Interaction Strategies for an Affective Conversational Agent},
journal = {Presence Teleoperators Virtual Environ.},
volume = {20},
number = {5},
pages = {395--411},
year = {2011},
url = {https://doi.org/10.1162/PRES\_a\_00063},
doi = {10.1162/PRES\_A\_00063},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/presence/SmithCDCBPCTBBGHMWC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamma/GustafsonP11,
author = {Stephen Gustafson and
Tuoc Van Phan},
title = {Stable Directions for Degenerate Excited States of Nonlinear Schr{\"{o}}dinger
Equations},
journal = {{SIAM} J. Math. Anal.},
volume = {43},
number = {4},
pages = {1716--1758},
year = {2011},
url = {https://doi.org/10.1137/10079210X},
doi = {10.1137/10079210X},
timestamp = {Fri, 03 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamma/GustafsonP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamsc/TuminaroBCDEFJKKKLMMSW11,
author = {Ray Tuminaro and
Michele Benzi and
Xiao{-}Chuan Cai and
Iain Duff and
Howard C. Elman and
Roland Freund and
Kirk E. Jordan and
Tim Kelley and
David E. Keyes and
Misha Elena Kilmer and
Sven Leyffer and
Tom Manteuffel and
Steve F. McCormick and
David J. Silvester and
Homer F. Walker},
title = {Special Section: 2010 Copper Mountain Conference},
journal = {{SIAM} J. Sci. Comput.},
volume = {33},
number = {5},
pages = {2685},
year = {2011},
url = {https://doi.org/10.1137/SJOCE3000033000005002685000001},
doi = {10.1137/SJOCE3000033000005002685000001},
timestamp = {Mon, 26 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamsc/TuminaroBCDEFJKKKLMMSW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tec/AydtTCLOA11,
author = {Heiko Aydt and
Stephen John Turner and
Wentong Cai and
Malcolm Yoke Hean Low and
Yew{-}Soon Ong and
Rassul Ayani},
title = {Toward an Evolutionary Computing Modeling Language},
journal = {{IEEE} Trans. Evol. Comput.},
volume = {15},
number = {2},
pages = {230--247},
year = {2011},
url = {https://doi.org/10.1109/TEVC.2010.2081368},
doi = {10.1109/TEVC.2010.2081368},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tec/AydtTCLOA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/PanTCL11,
author = {Ke Pan and
Stephen John Turner and
Wentong Cai and
Zengxiang Li},
title = {A dynamic sort-based {DDM} matching algorithm for {HLA} applications},
journal = {{ACM} Trans. Model. Comput. Simul.},
volume = {21},
number = {3},
pages = {17:1--17:17},
year = {2011},
url = {https://doi.org/10.1145/1921598.1921601},
doi = {10.1145/1921598.1921601},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tomacs/PanTCL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/TulpuleYWR11,
author = {Pinak Tulpule and
Stephen Yurkovich and
J. Wang and
Giorgio Rizzoni},
title = {Hybrid large scale system model for a {DC} microgrid},
booktitle = {American Control Conference, {ACC} 2011, San Francisco, CA, USA, June
29 - July 1, 2011},
pages = {3899--3904},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ACC.2011.5990841},
doi = {10.1109/ACC.2011.5990841},
timestamp = {Sun, 08 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amcc/TulpuleYWR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/Turner11,
author = {Stephen John Turner},
editor = {David J. Roberts and
J. Mark Pullen and
Georgios Theodoropoulos and
Nick J. Avis},
title = {Symbiotic Simulation and Its Application to Complex Adaptive Systems},
booktitle = {15th {IEEE/ACM} International Symposium on Distributed Simulation
and Real Time Applications, {DS-RT} 2011, Salford, United Kingdom,
September 4-7, 2011},
pages = {3},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/DS-RT.2011.36},
doi = {10.1109/DS-RT.2011.36},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsrt/Turner11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/SakellariouCGTKC11,
author = {Sophia Sakellariou and
Vassilis Charissis and
Stephen Grant and
Janice Turner and
Dianne Kelly and
Chistodoulos Christomanos},
editor = {Randall Shumaker},
title = {Virtual Reality as Knowledge Enhancement Tool for Musculoskeletal
Pathology},
booktitle = {Virtual and Mixed Reality - Systems and Applications - International
Conference, Virtual and Mixed Reality 2011, Held as Part of {HCI}
International 2011, Orlando, FL, USA, July 9-14, 2011, Proceedings,
Part {II}},
series = {Lecture Notes in Computer Science},
volume = {6774},
pages = {54--63},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-22024-1\_7},
doi = {10.1007/978-3-642-22024-1\_7},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hci/SakellariouCGTKC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icbo/MungallABCCCCDEEGKILMMTTTTWH11,
author = {Chris Mungall and
David Anderson and
Anita E. Bandrowski and
Brian A. Canada and
Andrew Chatr{-}aryamontri and
Keith C. Cheng and
P. Michael Conn and
Kara Dolinski and
Mark H. Ellisman and
Janan T. Eppig and
Jeffrey S. Grethe and
Joseph W. Kemnitz and
Shawn Iadonato and
Stephen D. Larson and
Charles Magness and
Maryann E. Martone and
Mike Tyers and
Carlo Torniai and
Olga G. Troyanskaya and
Judith Turner and
Monte Westerfield and
Melissa A. Haendel},
editor = {Olivier Bodenreider and
Maryann E. Martone and
Alan Ruttenberg},
title = {An Ontology-Based Approach to Linking Model Organisms and Resources
to Human Diseases},
booktitle = {Proceedings of the 2nd International Conference on Biomedical Ontology,
Buffalo, NY, USA, July 26-30, 2011},
series = {{CEUR} Workshop Proceedings},
volume = {833},
publisher = {CEUR-WS.org},
year = {2011},
url = {https://ceur-ws.org/Vol-833/paper43.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:24 +0100},
biburl = {https://dblp.org/rec/conf/icbo/MungallABCCCCDEEGKILMMTTTTWH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/TaoTKC11,
author = {Tong Tao and
Stephen Tully and
George Kantor and
Howie Choset},
title = {Incremental construction of the saturated-GVG for multi-hypothesis
topological {SLAM}},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2011, Shanghai, China, 9-13 May 2011},
pages = {3072--3077},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ICRA.2011.5980524},
doi = {10.1109/ICRA.2011.5980524},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/TaoTKC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icst/ArzokySTC11,
author = {Mahir Arzoky and
Stephen Swift and
Allan Tucker and
James Cain},
title = {Munch: An Efficient Modularisation Strategy to Assess the Degree of
Refactoring on Sequential Source Code Checkings},
booktitle = {Fourth {IEEE} International Conference on Software Testing, Verification
and Validation, {ICST} 2012, Berlin, Germany, 21-25 March, 2011, Workshop
Proceedings},
pages = {422--429},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ICSTW.2011.87},
doi = {10.1109/ICSTW.2011.87},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icst/ArzokySTC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/FuTKC11,
author = {Yu Fu and
Stephen Tully and
George Kantor and
Howie Choset},
title = {Monte Carlo Localization using 3D texture maps},
booktitle = {2011 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, {IROS} 2011, San Francisco, CA, USA, September 25-30, 2011},
pages = {482--487},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/IROS.2011.6094843},
doi = {10.1109/IROS.2011.6094843},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/FuTKC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/TullyKC11,
author = {Stephen Tully and
George Kantor and
Howie Choset},
title = {Inequality constrained Kalman filtering for the localization and registration
of a surgical robot},
booktitle = {2011 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, {IROS} 2011, San Francisco, CA, USA, September 25-30, 2011},
pages = {5147--5152},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/IROS.2011.6094750},
doi = {10.1109/IROS.2011.6094750},
timestamp = {Mon, 22 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iros/TullyKC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/TullyKZC11,
author = {Stephen Tully and
George Kantor and
Marco A. Zenati and
Howie Choset},
title = {Shape estimation for image-guided surgery with a highly articulated
snake robot},
booktitle = {2011 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, {IROS} 2011, San Francisco, CA, USA, September 25-30, 2011},
pages = {1353--1358},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/IROS.2011.6094751},
doi = {10.1109/IROS.2011.6094751},
timestamp = {Mon, 22 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iros/TullyKZC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isqed/TuanLKT11,
author = {Tim Tuan and
Austin Lesea and
Chris Kingsley and
Steven Trimberger},
title = {Analysis of within-die process variation in 65nm FPGAs},
booktitle = {Proceedings of the 12th International Symposium on Quality Electronic
Design, {ISQED} 2011, Santa Clara, California, USA, 14-16 March 2011},
pages = {716--720},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ISQED.2011.5770808},
doi = {10.1109/ISQED.2011.5770808},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isqed/TuanLKT11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mhci/BrewsterJMNRST11,
author = {Stephen A. Brewster and
Matt Jones and
Roderick Murray{-}Smith and
Amit Anil Nanavati and
Nitendra Rajput and
Albrecht Schmidt and
Markku Turunen},
editor = {Markus Bylund and
Oskar Juhlin and
Ylva Fernaeus},
title = {We need to talk: rediscovering audio for universal access},
booktitle = {Proceedings of the 13th Conference on Human-Computer Interaction with
Mobile Devices and Services, Mobile {HCI} 2011, Stockholm, Sweden,
August 30 - September 2, 2011},
pages = {715--716},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2037373.2037494},
doi = {10.1145/2037373.2037494},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mhci/BrewsterJMNRST11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/GongLCWYZGM11,
author = {Zhaojin Gong and
Jianfeng Lu and
Jia Chen and
Yaping Wang and
Yixuan Yuan and
Tuo Zhang and
Lei Guo and
L. Stephen Miller},
editor = {Tianming Liu and
Dinggang Shen and
Luis Ib{\'{a}}{\~{n}}ez and
Xiaodong Tao},
title = {Ventricle Shape Analysis for Centenarians, Elderly Subjects, {MCI}
and {AD} Patients},
booktitle = {Multimodal Brain Image Analysis, First International Workshop, {MBIA}
2011, Held in Conjunction with {MICCAI} 2011, Toronto, Canada, September
18, 2011. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7012},
pages = {84--92},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-24446-9\_11},
doi = {10.1007/978-3-642-24446-9\_11},
timestamp = {Mon, 19 Feb 2024 14:24:13 +0100},
biburl = {https://dblp.org/rec/conf/miccai/GongLCWYZGM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/XuXLLCCAW11,
author = {Yanwu Xu and
Dong Xu and
Stephen Lin and
Jiang Liu and
Jun Cheng and
Carol Yim{-}lui Cheung and
Tin Aung and
Tien Yin Wong},
editor = {Gabor Fichtinger and
Anne L. Martel and
Terry M. Peters},
title = {Sliding Window and Regression Based Cup Detection in Digital Fundus
Images for Glaucoma Diagnosis},
booktitle = {Medical Image Computing and Computer-Assisted Intervention - {MICCAI}
2011 - 14th International Conference, Toronto, Canada, September 18-22,
2011, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {6893},
pages = {1--8},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-23626-6\_1},
doi = {10.1007/978-3-642-23626-6\_1},
timestamp = {Mon, 01 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miccai/XuXLLCCAW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/psb/TurnerB11,
author = {Stephen D. Turner and
William S. Bush},
editor = {Russ B. Altman and
A. Keith Dunker and
Lawrence Hunter and
Tiffany Murray and
Teri E. Klein},
title = {Multivariate Analysis of Regulatory Snps: Empowering Personal Genomics
by Considering Cis-Epistasis and Heterogeneity},
booktitle = {Biocomputing 2011: Proceedings of the Pacific Symposium, Kohala Coast,
Hawaii, USA, 3-7 January 2011},
pages = {276--287},
publisher = {World Scientific Publishing},
year = {2011},
url = {http://psb.stanford.edu/psb-online/proceedings/psb11/turner.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/psb/TurnerB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rivp/BasharatTSBLAP11,
author = {Arslan Basharat and
Wes Turner and
Gillian Stephens and
Benjamin Badillo and
Rick Lumpkin and
Patrick Andre and
Amitha Perera},
editor = {Nasser Kehtarnavaz and
Matthias F. Carlsohn},
title = {Tracking flow of leukocytes in blood for drug analysis},
booktitle = {Real-Time Image and Video Processing 2011, San Francisco Airport,
CA, USA, January 24-25, 2011},
series = {{SPIE} Proceedings},
volume = {7871},
pages = {78710N},
publisher = {{SPIE}},
year = {2011},
url = {https://doi.org/10.1117/12.872509},
doi = {10.1117/12.872509},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/rivp/BasharatTSBLAP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/TurnerPEC11,
author = {Scott A. Turner and
Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and
Stephen H. Edwards and
Joseph Chase},
editor = {Thomas J. Cortina and
Ellen Lowenfeld Walker and
Laurie A. Smith King and
David R. Musicant},
title = {Student attitudes and motivation for peer review in {CS2}},
booktitle = {Proceedings of the 42nd {ACM} technical symposium on Computer science
education, {SIGCSE} 2011, Dallas, TX, USA, March 9-12, 2011},
pages = {347--352},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/1953163.1953268},
doi = {10.1145/1953163.1953268},
timestamp = {Wed, 10 Mar 2021 13:17:16 +0100},
biburl = {https://dblp.org/rec/conf/sigcse/TurnerPEC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigite/UludagKT11,
author = {Suleyman Uludag and
Murat Karakus and
Stephen W. Turner},
editor = {Bryan S. Goda and
Edward Sobiesk and
Randy W. Connolly},
title = {Implementing {IT0/CS0} with scratch, app inventor forandroid, and
lego mindstorms},
booktitle = {SIGITE' 11 {ACM} Special Interest Group for Information Technology
Education Conference, West Point, NY, USA, October 20-22, 2011},
pages = {183--190},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2047594.2047645},
doi = {10.1145/2047594.2047645},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigite/UludagKT11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/AydtTCG11,
author = {Heiko Aydt and
Stephen John Turner and
Wentong Cai and
Boon{-}Ping Gan},
editor = {S. Jain and
Roy R. Creasey Jr. and
Jan Himmelspach and
K. Preston White and
Michael C. Fu},
title = {Symbiotic simulation for optimisation of tool operations in semiconductor
manufacturing},
booktitle = {Winter Simulation Conference 2011, WSC'11, Phoenix, AZ, USA, December
11-14, 2011},
pages = {2093--2104},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/WSC.2011.6147922},
doi = {10.1109/WSC.2011.6147922},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/AydtTCG11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TaylorGMTKFKS11,
author = {Simon J. E. Taylor and
Mohammadmersad Ghorbani and
Navonil Mustafee and
Stephen John Turner and
Tam{\'{a}}s Kiss and
Daniel Farkas and
Shane Kite and
Steffen Stra{\ss}burger},
editor = {S. Jain and
Roy R. Creasey Jr. and
Jan Himmelspach and
K. Preston White and
Michael C. Fu},
title = {Distributed computing and modeling {\&} simulation: speeding up
simulations and creating large models},
booktitle = {Winter Simulation Conference 2011, WSC'11, Phoenix, AZ, USA, December
11-14, 2011},
pages = {161--175},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/WSC.2011.6147748},
doi = {10.1109/WSC.2011.6147748},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/TaylorGMTKFKS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2011,
editor = {Dongming Wang and
Viorel Negru and
Tetsuo Ida and
Tudor Jebelean and
Dana Petcu and
Stephen M. Watt and
Daniela Zaharie},
title = {13th International Symposium on Symbolic and Numeric Algorithms for
Scientific Computing, {SYNASC} 2011, Timisoara, Romania, September
26-29, 2011},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://ieeexplore.ieee.org/xpl/conhome/6168887/proceeding},
isbn = {978-1-4673-0207-4},
timestamp = {Tue, 19 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/synasc/2011.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biodatamining/TurnerDR10,
author = {Stephen D. Turner and
Scott M. Dudek and
Marylyn D. Ritchie},
title = {{ATHENA:} {A} knowledge-based hybrid backpropagation-grammatical evolution
neural network algorithm for discovering epistasis among quantitative
trait Loci},
journal = {BioData Min.},
volume = {3},
pages = {5},
year = {2010},
url = {https://doi.org/10.1186/1756-0381-3-5},
doi = {10.1186/1756-0381-3-5},
timestamp = {Wed, 01 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/biodatamining/TurnerDR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ese/KitchenhamBTNLPB10,
author = {Barbara A. Kitchenham and
Pearl Brereton and
Mark Turner and
Mahmood Niazi and
Stephen G. Linkman and
Rialette Pretorius and
David Budgen},
title = {Refining the systematic literature review process - two participant-observer
case studies},
journal = {Empir. Softw. Eng.},
volume = {15},
number = {6},
pages = {618--653},
year = {2010},
url = {https://doi.org/10.1007/s10664-010-9134-8},
doi = {10.1007/S10664-010-9134-8},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ese/KitchenhamBTNLPB10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/imm/SchmalzelBRMTFF10,
author = {John L. Schmalzel and
Andrew Bracey and
Stephen Rawls and
Jon Morris and
Mark Turowski and
Richard Franzl and
Fernando Figueroa},
title = {Smart sensor demonstration payload},
journal = {{IEEE} Instrum. Meas. Mag.},
volume = {13},
number = {5},
pages = {8--15},
year = {2010},
url = {https://doi.org/10.1109/MIM.2010.5585068},
doi = {10.1109/MIM.2010.5585068},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/imm/SchmalzelBRMTFF10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/infsof/KitchenhamPBBTNL10,
author = {Barbara A. Kitchenham and
Rialette Pretorius and
David Budgen and
Pearl Brereton and
Mark Turner and
Mahmood Niazi and
Stephen G. Linkman},
title = {Systematic literature reviews in software engineering - {A} tertiary
study},
journal = {Inf. Softw. Technol.},
volume = {52},
number = {8},
pages = {792--805},
year = {2010},
url = {https://doi.org/10.1016/j.infsof.2010.03.006},
doi = {10.1016/J.INFSOF.2010.03.006},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/infsof/KitchenhamPBBTNL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcphy/LemieuxTSTTHA10,
author = {Jean{-}Fran{\c{c}}ois Lemieux and
L. Bruno Tremblay and
Jan Sedl{\'{a}}cek and
Paul F. Tupper and
Stephen Thomas and
David Huard and
Jean{-}Pierre Auclair},
title = {Improving the numerical convergence of viscous-plastic sea ice models
with the Jacobian-free Newton-Krylov method},
journal = {J. Comput. Phys.},
volume = {229},
number = {8},
pages = {2840--2852},
year = {2010},
url = {https://doi.org/10.1016/j.jcp.2009.12.011},
doi = {10.1016/J.JCP.2009.12.011},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcphy/LemieuxTSTTHA10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/ChenTCTXL10,
author = {Dan Chen and
Stephen John Turner and
Wentong Cai and
Georgios K. Theodoropoulos and
Muzhou Xiong and
Michael Lees},
title = {Synchronization in federation community networks},
journal = {J. Parallel Distributed Comput.},
volume = {70},
number = {2},
pages = {144--159},
year = {2010},
url = {https://doi.org/10.1016/j.jpdc.2009.10.006},
doi = {10.1016/J.JPDC.2009.10.006},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jpdc/ChenTCTXL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lht/MutulaK10,
author = {Stephen Mutula and
Tumelo Kalaote},
title = {Open source software deployment in the public sector: a review of
Botswana and South Africa},
journal = {Libr. Hi Tech},
volume = {28},
number = {1},
pages = {63--80},
year = {2010},
url = {https://doi.org/10.1108/07378831011026698},
doi = {10.1108/07378831011026698},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/lht/MutulaK10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/WilsonFZTYCG10,
author = {Carlene Wilson and
Ingrid H. K. Flight and
Ian Zajac and
Deborah Turnbull and
Graeme P. Young and
Stephen R. Cole and
Tess Gregory},
title = {Protocol for population testing of an Internet-based Personalised
Decision Support system for colorectal cancer screening},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {10},
pages = {50},
year = {2010},
url = {https://doi.org/10.1186/1472-6947-10-50},
doi = {10.1186/1472-6947-10-50},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/midm/WilsonFZTYCG10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/GrilloTLMLBGHPPP10,
author = {Giorgio Grillo and
Antonio Turi and
Flavio Licciulli and
Flavio Mignone and
Sabino Liuni and
Sandro Banfi and
Vincenzo Alessandro Gennarino and
David Stephen Horner and
Giulio Pavesi and
Ernesto Picardi and
Graziano Pesole},
title = {UTRdb and UTRsite {(RELEASE} 2010): a collection of sequences and
regulatory motifs of the untranslated regions of eukaryotic mRNAs},
journal = {Nucleic Acids Res.},
volume = {38},
number = {Database-Issue},
pages = {75--80},
year = {2010},
url = {https://doi.org/10.1093/nar/gkp902},
doi = {10.1093/NAR/GKP902},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/GrilloTLMLBGHPPP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WangBDKSSWXZB10,
author = {Yanli Wang and
Evan Bolton and
Svetlana Dracheva and
Karen Karapetyan and
Benjamin A. Shoemaker and
Tugba O. Suzek and
Jiyao Wang and
Jewen Xiao and
Jian Zhang and
Stephen H. Bryant},
title = {An overview of the PubChem BioAssay resource},
journal = {Nucleic Acids Res.},
volume = {38},
number = {Database-Issue},
pages = {255--266},
year = {2010},
url = {https://doi.org/10.1093/nar/gkp965},
doi = {10.1093/NAR/GKP965},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/WangBDKSSWXZB10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigops/BarrBDGHNTZ10,
author = {Kenneth C. Barr and
Prashanth P. Bungale and
Stephen Deasy and
Viktor Gyuris and
Perry Hung and
Craig Newell and
Harvey Tuch and
Bruno Zoppis},
title = {The VMware mobile virtualization platform: is that a hypervisor in
your pocket?},
journal = {{ACM} {SIGOPS} Oper. Syst. Rev.},
volume = {44},
number = {4},
pages = {124--135},
year = {2010},
url = {https://doi.org/10.1145/1899928.1899945},
doi = {10.1145/1899928.1899945},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigops/BarrBDGHNTZ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/JeongSTFMWRLP10,
author = {Won{-}Ki Jeong and
Jens Schneider and
Stephen G. Turney and
Beverly E. Faulkner{-}Jones and
Dominik Meyer and
R{\"{u}}diger Westermann and
R. Clay Reid and
Jeff Lichtman and
Hanspeter Pfister},
title = {Interactive Histology of Large-Scale Biomedical Image Stacks},
journal = {{IEEE} Trans. Vis. Comput. Graph.},
volume = {16},
number = {6},
pages = {1386--1395},
year = {2010},
url = {https://doi.org/10.1109/TVCG.2010.168},
doi = {10.1109/TVCG.2010.168},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvcg/JeongSTFMWRLP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/TullyKC10,
author = {Stephen Tully and
George Kantor and
Howie Choset},
editor = {Maria Fox and
David Poole},
title = {A Single-Step Maximum {A} Posteriori Update for Bearing-Only {SLAM}},
booktitle = {Proceedings of the Twenty-Fourth {AAAI} Conference on Artificial Intelligence,
{AAAI} 2010, Atlanta, Georgia, USA, July 11-15, 2010},
pages = {1252--1257},
publisher = {{AAAI} Press},
year = {2010},
url = {https://doi.org/10.1609/aaai.v24i1.7736},
doi = {10.1609/AAAI.V24I1.7736},
timestamp = {Mon, 04 Sep 2023 16:23:45 +0200},
biburl = {https://dblp.org/rec/conf/aaai/TullyKC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibe/NguyenFACL10,
author = {Tung T. Nguyen and
Panagiota T. Foteinou and
Ioannis P. Androulakis and
Steve E. Calvano and
Stephen F. Lowry},
title = {Dynamic Complexity of the Temporal Transcriptional Regulation Program
in Human Endotoxemia},
booktitle = {10th {IEEE} International Conference on Bioinformatics and Bioengineering,
{BIBE} 2010, Philadelphia, Pennsylvania, USA, May 31-June 3 2010},
pages = {112--117},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/BIBE.2010.27},
doi = {10.1109/BIBE.2010.27},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bibe/NguyenFACL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cloud/ArmbrustLTFFP10,
author = {Michael Armbrust and
Nick Lanham and
Stephen Tu and
Armando Fox and
Michael J. Franklin and
David A. Patterson},
editor = {Joseph M. Hellerstein and
Surajit Chaudhuri and
Mendel Rosenblum},
title = {The case for {PIQL:} a performance insightful query language},
booktitle = {Proceedings of the 1st {ACM} Symposium on Cloud Computing, SoCC 2010,
Indianapolis, Indiana, USA, June 10-11, 2010},
pages = {131--136},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1807128.1807149},
doi = {10.1145/1807128.1807149},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cloud/ArmbrustLTFFP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cscw/TuckerBRW10,
author = {Simon Tucker and
Ofer Bergman and
Anand Ramamoorthy and
Steve Whittaker},
editor = {Kori Inkpen and
Carl Gutwin and
John C. Tang},
title = {Catchup: a useful application of time-travel in meetings},
booktitle = {Proceedings of the 2010 {ACM} Conference on Computer Supported Cooperative
Work, {CSCW} 2010, Savannah, Georgia, USA, February 6-10, 2010},
pages = {99--102},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1718918.1718937},
doi = {10.1145/1718918.1718937},
timestamp = {Mon, 11 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cscw/TuckerBRW10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/LiCTP10,
author = {Zengxiang Li and
Wentong Cai and
Stephen John Turner and
Ke Pan},
editor = {Stephen John Turner and
David J. Roberts},
title = {A Three-Phases Byzantine Fault Tolerance Mechanism for HLA-Based Simulation},
booktitle = {{DS-RT} '10 Proceedings of the 2010 {IEEE/ACM} 14th International
Symposium on Distributed Simulation and Real Time Applications, Fairfax,
Virginia, USA, 17-20 October 2010},
pages = {149--158},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/DS-RT.2010.24},
doi = {10.1109/DS-RT.2010.24},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dsrt/LiCTP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/TurnerDR10,
author = {Stephen D. Turner and
Scott M. Dudek and
Marylyn D. Ritchie},
editor = {Clara Pizzuti and
Marylyn D. Ritchie and
Mario Giacobini},
title = {Grammatical Evolution of Neural Networks for Discovering Epistasis
among Quantitative Trait Loci},
booktitle = {Evolutionary Computation, Machine Learning and Data Mining in Bioinformatics,
8th European Conference, EvoBIO 2010, Istanbul, Turkey, April 7-9,
2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6023},
pages = {86--97},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-12211-8\_8},
doi = {10.1007/978-3-642-12211-8\_8},
timestamp = {Tue, 14 May 2019 10:00:37 +0200},
biburl = {https://dblp.org/rec/conf/evoW/TurnerDR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/HolzingerBDTTR10,
author = {Emily Rose Holzinger and
Carrie C. Buchanan and
Scott M. Dudek and
Eric Torstenson and
Stephen D. Turner and
Marylyn D. Ritchie},
editor = {Martin Pelikan and
J{\"{u}}rgen Branke},
title = {Initialization parameter sweep in {ATHENA:} optimizing neural networks
for detecting gene-gene interactions in the presence of small main
effects},
booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2010, Proceedings,
Portland, Oregon, USA, July 7-11, 2010},
pages = {203--210},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1830483.1830519},
doi = {10.1145/1830483.1830519},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gecco/HolzingerBDTTR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/grid/JinTLKGH10,
author = {Jiangming Jin and
Stephen John Turner and
Bu{-}Sung Lee and
Shyh{-}Hao Kuo and
Rick Siow Mong Goh and
Terence Hung},
title = {Performance modeling for runtime kernel adaptation: {A} case study
on infectious disease simulation},
booktitle = {Proceedings of the 2010 11th {IEEE/ACM} International Conference on
Grid Computing, Brussels, Belgium, October 25-29, 2010},
pages = {349--358},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/GRID.2010.5698009},
doi = {10.1109/GRID.2010.5698009},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/grid/JinTLKGH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icann/HuntSSADSBBT10,
author = {Stephen P. Hunt and
Yi Sun and
Alexander V. Shafarenko and
Rod Adams and
Neil Davey and
Brendan Slater and
Ranjeet S. Bhamber and
Sonia K. Boscolo and
Sergei K. Turitsyn},
editor = {Konstantinos I. Diamantaras and
Wlodek Duch and
Lazaros S. Iliadis},
title = {Correcting Errors in Optical Data Transmission Using Neural Networks},
booktitle = {Artificial Neural Networks - {ICANN} 2010, 20th International Conference,
Thessaloniki, Greece, September 15-18, 2010, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {6353},
pages = {448--457},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-15822-3\_55},
doi = {10.1007/978-3-642-15822-3\_55},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icann/HuntSSADSBBT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/DavisHTB10,
author = {Linda M. Davis and
Stephen V. Hanly and
Paul Tune and
Sibi Raj Bhaskaran},
title = {Multi-Antenna Downlink Broadcast Using Compressed-Sensed Medium Access},
booktitle = {Proceedings of {IEEE} International Conference on Communications,
{ICC} 2010, Cape Town, South Africa, 23-27 May 2010},
pages = {1--5},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ICC.2010.5501819},
doi = {10.1109/ICC.2010.5501819},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/icc/DavisHTB10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmi/LiGFZDZJZCHML10,
author = {Kaiming Li and
Lei Guo and
Carlos Faraco and
Dajiang Zhu and
Fan Deng and
Tuo Zhang and
Xi Jiang and
Degang Zhang and
Hanbo Chen and
Xintao Hu and
L. Stephen Miller and
Tianming Liu},
editor = {Wen Gao and
Chin{-}Hui Lee and
Jie Yang and
Xilin Chen and
Maxine Esk{\'{e}}nazi and
Zhengyou Zhang},
title = {Human-centered attention models for video summarization},
booktitle = {Proceedings of the 12th International Conference on Multimodal Interfaces
/ 7. International Workshop on Machine Learning for Multimodal Interaction,
{ICMI-MLMI} 2010, Beijing, China, November 8-12, 2010},
pages = {27:1--27:8},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1891903.1891938},
doi = {10.1145/1891903.1891938},
timestamp = {Thu, 07 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmi/LiGFZDZJZCHML10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/incdm/TuckerSCKDLT10,
author = {Allan Tucker and
Stephen Swift and
Steve Counsell and
Simon Kent and
John Dickie and
Kenwin Liu and
Robert Turner},
editor = {Petra Perner},
title = {Data Mining the Millennium Seedbank at Kew},
booktitle = {Advances in Data Mining. 10th Industrial Conference, {ICDM} 2010,
Berlin, Germany, July 2010, Workshop Proceedings},
pages = {85--94},
publisher = {ibai Publishing},
year = {2010},
timestamp = {Tue, 22 Feb 2022 10:29:42 +0100},
biburl = {https://dblp.org/rec/conf/incdm/TuckerSCKDLT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/PanCTZT10,
author = {Ke Pan and
Wentong Cai and
Xueyan Tang and
Suiping Zhou and
Stephen John Turner},
title = {A hybrid Interest Management mechanism for peer-to-peer Networked
Virtual Environments},
booktitle = {24th {IEEE} International Symposium on Parallel and Distributed Processing,
{IPDPS} 2010, Atlanta, Georgia, USA, 19-23 April 2010 - Conference
Proceedings},
pages = {1--12},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/IPDPS.2010.5470364},
doi = {10.1109/IPDPS.2010.5470364},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ipps/PanCTZT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/SmithTBR10,
author = {Stephen L. Smith and
Jana Tumova and
Calin Belta and
Daniela Rus},
title = {Optimal path planning under temporal logic constraints},
booktitle = {2010 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, October 18-22, 2010, Taipei, Taiwan},
pages = {3288--3293},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/IROS.2010.5650896},
doi = {10.1109/IROS.2010.5650896},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/SmithTBR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iva/SmithCBCDPCPCT10,
author = {Cameron G. Smith and
Nigel T. Crook and
Johan Boye and
Daniel Charlton and
Simon Dobnik and
David Pizzi and
Marc Cavazza and
Stephen G. Pulman and
Ra{\'{u}}l Santos de la C{\'{a}}mara and
Markku Turunen},
editor = {Jan M. Allbeck and
Norman I. Badler and
Timothy W. Bickmore and
Catherine Pelachaud and
Alla Safonova},
title = {Interaction Strategies for an Affective Conversational Agent},
booktitle = {Intelligent Virtual Agents, 10th International Conference, {IVA} 2010,
Philadelphia, PA, USA, September 20-22, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6356},
pages = {301--314},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-15892-6\_31},
doi = {10.1007/978-3-642-15892-6\_31},
timestamp = {Fri, 09 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iva/SmithCBCDPCPCT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/HuDLZCJLZFZMHHXMGL10,
author = {Xintao Hu and
Fan Deng and
Kaiming Li and
Tuo Zhang and
Hanbo Chen and
Xi Jiang and
Jinglei Lv and
Dajiang Zhu and
Carlos Faraco and
Degang Zhang and
Arsham Mesbah and
Junwei Han and
Xian{-}Sheng Hua and
Li Xie and
L. Stephen Miller and
Lei Guo and
Tianming Liu},
editor = {Alberto Del Bimbo and
Shih{-}Fu Chang and
Arnold W. M. Smeulders},
title = {Bridging low-level features and high-level semantics via fMRI brain
imaging for video classification},
booktitle = {Proceedings of the 18th International Conference on Multimedia 2010,
Firenze, Italy, October 25-29, 2010},
pages = {451--460},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1873951.1874016},
doi = {10.1145/1873951.1874016},
timestamp = {Thu, 07 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mm/HuDLZCJLZFZMHHXMGL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LiGFZDZJZCHML10,
author = {Kaiming Li and
Lei Guo and
Carlos Faraco and
Dajiang Zhu and
Fan Deng and
Tuo Zhang and
Xi Jiang and
Degang Zhang and
Hanbo Chen and
Xintao Hu and
L. Stephen Miller and
Tianming Liu},
editor = {John D. Lafferty and
Christopher K. I. Williams and
John Shawe{-}Taylor and
Richard S. Zemel and
Aron Culotta},
title = {Individualized {ROI} Optimization via Maximization of Group-wise Consistency
of Structural and Functional Profiles},
booktitle = {Advances in Neural Information Processing Systems 23: 24th Annual
Conference on Neural Information Processing Systems 2010. Proceedings
of a meeting held 6-9 December 2010, Vancouver, British Columbia,
Canada},
pages = {1369--1377},
publisher = {Curran Associates, Inc.},
year = {2010},
url = {https://proceedings.neurips.cc/paper/2010/hash/ccb1d45fb76f7c5a0bf619f979c6cf36-Abstract.html},
timestamp = {Thu, 07 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/LiGFZDZJZCHML10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/LiCTP10,
author = {Zengxiang Li and
Wentong Cai and
Stephen John Turner and
Ke Pan},
editor = {George F. Riley and
Richard M. Fujimoto and
Rob Simmonds and
Francesco Quaglia},
title = {Federate Fault Tolerance in HLA-Based Simulation},
booktitle = {24th {ACM/IEEE/SCS} Workshop on Principles of Advanced and Distributed
Simulation, {PADS} 2010, Atlanta, Georgia, USA, May 17-19, 2010},
pages = {3--12},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/PADS.2010.5471663},
doi = {10.1109/PADS.2010.5471663},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/LiCTP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/persuasive/CavazzaSCCBPMPCT10,
author = {Marc Cavazza and
Cameron G. Smith and
Daniel Charlton and
Nigel T. Crook and
Johan Boye and
Stephen G. Pulman and
Karo Moilanen and
David Pizzi and
Ra{\'{u}}l Santos de la C{\'{a}}mara and
Markku Turunen},
editor = {Thomas Ploug and
Per F. V. Hasle and
Harri Oinas{-}Kukkonen},
title = {Persuasive Dialogue Based on a Narrative Theory: An {ECA} Implementation},
booktitle = {Persuasive Technology, 5th International Conference, {PERSUASIVE}
2010, Copenhagen, Denmark, June 7-10, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6137},
pages = {250--261},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-13226-1\_25},
doi = {10.1007/978-3-642-13226-1\_25},
timestamp = {Fri, 09 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/persuasive/CavazzaSCCBPMPCT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ppsn/TurnerDR10,
author = {Stephen D. Turner and
Scott M. Dudek and
Marylyn D. Ritchie},
editor = {Robert Schaefer and
Carlos Cotta and
Joanna Kolodziej and
G{\"{u}}nter Rudolph},
title = {Incorporating Domain Knowledge into Evolutionary Computing for Discovering
Gene-Gene Interaction},
booktitle = {Parallel Problem Solving from Nature - {PPSN} XI, 11th International
Conference, Krak{\'{o}}w, Poland, September 11-15, 2010, Proceedings,
Part {I}},
series = {Lecture Notes in Computer Science},
volume = {6238},
pages = {394--403},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-15844-5\_40},
doi = {10.1007/978-3-642-15844-5\_40},
timestamp = {Wed, 25 Sep 2019 18:08:28 +0200},
biburl = {https://dblp.org/rec/conf/ppsn/TurnerDR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/TurnerPEC10,
author = {Scott A. Turner and
Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and
Stephen H. Edwards and
Joseph Chase},
editor = {Gary Lewandowski and
Steven A. Wolfman and
Thomas J. Cortina and
Ellen Lowenfeld Walker},
title = {Peer review in {CS2:} conceptual learning},
booktitle = {Proceedings of the 41st {ACM} technical symposium on Computer science
education, {SIGCSE} 2010, Milwaukee, Wisconsin, USA, March 10-13,
2010},
pages = {331--335},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1734263.1734379},
doi = {10.1145/1734263.1734379},
timestamp = {Wed, 10 Mar 2021 13:17:16 +0100},
biburl = {https://dblp.org/rec/conf/sigcse/TurnerPEC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmod/ArmbrustTFFPLTT10,
author = {Michael Armbrust and
Stephen Tu and
Armando Fox and
Michael J. Franklin and
David A. Patterson and
Nick Lanham and
Beth Trushkowsky and
Jesse Trutna},
editor = {Ahmed K. Elmagarmid and
Divyakant Agrawal},
title = {{PIQL:} a performance insightful query language},
booktitle = {Proceedings of the {ACM} {SIGMOD} International Conference on Management
of Data, {SIGMOD} 2010, Indianapolis, Indiana, USA, June 6-10, 2010},
pages = {1207--1210},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1807167.1807320},
doi = {10.1145/1807167.1807320},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigmod/ArmbrustTFFPLTT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/springsim/LiCTP10,
author = {Zengxiang Li and
Wentong Cai and
Stephen John Turner and
Ke Pan},
editor = {Robert M. McGraw and
Eric S. Imsand and
Michael J. Chinni},
title = {A replication structure for efficient and fault-tolerant parallel
and distributed simulations},
booktitle = {Proceedings of the 2010 Spring Simulation Multiconference, SpringSim
2010, Orlando, Florida, USA, April 11-15, 2010},
pages = {151},
publisher = {{SCS/ACM}},
year = {2010},
url = {https://doi.org/10.1145/1878537.1878695},
doi = {10.1145/1878537.1878695},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/springsim/LiCTP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TaylorMKWTS10,
author = {Simon J. E. Taylor and
Navonil Mustafee and
Shane Kite and
Chris Wood and
Stephen John Turner and
Steffen Stra{\ss}burger},
title = {Improving simulation through advanced computing techniques: Grid computing
and simulation interoperability},
booktitle = {Proceedings of the 2010 Winter Simulation Conference, {WSC} 2010,
Baltimore, Maryland, USA, 5-8 December 2010},
pages = {216--230},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/WSC.2010.5679162},
doi = {10.1109/WSC.2010.5679162},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/TaylorMKWTS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:journals/procedia/ShahandTCH10,
author = {Shayan Shahand and
Stephen John Turner and
Wentong Cai and
Maryam Khademi Hedayat},
editor = {Peter M. A. Sloot and
G. Dick van Albada and
Jack J. Dongarra},
title = {DynaSched: a dynamic Web service scheduling and deployment framework
for data-intensive Grid workflows},
booktitle = {Proceedings of the International Conference on Computational Science,
{ICCS} 2010, University of Amsterdam, The Netherlands, May 31 - June
2, 2010},
series = {Procedia Computer Science},
volume = {1},
number = {1},
pages = {593--602},
publisher = {Elsevier},
year = {2010},
url = {https://doi.org/10.1016/j.procs.2010.04.063},
doi = {10.1016/J.PROCS.2010.04.063},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/procedia/ShahandTCH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/dsrt/2010,
editor = {Stephen John Turner and
David J. Roberts},
title = {{DS-RT} '10 Proceedings of the 2010 {IEEE/ACM} 14th International
Symposium on Distributed Simulation and Real Time Applications, Fairfax,
Virginia, USA, 17-20 October 2010},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://ieeexplore.ieee.org/xpl/conhome/5634610/proceeding},
isbn = {978-0-7695-4251-5},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dsrt/2010.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2010,
editor = {Tetsuo Ida and
Viorel Negru and
Tudor Jebelean and
Dana Petcu and
Stephen M. Watt and
Daniela Zaharie},
title = {12th International Symposium on Symbolic and Numeric Algorithms for
Scientific Computing, {SYNASC} 2010, Timisoara, Romania, 23-26 September
2010},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://ieeexplore.ieee.org/xpl/conhome/5714592/proceeding},
isbn = {978-0-7695-4324-6},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/synasc/2010.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1007-2212,
author = {Stephen L. Smith and
Jana Tumova and
Calin Belta and
Daniela Rus},
title = {Optimal Path Planning under Temporal Logic Constraints},
journal = {CoRR},
volume = {abs/1007.2212},
year = {2010},
url = {http://arxiv.org/abs/1007.2212},
eprinttype = {arXiv},
eprint = {1007.2212},
timestamp = {Mon, 28 Jan 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1007-2212.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ercim/OSullivanD10,
author = {Stephen O'Sullivan and
Turlough Downes},
title = {Massively Parallel Simulations of Star-Forming Gas Clouds},
journal = {{ERCIM} News},
volume = {2010},
number = {81},
year = {2010},
url = {http://ercim-news.ercim.eu/en81/special/massively-parallel-simulations-of-star-forming-gas-clouds},
timestamp = {Wed, 22 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ercim/OSullivanD10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc5755,
author = {Stephen Farrell and
Russ Housley and
Sean Turner},
title = {An Internet Attribute Certificate Profile for Authorization},
journal = {{RFC}},
volume = {5755},
pages = {1--50},
year = {2010},
url = {https://doi.org/10.17487/RFC5755},
doi = {10.17487/RFC5755},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rfc/rfc5755.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc5990,
author = {Randall J. Atkinson and
Burt Kaliski and
John G. Brainard and
Sean Turner},
title = {Use of the {RSA-KEM} Key Transport Algorithm in the Cryptographic
Message Syntax {(CMS)}},
journal = {{RFC}},
volume = {5990},
pages = {1--27},
year = {2010},
url = {https://doi.org/10.17487/RFC5990},
doi = {10.17487/RFC5990},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rfc/rfc5990.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/ChaiSBTAK09,
author = {High{-}Seng Chai and
Hugues Sicotte and
Kent R. Bailey and
Stephen T. Turner and
Yan W. Asmann and
Jean{-}Pierre A. Kocher},
title = {{GLOSSI:} a method to assess the association of genetic loci-sets
with complex diseases},
journal = {{BMC} Bioinform.},
volume = {10},
year = {2009},
url = {https://doi.org/10.1186/1471-2105-10-102},
doi = {10.1186/1471-2105-10-102},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/ChaiSBTAK09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/JamesonTAKRSGSOWKP09,
author = {Daniel Jameson and
David A. Turner and
John Ankers and
Stephnie Kennedy and
Sheila Ryan and
Neil Swainston and
Tony Griffiths and
David G. Spiller and
Stephen G. Oliver and
Michael R. H. White and
Douglas B. Kell and
Norman W. Paton},
title = {Information management for high content live cell imaging},
journal = {{BMC} Bioinform.},
volume = {10},
year = {2009},
url = {https://doi.org/10.1186/1471-2105-10-226},
doi = {10.1186/1471-2105-10-226},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/JamesonTAKRSGSOWKP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csda/SunJTBK09,
author = {Yan V. Sun and
Douglas M. Jacobsen and
Stephen T. Turner and
Eric Boerwinkle and
Sharon L. R. Kardia},
title = {Fast implementation of a scan statistic for identifying chromosomal
patterns of genome wide association studies},
journal = {Comput. Stat. Data Anal.},
volume = {53},
number = {5},
pages = {1794--1801},
year = {2009},
url = {https://doi.org/10.1016/j.csda.2008.04.013},
doi = {10.1016/J.CSDA.2008.04.013},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csda/SunJTBK09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/infsof/KitchenhamBBTBL09,
author = {Barbara A. Kitchenham and
Pearl Brereton and
David Budgen and
Mark Turner and
John Bailey and
Stephen G. Linkman},
title = {Systematic literature reviews in software engineering - {A} systematic
literature review},
journal = {Inf. Softw. Technol.},
volume = {51},
number = {1},
pages = {7--15},
year = {2009},
url = {https://doi.org/10.1016/j.infsof.2008.09.009},
doi = {10.1016/J.INFSOF.2008.09.009},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/infsof/KitchenhamBBTBL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WangXSZWB09,
author = {Yanli Wang and
Jewen Xiao and
Tugba O. Suzek and
Jian Zhang and
Jiyao Wang and
Stephen H. Bryant},
title = {PubChem: a public information system for analyzing bioactivities of
small molecules},
journal = {Nucleic Acids Res.},
volume = {37},
number = {Web-Server-Issue},
pages = {623--633},
year = {2009},
url = {https://doi.org/10.1093/nar/gkp456},
doi = {10.1093/NAR/GKP456},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/WangXSZWB09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/YuPZW09,
author = {Donggang Yu and
Tuan D. Pham and
Xiaobo Zhou and
Stephen T. C. Wong},
title = {Recognition and analysis of cell nuclear phases for high-content screening
based on morphological features},
journal = {Pattern Recognit.},
volume = {42},
number = {4},
pages = {498--508},
year = {2009},
url = {https://doi.org/10.1016/j.patcog.2008.08.003},
doi = {10.1016/J.PATCOG.2008.08.003},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pr/YuPZW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/PanTCL09,
author = {Ke Pan and
Stephen John Turner and
Wentong Cai and
Zengxiang Li},
title = {A Hybrid {HLA} Time Management Algorithm Based on Both Conditional
and Unconditional Information},
journal = {Simul.},
volume = {85},
number = {9},
pages = {559--573},
year = {2009},
url = {https://doi.org/10.1177/0037549709106328},
doi = {10.1177/0037549709106328},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simulation/PanTCL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/WangWHLL09,
author = {Tunde Wang and
Dong Wang and
Paul J. Hurst and
Bernard C. Levy and
Stephen H. Lewis},
title = {A Level-Crossing Analog-to-Digital Converter With Triangular Dither},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {56-I},
number = {9},
pages = {2089--2099},
year = {2009},
url = {https://doi.org/10.1109/TCSI.2008.2011586},
doi = {10.1109/TCSI.2008.2011586},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/WangWHLL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aswec/ChartersBTKBL09,
author = {Stuart M. Charters and
David Budgen and
Mark Turner and
Barbara A. Kitchenham and
Pearl Brereton and
Stephen G. Linkman},
title = {Objectivity in Research: Challenges from the Evidence-Based Paradigm},
booktitle = {20th Australian Software Engineering Conference {(ASWEC} 2009), 14-17
April 2009, Gold Cost, Australia},
pages = {73--80},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ASWEC.2009.25},
doi = {10.1109/ASWEC.2009.25},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aswec/ChartersBTKBL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bliss/YanciPA09,
author = {Asier Goikoetxea Yanci and
Stephen Pickles and
Tughrul Arslan},
editor = {Adrian Stoica and
Tughrul Arslan and
Ahmet T. Erdogan and
Tetsuya Higuchi and
Ahmed Bouridane and
Ahmed O. El{-}Rayis},
title = {Characterization of a Voltage Glitch Attack Detector for Secure Devices},
booktitle = {2009 Symposium on Bio-inspired Learning and Intelligent Systems for
Security, {BLISS} 2009, Edingburgh, United Kingdom, August 20-21 2009},
pages = {91--96},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/BLISS.2009.18},
doi = {10.1109/BLISS.2009.18},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bliss/YanciPA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/BergmanTBCW09,
author = {Ofer Bergman and
Simon Tucker and
Ruth Beyth{-}Marom and
Edward Cutrell and
Steve Whittaker},
editor = {Dan R. Olsen Jr. and
Richard B. Arthur and
Ken Hinckley and
Meredith Ringel Morris and
Scott E. Hudson and
Saul Greenberg},
title = {It's not that important: demoting personal information of low subjective
importance using GrayArea},
booktitle = {Proceedings of the 27th International Conference on Human Factors
in Computing Systems, {CHI} 2009, Boston, MA, USA, April 4-9, 2009},
pages = {269--278},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1518701.1518745},
doi = {10.1145/1518701.1518745},
timestamp = {Sun, 04 Aug 2024 19:38:26 +0200},
biburl = {https://dblp.org/rec/conf/chi/BergmanTBCW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/det/ValenteNNT09,
author = {Anna Valente and
Aydin Nassehi and
Stephen T. Newman and
Tullio Tolio},
editor = {George Q. Huang and
Kai{-}Ling Mak and
Paul G. Maropoulos},
title = {A {STEP} Compliant Knowledge Based Schema for the Manufacture of Composites
in the Aerospace Industry},
booktitle = {Proceedings of the 6th CIRP-Sponsored International Conference on
Digital Enterprise Technology, {DET} 2009, Hong Kong, China, December
14.16, 2009},
series = {Advances in Intelligent and Soft Computing},
volume = {66},
pages = {1509--1525},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-10430-5\_114},
doi = {10.1007/978-3-642-10430-5\_114},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/det/ValenteNNT09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/FanchaoTA09,
author = {Zeng Fanchao and
Stephen John Turner and
Heiko Aydt},
editor = {Stephen John Turner and
David J. Roberts and
Wentong Cai and
Abdulmotaleb El{-}Saddik},
title = {Symbiotic Simulation Control in Supply Chain of Lubricant Additive
Industry},
booktitle = {13th {IEEE/ACM} International Symposium on Distributed Simulation
and Real Time Applications, Singapore, 25-28 October 2009},
pages = {165--172},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/DS-RT.2009.17},
doi = {10.1109/DS-RT.2009.17},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsrt/FanchaoTA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/PanTCL09,
author = {Ke Pan and
Stephen John Turner and
Wentong Cai and
Zengxiang Li},
editor = {Stephen John Turner and
David J. Roberts and
Wentong Cai and
Abdulmotaleb El{-}Saddik},
title = {Multi-user Gaming on the Grid Using a Service Oriented {HLA} {RTI}},
booktitle = {13th {IEEE/ACM} International Symposium on Distributed Simulation
and Real Time Applications, Singapore, 25-28 October 2009},
pages = {48--56},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/DS-RT.2009.39},
doi = {10.1109/DS-RT.2009.39},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dsrt/PanTCL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eann/HuntSSADSBBT09,
author = {Stephen P. Hunt and
Yi Sun and
Alexander V. Shafarenko and
Rod Adams and
Neil Davey and
Brendan Slater and
Ranjeet S. Bhamber and
Sonia K. Boscolo and
Sergei K. Turitsyn},
editor = {Dominic Palmer{-}Brown and
Chrisina Draganova and
Elias Pimenidis and
Haris Mouratidis},
title = {Adaptive Electrical Signal Post-processing with Varying Representations
in Optical Communication Systems},
booktitle = {Engineering Applications of Neural Networks - 11th International Conference,
{EANN} 2009, London, UK, August 27-29, 2009. Proceedings},
series = {Communications in Computer and Information Science},
volume = {43},
pages = {235--245},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-03969-0\_22},
doi = {10.1007/978-3-642-03969-0\_22},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eann/HuntSSADSBBT09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esem/KitchenhamBTNLPB09,
author = {Barbara A. Kitchenham and
Pearl Brereton and
Mark Turner and
Mahmood Niazi and
Stephen G. Linkman and
Rialette Pretorius and
David Budgen},
title = {The impact of limited search procedures for systematic literature
reviews {A} participant-observer case study},
booktitle = {Proceedings of the Third International Symposium on Empirical Software
Engineering and Measurement, {ESEM} 2009, October 15-16, 2009, Lake
Buena Vista, Florida, {USA}},
pages = {336--345},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ESEM.2009.5314238},
doi = {10.1109/ESEM.2009.5314238},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esem/KitchenhamBTNLPB09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/TurnerRB09,
author = {Stephen D. Turner and
Marylyn D. Ritchie and
William S. Bush},
editor = {Clara Pizzuti and
Marylyn D. Ritchie and
Mario Giacobini},
title = {Conquering the Needle-in-a-Haystack: How Correlated Input Variables
Beneficially Alter the Fitness Landscape for Neural Networks},
booktitle = {Evolutionary Computation, Machine Learning and Data Mining in Bioinformatics,
7th European Conference, EvoBIO 2009, T{\"{u}}bingen, Germany,
April 15-17, 2009, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5483},
pages = {80--91},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-01184-9\_8},
doi = {10.1007/978-3-642-01184-9\_8},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/evoW/TurnerRB09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fsr/TullyKC09,
author = {Stephen Tully and
George Kantor and
Howie Choset},
editor = {Andrew Howard and
Karl Iagnemma and
Alonzo Kelly},
title = {Leap-Frog Path Design for Multi-Robot Cooperative Localization},
booktitle = {Field and Service Robotics, Results of the 7th International Conference,
{FSR} 2009, Cambridge, Massachusetts, USA, 14-16 July 2009},
series = {Springer Tracts in Advanced Robotics},
volume = {62},
pages = {307--317},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-13408-1\_28},
doi = {10.1007/978-3-642-13408-1\_28},
timestamp = {Mon, 22 May 2017 17:10:59 +0200},
biburl = {https://dblp.org/rec/conf/fsr/TullyKC09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ida/CainCST09,
author = {James Cain and
Steve Counsell and
Stephen Swift and
Allan Tucker},
editor = {Niall M. Adams and
C{\'{e}}line Robardet and
Arno Siebes and
Jean{-}Fran{\c{c}}ois Boulicaut},
title = {An Application of Intelligent Data Analysis Techniques to a Large
Software Engineering Dataset},
booktitle = {Advances in Intelligent Data Analysis VIII, 8th International Symposium
on Intelligent Data Analysis, {IDA} 2009, Lyon, France, August 31
- September 2, 2009. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5772},
pages = {261--272},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-03915-7\_23},
doi = {10.1007/978-3-642-03915-7\_23},
timestamp = {Tue, 14 May 2019 10:00:49 +0200},
biburl = {https://dblp.org/rec/conf/ida/CainCST09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/WrigleyTBW09,
author = {Stuart N. Wrigley and
Simon Tucker and
Guy J. Brown and
Steve Whittaker},
title = {Audio spatialisation strategies for multitasking during teleconferences},
booktitle = {10th Annual Conference of the International Speech Communication Association,
{INTERSPEECH} 2009, Brighton, United Kingdom, September 6-10, 2009},
pages = {2935--2938},
publisher = {{ISCA}},
year = {2009},
url = {https://doi.org/10.21437/Interspeech.2009-743},
doi = {10.21437/INTERSPEECH.2009-743},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/WrigleyTBW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/TullyKCW09,
author = {Stephen Tully and
George Kantor and
Howie Choset and
Felix Werner},
title = {A multi-hypothesis topological {SLAM} approach for loop closing on
edge-ordered graphs},
booktitle = {2009 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, October 11-15, 2009, St. Louis, MO, {USA}},
pages = {4943--4948},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/IROS.2009.5354255},
doi = {10.1109/IROS.2009.5354255},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/TullyKCW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/WernerMSCTK09,
author = {Felix Werner and
Fr{\'{e}}d{\'{e}}ric Maire and
Joaquin Sitte and
Howie Choset and
Stephen Tully and
George Kantor},
title = {Topological {SLAM} using neighbourhood information of places},
booktitle = {2009 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, October 11-15, 2009, St. Louis, MO, {USA}},
pages = {4937--4942},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/IROS.2009.5354748},
doi = {10.1109/IROS.2009.5354748},
timestamp = {Mon, 22 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iros/WernerMSCTK09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isit/TuneBH09,
author = {Paul Tune and
Sibi Raj Bhaskaran and
Stephen V. Hanly},
title = {Number of measurements in sparse signal recovery},
booktitle = {{IEEE} International Symposium on Information Theory, {ISIT} 2009,
June 28 - July 3, 2009, Seoul, Korea, Proceedings},
pages = {16--20},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/ISIT.2009.5205809},
doi = {10.1109/ISIT.2009.5205809},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/isit/TuneBH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispa/HedayatCTS09,
author = {Maryam Khademi Hedayat and
Wentong Cai and
Stephen John Turner and
Shayan Shahand},
title = {Distributed Execution of Workflow Using Parallel Partitioning},
booktitle = {{IEEE} International Symposium on Parallel and Distributed Processing
with Applications, {ISPA} 2009, Chengdu, Sichuan, China, 10-12 August
2009},
pages = {106--112},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ISPA.2009.96},
doi = {10.1109/ISPA.2009.96},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ispa/HedayatCTS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itw/BhaskaranDGHT09,
author = {Sibi Raj Bhaskaran and
Linda M. Davis and
Alex J. Grant and
Stephen V. Hanly and
Paul Tune},
editor = {Bruce E. Hajek and
Leandros Tassiulas and
Venkat Anantharam and
Ioannis Kontoyiannis},
title = {Downlink scheduling using compressed sensing},
booktitle = {2009 {IEEE} Information Theory Workshop, {ITW} 2009, Volos, Greece,
June 10-12, 2009},
pages = {201--205},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/ITWNIT.2009.5158571},
doi = {10.1109/ITWNIT.2009.5158571},
timestamp = {Mon, 09 Aug 2021 14:54:02 +0200},
biburl = {https://dblp.org/rec/conf/itw/BhaskaranDGHT09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iui/TuckerW09,
author = {Simon Tucker and
Steve Whittaker},
editor = {Cristina Conati and
Mathias Bauer and
Nuria Oliver and
Daniel S. Weld},
title = {Have a say over what you see: evaluating interactive compression techniques},
booktitle = {Proceedings of the 14th International Conference on Intelligent User
Interfaces, {IUI} 2009, Sanibel Island, Florida, USA, February 8-11,
2009},
pages = {37--46},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1502650.1502659},
doi = {10.1145/1502650.1502659},
timestamp = {Mon, 11 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iui/TuckerW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/AydtTCLA09,
author = {Heiko Aydt and
Stephen John Turner and
Wentong Cai and
Malcolm Yoke Hean Low and
Rassul Ayani},
title = {Symbiotic Simulation Model Validation for Radiation Detection Applications},
booktitle = {23rd International Workshop on Principles of Advanced and Distributed
Simulation, {PADS} 2009, Lake Placid, New York, USA, June 22-25, 2009},
pages = {11--18},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/PADS.2009.20},
doi = {10.1109/PADS.2009.20},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/AydtTCLA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/RodgerHLQNTLCDS09,
author = {Susan H. Rodger and
Jenna Hayes and
Gaetjens Lezin and
Henry Qin and
Deborah Nelson and
Ruth Tucker and
Mercedes Lopez and
Stephen Cooper and
Wanda P. Dann and
Don Slater},
editor = {Sue Fitzgerald and
Mark Guzdial and
Gary Lewandowski and
Steven A. Wolfman},
title = {Engaging middle school teachers and students with alice in a diverse
set of subjects},
booktitle = {Proceedings of the 40th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 2009, Chattanooga, TN, USA, March 4-7, 2009},
pages = {271--275},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1508865.1508967},
doi = {10.1145/1508865.1508967},
timestamp = {Thu, 10 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigcse/RodgerHLQNTLCDS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/PalazziSFLAABBC09,
author = {Maria Palazzi and
Norah Zuniga Shaw and
William Forsythe and
Matthew R. Lewis and
Beth Albright and
Michael Andereck and
Sucheta Bhatawadekar and
Hyowon Ban and
Andrew Calhoun and
Jane Drozd and
Joshua Fry and
Melissa S. Quintanilha and
Anna Reed and
Benjamin Schroeder and
Lily Skove and
Ashley Thorndike and
Mary Twohig and
Ola Ahlqvist and
Peter Chan and
Noel Cressie and
Stephen Turk and
Jill Johnson and
Christopher Roman and
Elizabeth Waterhouse and
Scott DeLahunta and
Patrick Haggard and
Alva No{\"{e}}},
editor = {Jacquelyn Martino},
title = {Synchronous Objects for One Flat Thing, reproduced},
booktitle = {International Conference on Computer Graphics and Interactive Techniques,
{SIGGRAPH} 2009, New Orleans, Louisiana, USA, August 3-7, 2009, Art
Gallery},
pages = {37:1},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1667265.1667306},
doi = {10.1145/1667265.1667306},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/siggraph/PalazziSFLAABBC09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tpcg/LongshawTFG09,
author = {Stephen M. Longshaw and
Martin J. Turner and
Emma Finch and
Robert Gawthorpe},
editor = {Wen Tang and
John P. Collomosse},
title = {Discrete Element Modelling Using a Parallelised Physics Engine},
booktitle = {{EG} {UK} Theory and Practice of Computer Graphics, Cardiff University,,
United Kingdom, 2009. Proceedings},
pages = {207--214},
publisher = {Eurographics Association},
year = {2009},
url = {https://doi.org/10.2312/LocalChapterEvents/TPCG/TPCG09/207-214},
doi = {10.2312/LOCALCHAPTEREVENTS/TPCG/TPCG09/207-214},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tpcg/LongshawTFG09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/AydtTCL09,
author = {Heiko Aydt and
Stephen John Turner and
Wentong Cai and
Malcolm Yoke Hean Low},
editor = {Ann Dunkin and
Ricki G. Ingalls and
Enver Y{\"{u}}cesan and
Manuel D. Rossetti and
Ray Hill and
Bj{\"{o}}rn Johansson},
title = {Research Issues in Symbiotic Simulation},
booktitle = {Proceedings of the 2009 Winter Simulation Conference, {WSC} 2009,
Hilton Austin Hotel, Austin, TX, USA, December 13-16, 2009},
pages = {1213--1222},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/WSC.2009.5429419},
doi = {10.1109/WSC.2009.5429419},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/AydtTCL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/PanTCL09,
author = {Ke Pan and
Stephen John Turner and
Wentong Cai and
Zengxiang Li},
editor = {Ann Dunkin and
Ricki G. Ingalls and
Enver Y{\"{u}}cesan and
Manuel D. Rossetti and
Ray Hill and
Bj{\"{o}}rn Johansson},
title = {Implementation of Data Distribution Management Services in a Service
Oriented {HLA} {RTI}},
booktitle = {Proceedings of the 2009 Winter Simulation Conference, {WSC} 2009,
Hilton Austin Hotel, Austin, TX, USA, December 13-16, 2009},
pages = {1027--1038},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/WSC.2009.5429557},
doi = {10.1109/WSC.2009.5429557},
timestamp = {Thu, 10 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/PanTCL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TaylorMTPS09,
author = {Simon J. E. Taylor and
Navonil Mustafee and
Stephen John Turner and
Ke Pan and
Steffen Stra{\ss}burger},
editor = {Ann Dunkin and
Ricki G. Ingalls and
Enver Y{\"{u}}cesan and
Manuel D. Rossetti and
Ray Hill and
Bj{\"{o}}rn Johansson},
title = {Commercial-Off-The-Shelf Simulation Package Interoperability: Issues
and Futures},
booktitle = {Proceedings of the 2009 Winter Simulation Conference, {WSC} 2009,
Hilton Austin Hotel, Austin, TX, USA, December 13-16, 2009},
pages = {203--215},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/WSC.2009.5429326},
doi = {10.1109/WSC.2009.5429326},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/TaylorMTPS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/tf/09/TurnerCLA09,
author = {Stephen John Turner and
Wentong Cai and
Malcolm Yoke Hean Low and
Heiko Aydt},
editor = {Adelinde M. Uhrmacher and
Danny Weyns},
title = {An Agent-Based Generic Framework for Symbiotic Simulation Systems},
booktitle = {Multi-Agent Systems - Simulation and Applications},
series = {Computational Analysis, Synthesis, and Design of Dynamic Systems},
pages = {357--387},
publisher = {{CRC} Press / Taylor {\&} Francis},
year = {2009},
url = {https://doi.org/10.1201/9781420070248.ch12},
doi = {10.1201/9781420070248.CH12},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/tf/09/TurnerCLA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/dsrt/2009,
editor = {Stephen John Turner and
David J. Roberts and
Wentong Cai and
Abdulmotaleb El{-}Saddik},
title = {13th {IEEE/ACM} International Symposium on Distributed Simulation
and Real Time Applications, Singapore, 25-28 October 2009},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://ieeexplore.ieee.org/xpl/conhome/5361739/proceeding},
isbn = {978-0-7695-3868-6},
timestamp = {Wed, 10 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dsrt/2009.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2009,
editor = {Stephen M. Watt and
Viorel Negru and
Tetsuo Ida and
Tudor Jebelean and
Dana Petcu and
Daniela Zaharie},
title = {11th International Symposium on Symbolic and Numeric Algorithms for
Scientific Computing, {SYNASC} 2009, Timisoara, Romania, September
26-29, 2009},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://ieeexplore.ieee.org/xpl/conhome/5459479/proceeding},
isbn = {978-1-4244-5910-0},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/synasc/2009.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0904-4525,
author = {Paul Tune and
Sibiraj Bhaskaran Pillai and
Stephen V. Hanly},
title = {Number of Measurements in Sparse Signal Recovery},
journal = {CoRR},
volume = {abs/0904.4525},
year = {2009},
url = {http://arxiv.org/abs/0904.4525},
eprinttype = {arXiv},
eprint = {0904.4525},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-0904-4525.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csda/FridleyTCRBB08,
author = {Brooke L. Fridley and
Stephen T. Turner and
Arlene B. Chapman and
Andrei S. Rodin and
Eric Boerwinkle and
Kent R. Bailey},
title = {Reproducibility of genotypes as measured by the affymetrix GeneChip\({}^{\mbox{{\textregistered}}}\)
100K Human Mapping Array set},
journal = {Comput. Stat. Data Anal.},
volume = {52},
number = {12},
pages = {5367--5374},
year = {2008},
url = {https://doi.org/10.1016/j.csda.2008.05.020},
doi = {10.1016/J.CSDA.2008.05.020},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/csda/FridleyTCRBB08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ese/BudgenKCTBL08,
author = {David Budgen and
Barbara A. Kitchenham and
Stuart M. Charters and
Mark Turner and
Pearl Brereton and
Stephen G. Linkman},
title = {Presenting software engineering results using structured abstracts:
a randomised experiment},
journal = {Empir. Softw. Eng.},
volume = {13},
number = {4},
pages = {435--468},
year = {2008},
url = {https://doi.org/10.1007/s10664-008-9075-7},
doi = {10.1007/S10664-008-9075-7},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ese/BudgenKCTBL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/ChenTTCMZ08,
author = {Dan Chen and
Georgios K. Theodoropoulos and
Stephen John Turner and
Wentong Cai and
Rob Minson and
Yi Zhang},
title = {Large scale agent-based simulation on the grid},
journal = {Future Gener. Comput. Syst.},
volume = {24},
number = {7},
pages = {658--671},
year = {2008},
url = {https://doi.org/10.1016/j.future.2008.01.004},
doi = {10.1016/J.FUTURE.2008.01.004},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fgcs/ChenTTCMZ08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/ChenTCX08,
author = {Dan Chen and
Stephen John Turner and
Wentong Cai and
Muzhou Xiong},
title = {A decoupled federate architecture for high level architecture-based
distributed simulation},
journal = {J. Parallel Distributed Comput.},
volume = {68},
number = {11},
pages = {1487--1503},
year = {2008},
url = {https://doi.org/10.1016/j.jpdc.2008.07.010},
doi = {10.1016/J.JPDC.2008.07.010},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jpdc/ChenTCX08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/BugAGGFLLRSTM08,
author = {William J. Bug and
Giorgio A. Ascoli and
Jeffrey S. Grethe and
Amarnath Gupta and
Christine Fennema{-}Notestine and
Angela R. Laird and
Stephen D. Larson and
Daniel L. Rubin and
Gordon M. Shepherd and
Jessica A. Turner and
Maryann E. Martone},
title = {The {NIFSTD} and BIRNLex Vocabularies: Building Comprehensive Ontologies
for Neuroscience},
journal = {Neuroinformatics},
volume = {6},
number = {3},
pages = {175--194},
year = {2008},
url = {https://doi.org/10.1007/s12021-008-9032-z},
doi = {10.1007/S12021-008-9032-Z},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ni/BugAGGFLLRSTM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/puc/WhittakerTSL08,
author = {Steve Whittaker and
Simon Tucker and
Kumutha Swampillai and
Rachel Laban},
title = {Design and evaluation of systems to support interaction capture and
retrieval},
journal = {Pers. Ubiquitous Comput.},
volume = {12},
number = {3},
pages = {197--221},
year = {2008},
url = {https://doi.org/10.1007/s00779-007-0146-3},
doi = {10.1007/S00779-007-0146-3},
timestamp = {Mon, 11 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/puc/WhittakerTSL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigplan/AllenBBBFFHKKLLLPRRSTW08,
author = {Eric Allen and
Mark W. Bailey and
Rastislav Bod{\'{\i}}k and
Kim B. Bruce and
Kathleen Fisher and
Stephen N. Freund and
Robert Harper and
Chandra Krintz and
Shriram Krishnamurthi and
James R. Larus and
Doug Lea and
Gary T. Leavens and
Lori L. Pollock and
Stuart Reges and
Martin C. Rinard and
Mark A. Sheldon and
Franklyn A. Turbak and
Mitchell Wand},
title = {{SIGPLAN} programming language curriculum workshop: Discussion Summaries
and recommendations},
journal = {{ACM} {SIGPLAN} Notices},
volume = {43},
number = {11},
pages = {6--29},
year = {2008},
url = {https://doi.org/10.1145/1480828.1480831},
doi = {10.1145/1480828.1480831},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigplan/AllenBBBFFHKKLLLPRRSTW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/ChenTC08,
author = {Dan Chen and
Stephen John Turner and
Wentong Cai},
title = {Towards Fault-tolerant HLA-based Distributed Simulations},
journal = {Simul.},
volume = {84},
number = {10-11},
pages = {493--509},
year = {2008},
url = {https://doi.org/10.1177/0037549708095518},
doi = {10.1177/0037549708095518},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simulation/ChenTC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/TuckerW08,
author = {Simon Tucker and
Steve Whittaker},
title = {Temporal Compression Of Speech: An Evaluation},
journal = {{IEEE} Trans. Speech Audio Process.},
volume = {16},
number = {4},
pages = {790--796},
year = {2008},
url = {https://doi.org/10.1109/TASL.2008.916527},
doi = {10.1109/TASL.2008.916527},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taslp/TuckerW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/PhamWZBBHABHLW08,
author = {Tuan D. Pham and
Honghui Wang and
Xiaobo Zhou and
Dominik Beck and
Miriam Brandl and
Gerard Hoehn and
Joseph Azok and
Marie{-}Luise Brennan and
Stanley L. Hazen and
King C. Li and
Stephen T. C. Wong},
title = {Computational Prediction Models for Early Detection of Risk of Cardiovascular
Events Using Mass Spectrometry Data},
journal = {{IEEE} Trans. Inf. Technol. Biomed.},
volume = {12},
number = {5},
pages = {636--643},
year = {2008},
url = {https://doi.org/10.1109/TITB.2007.908756},
doi = {10.1109/TITB.2007.908756},
timestamp = {Wed, 13 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/titb/PhamWZBBHABHLW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aina/LiTTCH08,
author = {Xiaorong Li and
Stephen John Turner and
Kok Heng Tong and
Hoong{-}Maeng Chan and
Terence Hung},
title = {Design of an SLA-Driven QoS Management Platform for Provisioning Multimedia
Personalized Services},
booktitle = {22nd International Conference on Advanced Information Networking and
Applications, {AINA} 2008, Workshops Proceedings, GinoWan, Okinawa,
Japan, March 25-28, 2008},
pages = {1405--1409},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/WAINA.2008.256},
doi = {10.1109/WAINA.2008.256},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aina/LiTTCH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asiams/ChenCTW08,
author = {Xinjun Chen and
Wentong Cai and
Stephen John Turner and
Yong Wang},
title = {Shared Variable Management in SOAr-DSGrid},
booktitle = {Second Asia International Conference on Modelling and Simulation,
{AMS} 2008, Kuala Lumpur, Malaysia, May 13-15, 2008},
pages = {154--161},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/AMS.2008.161},
doi = {10.1109/AMS.2008.161},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asiams/ChenCTW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bliss/YanciPA08,
author = {Asier Goikoetxea Yanci and
Stephen Pickles and
Tughrul Arslan},
editor = {Adrian Stoica and
Tughrul Arslan and
Daniel Howard and
Tetsuya Higuchi and
Ahmed O. El{-}Rayis},
title = {Detecting Voltage Glitch Attacks on Secure Devices},
booktitle = {2008 {ECSIS} Symposium on Bio-inspired, Learning, and Intelligent
Systems for Security, {BLISS} 2008, Edinburgh, UK, 4-6 August 2008},
pages = {75--80},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/BLISS.2008.26},
doi = {10.1109/BLISS.2008.26},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bliss/YanciPA08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/Turner08,
author = {Stephen John Turner},
editor = {David J. Roberts and
Abdulmotaleb El{-}Saddik and
Alois Ferscha},
title = {Distributed Simulation on the Grid: Opportunities and Challenges},
booktitle = {12th {IEEE/ACM} International Symposium on Distributed Simulation
and Real-Time Applications, 27-29 October 2008, Vancouver, BC, Canada,
Proceedings},
pages = {3},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/DS-RT.2008.49},
doi = {10.1109/DS-RT.2008.49},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dsrt/Turner08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/EdwardsBTDTSMR08,
author = {Todd L. Edwards and
William S. Bush and
Stephen D. Turner and
Scott M. Dudek and
Eric Torstenson and
Mike Schmidt and
Eden Martin and
Marylyn D. Ritchie},
editor = {Elena Marchiori and
Jason H. Moore},
title = {Generating Linkage Disequilibrium Patterns in Data Simulations Using
genomeSIMLA},
booktitle = {Evolutionary Computation, Machine Learning and Data Mining in Bioinformatics,
6th European Conference, EvoBIO 2008, Naples, Italy, March 26-28,
2008. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4973},
pages = {24--35},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-78757-0\_3},
doi = {10.1007/978-3-540-78757-0\_3},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/evoW/EdwardsBTDTSMR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fecs/TurnerF08,
author = {Stephen W. Turner and
Michael Farmer},
editor = {Hamid R. Arabnia and
Victor A. Clincy and
Nasser Tadayon},
title = {Assessment of Student Performance in an Internet-Based Multimedia
Classroom},
booktitle = {Proceedings of the 2008 International Conference on Frontiers in Education:
Computer Science {\&} Computer Engineering, {FECS} 2008, July
14-17, 2008, Las Vegas, Nevada, {USA}},
pages = {411--415},
publisher = {{CSREA} Press},
year = {2008},
timestamp = {Mon, 21 Dec 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fecs/TurnerF08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hoti/FeehrerRSGYPHT08,
author = {John R. Feehrer and
Paul Rotker and
Milton Shih and
Paul Gingras and
Peter Yakutis and
Stephen Phillips and
John Heath and
Sebastian Turullols},
title = {Coherency Hub Design for Multi-Node Victoria Falls Server Systems},
booktitle = {16th Annual {IEEE} Symposium on High Performance Interconnects {(HOTI}
2008), 26-28 August 2008, Stanford, CA, {USA}},
pages = {43--50},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/HOTI.2008.12},
doi = {10.1109/HOTI.2008.12},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hoti/FeehrerRSGYPHT08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iadis/FarrierGT08,
author = {Stephen Farrier and
Patricia Gannon{-}Leary and
Chris Turnock},
editor = {Miguel Baptista Nunes and
Maggie McPherson},
title = {Risk Managing Your Vle: Strategic Implications For Learning Providers},
booktitle = {{IADIS} International Conference e-Learning 2008, Amsterdam, The Netherlands,
July 22-25, 2008. Proceedings},
pages = {33--37},
publisher = {{IADIS}},
year = {2008},
timestamp = {Sun, 01 Mar 2009 21:54:10 +0100},
biburl = {https://dblp.org/rec/conf/iadis/FarrierGT08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/AydtTCLLG08,
author = {Heiko Aydt and
Stephen John Turner and
Wentong Cai and
Malcolm Yoke Hean Low and
Peter Lendermann and
Boon{-}Ping Gan},
editor = {Marian Bubak and
G. Dick van Albada and
Jack J. Dongarra and
Peter M. A. Sloot},
title = {Symbiotic Simulation Control in Semiconductor Manufacturing},
booktitle = {Computational Science - {ICCS} 2008, 8th International Conference,
Krak{\'{o}}w, Poland, June 23-25, 2008, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {5103},
pages = {26--35},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-69389-5\_5},
doi = {10.1007/978-3-540-69389-5\_5},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccS/AydtTCLLG08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/TullyMKC08,
author = {Stephen Tully and
Hyungpil Moon and
George Kantor and
Howie Choset},
title = {Iterated filters for bearing-only {SLAM}},
booktitle = {2008 {IEEE} International Conference on Robotics and Automation, {ICRA}
2008, May 19-23, 2008, Pasadena, California, {USA}},
pages = {1442--1448},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/ROBOT.2008.4543405},
doi = {10.1109/ROBOT.2008.4543405},
timestamp = {Mon, 22 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/TullyMKC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/WrigleyTBW08,
author = {Stuart N. Wrigley and
Simon Tucker and
Guy J. Brown and
Steve Whittaker},
title = {The influence of audio presentation style on multitasking during teleconferences},
booktitle = {9th Annual Conference of the International Speech Communication Association,
{INTERSPEECH} 2008, Brisbane, Australia, September 22-26, 2008},
pages = {801--804},
publisher = {{ISCA}},
year = {2008},
url = {https://doi.org/10.21437/Interspeech.2008-245},
doi = {10.21437/INTERSPEECH.2008-245},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/WrigleyTBW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispd/LiAHMQV08,
author = {Zhuo Li and
Charles J. Alpert and
Shiyan Hu and
Tuhin Muhmud and
Stephen T. Quay and
Paul G. Villarrubia},
editor = {David Z. Pan and
Gi{-}Joon Nam},
title = {Fast interconnect synthesis with layer assignment},
booktitle = {Proceedings of the 2008 International Symposium on Physical Design,
{ISPD} 2008, Portland, Oregon, USA, April 13-16, 2008},
pages = {71--77},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1353629.1353648},
doi = {10.1145/1353629.1353648},
timestamp = {Tue, 06 Nov 2018 11:07:47 +0100},
biburl = {https://dblp.org/rec/conf/ispd/LiAHMQV08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/massdata/PhamWZBBHABHW08,
author = {Tuan D. Pham and
Honghui Wang and
Xiaobo Zhou and
Dominik Beck and
Miriam Brandl and
Gerard Hoehn and
Joseph Azok and
Marie{-}Luise Brennan and
Stanley L. Hazen and
Stephen T. C. Wong},
editor = {Petra Perner and
Ovidio Salvetti},
title = {Classification of Mass Spectrometry Based Protein Markers by Kriging
Error Matching},
booktitle = {Advances in Mass Data Analysis of Images and Signals in Medicine,
Biotechnology, Chemistry and Food Industry, Third International Conference,
{MDA} 2008, Leipzig, Germany, July 14, 2008, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5108},
pages = {82--94},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-70715-8\_8},
doi = {10.1007/978-3-540-70715-8\_8},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/massdata/PhamWZBBHABHW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mlmi/TuckerKW08,
author = {Simon Tucker and
Nicos Kyprianou and
Steve Whittaker},
editor = {Andrei Popescu{-}Belis and
Rainer Stiefelhagen},
title = {Time-Compressing Speech: {ASR} Transcripts Are an Effective Way to
Support Gist Extraction},
booktitle = {Machine Learning for Multimodal Interaction, 5th International Workshop,
{MLMI} 2008, Utrecht, The Netherlands, September 8-10, 2008. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5237},
pages = {226--235},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-85853-9\_21},
doi = {10.1007/978-3-540-85853-9\_21},
timestamp = {Mon, 11 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mlmi/TuckerKW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mmvr/TurinskyFTDSSWH08,
author = {Andrei L. Turinsky and
Elena Fanea and
Quang Trinh and
Xiaoli Dong and
Julie N. Stromer and
Xueling Shu and
Stephen Wat and
Benedikt Hallgr{\'{\i}}msson and
Jonathan W. Hill and
Carol Edwards and
Brenda Grosenick and
Masumi Yajima and
Christoph W. Sensen},
editor = {James D. Westwood and
Randy S. Haluck and
Helene M. Hoffman and
Greg T. Mogel and
Roger Phillips and
Richard A. Robb and
Kirby G. Vosburgh},
title = {Integration of Genomic and Medical Data into a 3D Atlas of Human Anatomy},
booktitle = {Medicine Meets Virtual Reality 16 - parallel, combinatorial, convergent:
NextMed by Design, {MMVR} 2008, Long Beach, CA, USA, January 29, 2008},
series = {Studies in Health Technology and Informatics},
volume = {132},
pages = {526--531},
publisher = {{IOS} Press},
year = {2008},
timestamp = {Tue, 09 Jan 2018 17:48:16 +0100},
biburl = {https://dblp.org/rec/conf/mmvr/TurinskyFTDSSWH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/AydtTCL08,
author = {Heiko Aydt and
Stephen John Turner and
Wentong Cai and
Malcolm Yoke Hean Low},
editor = {Francesco Quaglia and
Jason Liu},
title = {Symbiotic Simulation Systems: An Extended Definition Motivated by
Symbiosis in Biology},
booktitle = {22st International Workshop on Principles of Advanced and Distributed
Simulation, {PADS} 2008, Roma, Italy, June 3-6, 2008},
pages = {109--116},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/PADS.2008.17},
doi = {10.1109/PADS.2008.17},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pads/AydtTCL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/PanTCL08,
author = {Ke Pan and
Stephen John Turner and
Wentong Cai and
Zengxiang Li},
editor = {Francesco Quaglia and
Jason Liu},
title = {A Hybrid {HLA} Time Management Algorithm Based on Both Conditional
and Unconditional Information},
booktitle = {22st International Workshop on Principles of Advanced and Distributed
Simulation, {PADS} 2008, Roma, Italy, June 3-6, 2008},
pages = {203--211},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/PADS.2008.11},
doi = {10.1109/PADS.2008.11},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/PanTCL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/TaylorTS08,
author = {Simon J. E. Taylor and
Stephen John Turner and
Steffen Stra{\ss}burger},
editor = {Francesco Quaglia and
Jason Liu},
title = {Clarifying Interoperability: The {SISO} {CSPI} {PDG} Standard for
Commercial Off-The-Shelf Simulation Package Interoperability Reference
Models},
booktitle = {22st International Workshop on Principles of Advanced and Distributed
Simulation, {PADS} 2008, Roma, Italy, June 3-6, 2008},
pages = {153},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/PADS.2008.35},
doi = {10.1109/PADS.2008.35},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pads/TaylorTS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scss/ClarkST08,
author = {Stephen O. Clark and
Steven T. Shorrock and
Nic Turley},
editor = {Felix Redmill and
Tom Anderson},
title = {Human Factors Safety Assurance for Changing {ATM} Systems},
booktitle = {Improvements in System Safety - Proceedings of the Sixteenth Safety-Critical
Systems Symposium, Brighton, UK, February 5-7, 2008},
pages = {155--173},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-1-84800-100-8\_10},
doi = {10.1007/978-1-84800-100-8\_10},
timestamp = {Fri, 15 May 2020 12:05:38 +0200},
biburl = {https://dblp.org/rec/conf/scss/ClarkST08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/TurnerQPE08,
author = {Scott A. Turner and
Ricardo Quintana{-}Castillo and
Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and
Stephen H. Edwards},
editor = {J. D. Dougherty and
Susan H. Rodger and
Sue Fitzgerald and
Mark Guzdial},
title = {Misunderstandings about object-oriented design: experiences using
code reviews},
booktitle = {Proceedings of the 39th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 2008, Portland, OR, USA, March 12-15, 2008},
pages = {97--101},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1352135.1352169},
doi = {10.1145/1352135.1352169},
timestamp = {Wed, 10 Mar 2021 13:17:16 +0100},
biburl = {https://dblp.org/rec/conf/sigcse/TurnerQPE08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tpcg/LongshawTH08,
author = {Stephen M. Longshaw and
Martin J. Turner and
W. Terry Hewitt},
editor = {Ik Soo Lim and
Wen Tang},
title = {Interactive Grid Based Binning for Information Visualization},
booktitle = {{EG} {UK} Theory and Practice of Computer Graphics, Manchester, United
Kingdom, 2008. Proceedings},
pages = {35--42},
publisher = {Eurographics Association},
year = {2008},
url = {https://doi.org/10.2312/LocalChapterEvents/TPCG/TPCG08/035-042},
doi = {10.2312/LOCALCHAPTEREVENTS/TPCG/TPCG08/035-042},
timestamp = {Sat, 16 Sep 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tpcg/LongshawTH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/AydtTCLLGA08,
author = {Heiko Aydt and
Stephen John Turner and
Wentong Cai and
Malcolm Yoke Hean Low and
Peter Lendermann and
Boon{-}Ping Gan and
Rassul Ayani},
editor = {Scott J. Mason and
Raymond R. Hill and
Lars M{\"{o}}nch and
Oliver Rose and
Thomas Jefferson and
John W. Fowler},
title = {Preventive what-if analysis in symbiotic simulation},
booktitle = {Proceedings of the 2008 Winter Simulation Conference, Global Gateway
to Discovery, {WSC} 2008, InterContinental Hotel, Miami, Florida,
USA, December 7-10, 2008},
pages = {750--758},
publisher = {{WSC}},
year = {2008},
url = {https://doi.org/10.1109/WSC.2008.4736137},
doi = {10.1109/WSC.2008.4736137},
timestamp = {Thu, 10 Jun 2021 22:19:17 +0200},
biburl = {https://dblp.org/rec/conf/wsc/AydtTCLLGA08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/LiCTP08,
author = {Zengxiang Li and
Wentong Cai and
Stephen John Turner and
Ke Pan},
editor = {Scott J. Mason and
Raymond R. Hill and
Lars M{\"{o}}nch and
Oliver Rose and
Thomas Jefferson and
John W. Fowler},
title = {Improving performance by replicating simulations with alternative
synchronization approaches},
booktitle = {Proceedings of the 2008 Winter Simulation Conference, Global Gateway
to Discovery, {WSC} 2008, InterContinental Hotel, Miami, Florida,
USA, December 7-10, 2008},
pages = {1112--1120},
publisher = {{WSC}},
year = {2008},
url = {https://doi.org/10.1109/WSC.2008.4736180},
doi = {10.1109/WSC.2008.4736180},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/LiCTP08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/LiangTG08,
author = {Yuanxi Liang and
Stephen John Turner and
Boon{-}Ping Gan},
editor = {Scott J. Mason and
Raymond R. Hill and
Lars M{\"{o}}nch and
Oliver Rose and
Thomas Jefferson and
John W. Fowler},
title = {Predictive-conservative synchronization for commercial simulation
package interoperability},
booktitle = {Proceedings of the 2008 Winter Simulation Conference, Global Gateway
to Discovery, {WSC} 2008, InterContinental Hotel, Miami, Florida,
USA, December 7-10, 2008},
pages = {1103--1111},
publisher = {{WSC}},
year = {2008},
url = {https://doi.org/10.1109/WSC.2008.4736179},
doi = {10.1109/WSC.2008.4736179},
timestamp = {Thu, 10 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/LiangTG08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TaylorTS08,
author = {Simon J. E. Taylor and
Stephen John Turner and
Steffen Stra{\ss}burger},
editor = {Scott J. Mason and
Raymond R. Hill and
Lars M{\"{o}}nch and
Oliver Rose and
Thomas Jefferson and
John W. Fowler},
title = {Guidelines for commercial off-the-shelf Simulation Package interoperability},
booktitle = {Proceedings of the 2008 Winter Simulation Conference, Global Gateway
to Discovery, {WSC} 2008, InterContinental Hotel, Miami, Florida,
USA, December 7-10, 2008},
pages = {193--204},
publisher = {{WSC}},
year = {2008},
url = {https://doi.org/10.1109/WSC.2008.4736068},
doi = {10.1109/WSC.2008.4736068},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/TaylorTS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/FuLWOT08,
author = {Xiuju Fu and
Xiaorong Li and
Lipo Wang and
David Ong and
Stephen John Turner},
editor = {John Fulcher and
Lakhmi C. Jain},
title = {Data Mining in QoS-Aware Media Grids},
booktitle = {Computational Intelligence: {A} Compendium},
series = {Studies in Computational Intelligence},
volume = {115},
pages = {689--714},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-78293-3\_16},
doi = {10.1007/978-3-540-78293-3\_16},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/series/sci/FuLWOT08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ease/2008,
editor = {Giuseppe Visaggio and
Maria Teresa Baldassarre and
Stephen G. Linkman and
Mark Turner},
title = {12th International Conference on Evaluation and Assessment in Software
Engineering, {EASE} 2008, University of Bari, Italy, 26-27 June 2008},
series = {Workshops in Computing},
publisher = {{BCS}},
year = {2008},
url = {http://ewic.bcs.org/category/16334},
timestamp = {Tue, 15 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ease/2008.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0802-3047,
author = {C. Saha and
Terence O'Donnell and
J. Godsell and
L. Carlioz and
Ningning Wang and
Paul McCloskey and
Stephen P. Beeby and
M.{-}J. Tudor and
Russel N. Torah},
title = {Step-up converter for electromagnetic vibrational energy scavenger},
journal = {CoRR},
volume = {abs/0802.3047},
year = {2008},
url = {http://arxiv.org/abs/0802.3047},
eprinttype = {arXiv},
eprint = {0802.3047},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-0802-3047.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iasc/BowmanLTCN07,
author = {Catherine D. D. Bowman and
Stephenie H. Lievense and
Edward W. Tunstel and
Eugene C. Chalfant and
Jeffrey S. Norris},
title = {{NASA} Robotics Education: Inspiring the Next Generation of Explorers},
journal = {Intell. Autom. Soft Comput.},
volume = {13},
number = {1},
pages = {69--80},
year = {2007},
url = {https://doi.org/10.1080/10798587.2007.10642951},
doi = {10.1080/10798587.2007.10642951},
timestamp = {Fri, 26 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iasc/BowmanLTCN07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iee/KitchenhamBBTCL07,
author = {Barbara A. Kitchenham and
David Budgen and
Pearl Brereton and
Mark Turner and
Stuart M. Charters and
Stephen G. Linkman},
title = {Large-scale software engineering questions expert opinion or empirical
evidence?},
journal = {{IET} Softw.},
volume = {1},
number = {5},
pages = {161--171},
year = {2007},
url = {https://doi.org/10.1049/iet-sen:20060052},
doi = {10.1049/IET-SEN:20060052},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iee/KitchenhamBBTCL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jos/LendermannTLGJC07,
author = {Peter Lendermann and
Stephen John Turner and
Malcolm Y. H. Low and
Boon Ping Gan and
Nirupam Julka and
Lai Peng Chan and
Wentong Cai and
Loo Hay Lee and
Ek Peng Chew and
Suyan Teng and
Leon F. McGinnis},
title = {An integrated and adaptive decision-support framework for high-tech
manufacturing and service networks},
journal = {J. Simulation},
volume = {1},
number = {2},
pages = {69--79},
year = {2007},
url = {https://doi.org/10.1057/palgrave.jos.4250016},
doi = {10.1057/PALGRAVE.JOS.4250016},
timestamp = {Sat, 19 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jos/LendermannTLGJC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BehzadCC0PLLLAK07,
author = {Arya Behzad and
Keith A. Carter and
Hung{-}Ming Chien and
Stephen Wu and
Meng{-}An Pan and
C. Paul Lee and
Qiang (Tom) Li and
John C. Leete and
Stephen Au and
Michael S. Kappes and
Zhimin Zhou and
Dayo Ojo and
Lijun Zhang and
Alireza Zolfaghari and
Jesse Castaneda and
Hooman Darabi and
Benson Yeung and
Ahmadreza Rofougaran and
Maryam Rofougaran and
Jason Trachewsky and
Tushar Moorti and
Rohit V. Gaikwad and
Amit Bagchi and
Joachim S. Hammerschmidt and
Jay Pattin and
Jacob J. Rael and
Bojko Marholev},
title = {A Fully Integrated {MIMO} Multiband Direct Conversion {CMOS} Transceiver
for {WLAN} Applications (802.11n)},
journal = {{IEEE} J. Solid State Circuits},
volume = {42},
number = {12},
pages = {2795--2808},
year = {2007},
url = {https://doi.org/10.1109/JSSC.2007.908667},
doi = {10.1109/JSSC.2007.908667},
timestamp = {Wed, 02 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/BehzadCC0PLLLAK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lre/MostefaMCPCTCTCTPMTBSBR07,
author = {Djamel Mostefa and
Nicolas Moreau and
Khalid Choukri and
Gerasimos Potamianos and
Stephen M. Chu and
Ambrish Tyagi and
Josep R. Casas and
Jordi Turmo and
Luca Cristoforetti and
Francesco Tobia and
Aristodemos Pnevmatikakis and
Vasileios Mylonakis and
Fotios Talantzis and
Susanne Burger and
Rainer Stiefelhagen and
Keni Bernardin and
Cedrick Rochet},
title = {The {CHIL} audiovisual corpus for lecture and meeting analysis inside
smart rooms},
journal = {Lang. Resour. Evaluation},
volume = {41},
number = {3-4},
pages = {389--407},
year = {2007},
url = {https://doi.org/10.1007/s10579-007-9054-4},
doi = {10.1007/S10579-007-9054-4},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/lre/MostefaMCPCTCTCTPMTBSBR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/ShiTZRTDT07,
author = {Yonggang Shi and
Paul M. Thompson and
Greig I. de Zubicaray and
Stephen E. Rose and
Zhuowen Tu and
Ivo D. Dinov and
Arthur W. Toga},
title = {Direct mapping of hippocampal surfaces with intrinsic shape context},
journal = {NeuroImage},
volume = {37},
number = {3},
pages = {792--807},
year = {2007},
url = {https://doi.org/10.1016/j.neuroimage.2007.05.016},
doi = {10.1016/J.NEUROIMAGE.2007.05.016},
timestamp = {Fri, 30 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/ShiTZRTDT07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/ZhouCTWZ07,
author = {Suiping Zhou and
Wentong Cai and
Stephen John Turner and
Junhu Wei and
Wenbo Zong},
title = {Flexible State Update Mechanism for Large-Scale Distributed Wargame
Simulations},
journal = {Simul.},
volume = {83},
number = {10},
pages = {707--719},
year = {2007},
url = {https://doi.org/10.1177/0037549707085541},
doi = {10.1177/0037549707085541},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simulation/ZhouCTWZ07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/TuanRDTK07,
author = {Tim Tuan and
Arifur Rahman and
Satyaki Das and
Steven Trimberger and
Sean Kao},
title = {A 90-nm Low-Power {FPGA} for Battery-Powered Applications},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {26},
number = {2},
pages = {296--300},
year = {2007},
url = {https://doi.org/10.1109/TCAD.2006.885731},
doi = {10.1109/TCAD.2006.885731},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcad/TuanRDTK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkde/TuckerMSS07,
author = {Peter A. Tucker and
David Maier and
Tim Sheard and
Paul Stephens},
title = {Using Punctuation Schemes to Characterize Strategies for Querying
over Data Streams},
journal = {{IEEE} Trans. Knowl. Data Eng.},
volume = {19},
number = {9},
pages = {1227--1240},
year = {2007},
url = {https://doi.org/10.1109/TKDE.2007.1052},
doi = {10.1109/TKDE.2007.1052},
timestamp = {Tue, 07 Nov 2017 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tkde/TuckerMSS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/ZengTLHPRL07,
author = {Zhihong Zeng and
Jilin Tu and
Ming Liu and
Thomas S. Huang and
Brian Pianfetti and
Dan Roth and
Stephen E. Levinson},
title = {Audio-Visual Affect Recognition},
journal = {{IEEE} Trans. Multim.},
volume = {9},
number = {2},
pages = {424--428},
year = {2007},
url = {https://doi.org/10.1109/TMM.2006.886310},
doi = {10.1109/TMM.2006.886310},
timestamp = {Thu, 01 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmm/ZengTLHPRL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomccap/ZhouCTLW07,
author = {Suiping Zhou and
Wentong Cai and
Stephen John Turner and
Bu{-}Sung Lee and
Junhu Wei},
title = {Critical causal order of events in distributed virtual environments},
journal = {{ACM} Trans. Multim. Comput. Commun. Appl.},
volume = {3},
number = {3},
pages = {15},
year = {2007},
url = {https://doi.org/10.1145/1236471.1236474},
doi = {10.1145/1236471.1236474},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tomccap/ZhouCTLW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/TavaresTKFNMCHOLS07,
author = {Tulio Tavares and
George Teodoro and
Tahsin M. Kur{\c{c}} and
Renato Ferreira and
Dorgival Olavo Guedes Neto and
Wagner Meira Jr. and
{\"{U}}mit V. {\c{C}}ataly{\"{u}}rek and
Shannon Hastings and
Scott Oster and
Stephen Langella and
Joel H. Saltz},
title = {An Efficient and Reliable Scientific Workflow System},
booktitle = {Seventh {IEEE} International Symposium on Cluster Computing and the
Grid (CCGrid 2007), 14-17 May 2007, Rio de Janeiro, Brazil},
pages = {445--452},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/CCGRID.2007.20},
doi = {10.1109/CCGRID.2007.20},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ccgrid/TavaresTKFNMCHOLS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccnc/LiJFCHHOTV07,
author = {Xiaorong Li and
Wei Jie and
Xiuju Fu and
Hoong{-}Maeng Chan and
Quoc{-}Thuan Ho and
Terence Hung and
David Ong and
Stephen John Turner and
Bharadwaj Veeravalli},
title = {A Multi-Agent Method for Streaming Quality Monitoring and Analysis
over Media Grid},
booktitle = {4th {IEEE} Consumer Communications and Networking Conference, {CCNC}
2007, Las Vegas, NV, USA, January 11-13, 2007},
pages = {327--331},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/CCNC.2007.71},
doi = {10.1109/CCNC.2007.71},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ccnc/LiJFCHHOTV07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/TuanST07,
author = {Tim Tuan and
Tom Strader and
Steve Trimberger},
title = {Analysis of Data Remanence in a 90nm {FPGA}},
booktitle = {Proceedings of the {IEEE} 2007 Custom Integrated Circuits Conference,
{CICC} 2007, DoubleTree Hotel, San Jose, California, USA, September
16-19, 2007},
pages = {93--96},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/CICC.2007.4405689},
doi = {10.1109/CICC.2007.4405689},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cicc/TuanST07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/LiCTP07,
author = {Zengxiang Li and
Wentong Cai and
Stephen John Turner and
Ke Pan},
editor = {David J. Roberts and
Georgios Theodoropoulos and
Abdulmotaleb El{-}Saddik},
title = {Federate Migration in a Service Oriented {HLA} {RTI}},
booktitle = {11th {IEEE} International Symposium on Distributed Simulation and
Real-Time Applications, {DS-RT} 2007, Chania, Greece, 22-24 October
2007},
pages = {113--121},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/DS-RT.2007.31},
doi = {10.1109/DS-RT.2007.31},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsrt/LiCTP07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ease/BudgenKCTBL07,
author = {David Budgen and
Barbara A. Kitchenham and
Stuart M. Charters and
Mark Turner and
Pearl Brereton and
Stephen G. Linkman},
editor = {Barbara A. Kitchenham and
Pearl Brereton and
Mark Turner},
title = {Preliminary results of a study of the completeness and clarity of
structured abstracts},
booktitle = {11th International Conference on Evaluation and Assessment in Software
Engineering, {EASE} 2007, Keele University, UK, 2-3 April 2007},
series = {Workshops in Computing},
publisher = {{BCS}},
year = {2007},
url = {http://ewic.bcs.org/content/ConWebDoc/10676},
timestamp = {Mon, 14 Sep 2020 16:49:35 +0200},
biburl = {https://dblp.org/rec/conf/ease/BudgenKCTBL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esem/BaileyBTKBL07,
author = {John Bailey and
David Budgen and
Mark Turner and
Barbara A. Kitchenham and
Pearl Brereton and
Stephen G. Linkman},
title = {Evidence relating to Object-Oriented software design: {A} survey},
booktitle = {Proceedings of the First International Symposium on Empirical Software
Engineering and Measurement, {ESEM} 2007, September 20-21, 2007, Madrid,
Spain},
pages = {482--484},
publisher = {{ACM} / {IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/ESEM.2007.58},
doi = {10.1109/ESEM.2007.58},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esem/BaileyBTKBL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/SwiftTCG07,
author = {Stephen Swift and
Allan Tucker and
Jason Crampton and
David Garway{-}Heath},
editor = {Hod Lipson},
title = {An improved restricted growth function genetic algorithm for the consensus
clustering of retinal nerve fibre data},
booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2007, Proceedings,
London, England, UK, July 7-11, 2007},
pages = {2174--2181},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1276958.1277376},
doi = {10.1145/1276958.1277376},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gecco/SwiftTCG07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/TuckerSC07,
author = {Allan Tucker and
Stephen Swift and
Jason Crampton},
editor = {Hod Lipson},
title = {Efficiency updates for the restricted growth function {GA} for grouping
problems},
booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2007, Proceedings,
London, England, UK, July 7-11, 2007},
pages = {1536},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1276958.1277265},
doi = {10.1145/1276958.1277265},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gecco/TuckerSC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwn/Turner07,
author = {Stephen Turner},
editor = {Hamid R. Arabnia and
Victor A. Clincy and
Laurence Tianruo Yang},
title = {Dynamic Simple Channel Assignment Strategies for Multiple-Channel
Ad Hoc Networks},
booktitle = {Proceedings of the 2007 International Conference on Wireless Networks,
June 25-28, 2007, Las Vegas, Nevada, {USA}},
pages = {146--152},
publisher = {{CSREA} Press},
year = {2007},
timestamp = {Mon, 09 Feb 2009 10:38:02 +0100},
biburl = {https://dblp.org/rec/conf/icwn/Turner07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icws/PanTCL07,
author = {Ke Pan and
Stephen John Turner and
Wentong Cai and
Zengxiang Li},
title = {A Service Oriented {HLA} {RTI} on the Grid},
booktitle = {2007 {IEEE} International Conference on Web Services {(ICWS} 2007),
July 9-13, 2007, Salt Lake City, Utah, {USA}},
pages = {984--992},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/ICWS.2007.20},
doi = {10.1109/ICWS.2007.20},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icws/PanTCL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/PedeltyDMBPTRJVPNJSLPP07,
author = {Jeffrey A. Pedelty and
Sadashiva Devadiga and
Edward J. Masuoka and
Molly E. Brown and
Jorge E. Pinz{\'{o}}n and
Compton J. Tucker and
David P. Roy and
Junchang Ju and
Eric F. Vermote and
Stephen D. Prince and
Jyoteshwar R. Nagol and
Christopher Justice and
Crystal Schaaf and
Jicheng Liu and
Jeffrey L. Privette and
Ana C. T. Pinheiro},
title = {Generating a long-term land data record from the {AVHRR} and {MODIS}
Instruments},
booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
{IGARSS} 2007, July 23-28, 2007, Barcelona, Spain, Proceedings},
pages = {1021--1025},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/IGARSS.2007.4422974},
doi = {10.1109/IGARSS.2007.4422974},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/PedeltyDMBPTRJVPNJSLPP07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/TullyMMKC07,
author = {Stephen Tully and
Hyungpil Moon and
Deryck Morales and
George Kantor and
Howie Choset},
title = {Hybrid localization using the hierarchical atlas},
booktitle = {2007 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, October 29 - November 2, 2007, Sheraton Hotel and Marina,
San Diego, California, {USA}},
pages = {2857--2864},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/IROS.2007.4399553},
doi = {10.1109/IROS.2007.4399553},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/TullyMMKC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/BehzadCCWPLLLAKZOZZCDYRRTMGBRM07,
author = {Arya Behzad and
Keith A. Carter and
Ed Chien and
Steve Wu and
Michael Pan and
C. Paul Lee and
Tom Li and
John C. Leete and
Stephen Au and
Michael S. Kappes and
Zhimin Zhou and
Dayo Ojo and
Lijun Zhang and
Alireza Zolfaghari and
Jesse Castaneda and
Hooman Darabi and
Benson Yeung and
Reza Rofougaran and
Maryam Rofougaran and
Jason Trachewsky and
Tushar Moorti and
Rohit V. Gaikwad and
Amit Bagchi and
Jacob J. Rael and
Bojko Marholev},
title = {A Fully Integrated {MIMO} Multi-Band Direct-Conversion {CMOS} Transceiver
for {WLAN} Applications (802.11n)},
booktitle = {2007 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2007, Digest of Technical Papers, San Francisco, CA, USA, February
11-15, 2007},
pages = {560--622},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/ISSCC.2007.373543},
doi = {10.1109/ISSCC.2007.373543},
timestamp = {Wed, 02 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/BehzadCCWPLLLAKZOZZCDYRRTMGBRM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lcn/DinhHSCOB07,
author = {Tuan Le Dinh and
Wen Hu and
Pavan Sikka and
Peter I. Corke and
Leslie Overs and
Stephen Brosnan},
title = {Design and Deployment of a Remote Robust Sensor Network: Experiences
from an Outdoor Water Quality Monitoring Network},
booktitle = {32nd Annual {IEEE} Conference on Local Computer Networks {(LCN} 2007),
15-18 October 2007, Clontarf Castle, Dublin, Ireland, Proceedings},
pages = {799--806},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/LCN.2007.39},
doi = {10.1109/LCN.2007.39},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/lcn/DinhHSCOB07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/MurrayHTKCMR07,
author = {Gabriel Murray and
Pei{-}Yun Hsueh and
Simon Tucker and
Jonathan Kilgour and
Jean Carletta and
Johanna D. Moore and
Steve Renals},
editor = {Candace L. Sidner and
Tanja Schultz and
Matthew Stone and
ChengXiang Zhai},
title = {Automatic Segmentation and Summarization of Meeting Speech},
booktitle = {Human Language Technology Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, April
22-27, 2007, Rochester, New York, {USA}},
pages = {9--10},
publisher = {The Association for Computational Linguistics},
year = {2007},
url = {https://aclanthology.org/N07-4005/},
timestamp = {Wed, 07 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/MurrayHTKCMR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/PanTCL07,
author = {Ke Pan and
Stephen John Turner and
Wentong Cai and
Zengxiang Li},
title = {An Efficient Sort-Based {DDM} Matching Algorithm for {HLA} Applications
with a Large Spatial Environment},
booktitle = {21st International Workshop on Principles of Advanced and Distributed
Simulation, PADS'07, San Diego, California, USA, June 12-15, 2007},
pages = {70--82},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/PADS.2007.14},
doi = {10.1109/PADS.2007.14},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/PanTCL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scsc/WangTCC07,
author = {Yong Wang and
Stephen John Turner and
Wentong Cai and
Xinjun Chen},
editor = {Gabriel A. Wainer},
title = {Time management in a service-oriented architecture for distributed
simulation on the grid},
booktitle = {Proceedings of the 2007 Summer Computer Simulation Conference, {SCSC}
2007, San Diego, California, USA, July 16-19, 2007},
pages = {392--399},
publisher = {Simulation Councils, Inc.},
year = {2007},
url = {https://dl.acm.org/citation.cfm?id=1357972},
timestamp = {Wed, 10 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/scsc/WangTCC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tpcg/GobeawanXT07,
author = {Like Gobeawan and
Shuhong Xu and
Stephen John Turner},
editor = {Ik Soo Lim and
David Duce},
title = {Seamless Mesh Stitching Using Curve Approximation},
booktitle = {{EG} {UK} Theory and Practice of Computer Graphics, Bangor, United
Kingdom, June 13-15, 2007},
pages = {165--172},
publisher = {Eurographics Association},
year = {2007},
url = {https://doi.org/10.2312/LocalChapterEvents/TPCG/TPCG07/165-172},
doi = {10.2312/LOCALCHAPTEREVENTS/TPCG/TPCG07/165-172},
timestamp = {Mon, 22 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tpcg/GobeawanXT07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/LowTLPCLB07,
author = {Malcolm Y. H. Low and
Stephen John Turner and
Ding Ling and
Hai L. Peng and
Lai Peng Chan and
Peter Lendermann and
Stephen J. Buckley},
editor = {Shane G. Henderson and
Bahar Biller and
Ming{-}Hua Hsieh and
John Shortle and
Jeffrey D. Tew and
Russell R. Barton},
title = {Symbiotic simulation for business process re-engineering in high-tech
manufacturing and service networks},
booktitle = {Proceedings of the Winter Simulation Conference, {WSC} 2007, Washington,
DC, USA, December 9-12, 2007},
pages = {568--576},
publisher = {{WSC}},
year = {2007},
url = {https://doi.org/10.1109/WSC.2007.4419649},
doi = {10.1109/WSC.2007.4419649},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/LowTLPCLB07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TaylorMSTLL07,
author = {Simon J. E. Taylor and
Navonil Mustafee and
Steffen Stra{\ss}burger and
Stephen John Turner and
Malcolm Y. H. Low and
John Ladbrook},
editor = {Shane G. Henderson and
Bahar Biller and
Ming{-}Hua Hsieh and
John Shortle and
Jeffrey D. Tew and
Russell R. Barton},
title = {The {SISO} {CSPI} {PDG} standard for commercial off-the-shelf simulation
package interoperability reference models},
booktitle = {Proceedings of the Winter Simulation Conference, {WSC} 2007, Washington,
DC, USA, December 9-12, 2007},
pages = {594--602},
publisher = {{WSC}},
year = {2007},
url = {https://doi.org/10.1109/WSC.2007.4419652},
doi = {10.1109/WSC.2007.4419652},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/TaylorMSTLL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0711-3314,
author = {Stephen P. Beeby and
M.{-}J. Tudor and
Russel N. Torah and
E. Koukharenko and
S. Roberts and
Terence O'Donnell and
S. Roy},
title = {Macro and Micro Scale Electromagnetic Kinetic Energy Harvesting Generators},
journal = {CoRR},
volume = {abs/0711.3314},
year = {2007},
url = {http://arxiv.org/abs/0711.3314},
eprinttype = {arXiv},
eprint = {0711.3314},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-0711-3314.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0711-3316,
author = {Terence O'Donnell and
C. Saha and
Stephen P. Beeby and
M.{-}J. Tudor},
title = {Scaling Effects for Electromagnetic Vibrational Power Generators},
journal = {CoRR},
volume = {abs/0711.3316},
year = {2007},
url = {http://arxiv.org/abs/0711.3316},
eprinttype = {arXiv},
eprint = {0711.3316},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-0711-3316.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/PattonSSXLDST06,
author = {G. W. Patton and
Robert M. Stephens and
I. A. Sidorov and
X. Xiao and
Richard A. Lempicki and
Dimiter S. Dimitrov and
Robert H. Shoemaker and
G. Tudor},
title = {Transcriptomic response to differentiation induction},
journal = {{BMC} Bioinform.},
volume = {7},
pages = {81},
year = {2006},
url = {https://doi.org/10.1186/1471-2105-7-81},
doi = {10.1186/1471-2105-7-81},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/PattonSSXLDST06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ecra/ChauT06,
author = {Stephen B. Chau and
Paul Turner},
title = {Utilisation of mobile handheld devices for care management at an Australian
aged care facility},
journal = {Electron. Commer. Res. Appl.},
volume = {5},
number = {4},
pages = {305--312},
year = {2006},
url = {https://doi.org/10.1016/j.elerap.2006.04.005},
doi = {10.1016/J.ELERAP.2006.04.005},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ecra/ChauT06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gandc/ClevisTLDGL06,
author = {Quintijn Clevis and
Gregory E. Tucker and
Stephen T. Lancaster and
Arnaud Desitter and
Nicole Gasparini and
Gary Lock},
title = {A simple algorithm for the mapping of {TIN} data onto a static grid:
Applied to the stratigraphic simulation of river meander deposits},
journal = {Comput. Geosci.},
volume = {32},
number = {6},
pages = {749--766},
year = {2006},
url = {https://doi.org/10.1016/j.cageo.2005.05.012},
doi = {10.1016/J.CAGEO.2005.05.012},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/gandc/ClevisTLDGL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcia/PhamTZW06,
author = {Tuan D. Pham and
Dat Tran and
Xiaobo Zhou and
Stephen T. C. Wong},
title = {Integrated Algorithms for Image Analysis and Classification of Nuclear
Division for High-Content Cell-Cycle Screening},
journal = {Int. J. Comput. Intell. Appl.},
volume = {6},
number = {1},
pages = {21--43},
year = {2006},
url = {https://doi.org/10.1142/S1469026806001769},
doi = {10.1142/S1469026806001769},
timestamp = {Wed, 01 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijcia/PhamTZW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WheelerBBBCCCDEFGHKKKLMMOPSSSSSSSSTTWY06,
author = {David L. Wheeler and
Tanya Barrett and
Dennis A. Benson and
Stephen H. Bryant and
Kathi Canese and
Vyacheslav Chetvernin and
Deanna M. Church and
Michael DiCuccio and
Ron Edgar and
Scott Federhen and
Lewis Y. Geer and
Wolfgang Helmberg and
Yuri Kapustin and
David L. Kenton and
Oleg Khovayko and
David J. Lipman and
Thomas L. Madden and
Donna R. Maglott and
James Ostell and
Kim D. Pruitt and
Gregory D. Schuler and
Lynn M. Schriml and
Edwin Sequeira and
Stephen T. Sherry and
Karl Sirotkin and
Alexandre Souvorov and
Grigory Starchenko and
Tugba O. Suzek and
Roman L. Tatusov and
Tatiana A. Tatusova and
Lukas Wagner and
Eugene Yaschenko},
title = {Database resources of the National Center for Biotechnology Information},
journal = {Nucleic Acids Res.},
volume = {34},
number = {Database-Issue},
pages = {173--180},
year = {2006},
url = {https://doi.org/10.1093/nar/gkj158},
doi = {10.1093/NAR/GKJ158},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/WheelerBBBCCCDEFGHKKKLMMOPSSSSSSSSTTWY06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/BalchDFGIKPSW06,
author = {Tucker R. Balch and
Frank Dellaert and
Adam Feldman and
Andrew Guillory and
Charles Lee Isbell Jr. and
Zia Khan and
Stephen C. Pratt and
Andrew N. Stein and
Hank Wilde},
title = {How Multirobot Systems Research will Accelerate our Understanding
of Social Animal Behavior},
journal = {Proc. {IEEE}},
volume = {94},
number = {7},
pages = {1445--1463},
year = {2006},
url = {https://doi.org/10.1109/JPROC.2006.876969},
doi = {10.1109/JPROC.2006.876969},
timestamp = {Tue, 25 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pieee/BalchDFGIKPSW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigsoft/CounsellSTM06,
author = {Steve Counsell and
Stephen Swift and
Allan Tucker and
Emilia Mendes},
title = {Object-oriented cohesion subjectivity amongst experienced and novice
developers: an empirical study},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {31},
number = {5},
pages = {1--10},
year = {2006},
url = {https://doi.org/10.1145/1163514.1163530},
doi = {10.1145/1163514.1163530},
timestamp = {Thu, 17 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigsoft/CounsellSTM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/LowGWWTC06,
author = {Malcolm Yoke Hean Low and
Boon{-}Ping Gan and
Junhu Wei and
Xiaoguang Wang and
Stephen John Turner and
Wentong Cai},
title = {Shared State Synchronization for HLA-Based Distributed Simulation},
journal = {Simul.},
volume = {82},
number = {8},
pages = {511--521},
year = {2006},
url = {https://doi.org/10.1177/0037549706069342},
doi = {10.1177/0037549706069342},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simulation/LowGWWTC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/TaylorWTL06,
author = {Simon J. E. Taylor and
Xiaoguang Wang and
Stephen John Turner and
Malcolm Y. H. Low},
title = {Integrating Heterogeneous Distributed {COTS} Discrete-Event Simulation
Packages: An Emerging Standards-Based Approach},
journal = {{IEEE} Trans. Syst. Man Cybern. Part {A}},
volume = {36},
number = {1},
pages = {109--122},
year = {2006},
url = {https://doi.org/10.1109/TSMCA.2005.859167},
doi = {10.1109/TSMCA.2005.859167},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsmc/TaylorWTL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aspdac/PhamABBGHHJKKKLLNPPPPRVWWW06,
author = {Dac C. Pham and
Hans{-}Werner Anderson and
Erwin Behnen and
Mark Bolliger and
Sanjay Gupta and
H. Peter Hofstee and
Paul E. Harvey and
Charles R. Johns and
James A. Kahle and
Atsushi Kameyama and
John M. Keaty and
Bob Le and
Sang Lee and
Tuyen V. Nguyen and
John G. Petrovick and
Mydung Pham and
Juergen Pille and
Stephen D. Posluszny and
Mack W. Riley and
Joseph Verock and
James D. Warnock and
Steve Weitzel and
Dieter F. Wendel},
editor = {Fumiyasu Hirose},
title = {Key features of the design methodology enabling a multi-core SoC implementation
of a first-generation {CELL} processor},
booktitle = {Proceedings of the 2006 Conference on Asia South Pacific Design Automation:
{ASP-DAC} 2006, Yokohama, Japan, January 24-27, 2006},
pages = {871--878},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/ASPDAC.2006.1594796},
doi = {10.1109/ASPDAC.2006.1594796},
timestamp = {Fri, 15 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aspdac/PhamABBGHHJKKKLLNPPPPRVWWW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/JieHTC06,
author = {Wei Jie and
Terence Hung and
Stephen John Turner and
Wentong Cai},
title = {Architecture Model for Information Service in Large Scale Grid Environments},
booktitle = {Sixth {IEEE} International Symposium on Cluster Computing and the
Grid (CCGrid 2006), 16-19 May 2006, Singapore},
pages = {107--114},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/CCGRID.2006.19},
doi = {10.1109/CCGRID.2006.19},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ccgrid/JieHTC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/TheodoropoulosZCMTCXL06,
author = {Georgios Theodoropoulos and
Yi Zhang and
Dan Chen and
Rob Minson and
Stephen John Turner and
Wentong Cai and
Yong Xie and
Brian Logan},
title = {Large Scale Distributed Simulation on the Grid},
booktitle = {Sixth {IEEE} International Symposium on Cluster Computing and the
Grid (CCGrid 2006), 16-19 May 2006, Singapore},
pages = {63},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.ieeecomputersociety.org/10.1109/CCGRID.2006.151},
doi = {10.1109/CCGRID.2006.151},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ccgrid/TheodoropoulosZCMTCXL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/TuckerW06,
author = {Simon Tucker and
Steve Whittaker},
editor = {Rebecca E. Grinter and
Tom Rodden and
Paul M. Aoki and
Edward Cutrell and
Robin Jeffries and
Gary M. Olson},
title = {Time is of the essence: an evaluation of temporal compression algorithms},
booktitle = {Proceedings of the 2006 Conference on Human Factors in Computing Systems,
{CHI} 2006, Montr{\'{e}}al, Qu{\'{e}}bec, Canada, April
22-27, 2006},
pages = {329--338},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1124772.1124822},
doi = {10.1145/1124772.1124822},
timestamp = {Mon, 11 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/TuckerW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/RahmanDTT06,
author = {Arifur Rahman and
Satyaki Das and
Tim Tuan and
Steven Trimberger},
title = {Determination of Power Gating Granularity for {FPGA} Fabric},
booktitle = {Proceedings of the {IEEE} 2006 Custom Integrated Circuits Conference,
{CICC} 2006, DoubleTree Hotel, San Jose, California, USA, September
10-13, 2006},
pages = {9--12},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/CICC.2006.320938},
doi = {10.1109/CICC.2006.320938},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cicc/RahmanDTT06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/complife/HirschTSMOKL06,
author = {Michael Hirsch and
Allan Tucker and
Stephen Swift and
Nigel J. Martin and
Christine A. Orengo and
Paul Kellam and
Xiaohui Liu},
editor = {Michael R. Berthold and
Robert C. Glen and
Ingrid Fischer},
title = {Improved Robustness in Time Series Analysis of Gene Expression Data
by Polynomial Model Based Clustering},
booktitle = {Computational Life Sciences II, Second International Symposium, CompLife
2006, Cambridge, UK, September 27-29, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4216},
pages = {1--10},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11875741\_1},
doi = {10.1007/11875741\_1},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/complife/HirschTSMOKL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fpga/TuanKRDT06,
author = {Tim Tuan and
Sean Kao and
Arifur Rahman and
Satyaki Das and
Steven Trimberger},
editor = {Steven J. E. Wilton and
Andr{\'{e}} DeHon},
title = {A 90nm low-power {FPGA} for battery-powered applications},
booktitle = {Proceedings of the {ACM/SIGDA} 14th International Symposium on Field
Programmable Gate Arrays, {FPGA} 2006, Monterey, California, USA,
February 22-24, 2006},
pages = {3--11},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1117201.1117203},
doi = {10.1145/1117201.1117203},
timestamp = {Tue, 06 Nov 2018 16:58:23 +0100},
biburl = {https://dblp.org/rec/conf/fpga/TuanKRDT06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdm/PhamCZW06,
author = {Tuan D. Pham and
Vikram Chandramohan and
Xiaobo Zhou and
Stephen T. C. Wong},
title = {Robust Feature Extraction and Reduction of Mass Spectrometry Data
for Cancer Classification},
booktitle = {Workshops Proceedings of the 6th {IEEE} International Conference on
Data Mining {(ICDM} 2006), 18-22 December 2006, Hong Kong, China},
pages = {202--206},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ICDMW.2006.143},
doi = {10.1109/ICDMW.2006.143},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdm/PhamCZW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmcs/ZhangyPCTH06,
author = {ZhenQiu Zhang and
Gerasimos Potamianos and
Stephen M. Chu and
Jilin Tu and
Thomas S. Huang},
title = {Person Tracking in Smart Rooms using Dynamic Programming and Adaptive
Subspace Learning},
booktitle = {Proceedings of the 2006 {IEEE} International Conference on Multimedia
and Expo, {ICME} 2006, July 9-12 2006, Toronto, Ontario, Canada},
pages = {2061--2064},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ICME.2006.262620},
doi = {10.1109/ICME.2006.262620},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmcs/ZhangyPCTH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iconip/TanNQK06,
author = {Tuan Zea Tan and
Geok See Ng and
Hiok Chai Quek and
Stephen C. L. Koh},
editor = {Irwin King and
Jun Wang and
Laiwan Chan and
DeLiang L. Wang},
title = {Ovarian Cancer Prognosis by Hemostasis and Complementary Learning},
booktitle = {Neural Information Processing, 13th International Conference, {ICONIP}
2006, Hong Kong, China, October 3-6, 2006, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {4234},
pages = {145--154},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11893295\_17},
doi = {10.1007/11893295\_17},
timestamp = {Fri, 16 Aug 2024 07:48:40 +0200},
biburl = {https://dblp.org/rec/conf/iconip/TanNQK06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwn/Turner06,
author = {Stephen Turner},
editor = {Hamid R. Arabnia},
title = {Simple Channel Assignment Strategies for Multiple Channel Ad Hoc Networks},
booktitle = {Proceedings of the 2006 International Conference on Wireless Networks,
{ICWN} 2006, Las Vegas, Nevada, USA, June 26-29, 2006},
pages = {206--212},
publisher = {{CSREA} Press},
year = {2006},
timestamp = {Tue, 02 Jan 2007 13:08:22 +0100},
biburl = {https://dblp.org/rec/conf/icwn/Turner06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/CeccatoBBCDGRT06,
author = {Pietro Ceccato and
Michael A. Bell and
M. Benno Blumenthal and
Stephen J. Connor and
Tufa Dinku and
Emily K. Grover{-}Kopec and
Chester F. Ropelewski and
Madeleine C. Thomson},
title = {Use of Remote Sensing for Monitoring Climate Variability for Integrated
Early Warning Systems: Applications for Human Diseases and Desert
Locust Management},
booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
{IGARSS} 2006, July 31 - August 4, 2006, Denver, Colorado, USA, Proceedings},
pages = {270--274},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/IGARSS.2006.74},
doi = {10.1109/IGARSS.2006.74},
timestamp = {Wed, 08 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/CeccatoBBCDGRT06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/ChenCTW06,
author = {Xinjun Chen and
Wentong Cai and
Stephen John Turner and
Yong Wang},
title = {SOAr-DSGrid: Service-Oriented Architecture for Distributed Simulation
on the Grid},
booktitle = {20th {IEEE/ACM/SCS} Workshop on Principles of Advanced and Distributed
Simulation, {PADS} 2006, Singapore, May 23-26, 2006},
pages = {65--73},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/PADS.2006.33},
doi = {10.1109/PADS.2006.33},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pads/ChenCTW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/ChenTC06,
author = {Dan Chen and
Stephen John Turner and
Wentong Cai},
title = {A Framework for Robust HLA-based Distributed Simulations},
booktitle = {20th {IEEE/ACM/SCS} Workshop on Principles of Advanced and Distributed
Simulation, {PADS} 2006, Singapore, May 23-26, 2006},
pages = {183--192},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/PADS.2006.7},
doi = {10.1109/PADS.2006.7},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pads/ChenTC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/HuangCTHZLFA06,
author = {Shell{-}Ying Huang and
Wentong Cai and
Stephen John Turner and
Wen{-}Jing Hsu and
Suiping Zhou and
Malcolm Yoke Hean Low and
Richard Fujimoto and
Rassul Ayani},
title = {A Generic Symbiotic Simulation Framework},
booktitle = {20th {IEEE/ACM/SCS} Workshop on Principles of Advanced and Distributed
Simulation, {PADS} 2006, Singapore, May 23-26, 2006},
pages = {131},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/PADS.2006.8},
doi = {10.1109/PADS.2006.8},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pads/HuangCTHZLFA06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/WangTT06,
author = {Xiaoguang Wang and
Stephen John Turner and
Simon J. E. Taylor},
title = {{COTS} Simulation Package {(CSP)} Interoperability -A Solution to
Synchronous Entity Passing},
booktitle = {20th {IEEE/ACM/SCS} Workshop on Principles of Advanced and Distributed
Simulation, {PADS} 2006, Singapore, May 23-26, 2006},
pages = {201--210},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/PADS.2006.13},
doi = {10.1109/PADS.2006.13},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/WangTT06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wiser/BudgenCTBKL06,
author = {David Budgen and
Stuart M. Charters and
Mark Turner and
Pearl Brereton and
Barbara A. Kitchenham and
Stephen G. Linkman},
editor = {Nikolay Mehandjiev and
Pearl Brereton and
John G. Hosking},
title = {Investigating the applicability of the evidence-based paradigm to
software engineering},
booktitle = {Proceedings of the 2006 Workshop on interdisciplinary software engineering
research, {WISER} 2006, Shanghai, China, May 20, 2006},
pages = {7--14},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1137661.1137665},
doi = {10.1145/1137661.1137665},
timestamp = {Tue, 24 Oct 2023 14:39:14 +0200},
biburl = {https://dblp.org/rec/conf/wiser/BudgenCTBKL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/GanCT06,
author = {Boon{-}Ping Gan and
Lai Peng Chan and
Stephen John Turner},
editor = {L. Felipe Perrone and
Barry Lawson and
Jason Liu and
Frederick P. Wieland},
title = {Interoperating simulations of automatic material handling systems
and manufacturing processes},
booktitle = {Proceedings of the Winter Simulation Conference {WSC} 2006, Monterey,
California, USA, December 3-6, 2006},
pages = {1129--1135},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/WSC.2006.323203},
doi = {10.1109/WSC.2006.323203},
timestamp = {Mon, 29 Apr 2024 16:19:40 +0200},
biburl = {https://dblp.org/rec/conf/wsc/GanCT06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/LadbrookLSTTW06,
author = {John Ladbrook and
Malcolm Y. H. Low and
Steffen Stra{\ss}burger and
Simon J. E. Taylor and
Stephen John Turner and
Xiaoguang Wang},
editor = {L. Felipe Perrone and
Barry Lawson and
Jason Liu and
Frederick P. Wieland},
title = {Developing interoperability standards for distributed simulaton and
{COTS} simulation packages with the {CSPI} {PDG}},
booktitle = {Proceedings of the Winter Simulation Conference {WSC} 2006, Monterey,
California, USA, December 3-6, 2006},
pages = {1101--1110},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/WSC.2006.323200},
doi = {10.1109/WSC.2006.323200},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/LadbrookLSTTW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-cs-0603121,
author = {Scott A. Turner and
Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and
Stephen H. Edwards},
title = {minimUML: {A} Minimalist Approach to {UML} Diagraming for Early Computer
Science Education},
journal = {CoRR},
volume = {abs/cs/0603121},
year = {2006},
url = {http://arxiv.org/abs/cs/0603121},
eprinttype = {arXiv},
eprint = {cs/0603121},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-cs-0603121.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-cs-0607072,
author = {Scott A. Turner and
Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and
Stephen H. Edwards},
title = {Effect of Interface Style in Peer Review Comments for {UML} Designs},
journal = {CoRR},
volume = {abs/cs/0607072},
year = {2006},
url = {http://arxiv.org/abs/cs/0607072},
eprinttype = {arXiv},
eprint = {cs/0607072},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-cs-0607072.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/AliodABBBBBCGHHLMMMMORSSSTVTTW05,
author = {Diego Moll{\'{a}} Aliod and
Eduardo Alonso and
Srinivas Bangalore and
Joseph E. Beck and
Bir Bhanu and
Jim Blythe and
Mark S. Boddy and
Amedeo Cesta and
Marko Grobelnik and
Dilek Hakkani{-}T{\"{u}}r and
Sanda M. Harabagiu and
Alain L{\'{e}}ger and
Deborah L. McGuinness and
Stacy Marsella and
Natasa Milic{-}Frayling and
Dunja Mladenic and
Daniel Oblinger and
Paul E. Rybski and
Pavel Shvaiko and
Stephen F. Smith and
Biplav Srivastava and
Sheila Tejada and
Hannes H{\"{o}}gni Vilhj{\'{a}}lmsson and
Kristinn R. Th{\'{o}}risson and
G{\"{o}}khan T{\"{u}}r and
Jos{\'{e}} Luis Vicedo Gonz{\'{a}}lez and
Holger Wache},
title = {The Workshops at the Twentieth National Conference on Artificial Intelligence},
journal = {{AI} Mag.},
volume = {26},
number = {4},
pages = {102--108},
year = {2005},
url = {https://doi.org/10.1609/aimag.v26i4.1855},
doi = {10.1609/AIMAG.V26I4.1855},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/AliodABBBBBCGHHLMMMMORSSSTVTTW05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/DonofrioRBDWNFMGTOPFPSLD05,
author = {Nicole Donofrio and
Ravi Rajagopalon and
Douglas E. Brown and
Stephen E. Diener and
Donald Windham and
Shelly Nolin and
Anna Floyd and
Thomas K. Mitchell and
Natalia Galadima and
Sara Tucker and
Marc J. Orbach and
Gayatri Patel and
Mark L. Farman and
Vishal Pampanwar and
Cari Soderlund and
Yong{-}Hwan Lee and
Ralph A. Dean},
title = {'PACLIMS': {A} component {LIM} system for high-throughput functional
genomic analysis},
journal = {{BMC} Bioinform.},
volume = {6},
pages = {94},
year = {2005},
url = {https://doi.org/10.1186/1471-2105-6-94},
doi = {10.1186/1471-2105-6-94},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/DonofrioRBDWNFMGTOPFPSLD05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ec/TuckerCS05,
author = {Allan Tucker and
Jason Crampton and
Stephen Swift},
title = {{RGFGA:} An Efficient Representation and Crossover for Grouping Genetic
Algorithms},
journal = {Evol. Comput.},
volume = {13},
number = {4},
pages = {477--499},
year = {2005},
url = {https://doi.org/10.1162/106365605774666903},
doi = {10.1162/106365605774666903},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ec/TuckerCS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/CaiYLT05,
author = {Wentong Cai and
Zijing Yuan and
Malcolm Yoke Hean Low and
Stephen John Turner},
title = {Federate migration in HLA-based simulation},
journal = {Future Gener. Comput. Syst.},
volume = {21},
number = {1},
pages = {87--95},
year = {2005},
url = {https://doi.org/10.1016/j.future.2004.09.019},
doi = {10.1016/J.FUTURE.2004.09.019},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fgcs/CaiYLT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpca/DennisFSSTTT05,
author = {John M. Dennis and
Aim{\'{e}} Fournier and
William F. Spotz and
Amik St.{-}Cyr and
Mark A. Taylor and
Stephen J. Thomas and
Henry M. Tufo},
title = {High-Resolution Mesh Convergence Properties and Parallel Efficiency
of a Spectral Element Atmospheric Dynamical Core},
journal = {Int. J. High Perform. Comput. Appl.},
volume = {19},
number = {3},
pages = {225--235},
year = {2005},
url = {https://doi.org/10.1177/1094342005056108},
doi = {10.1177/1094342005056108},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijhpca/DennisFSSTTT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jeric/TurnerPE05,
author = {Scott A. Turner and
Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and
Stephen H. Edwards},
title = {minimUML: {A} minimalist approach to {UML} diagramming for early computer
science education},
journal = {{ACM} J. Educ. Resour. Comput.},
volume = {5},
number = {4},
pages = {1:1--1:28},
year = {2005},
url = {https://doi.org/10.1145/1186639.1186640},
doi = {10.1145/1186639.1186640},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jeric/TurnerPE05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jwsr/JieZHTC05,
author = {Wei Jie and
Tianyi Zang and
Terence Hung and
Stephen John Turner and
Wentong Cai},
title = {Information Management for Computational Grids},
journal = {Int. J. Web Serv. Res.},
volume = {2},
number = {3},
pages = {69--82},
year = {2005},
url = {https://doi.org/10.4018/jwsr.2005070103},
doi = {10.4018/JWSR.2005070103},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jwsr/JieZHTC05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/BarrettSTWNLRLFE05,
author = {Tanya Barrett and
Tugba O. Suzek and
Dennis B. Troup and
Stephen E. Wilhite and
Wing{-}Chi Ngau and
Pierre Ledoux and
Dmitry Rudnev and
Alex E. Lash and
Wataru Fujibuchi and
Ron Edgar},
title = {{NCBI} {GEO:} mining millions of expression profiles - database and
tools},
journal = {Nucleic Acids Res.},
volume = {33},
number = {Database-Issue},
pages = {562--566},
year = {2005},
url = {https://doi.org/10.1093/nar/gki022},
doi = {10.1093/NAR/GKI022},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/BarrettSTWNLRLFE05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WheelerBBBCCDEFHKKLMMOPPSSSSSSSTTWY05,
author = {David L. Wheeler and
Tanya Barrett and
Dennis A. Benson and
Stephen H. Bryant and
Kathi Canese and
Deanna M. Church and
Michael DiCuccio and
Ron Edgar and
Scott Federhen and
Wolfgang Helmberg and
David L. Kenton and
Oleg Khovayko and
David J. Lipman and
Thomas L. Madden and
Donna R. Maglott and
James Ostell and
Joan U. Pontius and
Kim D. Pruitt and
Gregory D. Schuler and
Lynn M. Schriml and
Edwin Sequeira and
Steven T. Sherry and
Karl Sirotkin and
Grigory Starchenko and
Tugba O. Suzek and
Roman L. Tatusov and
Tatiana A. Tatusova and
Lukas Wagner and
Eugene Yaschenko},
title = {Database resources of the National Center for Biotechnology Information},
journal = {Nucleic Acids Res.},
volume = {33},
number = {Database-Issue},
pages = {39--45},
year = {2005},
url = {https://doi.org/10.1093/nar/gki062},
doi = {10.1093/NAR/GKI062},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/WheelerBBBCCDEFHKKLMMOPPSSSSSSSTTWY05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/TaylorTMAA05,
author = {Simon J. E. Taylor and
Stephen John Turner and
Navonil Mustafee and
Henrik Ahlander and
Rassul Ayani},
title = {A Comparison of {CMB-} and HLA-Based Approaches to Type {I} Interoperability
Reference Model Problems for COTS-Based Distributed Simulation},
journal = {Simul.},
volume = {81},
number = {1},
pages = {33--43},
year = {2005},
url = {https://doi.org/10.1177/0037549705052455},
doi = {10.1177/0037549705052455},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simulation/TaylorTMAA05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/TaylorTV05,
author = {Simon J. E. Taylor and
Stephen John Turner and
Alexander Verbraeck},
title = {Preface to the Special Issue on Applications of Parallel and Distributed
Simulation in Industry},
journal = {Simul.},
volume = {81},
number = {1},
pages = {3--4},
year = {2005},
url = {https://doi.org/10.1177/0037549705054576},
doi = {10.1177/0037549705054576},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simulation/TaylorTV05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/WangTLG05,
author = {Xiaoguang Wang and
Stephen John Turner and
Malcolm Yoke Hean Low and
Boon{-}Ping Gan},
title = {Optimistic Synchronization in HLA-Based Distributed Simulation},
journal = {Simul.},
volume = {81},
number = {4},
pages = {279--291},
year = {2005},
url = {https://doi.org/10.1177/0037549705054931},
doi = {10.1177/0037549705054931},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simulation/WangTLG05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/technometrics/TurlachVW05,
author = {Berwin A. Turlach and
William N. Venables and
Stephen J. Wright},
title = {Simultaneous Variable Selection},
journal = {Technometrics},
volume = {47},
number = {3},
pages = {349--363},
year = {2005},
url = {https://doi.org/10.1198/004017005000000139},
doi = {10.1198/004017005000000139},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/technometrics/TurlachVW05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/CaiTLZ05,
author = {Wentong Cai and
Stephen John Turner and
Bu{-}Sung Lee and
Junlan Zhou},
title = {An alternative time management mechanism for distributed simulations},
journal = {{ACM} Trans. Model. Comput. Simul.},
volume = {15},
number = {2},
pages = {109--137},
year = {2005},
url = {https://doi.org/10.1145/1060576.1060577},
doi = {10.1145/1060576.1060577},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tomacs/CaiTLZ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/ChenTCGL05,
author = {Dan Chen and
Stephen John Turner and
Wentong Cai and
Boon{-}Ping Gan and
Malcolm Yoke Hean Low},
title = {Algorithms for HLA-based distributed simulation cloning},
journal = {{ACM} Trans. Model. Comput. Simul.},
volume = {15},
number = {4},
pages = {316--345},
year = {2005},
url = {https://doi.org/10.1145/1113316.1113318},
doi = {10.1145/1113316.1113318},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tomacs/ChenTCGL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anss/CaiTZWZ05,
author = {Wentong Cai and
Stephen John Turner and
Suiping Zhou and
Junhu Wei and
Wenbo Zong},
title = {Performance Evaluation of a Bandwidth Requirements Reduction Technique
Based on Timely State Update},
booktitle = {Proceedings 38th Annual Simulation Symposium {(ANSS-38} 2005), 4-6
April 2005, San Diego, CA, {USA}},
pages = {225--232},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ANSS.2005.35},
doi = {10.1109/ANSS.2005.35},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/anss/CaiTZWZ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atal/LowLLTCL05,
author = {Malcolm Yoke Hean Low and
Kong Wei Lye and
Peter Lendermann and
Stephen John Turner and
Reman Tat Wee Chim and
Surya Hadisaputra Leo},
editor = {Michal Pechoucek and
Donald Steiner and
Simon G. Thompson},
title = {An agent-based approach for managing symbiotic simulation of semiconductor
assembly and test operation},
booktitle = {4rd International Joint Conference on Autonomous Agents and Multiagent
Systems {(AAMAS} 2005), July 25-29, 2005, Utrecht, The Netherlands
- Special Track for Industrial Applications},
pages = {85--92},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1082473.1082809},
doi = {10.1145/1082473.1082809},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/atal/LowLLTCL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/SwiftSCT05,
author = {Stephen Swift and
Amy Shi and
Jason Crampton and
Allan Tucker},
title = {{ICARUS:} intelligent coupon allocation for retailers using search},
booktitle = {Proceedings of the {IEEE} Congress on Evolutionary Computation, {CEC}
2005, 2-4 September 2005, Edinburgh, {UK}},
pages = {182--189},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/CEC.2005.1554683},
doi = {10.1109/CEC.2005.1554683},
timestamp = {Thu, 16 Dec 2021 13:59:05 +0100},
biburl = {https://dblp.org/rec/conf/cec/SwiftSCT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/WellnerFTW05,
author = {Pierre Wellner and
Mike Flynn and
Simon Tucker and
Steve Whittaker},
editor = {Gerrit C. van der Veer and
Carolyn Gale},
title = {A meeting browser evaluation test},
booktitle = {Extended Abstracts Proceedings of the 2005 Conference on Human Factors
in Computing Systems, {CHI} 2005, Portland, Oregon, USA, April 2-7,
2005},
pages = {2021--2024},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1056808.1057082},
doi = {10.1145/1056808.1057082},
timestamp = {Mon, 11 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/WellnerFTW05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/BeacomBBRSVDKSC05,
author = {Tom Beacom and
Timothy C. Buchholtz and
D. Bradley and
Jack Randolph and
Salvatore N. Storino and
Mark Veldhuizen and
Sherman M. Dance and
Jente B. Kuang and
Steve Schwinn and
Sue Cox and
Fred Ziegler and
J. Kao and
Chuck Li and
Christophe Tretz and
J. Cabellon and
Andrew Freemyer and
Matthew Tubbs},
title = {Fine-grained power managed dual-thread vector scalar unit for the
first-generation {CELL} processor},
booktitle = {Proceedings of the {IEEE} 2005 Custom Integrated Circuits Conference,
{CICC} 2005, DoubleTree Hotel, San Jose, California, USA, September
18-21, 2005},
pages = {235--238},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/CICC.2005.1568650},
doi = {10.1109/CICC.2005.1568650},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cicc/BeacomBBRSVDKSC05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ZengTPLZZHL05,
author = {Zhihong Zeng and
Jilin Tu and
Brian Pianfetti and
Ming Liu and
Tong Zhang and
ZhenQiu Zhang and
Thomas S. Huang and
Stephen E. Levinson},
title = {Audio-Visual Affect Recognition through Multi-Stream Fused {HMM} for
{HCI}},
booktitle = {2005 {IEEE} Computer Society Conference on Computer Vision and Pattern
Recognition {(CVPR} 2005), 20-26 June 2005, San Diego, CA, {USA}},
pages = {967--972},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/CVPR.2005.77},
doi = {10.1109/CVPR.2005.77},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/ZengTPLZZHL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/GanLWT05,
author = {Boon{-}Ping Gan and
Malcolm Yoke Hean Low and
Xiaoguang Wang and
Stephen John Turner},
title = {Using Manufacturing Process Flow for Time Synchronization in HLA-Based
Simulation},
booktitle = {9th {IEEE} International Symposium on Distributed Simulation and Real-Time
Applications {(DS-RT} 2005), 10-12 October 2005, Montreal, Canada},
pages = {148--160},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/DISTRA.2005.42},
doi = {10.1109/DISTRA.2005.42},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dsrt/GanLWT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/TaylorBWT05,
author = {Simon J. E. Taylor and
Leif Bohli and
Xiaoguang Wang and
Stephen John Turner},
title = {Investigating Distributed Simulation at The Ford Motor Company},
booktitle = {9th {IEEE} International Symposium on Distributed Simulation and Real-Time
Applications {(DS-RT} 2005), 10-12 October 2005, Montreal, Canada},
pages = {139--147},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/DISTRA.2005.25},
doi = {10.1109/DISTRA.2005.25},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dsrt/TaylorBWT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/TuckerW05,
author = {Simon Tucker and
Steve Whittaker},
title = {Novel Techniques For Time-Compressing Speech: An Exploratory Study},
booktitle = {2005 {IEEE} International Conference on Acoustics, Speech, and Signal
Processing, {ICASSP} '05, Philadelphia, Pennsylvania, USA, March 18-23,
2005},
pages = {477--480},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/ICASSP.2005.1415154},
doi = {10.1109/ICASSP.2005.1415154},
timestamp = {Mon, 11 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/TuckerW05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwn/Turner05,
author = {Stephen Turner},
editor = {Laurence Tianruo Yang and
Hamid R. Arabnia and
Li{-}Chun Wang},
title = {Channel-Changing Heuristics in High-Mobility Ad Hoc Networks with
Varying Traffic Demands},
booktitle = {Proceedings of the 2005 International Conference on Wireless Networks,
{ICWN} 2005, Las Vegas, Nevada, USA, June 27-30, 2005},
pages = {317--323},
publisher = {{CSREA} Press},
year = {2005},
timestamp = {Tue, 29 Oct 2019 17:54:20 +0100},
biburl = {https://dblp.org/rec/conf/icwn/Turner05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ChuZKLITCD05,
author = {Anhua Chu and
Jakob J. van Zyl and
Yunjin Kim and
Yunling Lou and
David A. Imel and
Wayne Tung and
Bruce Chapman and
Stephen L. Durden},
title = {{AIRSAR} automated web-based data processing and distribution system},
booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
{IGARSS} 2005, July 25-29, 2005, Seoul, Korea, Proceedings},
pages = {1218--1220},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/IGARSS.2005.1525337},
doi = {10.1109/IGARSS.2005.1525337},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/ChuZKLITCD05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mlmi/WhittakerLT05,
author = {Steve Whittaker and
Rachel Laban and
Simon Tucker},
editor = {Steve Renals and
Samy Bengio},
title = {Analysing Meeting Records: An Ethnographic Study and Technological
Implications},
booktitle = {Machine Learning for Multimodal Interaction, Second International
Workshop, {MLMI} 2005, Edinburgh, UK, July 11-13, 2005, Revised Selected
Papers},
series = {Lecture Notes in Computer Science},
volume = {3869},
pages = {101--113},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11677482\_9},
doi = {10.1007/11677482\_9},
timestamp = {Mon, 11 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mlmi/WhittakerLT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/TeoTJ05,
author = {Peihan Teo and
Stephen John Turner and
Zoltan Juhasz},
title = {Optimistic Protocol Analysis in a Performance Analyzer and Prediction
Tool},
booktitle = {19th Workshop on Parallel and Distributed Simulation, {PADS} 20055,
Monterey, CA, USA, June 1-3, 2005},
pages = {49--58},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/PADS.2005.17},
doi = {10.1109/PADS.2005.17},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/TeoTJ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/XieTCT05,
author = {Yong Xie and
Yong Meng Teo and
Wentong Cai and
Stephen John Turner},
title = {Servicing Provisioning for HLA-Based Distributed Simulation on the
Grid},
booktitle = {19th Workshop on Parallel and Distributed Simulation, {PADS} 20055,
Monterey, CA, USA, June 1-3, 2005},
pages = {282--291},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/PADS.2005.26},
doi = {10.1109/PADS.2005.26},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pads/XieTCT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scam/CounsellST05,
author = {Steve Counsell and
Stephen Swift and
Allan Tucker},
title = {Object-oriented cohesion as a surrogate of software comprehension:
an empirical study},
booktitle = {5th {IEEE} International Workshop on Source Code Analysis and Manipulation
{(SCAM} 2005), 30 September - 1 October 2005, Budapest, Hungary},
pages = {161--172},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/SCAM.2005.19},
doi = {10.1109/SCAM.2005.19},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/scam/CounsellST05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sensys/TollePSCTTBDBGH05,
author = {Gilman Tolle and
Joseph Polastre and
Robert Szewczyk and
David E. Culler and
Neil Turner and
Kevin Tu and
Stephen Burgess and
Todd Dawson and
Philip Buonadonna and
David Gay and
Wei Hong},
editor = {Jason Redi and
Hari Balakrishnan and
Feng Zhao},
title = {A macroscope in the redwoods},
booktitle = {Proceedings of the 3rd International Conference on Embedded Networked
Sensor Systems, SenSys 2005, San Diego, California, USA, November
2-4, 2005},
pages = {51--63},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1098918.1098925},
doi = {10.1145/1098918.1098925},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sensys/TollePSCTTBDBGH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/GanLLTWT05,
author = {Boon{-}Ping Gan and
Peter Lendermann and
Malcolm Yoke Hean Low and
Stephen John Turner and
Xiaoguang Wang and
Simon J. E. Taylor},
title = {Interoperating autosched {AP} using the high level architecture},
booktitle = {Proceedings of the 37th Winter Simulation Conference, Orlando, FL,
USA, December 4-7, 2005},
pages = {394--401},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/WSC.2005.1574274},
doi = {10.1109/WSC.2005.1574274},
timestamp = {Thu, 10 Jun 2021 22:18:45 +0200},
biburl = {https://dblp.org/rec/conf/wsc/GanLLTWT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/LendermannLGJCLTTCWHMB05,
author = {Peter Lendermann and
Malcolm Y. H. Low and
Boon{-}Ping Gan and
Nirupam Julka and
Lai Peng Chan and
Loo Hay Lee and
Simon J. E. Taylor and
Stephen John Turner and
Wentong Cai and
Xiaoguang Wang and
Terence Hung and
Leon F. McGinnis and
Stephen J. Buckley},
title = {An integrated and adaptive decision-support framework for high-tech
manufacturing and service networks},
booktitle = {Proceedings of the 37th Winter Simulation Conference, Orlando, FL,
USA, December 4-7, 2005},
pages = {2052--2062},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/WSC.2005.1574487},
doi = {10.1109/WSC.2005.1574487},
timestamp = {Thu, 10 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/LendermannLGJCLTTCWHMB05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/WangTTLG05,
author = {Xiaoguang Wang and
Stephen John Turner and
Simon J. E. Taylor and
Malcolm Y. H. Low and
Boon{-}Ping Gan},
title = {A {COTS} Simulation Package Emulator {(CSPE)} for investigating {COTS}
simulation package interoperability},
booktitle = {Proceedings of the 37th Winter Simulation Conference, Orlando, FL,
USA, December 4-7, 2005},
pages = {402--411},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/WSC.2005.1574275},
doi = {10.1109/WSC.2005.1574275},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/WangTTLG05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-nlin-0511072,
author = {May Lim and
Dan Braha and
Sanith Wijesinghe and
Stephenson Tucker and
Yaneer Bar{-}Yam},
title = {Connectivity and Cost Trade-offs in Multihop Wireless Networks},
journal = {CoRR},
volume = {abs/nlin/0511072},
year = {2005},
url = {http://arxiv.org/abs/nlin/0511072},
eprinttype = {arXiv},
eprint = {nlin/0511072},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-nlin-0511072.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/concurrency/Turner04,
author = {Stephen John Turner},
title = {Special Issue: Distributed Simulation and Real-Time Applications},
journal = {Concurr. Pract. Exp.},
volume = {16},
number = {15},
pages = {1477--1481},
year = {2004},
url = {https://doi.org/10.1002/cpe.935},
doi = {10.1002/CPE.935},
timestamp = {Thu, 21 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/concurrency/Turner04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/ZengCTZL04,
author = {Yi Zeng and
Wentong Cai and
Stephen John Turner and
Suiping Zhou and
Bu{-}Sung Lee},
title = {Characterization and delivery of directly coupled causal messages
in distributed systems},
journal = {Future Gener. Comput. Syst.},
volume = {20},
number = {1},
pages = {171--178},
year = {2004},
url = {https://doi.org/10.1016/j.future.2003.07.013},
doi = {10.1016/J.FUTURE.2003.07.013},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fgcs/ZengCTZL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcise/McMahonLCCCSS04,
author = {Chris A. McMahon and
Alistair Lowe and
Steve J. Culley and
Mark Corderoy and
Rose Crossland and
Tulan Shah and
Dave Stewart},
title = {Waypoint: An Integrated Search and Retrieval System for Engineering
Documents},
journal = {J. Comput. Inf. Sci. Eng.},
volume = {4},
number = {4},
pages = {329--338},
year = {2004},
url = {https://doi.org/10.1115/1.1812557},
doi = {10.1115/1.1812557},
timestamp = {Thu, 07 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcise/McMahonLCCCSS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/ZhouCLT04,
author = {Suiping Zhou and
Wentong Cai and
Bu{-}Sung Lee and
Stephen John Turner},
title = {Time-space consistency in large-scale distributed virtual environments},
journal = {{ACM} Trans. Model. Comput. Simul.},
volume = {14},
number = {1},
pages = {31--47},
year = {2004},
url = {https://doi.org/10.1145/974734.974736},
doi = {10.1145/974734.974736},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tomacs/ZhouCLT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/ChenTGC04,
author = {Dan Chen and
Stephen John Turner and
Boon{-}Ping Gan and
Wentong Cai},
title = {HLA-Based Distributed Simulation Cloning},
booktitle = {8th {IEEE} International Symposium on Distributed Simulation and Real-Time
Applications {(DS-RT} 2004), 21-23 October 2004, Budapest, Hungary},
pages = {244--247},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/DS-RT.2004.23},
doi = {10.1109/DS-RT.2004.23},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsrt/ChenTGC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/TaylorPPT04,
author = {Simon J. E. Taylor and
George V. Popescu and
J. Mark Pullen and
Stephen John Turner},
title = {Distributed Simulation and the Grid: Position Statements},
booktitle = {8th {IEEE} International Symposium on Distributed Simulation and Real-Time
Applications {(DS-RT} 2004), 21-23 October 2004, Budapest, Hungary},
pages = {144--149},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/DS-RT.2004.14},
doi = {10.1109/DS-RT.2004.14},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsrt/TaylorPPT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/ZongWCT04,
author = {Wenbo Zong and
Yong Wang and
Wentong Cai and
Stephen John Turner},
title = {Grid Services and Service Discovery for HLA-Based Distributed Simulation},
booktitle = {8th {IEEE} International Symposium on Distributed Simulation and Real-Time
Applications {(DS-RT} 2004), 21-23 October 2004, Budapest, Hungary},
pages = {116--124},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/DS-RT.2004.22},
doi = {10.1109/DS-RT.2004.22},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsrt/ZongWCT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icarcv/WangWBT04,
author = {Xin Wang and
Brian Stephen Wong and
W. M. Bai and
Chen Guan Tui},
title = {X-ray image segmentation using wavelet method},
booktitle = {8th International Conference on Control, Automation, Robotics and
Vision, {ICARCV} 2004, Kunming, China, 6-9 December 2004, Proceedings},
pages = {1129--1133},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/ICARCV.2004.1469003},
doi = {10.1109/ICARCV.2004.1469003},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icarcv/WangWBT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/YuanCLT04,
author = {Zijing Yuan and
Wentong Cai and
Yoke{-}Hean Low and
Stephen John Turner},
editor = {Marian Bubak and
G. Dick van Albada and
Peter M. A. Sloot and
Jack J. Dongarra},
title = {Federate Migration in HLA-Based Simulation},
booktitle = {Computational Science - {ICCS} 2004, 4th International Conference,
Krak{\'{o}}w, Poland, June 6-9, 2004, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {3038},
pages = {856--864},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-24688-6\_110},
doi = {10.1007/978-3-540-24688-6\_110},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccS/YuanCLT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmi/ZengTLZRZHRL04,
author = {Zhihong Zeng and
Jilin Tu and
Ming Liu and
Tong Zhang and
Nicholas Rizzolo and
ZhenQiu Zhang and
Thomas S. Huang and
Dan Roth and
Stephen E. Levinson},
editor = {Rajeev Sharma and
Trevor Darrell and
Mary P. Harper and
Gianni Lazzari and
Matthew A. Turk},
title = {Bimodal HCI-related affect recognition},
booktitle = {Proceedings of the 6th International Conference on Multimodal Interfaces,
{ICMI} 2004, State College, PA, USA, October 13-15, 2004},
pages = {137--143},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/1027933.1027958},
doi = {10.1145/1027933.1027958},
timestamp = {Fri, 03 Jul 2020 08:57:26 +0200},
biburl = {https://dblp.org/rec/conf/icmi/ZengTLZRZHRL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/OlsenWT04,
author = {Dan R. Olsen and
Stephen Bart Wood and
Jonathan Turner},
title = {Metrics for Human Driving of Multiple Robots},
booktitle = {Proceedings of the 2004 {IEEE} International Conference on Robotics
and Automation, {ICRA} 2004, April 26 - May 1, 2004, New Orleans,
LA, {USA}},
pages = {2315--2320},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/ROBOT.2004.1307407},
doi = {10.1109/ROBOT.2004.1307407},
timestamp = {Mon, 22 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/OlsenWT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwn/Turner04,
author = {Stephen W. Turner},
editor = {Hamid R. Arabnia and
Laurence Tianruo Yang and
Chi{-}Hsiang Yeh},
title = {Channel-Changing Strategies to Preserve Bandwidth of Flows in Ad Hoc
Networks},
booktitle = {Proceedings of the International Conference on Wireless Networks,
{ICWN} '04, June 21-24, 2004, Las Vegas, Nevada, USA, Volume 1},
pages = {172--178},
publisher = {{CSREA} Press},
year = {2004},
timestamp = {Mon, 22 Nov 2004 14:01:57 +0100},
biburl = {https://dblp.org/rec/conf/icwn/Turner04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icws/ZangJHLTC04,
author = {Tianyi Zang and
Wei Jie and
Terence Hung and
Zhou Lei and
Stephen John Turner and
Wentong Cai},
title = {The Design and Implementation of An OGSA-based Grid Information Service},
booktitle = {Proceedings of the {IEEE} International Conference on Web Services
(ICWS'04), June 6-9, 2004, San Diego, California, {USA}},
pages = {566},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/ICWS.2004.1314783},
doi = {10.1109/ICWS.2004.1314783},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icws/ZangJHLTC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/TuluF04,
author = {Zeynep Tulu and
Stephen J. Frasier},
title = {Design considerations for bistatic radar probing of winds in clear
air conditions},
booktitle = {2004 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2004, Anchorage, Alaska, USA, 20-24 September 2004},
pages = {3662--3665},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/IGARSS.2004.1369913},
doi = {10.1109/IGARSS.2004.1369913},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/TuluF04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/WangTLASHPS04,
author = {Peng Wang and
George W. Turner and
Daniel A. Lauer and
Matthew Allen and
Stephen C. Simms and
David Hart and
Mary Papakhian and
Craig A. Stewart},
title = {{LINPACK} Performance on a Geographically Distributed Linux Cluster},
booktitle = {18th International Parallel and Distributed Processing Symposium {(IPDPS}
2004), {CD-ROM} / Abstracts Proceedings, 26-30 April 2004, Santa Fe,
New Mexico, {USA}},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/IPDPS.2004.1303301},
doi = {10.1109/IPDPS.2004.1303301},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/WangTLASHPS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jbi/KellamSTVMOL04,
author = {Paul Kellam and
Stephen Swift and
Allan Tucker and
Veronica Vinciotti and
Nigel J. Martin and
Christine A. Orengo and
Xiaohui Liu},
editor = {Xavier Messeguer and
Gabriel Valiente},
title = {Consensus Clustering and Functional Interpretation of Gene Expression
Data},
booktitle = {Proceedings of the 5th Annual Spanish Bioinformatics Conference, Barcelona,
Catalonia, Spain, November 29-30, 2004},
pages = {6},
publisher = {Technical University of Catalonia, Barcelona},
year = {2004},
timestamp = {Mon, 11 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/jbi/KellamSTVMOL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mabs/WangTW04,
author = {Fang Wang and
Stephen John Turner and
Lihua Wang},
editor = {Paul Davidsson and
Brian Logan and
Keiki Takadama},
title = {Agent Communication in Distributed Simulations},
booktitle = {Multi-Agent and Multi-Agent-Based Simulation, Joint Workshop {MABS}
2004, New York, NY, USA, July 19, 2004, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {3415},
pages = {11--24},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-32243-6\_2},
doi = {10.1007/978-3-540-32243-6\_2},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mabs/WangTW04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mlmi/TuckerW04,
author = {Simon Tucker and
Steve Whittaker},
editor = {Samy Bengio and
Herv{\'{e}} Bourlard},
title = {Accessing Multimodal Meeting Data: Systems, Problems and Possibilities},
booktitle = {Machine Learning for Multimodal Interaction, First International Workshop,MLMI
2004, Martigny, Switzerland, June 21-23, 2004, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {3361},
pages = {1--11},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30568-2\_1},
doi = {10.1007/978-3-540-30568-2\_1},
timestamp = {Mon, 11 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mlmi/TuckerW04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pacis/ChauT04,
author = {Stephen B. Chau and
Paul Turner},
title = {Examining the Utilisation of Mobile Handheld Devices at an Australian
Aged Care Facility},
booktitle = {Pacific Asia Conference on Information Systems, {PACIS} 2004, Shanghai,
China, July 8-11, 2004},
pages = {50},
publisher = {AISeL},
year = {2004},
url = {http://aisel.aisnet.org/pacis2004/50},
timestamp = {Sat, 03 Mar 2012 13:26:52 +0100},
biburl = {https://dblp.org/rec/conf/pacis/ChauT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/WangTLG04,
author = {Xiaoguang Wang and
Stephen John Turner and
Yoke{-}Hean Low and
Boon{-}Ping Gan},
editor = {Johannes L{\"{u}}thi and
Axel Lehmann and
Ernest H. Page and
Thom McLean},
title = {Optimistic Synchronization in {HLA} Based Distributed Simulation},
booktitle = {18th Workshop on Parallel and Distributed Simulation, {PADS} 2004,
Kufstein, Austria, May 16-19, 2004},
pages = {123--130},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/PADS.2004.1301293},
doi = {10.1109/PADS.2004.1301293},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pads/WangTLG04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/ZengCT04,
author = {Yi Zeng and
Wentong Cai and
Stephen John Turner},
editor = {Johannes L{\"{u}}thi and
Axel Lehmann and
Ernest H. Page and
Thom McLean},
title = {Batch Based Cancellation: {A} Rollback Optimal Cancellation Scheme
in Time Warp Simulations},
booktitle = {18th Workshop on Parallel and Distributed Simulation, {PADS} 2004,
Kufstein, Austria, May 16-19, 2004},
pages = {78--86},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/PADS.2004.1301288},
doi = {10.1109/PADS.2004.1301288},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pads/ZengCT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/ZhouTCZP04,
author = {Suiping Zhou and
Stephen John Turner and
Wentong Cai and
Hanfeng Zhao and
Xiaolin Pang},
editor = {Johannes L{\"{u}}thi and
Axel Lehmann and
Ernest H. Page and
Thom McLean},
title = {A Utility Model for Timely State Update in Distributed Wargame Simulations},
booktitle = {18th Workshop on Parallel and Distributed Simulation, {PADS} 2004,
Kufstein, Austria, May 16-19, 2004},
pages = {105--111},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/PADS.2004.1301291},
doi = {10.1109/PADS.2004.1301291},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pads/ZhouTCZP04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ram/WangWT04,
author = {Xin Wang and
Brian Stephen Wong and
Chen Guan Tui},
title = {X-ray image segmentation based on genetic algorithm and maximum fuzzy
entropy},
booktitle = {2004 {IEEE} Conference on Robotics, Automation and Mechatronics, {RAM}
2004, December 1-3, 2004, Singapore},
pages = {991--995},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/RAMECH.2004.1438054},
doi = {10.1109/RAMECH.2004.1438054},
timestamp = {Thu, 12 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ram/WangWT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sgp/BhatIT04,
author = {Pravin Bhat and
Stephen Ingram and
Greg Turk},
editor = {Jean{-}Daniel Boissonnat and
Pierre Alliez},
title = {Geometric Texture Synthesis by Example},
booktitle = {Second Eurographics Symposium on Geometry Processing, Nice, France,
July 8-10, 2004},
series = {{ACM} International Conference Proceeding Series},
volume = {71},
pages = {41--44},
publisher = {Eurographics Association},
year = {2004},
url = {https://doi.org/10.2312/SGP/SGP04/043-046},
doi = {10.2312/SGP/SGP04/043-046},
timestamp = {Tue, 06 Nov 2018 16:58:19 +0100},
biburl = {https://dblp.org/rec/conf/sgp/BhatIT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/TuckerMDSJV04,
author = {Allen B. Tucker and
Dennis McCowan and
Fadi P. Deek and
Chris Stephenson and
Jill Jones and
Anita Verno},
editor = {Daniel T. Joyce and
Deborah Knox and
Wanda P. Dann and
Thomas L. Naps},
title = {Implementation challenges for a {K-12} computer science curriculum},
booktitle = {Proceedings of the 35th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 2004, Norfolk, Virginia, USA, March 3-7, 2004},
pages = {334--335},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/971300.971418},
doi = {10.1145/971300.971418},
timestamp = {Thu, 10 Jun 2021 16:43:03 +0200},
biburl = {https://dblp.org/rec/conf/sigcse/TuckerMDSJV04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/ChenTCGL04,
author = {Dan Chen and
Stephen John Turner and
Wentong Cai and
Boon{-}Ping Gan and
Malcolm Yoke Hean Low},
title = {Incremental HLA-Based Distributed Simulation Cloning},
booktitle = {Proceedings of the 36th conference on Winter simulation, Washington,
DC, USA, December 5-8, 2004},
pages = {386--394},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {http://www.informs-sim.org/wsc04papers/046.pdf},
timestamp = {Thu, 10 Jun 2021 22:19:50 +0200},
biburl = {https://dblp.org/rec/conf/wsc/ChenTCGL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TaylorLPRST04,
author = {Simon J. E. Taylor and
Peter Lendermann and
Ray J. Paul and
Steven W. Reichenthal and
Steffen Stra{\ss}burger and
Stephen John Turner},
title = {Panel on Future Challenges in Modeling Methodology},
booktitle = {Proceedings of the 36th conference on Winter simulation, Washington,
DC, USA, December 5-8, 2004},
pages = {327--335},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {http://www.informs-sim.org/wsc04papers/039.pdf},
timestamp = {Thu, 10 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/TaylorLPRST04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/WangTW04,
author = {Lihua Wang and
Stephen John Turner and
Fang Wang},
title = {Resolving Mutually Exclusive Interactions in Agent Based Distributed
Simulations},
booktitle = {Proceedings of the 36th conference on Winter simulation, Washington,
DC, USA, December 5-8, 2004},
pages = {783--791},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {http://www.informs-sim.org/wsc04papers/097.pdf},
timestamp = {Thu, 10 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/WangTW04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ecra/TungDCCL03,
author = {Lai Lai Tung and
Roger Debreceny and
Ying{-}Git Chan and
Aaron Tuck{-}Loon Chan and
Stephen Ee{-}Boon Le},
title = {Interacting with hypertext: an experimental investigation of navigation
tools},
journal = {Electron. Commer. Res. Appl.},
volume = {2},
number = {1},
pages = {61--72},
year = {2003},
url = {https://doi.org/10.1016/S1567-4223(03)00006-1},
doi = {10.1016/S1567-4223(03)00006-1},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ecra/TungDCCL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhci/CoxLTNWTA03,
author = {Stephen Cox and
Michael Lincoln and
Judy Tryggvason and
Melanie Nakisa and
Mark Wells and
Marcus Tutt and
Sanja Abbott},
title = {The Development and Evaluation of a Speech-to-Sign Translation System
to Assist Transactions},
journal = {Int. J. Hum. Comput. Interact.},
volume = {16},
number = {2},
pages = {141--161},
year = {2003},
url = {https://doi.org/10.1207/S15327590IJHC1602\_02},
doi = {10.1207/S15327590IJHC1602\_02},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhci/CoxLTNWTA03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmms/HayneST03,
author = {Stephen C. Hayne and
C. A. P. Smith and
Dan Turk},
title = {The effectiveness of groups recognizing patterns},
journal = {Int. J. Hum. Comput. Stud.},
volume = {59},
number = {5},
pages = {523--543},
year = {2003},
url = {https://doi.org/10.1016/S1071-5819(03)00046-6},
doi = {10.1016/S1071-5819(03)00046-6},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijmms/HayneST03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/EckersleyESTNSMJRHHJKLMMSNRRRSTUPVWWT03,
author = {Peter Eckersley and
Gary F. Egan and
Erik De Schutter and
Yiyuan Tang and
Mirko Novak and
V{\'{a}}clav Sebesta and
Line Matthiessen and
Iiro P. J{\"{a}}{\"{a}}skel{\"{a}}inen and
Ulla Ruotsalainen and
Andreas V. M. Herz and
K. Peter Hoffmann and
Raphael Ritz and
Viji Ravindranath and
Francesco Beltrame and
Shun{-}ichi Amari and
Shiro Usui and
Soo{-}Young Lee and
Jaap van Pelt and
Jan G. Bjaalie and
Andrzej Wr{\'{o}}bel and
Fernando Mira da Silva and
Carmen Gonz{\'{a}}lez and
Sten Grillner and
Paul F. M. J. Verschure and
Turgay Dalkara and
Robert Bennett and
David Willshaw and
Stephen H. Koslow and
Perry L. Miller and
Shankar Subramaniam and
Arthur W. Toga},
title = {Neuroscience data and tool sharing - {A} legal and policy framework
for neuroinformatics},
journal = {Neuroinformatics},
volume = {1},
number = {2},
pages = {149--165},
year = {2003},
url = {https://doi.org/10.1007/s12021-003-0002-1},
doi = {10.1007/S12021-003-0002-1},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ni/EckersleyESTNSMJRHHJKLMMSNRRRSTUPVWWT03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scp/ReesST03,
author = {D. Ll. L. Rees and
Karen Stephenson and
John V. Tucker},
title = {The algebraic structure of interfaces},
journal = {Sci. Comput. Program.},
volume = {49},
number = {1-3},
pages = {47--88},
year = {2003},
url = {https://doi.org/10.1016/j.scico.2003.04.001},
doi = {10.1016/J.SCICO.2003.04.001},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/scp/ReesST03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamsc/ThomasDTF03,
author = {Stephen J. Thomas and
John M. Dennis and
Henry M. Tufo and
Paul F. Fischer},
title = {A Schwarz Preconditioner for the Cubed-Sphere},
journal = {{SIAM} J. Sci. Comput.},
volume = {25},
number = {2},
pages = {442--453},
year = {2003},
url = {https://doi.org/10.1137/S1064827502409420},
doi = {10.1137/S1064827502409420},
timestamp = {Thu, 30 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamsc/ThomasDTF03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003},
url = {https://doi.org/10.1145/945546.945549},
doi = {10.1145/945546.945549},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/ChenTGCWJ03,
author = {Dan Chen and
Stephen John Turner and
Boon{-}Ping Gan and
Wentong Cai and
Junhu Wei and
Nirupam Julka},
title = {Alternative Solutions for Distributed Simulation Cloning},
journal = {Simul.},
volume = {79},
number = {5-6},
pages = {299--315},
year = {2003},
url = {https://doi.org/10.1177/0037549703037147},
doi = {10.1177/0037549703037147},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simulation/ChenTGCWJ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/JohnsonCKTMFH03,
author = {Stephen B. Johnson and
David A. Campbell and
Michael Krauthammer and
P. Karina Tulipano and
Eneida A. Mendon{\c{c}}a and
Carol Friedman and
George Hripcsak},
title = {A Native {XML} Database Design for Clinical Document Research},
booktitle = {{AMIA} 2003, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 8-12, 2003},
publisher = {{AMIA}},
year = {2003},
url = {https://knowledge.amia.org/amia-55142-a2003a-1.616734/t-002-1.618748/f-001-1.618749/a-266-1.619288/a-267-1.619285},
timestamp = {Wed, 17 Apr 2024 11:48:28 +0200},
biburl = {https://dblp.org/rec/conf/amia/JohnsonCKTMFH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anss/ChenGJTCW03,
author = {Dan Chen and
Boon{-}Ping Gan and
Nirupam Julka and
Stephen John Turner and
Wentong Cai and
Junhu Wei},
title = {Evaluating Alternative Solutions for Cloning in Distributed Simulation},
booktitle = {Proceedings 36th Annual Simulation Symposium {(ANSS-36} 2003), Orlando,
Florida, USA, March 30 - April 2, 2003},
pages = {201--208},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/SIMSYM.2003.1192814},
doi = {10.1109/SIMSYM.2003.1192814},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/anss/ChenGJTCW03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anss/ChenLCT03,
author = {Dan Chen and
Bu{-}Sung Lee and
Wentong Cai and
Stephen John Turner},
title = {Design and Development of a Cluster Gateway for Cluster-based {HLA}
Distributed Virtual Simulation Environments},
booktitle = {Proceedings 36th Annual Simulation Symposium {(ANSS-36} 2003), Orlando,
Florida, USA, March 30 - April 2, 2003},
pages = {193--200},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/SIMSYM.2003.1192813},
doi = {10.1109/SIMSYM.2003.1192813},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/anss/ChenLCT03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anss/LiuCTL03,
author = {Li Liu and
Wentong Cai and
Stephen John Turner and
Guangya Li},
title = {Improving Data Filtering Accuracy in Hierarchical Federations},
booktitle = {Proceedings 36th Annual Simulation Symposium {(ANSS-36} 2003), Orlando,
Florida, USA, March 30 - April 2, 2003},
pages = {209--215},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/SIMSYM.2003.1192815},
doi = {10.1109/SIMSYM.2003.1192815},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/anss/LiuCTL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cw/ZhouCTZ03,
author = {Suiping Zhou and
Wentong Cai and
Stephen John Turner and
Hanfeng Zhao},
title = {A Consistency Model for Evaluating Distributed Virtual Environments},
booktitle = {2nd International Conference on Cyberworlds {(CW} 2003), 3-5 December
2003, Singapore},
pages = {85--91},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/CYBER.2003.1253439},
doi = {10.1109/CYBER.2003.1253439},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cw/ZhouCTZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/WangTW03,
author = {Lihua Wang and
Stephen John Turner and
Fang Wang},
title = {Interest Management in Agent-Based Distributed Simulations},
booktitle = {7th {IEEE} International Symposium on Distributed Simulation and Real-Time
Applications {(DS-RT} 2003), 23-25 October 2003, Delft, The Netherlands},
pages = {20--29},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/DISRTA.2003.1242993},
doi = {10.1109/DISRTA.2003.1242993},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dsrt/WangTW03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ida/CounsellLNST03,
author = {Steve Counsell and
Xiaohui Liu and
Rajaa Najjar and
Stephen Swift and
Allan Tucker},
editor = {Michael R. Berthold and
Hans{-}Joachim Lenz and
Elizabeth Bradley and
Rudolf Kruse and
Christian Borgelt},
title = {Applying Intelligent Data Analysis to Coupling Relationships in Object-Oriented
Software},
booktitle = {Advances in Intelligent Data Analysis V, 5th International Symposium
on Intelligent Data Analysis, {IDA} 2003, Berlin, Germany, August
28-30, 2003, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2810},
pages = {440--450},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/978-3-540-45231-7\_41},
doi = {10.1007/978-3-540-45231-7\_41},
timestamp = {Wed, 09 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ida/CounsellLNST03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/CaiLTLL03,
author = {Wentong Cai and
Guangya Li and
Stephen John Turner and
Bu{-}Sung Lee and
Li Liu},
title = {Implementation of Federation Management Services over Federation Community
Networks},
booktitle = {Proceedings of the 17th Workshop on Parallel and Distributed Simulation,
{PADS} 2003, June 10-13, 2003, San Diego, CA, {USA}},
pages = {50--60},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/PADS.2003.1207420},
doi = {10.1109/PADS.2003.1207420},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/CaiLTLL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/TuckerDJMSV03,
author = {Allen B. Tucker and
Fadi P. Deek and
Jill Jones and
Dennis McCowan and
Chris Stephenson and
Anita Verno},
editor = {Scott Grissom and
Deborah Knox and
Daniel T. Joyce and
Wanda P. Dann},
title = {Toward a {K-12} computer science curriculum},
booktitle = {Proceedings of the 34th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 2003, Reno, Nevada, USA, February 19-23, 2003},
pages = {305--306},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/611892.611912},
doi = {10.1145/611892.611912},
timestamp = {Thu, 10 Jun 2021 16:43:03 +0200},
biburl = {https://dblp.org/rec/conf/sigcse/TuckerDJMSV03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/GanLWWTC03,
author = {Boon{-}Ping Gan and
Malcolm Yoke Hean Low and
Junhu Wei and
Xiaoguang Wang and
Stephen John Turner and
Wentong Cai},
editor = {Stephen E. Chick and
Paul J. Sanchez and
David M. Ferrin and
Douglas J. Morrice},
title = {Distributed simulation and manufacturing: synchronization and management
of shared state in HLA-based distributed simulation},
booktitle = {Proceedings of the 35th Winter Simulation Conference: Driving Innovation,
New Orleans, Louisiana, USA, December 7-10, 2003},
pages = {847--854},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/WSC.2003.1261503},
doi = {10.1109/WSC.2003.1261503},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wsc/GanLWWTC03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/ZengCT03,
author = {Yi Zeng and
Wentong Cai and
Stephen John Turner},
editor = {Stephen E. Chick and
Paul J. Sanchez and
David M. Ferrin and
Douglas J. Morrice},
title = {Parallel distributed simulation and modeling methods: causal order
based time warp: a tradeoff of optimism},
booktitle = {Proceedings of the 35th Winter Simulation Conference: Driving Innovation,
New Orleans, Louisiana, USA, December 7-10, 2003},
pages = {855--863},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/WSC.2003.1261504},
doi = {10.1109/WSC.2003.1261504},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wsc/ZengCT03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aiedam/McMahonCLSWC02,
author = {Chris A. McMahon and
Rose Crossland and
Alistair Lowe and
Tulan Shah and
J. H. Sims Williams and
Steve J. Culley},
title = {No zero match browsing of hierarchically categorized information entities},
journal = {Artif. Intell. Eng. Des. Anal. Manuf.},
volume = {16},
number = {3},
pages = {243--257},
year = {2002},
url = {https://doi.org/10.1017/S0890060402163098},
doi = {10.1017/S0890060402163098},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aiedam/McMahonCLSWC02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/candc/TurcotteMS02,
author = {Marcel Turcotte and
Stephen H. Muggleton and
Michael J. E. Sternberg},
title = {Generating Protein Three-dimensional Fold Signatures using Inductive
Logic Programming},
journal = {Comput. Chem.},
volume = {26},
number = {1},
pages = {57--64},
year = {2002},
url = {https://doi.org/10.1016/S0097-8485(01)00100-0},
doi = {10.1016/S0097-8485(01)00100-0},
timestamp = {Sat, 30 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/candc/TurcotteMS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/JieCT02,
author = {Wei Jie and
Wentong Cai and
Stephen John Turner},
title = {{POEMS:} {A} Parallel Object-oriented Environment for Multi-computer
Systems},
journal = {Comput. J.},
volume = {45},
number = {5},
pages = {540--560},
year = {2002},
url = {https://doi.org/10.1093/comjnl/45.5.540},
doi = {10.1093/COMJNL/45.5.540},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cj/JieCT02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ida/CounsellLMST02,
author = {Steve Counsell and
Xiaohui Liu and
Janet McFall and
Stephen Swift and
Allan Tucker},
title = {Evolutionary algorithms for grouping high dimensional Email data},
journal = {Intell. Data Anal.},
volume = {6},
number = {6},
pages = {503--516},
year = {2002},
url = {http://content.iospress.com/articles/intelligent-data-analysis/ida00108},
timestamp = {Mon, 05 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ida/CounsellLMST02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ida/KellamLMOST02,
author = {Paul Kellam and
Xiaohui Liu and
Nigel J. Martin and
Christine A. Orengo and
Stephen Swift and
Allan Tucker},
title = {A framework for modelling virus gene expression data},
journal = {Intell. Data Anal.},
volume = {6},
number = {3},
pages = {267--279},
year = {2002},
url = {http://content.iospress.com/articles/intelligent-data-analysis/ida00092},
timestamp = {Mon, 11 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ida/KellamLMOST02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcns/TunstallRS02,
author = {Mark J. Tunstall and
Alan Roberts and
Stephen R. Soffe},
title = {Modelling Inter-Segmental Coordination of Neuronal Oscillators: Synaptic
Mechanisms for Uni-Directional Coupling During Swimming in Xenopus
Tadpoles},
journal = {J. Comput. Neurosci.},
volume = {13},
number = {2},
pages = {143--158},
year = {2002},
url = {https://doi.org/10.1023/A:1020114324350},
doi = {10.1023/A:1020114324350},
timestamp = {Thu, 16 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcns/TunstallRS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmobile/ZhangLWT02,
author = {Junbiao Zhang and
Jun Li and
Stephen B. Weinstein and
Nan Tu},
title = {Virtual operator based {AAA} in wireless {LAN} hot spots with ad-hoc
networking support},
journal = {{ACM} {SIGMOBILE} Mob. Comput. Commun. Rev.},
volume = {6},
number = {3},
pages = {10--21},
year = {2002},
url = {https://doi.org/10.1145/581291.581297},
doi = {10.1145/581291.581297},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigmobile/ZhangLWT02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wc/LiWZT02,
author = {Jun Li and
Stephen B. Weinstein and
Junbiao Zhang and
Nan Tu},
title = {Public access mobility {LAN:} extending the wireless internet into
the {LAN} enwronment},
journal = {{IEEE} Wirel. Commun.},
volume = {9},
number = {3},
pages = {22--30},
year = {2002},
url = {https://doi.org/10.1109/MWC.2002.1016707},
doi = {10.1109/MWC.2002.1016707},
timestamp = {Tue, 24 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/wc/LiWZT02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acis/ChauT02,
author = {Stephen B. Chau and
Paul Turner},
title = {An Exploration of Factors that influence the ability of Small and
Medium Sized Enterprises to Engage in Electronic Commerce: preliminary
findings from 34 Australian case studies},
booktitle = {Australasian Conference on Information Systems, {ACIS} 2002, Melbourne,
Australia, December 3-6, 2002},
year = {2002},
url = {https://aisel.aisnet.org/acis2002/8},
timestamp = {Thu, 16 May 2024 17:06:13 +0200},
biburl = {https://dblp.org/rec/conf/acis/ChauT02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/assets/CoxLTNWTA02,
author = {Stephen Cox and
Michael Lincoln and
Judy Tryggvason and
Melanie Nakisa and
Mark Wells and
Marcus Tutt and
Sanja Abbott},
editor = {Vicki L. Hanson and
Julie A. Jacko},
title = {Tessa, a system to aid communication with deaf people},
booktitle = {Proceedings of the {ACM} Conference on Assistive Technologies, {ASSETS}
2002, Edinburgh, Scotland, UK, July 8-10, 2002},
pages = {205--212},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/638249.638287},
doi = {10.1145/638249.638287},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/assets/CoxLTNWTA02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/CaoSTJKSN02,
author = {Junwei Cao and
Daniel P. Spooner and
James D. Turner and
Stephen A. Jarvis and
Darren J. Kerbyson and
Subhash Saini and
Graham R. Nudd},
title = {Agent-Based Resource Management for Grid Computing},
booktitle = {2nd {IEEE} International Symposium on Cluster Computing and the Grid
(CCGrid 2002), 22-24 May 2002, Berlin, Germany},
pages = {350--351},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/CCGRID.2002.1017159},
doi = {10.1109/CCGRID.2002.1017159},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ccgrid/CaoSTJKSN02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/CaiLTLL02,
author = {Wentong Cai and
Guangya Li and
Stephen John Turner and
Bu{-}Sung Lee and
Li Liu},
title = {Automatic Construction of Hierarchical Federations Architecture},
booktitle = {6th {IEEE} International Workshop on Distributed Simulation and Real-Time
Applications {(DS-RT} 2002), 11-13 October 2002, Fort Worth, TX, {USA}},
pages = {50--58},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/DISRTA.2002.1166888},
doi = {10.1109/DISRTA.2002.1166888},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsrt/CaiLTLL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/CaiTZ02,
author = {Wentong Cai and
Stephen John Turner and
Hanfeng Zhao},
title = {A Load Management System for Running HLA-Based Distributed Simulations
over the Grid},
booktitle = {6th {IEEE} International Workshop on Distributed Simulation and Real-Time
Applications {(DS-RT} 2002), 11-13 October 2002, Fort Worth, TX, {USA}},
pages = {7--14},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/DISRTA.2002.1166883},
doi = {10.1109/DISRTA.2002.1166883},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dsrt/CaiTZ02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecis/ChauT02,
author = {Stephen B. Chau and
Paul Turner},
editor = {Stanislaw Wrycza},
title = {A Framework For Analysing Factors Influencing Small To Medium Sized
Enterprises (SMEs) Ability To Derive Benefit From The Conduct Of Web-based
Electronic Commerce {(EC)-34} Australian Case Studies},
booktitle = {Proceedings of the 10th European Conference on Information Systems,
Information Systems and the Future of the Digital Economy, {ECIS}
2002, Gdansk, Poland, June 6-8, 2002},
pages = {625--639},
year = {2002},
url = {http://aisel.aisnet.org/ecis2002/110},
timestamp = {Mon, 05 Dec 2016 15:14:00 +0100},
biburl = {https://dblp.org/rec/conf/ecis/ChauT02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/HuangJTFD02,
author = {Zhi Huang and
Xiuping Jia and
Brian Turner and
William Foley and
Stephen Dury},
title = {Use of {HYMAP} image data to estimate sideroxylonal-A concentration
of eucalypt foliage},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2002, Toronto, Ontario, Canada, 24-28 June 2002},
pages = {1652--1654},
publisher = {{IEEE}},
year = {2002},
url = {https://doi.org/10.1109/IGARSS.2002.1026210},
doi = {10.1109/IGARSS.2002.1026210},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/HuangJTFD02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/CaoJSTKN02,
author = {Junwei Cao and
Stephen A. Jarvis and
Daniel P. Spooner and
James D. Turner and
Darren J. Kerbyson and
Graham R. Nudd},
title = {Performance Prediction Technology for Agent-Based Resource Management
in Grid Environments},
booktitle = {16th International Parallel and Distributed Processing Symposium {(IPDPS}
2002), 15-19 April 2002, Fort Lauderdale, FL, USA, CD-ROM/Abstracts
Proceedings},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/IPDPS.2002.1015660},
doi = {10.1109/IPDPS.2002.1015660},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/CaoJSTKN02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/CaiXTL02,
author = {Wentong Cai and
Percival Xavier and
Stephen John Turner and
Bu{-}Sung Lee},
editor = {Frederick Wieland and
Philip A. Wilsey and
Lorenzo Donatiello and
Francesco Quaglia},
title = {A scalable architecture for supporting interactive games on the internet},
booktitle = {Proceedings of the 16th Workshop on Parallel and Distributed Simulation,
{PADS} 2002, Washington, D.C., USA, May 12-15, 2002},
pages = {60--67},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/PADS.2002.1004201},
doi = {10.1109/PADS.2002.1004201},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/CaiXTL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/ZhouCTL02,
author = {Suiping Zhou and
Wentong Cai and
Stephen John Turner and
Francis B. S. Lee},
editor = {Frederick Wieland and
Philip A. Wilsey and
Lorenzo Donatiello and
Francesco Quaglia},
title = {Critical causality in distributed virtual environments},
booktitle = {Proceedings of the 16th Workshop on Parallel and Distributed Simulation,
{PADS} 2002, Washington, D.C., USA, May 12-15, 2002},
pages = {53--59},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/PADS.2002.1004200},
doi = {10.1109/PADS.2002.1004200},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pads/ZhouCTL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pdpta/JieCTC02,
author = {Wei Jie and
Wentong Cai and
Stephen John Turner and
Wai Keong Chong},
editor = {Hamid R. Arabnia},
title = {A Parallel Object-oriented Environment for Cluster Computing},
booktitle = {Proceedings of the International Conference on Parallel and Distributed
Processing Techniques and Applications, {PDPTA} '02, June 24 - 27,
2002, Las Vegas, Nevada, USA, Volume 4},
pages = {1948--1954},
publisher = {{CSREA} Press},
year = {2002},
timestamp = {Wed, 10 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pdpta/JieCTC02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siguccs/TuckerPZ02,
author = {Stephen Tucker and
Andrew Pigou and
Thom D. Zaugg},
editor = {Pamela Vogel and
Catherine Yang and
Nancy J. Bauer},
title = {e-Learning: making it happen now},
booktitle = {Proceedings of the 30th annual {ACM} {SIGUCCS} conference on User
services: Charting Bold Courses - New Worlds in User Services, Providence,
Rhode Island, USA, November 20-23, 2002},
pages = {292--293},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/588646.588726},
doi = {10.1145/588646.588726},
timestamp = {Tue, 06 Nov 2018 16:58:10 +0100},
biburl = {https://dblp.org/rec/conf/siguccs/TuckerPZ02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/FerschaJT01,
author = {Alois Ferscha and
James Johnson and
Stephen John Turner},
title = {Distributed simulation performance data mining},
journal = {Future Gener. Comput. Syst.},
volume = {18},
number = {1},
pages = {157--174},
year = {2001},
url = {https://doi.org/10.1016/S0167-739X(01)00050-4},
doi = {10.1016/S0167-739X(01)00050-4},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fgcs/FerschaJT01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/PetersonGHTLSDPH01,
author = {Larry Peterson and
Yitzchak Gottlieb and
Mike Hibler and
Patrick Tullmann and
Jay Lepreau and
Stephen Schwab and
Hrishikesh Dandekar and
Andrew Purtell and
John Hartman},
title = {An {OS} interface for active routers},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {19},
number = {3},
pages = {473--487},
year = {2001},
url = {https://doi.org/10.1109/49.917708},
doi = {10.1109/49.917708},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/PetersonGHTLSDPH01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/SwiftTML01,
author = {Stephen Swift and
Allan Tucker and
Nigel J. Martin and
Xiaohui Liu},
title = {Grouping multivariate time series variables: applications to chemical
process and visual field data},
journal = {Knowl. Based Syst.},
volume = {14},
number = {3-4},
pages = {147--154},
year = {2001},
url = {https://doi.org/10.1016/S0950-7051(01)00091-0},
doi = {10.1016/S0950-7051(01)00091-0},
timestamp = {Sat, 25 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/kbs/SwiftTML01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ml/TurcotteMS01,
author = {Marcel Turcotte and
Stephen H. Muggleton and
Michael J. E. Sternberg},
title = {The Effect of Relational Background Knowledge on Learning of Protein
Three-Dimensional Fold Signatures},
journal = {Mach. Learn.},
volume = {43},
number = {1/2},
pages = {81--95},
year = {2001},
url = {https://doi.org/10.1023/A:1007672817406},
doi = {10.1023/A:1007672817406},
timestamp = {Sat, 30 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ml/TurcotteMS01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scpe/GanLCTJHH01,
author = {Boon{-}Ping Gan and
Yoke{-}Hean Low and
Wentong Cai and
Stephen John Turner and
Sanjay Jain and
Wen{-}Jing Hsu and
Shell{-}Ying Huang},
title = {The Development of Conservative Superstep Protocols for Shared Memory
Multiprocessor Systems},
journal = {Parallel Distributed Comput. Pract.},
volume = {4},
number = {1},
year = {2001},
url = {http://www.scpe.org/index.php/scpe/article/view/222},
timestamp = {Mon, 01 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/scpe/GanLCTJHH01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigops/LeeCTK01,
author = {Bu{-}Sung Lee and
Wentong Cai and
Stephen John Turner and
Jit{-}Beng Koh},
title = {Comparison of Network Protocol and Architecture for Distributed Virtual
Simulation Environment},
journal = {{ACM} {SIGOPS} Oper. Syst. Rev.},
volume = {35},
number = {3},
pages = {30--42},
year = {2001},
url = {https://doi.org/10.1145/383237.383242},
doi = {10.1145/383237.383242},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigops/LeeCTK01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/TuckerSL01,
author = {Allan Tucker and
Stephen Swift and
Xiaohui Liu},
title = {Variable grouping in multivariate time series via correlation},
journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
volume = {31},
number = {2},
pages = {235--245},
year = {2001},
url = {https://doi.org/10.1109/3477.915346},
doi = {10.1109/3477.915346},
timestamp = {Thu, 08 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsmc/TuckerSL01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acis/ChauT01,
author = {Stephen B. Chau and
Paul Turner},
title = {A Four Phase Model of {EC} Business Transformation amongst Small to
Medium Sized Enterprises: Preliminary Findings from 34 Australian
Case Studies},
booktitle = {Australasian Conference on Information Systems, {ACIS} 2001, Coffs
Harbour, Australia, December 5-7, 2001},
year = {2001},
url = {https://aisel.aisnet.org/acis2001/3},
timestamp = {Thu, 16 May 2024 17:06:13 +0200},
biburl = {https://dblp.org/rec/conf/acis/ChauT01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/JiGTC01,
author = {Zhengrong Ji and
Boon{-}Ping Gan and
Stephen John Turner and
Wentong Cai},
title = {Parallel Federates - An Architecture for Hybrid Distributed Simulation},
booktitle = {5th {IEEE} International Workshop on Distributed Simulation and Real-Time
Applications {(DS-RT} 2001), 13-15 August 2001, Cincinnati, OH, {USA}},
pages = {97--104},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/DISTRA.2001.946449},
doi = {10.1109/DISTRA.2001.946449},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsrt/JiGTC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceis/CounsellLSTM01,
author = {Steve Counsell and
Xiaohui Liu and
Stephen Swift and
Allan Tucker and
Janet McFall},
title = {Optimising the Grouping of Email Users to Servers Using Intelligent
Data Analysis},
booktitle = {{ICEIS} 2001, Proceedings of the 3rd International Conference on Enterprise
Information Systems, Setubal, Portugal, July 7-10, 2001},
pages = {489--496},
year = {2001},
timestamp = {Thu, 01 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iceis/CounsellLSTM01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpads/JieCT01,
author = {Wei Jie and
Wentong Cai and
Stephen John Turner},
title = {Dynamic Load-Balancing in a Data Parallel Object-Oriented System},
booktitle = {Eigth International Conference on Parallel and Distributed Systems,
{ICPADS} 2001, KyongJu City, Korea, June 26-29, 2001},
pages = {279--288},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/ICPADS.2001.934831},
doi = {10.1109/ICPADS.2001.934831},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icpads/JieCT01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ida/KellamLMOST01,
author = {Paul Kellam and
Xiaohui Liu and
Nigel J. Martin and
Christine A. Orengo and
Stephen Swift and
Allan Tucker},
editor = {Frank Hoffmann and
David J. Hand and
Niall M. Adams and
Douglas H. Fisher and
Gabriela Guimar{\~{a}}es},
title = {A Framework for Modelling Short, High-Dimensional Multivariate Time
Series: Preliminary Results in Virus Gene Expression Data Analysis},
booktitle = {Advances in Intelligent Data Analysis, 4th International Conference,
{IDA} 2001, Cascais, Portugal, September 13-15, 2001, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2189},
pages = {218--227},
publisher = {Springer},
year = {2001},
url = {https://doi.org/10.1007/3-540-44816-0\_22},
doi = {10.1007/3-540-44816-0\_22},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ida/KellamLMOST01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/JieCT01,
author = {Wei Jie and
Wentong Cai and
Stephen John Turner},
title = {Dynamic Load-balancing Using Prediction in a Parallel Object-oriented
System},
booktitle = {Proceedings of the 15th International Parallel {\&} Distributed
Processing Symposium (IPDPS-01), San Francisco, CA, USA, April 23-27,
2001},
pages = {76},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/IPDPS.2001.925024},
doi = {10.1109/IPDPS.2001.925024},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ipps/JieCT01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/CaiTG01,
author = {Wentong Cai and
Stephen John Turner and
Boon{-}Ping Gan},
editor = {Rajive L. Bagrodia and
Ewa Deelman and
Philip A. Wilsey},
title = {Hierarchical federations: an architecture for information hiding},
booktitle = {Proceedings of the 15th Workshop on Parallel and Distributed Simulation,
{PADS} 2001, Lake Arrowhead, California, USA, May 15-18, 2001},
pages = {67--74},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/PADS.2001.924622},
doi = {10.1109/PADS.2001.924622},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pads/CaiTG01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/ZhangCT01,
author = {Ye Zhang and
Wentong Cai and
Stephen John Turner},
editor = {Rajive L. Bagrodia and
Ewa Deelman and
Philip A. Wilsey},
title = {A parallel object-oriented manufacturing simulation language},
booktitle = {Proceedings of the 15th Workshop on Parallel and Distributed Simulation,
{PADS} 2001, Lake Arrowhead, California, USA, May 15-18, 2001},
pages = {101--108},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/PADS.2001.924626},
doi = {10.1109/PADS.2001.924626},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pads/ZhangCT01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robocup/StancliffBBESS01,
author = {Stephen B. Stancliff and
Ravi Balasubramanian and
Tucker R. Balch and
Rosemary Emery and
Kevin Sikorski and
Ashley W. Stroupe},
editor = {Andreas Birk and
Silvia Coradeschi and
Satoshi Tadokoro},
title = {{CMU} Hammerheads 2001 Team Description},
booktitle = {RoboCup 2001: Robot Soccer World Cup {V}},
series = {Lecture Notes in Computer Science},
volume = {2377},
pages = {631--634},
publisher = {Springer},
year = {2001},
url = {https://doi.org/10.1007/3-540-45603-1\_100},
doi = {10.1007/3-540-45603-1\_100},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/robocup/StancliffBBESS01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uist/MacIntyreMVHTC01,
author = {Blair MacIntyre and
Elizabeth D. Mynatt and
Stephen Voida and
Klaus Marius Hansen and
Joe Tullio and
Gregory M. Corso},
editor = {Joe Marks and
Elizabeth D. Mynatt},
title = {Support for multitasking and background awareness using interactive
peripheral displays},
booktitle = {Proceedings of the 14th Annual {ACM} Symposium on User Interface Software
and Technology, {UIST} 2001, Disney's BoardWalk Inn Resort, Walt Disney
World, Orlando, Florida, USA, November 11-14, 2001},
pages = {41--50},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/502348.502355},
doi = {10.1145/502348.502355},
timestamp = {Tue, 06 Nov 2018 16:58:06 +0100},
biburl = {https://dblp.org/rec/conf/uist/MacIntyreMVHTC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/GanLJTC01,
author = {Boon{-}Ping Gan and
Li Liu and
Zhengrong Ji and
Stephen John Turner and
Wentong Cai},
editor = {Matthew W. Rohrer and
Deborah J. Medeiros and
Mark R. Grabau},
title = {Managing event traces for a web front-end to a parallel simulation},
booktitle = {Proceedings of the 33nd conference on Winter simulation, {WSC} 2001,
Arlington, VA, USA, December 9-12, 2001},
pages = {637--644},
publisher = {{WSC}},
year = {2001},
url = {https://doi.org/10.1109/WSC.2001.977349},
doi = {10.1109/WSC.2001.977349},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/GanLJTC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc3185,
author = {Stephen Farrell and
Sean Turner},
title = {Reuse of {CMS} Content Encryption Keys},
journal = {{RFC}},
volume = {3185},
pages = {1--10},
year = {2001},
url = {https://doi.org/10.17487/RFC3185},
doi = {10.17487/RFC3185},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rfc/rfc3185.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/etai/TurcotteMS00,
author = {Marcel Turcotte and
Stephen H. Muggleton and
Michael J. E. Sternberg},
title = {Use of Inductive Logic Programming to Learn Principles of Protein
Structure},
journal = {Electron. Trans. Artif. Intell.},
volume = {4},
number = {B},
pages = {119--124},
year = {2000},
url = {http://www.ep.liu.se/ej/etai/2000/013/},
timestamp = {Sat, 30 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/etai/TurcotteMS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jors/GanT00,
author = {Boon{-}Ping Gan and
Stephen John Turner},
title = {An asynchronous protocol for virtual factory simulation on shared
memory multiprocessor systems},
journal = {J. Oper. Res. Soc.},
volume = {51},
number = {4},
pages = {413--422},
year = {2000},
url = {https://doi.org/10.1057/palgrave.jors.2600914},
doi = {10.1057/PALGRAVE.JORS.2600914},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jors/GanT00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/TurnerCG00,
author = {Stephen John Turner and
Wentong Cai and
Boon{-}Ping Gan},
title = {Adapting a Supply-Chain Simulation for {HLA}},
booktitle = {4th International Workshop on Distributed Simulation and Real-Time
Applications {(DS-RT} 2000), 25-17 August 2000, San Francisco, CA,
{USA}},
pages = {71--78},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/DISRTA.2000.874065},
doi = {10.1109/DISRTA.2000.874065},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dsrt/TurnerCG00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esm/ZhangCT00,
author = {Ye Zhang and
Wentong Cai and
Stephen John Turner},
editor = {Rik Van Landeghem},
title = {Parallel discrete event simulation of manufacturing systems using
parsec},
booktitle = {14\({}^{\mbox{th}}\) European Simulation Multiconference - Simulation
and Modelling: Enablers for a Better Quality of Life, May 23-26, 2000,
Ghent, Belgium},
pages = {296--301},
publisher = {{SCS} Europe},
year = {2000},
timestamp = {Wed, 10 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/esm/ZhangCT00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/ThomasTRC00,
author = {Federico Thomas and
Colin Turnbull and
Llu{\'{\i}}s Ros and
Stephen Cameron},
title = {Computing Signed Distances between Free-Form Objects},
booktitle = {Proceedings of the 2000 {IEEE} International Conference on Robotics
and Automation, {ICRA} 2000, April 24-28, 2000, San Francisco, CA,
{USA}},
pages = {3713--3718},
publisher = {{IEEE}},
year = {2000},
url = {https://doi.org/10.1109/ROBOT.2000.845310},
doi = {10.1109/ROBOT.2000.845310},
timestamp = {Mon, 22 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/ThomasTRC00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/TurnerAL00,
author = {Kenneth J. Turner and
F. Javier Argul{-}Marin and
Stephen D. Laing},
editor = {Jos{\'{e}} D. P. Rolim},
title = {Concurrent Specification and Timing Analysis of Digital Hardware Using
{SDL}},
booktitle = {Parallel and Distributed Processing, 15 {IPDPS} 2000 Workshops, Cancun,
Mexico, May 1-5, 2000, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1800},
pages = {1001--1008},
publisher = {Springer},
year = {2000},
url = {https://doi.org/10.1007/3-540-45591-4\_137},
doi = {10.1007/3-540-45591-4\_137},
timestamp = {Tue, 14 May 2019 10:00:41 +0200},
biburl = {https://dblp.org/rec/conf/ipps/TurnerAL00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/GanLJTCHH00,
author = {Boon{-}Ping Gan and
Yoke{-}Hean Low and
Sanjay Jain and
Stephen John Turner and
Wentong Cai and
Wen{-}Jing Hsu and
Shell{-}Ying Huang},
editor = {Lorenzo Donatiello and
Stephen John Turner and
David Bruce},
title = {Load balancing for conservative simulation on shared memory multiprocessor
systems},
booktitle = {Proceedings of the 14th Workshop on Parallel and Distributed Simulation,
{PADS} 2000, Bologna, Italy, May 28-31, 2000},
pages = {139--146},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/PADS.2000.847157},
doi = {10.1109/PADS.2000.847157},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/GanLJTCHH00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/DamianoKTB00,
author = {Brian Damiano and
Stephen W. Kercel and
Raymond W. Tucker Jr. and
S. Alenka Brown{-}VanHoozer},
title = {Recognizing a voice from its model},
booktitle = {Proceedings of the {IEEE} International Conference on Systems, Man
{\&} Cybernetics: "Cybernetics Evolving to Systems, Humans, Organizations,
and their Complex Interactions", Sheraton Music City Hotel, Nashville,
Tennessee, USA, 8-11 October 2000},
pages = {2216--2221},
publisher = {{IEEE}},
year = {2000},
url = {https://doi.org/10.1109/ICSMC.2000.886445},
doi = {10.1109/ICSMC.2000.886445},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/smc/DamianoKTB00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/GanLJTCH00,
author = {Boon{-}Ping Gan and
Li Liu and
Sanjay Jain and
Stephen John Turner and
Wentong Cai and
Wen{-}Jing Hsu},
editor = {Paul A. Fishwick and
Keebom Kang and
Jeffrey A. Joines and
Russell R. Barton},
title = {Manufacturing sypply chain management: distributed supply chain simulation
across enterprise boundaries},
booktitle = {Proceedings of the 32nd conference on Winter simulation, {WSC} 2000,
Wyndham Palace Resort {\&} Spa, Orlando, FL, USA, December 10-13,
2000},
pages = {1245--1251},
publisher = {{WSC}},
year = {2000},
url = {https://doi.org/10.1109/WSC.2000.899092},
doi = {10.1109/WSC.2000.899092},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wsc/GanLJTCH00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/pads/2000,
editor = {Lorenzo Donatiello and
Stephen John Turner and
David Bruce},
title = {Proceedings of the 14th Workshop on Parallel and Distributed Simulation,
{PADS} 2000, Bologna, Italy, May 28-31, 2000},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://ieeexplore.ieee.org/xpl/conhome/6840/proceeding},
isbn = {0-7695-0667-4},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/2000.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mor/StephenT99,
author = {Tamon Stephen and
Levent Tun{\c{c}}el},
title = {On a Representation of the Matching Polytope Via Semidefinite Liftings},
journal = {Math. Oper. Res.},
volume = {24},
number = {1},
pages = {1--7},
year = {1999},
url = {https://doi.org/10.1287/moor.24.1.1},
doi = {10.1287/MOOR.24.1.1},
timestamp = {Fri, 30 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mor/StephenT99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pc/CaiZTS99,
author = {Wentong Cai and
Kang Zhang and
Stephen John Turner and
Chengzheng Sun},
title = {Interlock avoidance in transparent and dynamic parallel program instrumentation
using logical clocks},
journal = {Parallel Comput.},
volume = {25},
number = {5},
pages = {569--591},
year = {1999},
url = {https://doi.org/10.1016/S0167-8191(99)00010-1},
doi = {10.1016/S0167-8191(99)00010-1},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pc/CaiZTS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/LowLCHHJT99,
author = {Yoke{-}Hean Low and
Chu{-}Cheow Lim and
Wentong Cai and
Shell{-}Ying Huang and
Wen{-}Jing Hsu and
Sanjay Jain and
Stephen John Turner},
title = {Survey of Languages and Runtime Libraries for Parallel Discrete-Event
Simulation},
journal = {Simul.},
volume = {72},
number = {3},
pages = {170--186},
year = {1999},
url = {https://doi.org/10.1177/003754979907200309},
doi = {10.1177/003754979907200309},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simulation/LowLCHHJT99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/arvlsi/BrittonWSWTBBDEEMTCJTHR99,
author = {Charles L. Britton Jr. and
R. J. Warmack and
Stephen F. Smith and
Alan L. Wintenberg and
T. Thundat and
G. M. Brown and
W. L. Bryan and
J. C. Depriest and
M. Nance Ericson and
M. S. Emery and
Michael Roy Moore and
G. W. Turner and
Lloyd G. Clonts and
R. L. Jones and
T. D. Threatt and
Z. Hu and
James M. Rochelle},
title = {Battery-powered, Wireless {MEMS} Sensors for High-Sensitivity Chemical
and Biological Sensing},
booktitle = {18th Conference on Advanced Research in {VLSI} {(ARVLSI} '99), 21-24
March 1999, Atlanta, GA, {USA}},
pages = {359--368},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/ARVLSI.1999.756060},
doi = {10.1109/ARVLSI.1999.756060},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/arvlsi/BrittonWSWTBBDEEMTCJTHR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/LiangCLT99,
author = {Lawrence A. H. Liang and
Wentong Cai and
Bu{-}Sung Lee and
Stephen John Turner},
title = {Performance Analysis of Packet Bundling Techniques in {DIS}},
booktitle = {3rd International Workshop on Distributed Interactive Simulation and
Real-Time Applications {(DIS-RT} '99), 22-23 October 1999, Greenbelt,
MD, {USA}},
pages = {75},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/DISRTA.1999.807728},
doi = {10.1109/DISRTA.1999.807728},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dsrt/LiangCLT99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ida/SwiftTL99,
author = {Stephen Swift and
Allan Tucker and
Xiaohui Liu},
editor = {David J. Hand and
Joost N. Kok and
Michael R. Berthold},
title = {Evolutionary Computation to Search for Strongly Correlated Variables
in High-Dimensional Time-Series},
booktitle = {Advances in Intelligent Data Analysis, Third International Symposium,
IDA-99, Amsterdam, The Netherlands, August 1999, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1642},
pages = {51--62},
publisher = {Springer},
year = {1999},
url = {https://doi.org/10.1007/3-540-48412-4\_5},
doi = {10.1007/3-540-48412-4\_5},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ida/SwiftTL99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/pads/1999,
editor = {Richard M. Fujimoto and
Stephen John Turner},
title = {Proceedings of the Thirteenth Workshop on Parallel and Distributed
Simulation, {PADS} '99, Atlanta, GA, USA, May 1-4, 1999},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://ieeexplore.ieee.org/xpl/conhome/6213/proceeding},
isbn = {0-7695-0155-9},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/1999.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsa/Turner98,
author = {Stephen John Turner},
title = {Models of computation for parallel discrete event simulation},
journal = {J. Syst. Archit.},
volume = {44},
number = {6-7},
pages = {395--409},
year = {1998},
url = {https://doi.org/10.1016/S1383-7621(97)00055-6},
doi = {10.1016/S1383-7621(97)00055-6},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsa/Turner98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esm/CuiT98,
author = {Qung Ming Cui and
Stephen John Turner},
editor = {Richard N. Zobel and
Dietmar P. F. M{\"{o}}ller},
title = {Reducing Null Messages in The Conservative Parallel Simulation of
Timed Petri Nets},
booktitle = {12\({}^{\mbox{th}}\) European Simulation Multiconference - Simulation
- Past, Present and Future, June 16-19, 1998, Machester, United Kingdom},
pages = {69--73},
publisher = {{SCS} Europe},
year = {1998},
timestamp = {Fri, 28 Apr 2006 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/esm/CuiT98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/TurnbullC98,
author = {Colin Turnbull and
Stephen Cameron},
title = {Computing Distances between NURBS-defined Convex Objects},
booktitle = {Proceedings of the {IEEE} International Conference on Robotics and
Automation, ICRA-98, Leuven, Belgium, May 16-20, 1998},
pages = {3685--3690},
publisher = {{IEEE} Computer Society},
year = {1998},
url = {https://doi.org/10.1109/ROBOT.1998.681406},
doi = {10.1109/ROBOT.1998.681406},
timestamp = {Mon, 22 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/TurnbullC98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ilp/TurcotteMS98,
author = {Marcel Turcotte and
Stephen H. Muggleton and
Michael J. E. Sternberg},
editor = {David Page},
title = {Application of Inductive Logic Programming to Discover Rules Governing
the Three-Dimensional Topology of Protein Structure},
booktitle = {Inductive Logic Programming, 8th International Workshop, ILP-98, Madison,
Wisconsin, USA, July 22-24, 1998, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1446},
pages = {53--64},
publisher = {Springer},
year = {1998},
url = {https://doi.org/10.1007/BFb0027310},
doi = {10.1007/BFB0027310},
timestamp = {Sat, 30 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ilp/TurcotteMS98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/LimLCHHT98,
author = {Chu{-}Cheow Lim and
Yoke{-}Hean Low and
Wentong Cai and
Wen{-}Jing Hsu and
Shell{-}Ying Huang and
Stephen John Turner},
editor = {Jos{\'{e}} D. P. Rolim},
title = {An Empirical Comparison of Runtime Systems for Conservative Parallel
Simulation},
booktitle = {Parallel and Distributed Processing, 10 IPPS/SPDP'98 Workshops Held
in Conjunction with the 12th International Parallel Processing Symposium
and 9th Symposium on Parallel and Distributed Processing, Orlando,
Florida, USA, March 30 - April 3, 1998, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1388},
pages = {123--134},
publisher = {Springer},
year = {1998},
url = {https://doi.org/10.1007/3-540-64359-1\_683},
doi = {10.1007/3-540-64359-1\_683},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ipps/LimLCHHT98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/TurnerCLLHH98,
author = {Stephen John Turner and
Wentong Cai and
Chu{-}Cheow Lim and
Yoke{-}Hean Low and
Wen{-}Jing Hsu and
Shell{-}Ying Huang},
editor = {Brian W. Unger and
Alois Ferscha},
title = {A Methodology for Automating the Parallelization of Manufacturing
Simulations},
booktitle = {Proceedings of the 12th Workshop on Parallel and Distributed Simulation,
{PADS} '98, Banff, Alberta, Canada, May 26-29, 1998},
pages = {126--133},
publisher = {{IEEE} Computer Society},
year = {1998},
url = {https://doi.org/10.1109/PADS.1998.685278},
doi = {10.1109/PADS.1998.685278},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pads/TurnerCLLHH98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ais/TuckettTJ97,
author = {J. Tuckett and
Peter J. Thomas and
Stephen R. Jones},
title = {Expert Opinion on the Future of Multimedia Based Education},
journal = {{AI} Soc.},
volume = {11},
number = {1},
pages = {88--103},
year = {1997},
url = {https://doi.org/10.1007/BF02812441},
doi = {10.1007/BF02812441},
timestamp = {Fri, 15 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ais/TuckettTJ97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hotos/FordMLCRT97,
author = {Bryan Ford and
Kevin Van Maren and
Jay Lepreau and
Stephen Clawson and
Bart Robinson and
Jeff Turner},
title = {The Flux {OS} Toolkit: Reusable Components for {OS} Implementation},
booktitle = {Proceedings of The Sixth Workshop on Hot Topics in Operating Systems,
HotOS-VI, Cape Cod, Massachusetts, USA, May 5-6, 1997},
pages = {14--19},
publisher = {{IEEE} Computer Society},
year = {1997},
url = {https://doi.org/10.1109/HOTOS.1997.595175},
doi = {10.1109/HOTOS.1997.595175},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hotos/FordMLCRT97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/CaiLT97,
author = {Wentong Cai and
Emmanuelle Letertre and
Stephen John Turner},
editor = {Alois Ferscha and
Rassul Ayani and
Carl Tropper},
title = {Dag Consistent Parallel Simulation: {A} Predictable and Robust Conservative
Algorithm},
booktitle = {Proceedings of the Eleventh Workshop on Parallel and Distributed Simulation,
{PADS} '97, Lockenhaus, Austria, June 10-13, 1997},
pages = {178--181},
publisher = {{IEEE} Computer Society},
year = {1997},
url = {https://doi.org/10.1109/PADS.1997.594604},
doi = {10.1109/PADS.1997.594604},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pads/CaiLT97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pcfd/RycroftT97,
author = {N. C. Rycroft and
Stephen R. Turnock},
editor = {David R. Emerson and
Akin Ecer and
Jacques P{\'{e}}riaux and
Nobuyuki Satofuka},
title = {Hybrid Cell Finite Volume Euler Solutions of Flow Around a Main-Jib
Sail Using an {IBM} {SP2}},
booktitle = {Conference on Parallel Computational Fluid Dynamics 1997, Manchester,
UK, May 19-21, 1997},
pages = {263--272},
publisher = {North Holland},
year = {1997},
url = {https://doi.org/10.1016/b978-044482849-1/50032-4},
doi = {10.1016/B978-044482849-1/50032-4},
timestamp = {Fri, 29 May 2020 15:29:13 +0200},
biburl = {https://dblp.org/rec/conf/pcfd/RycroftT97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pdpta/TurnerY97,
author = {Stephen John Turner and
Norlaily Yaacob},
editor = {Hamid R. Arabnia},
title = {A Transformational Approach to Object-Based Concurrent Reflective
Language},
booktitle = {Proceedings of the International Conference on Parallel and Distributed
Processing Techniques and Applications, {PDPTA} 1997, June 30 - July
3, 1997, Las Vegas, Nevada, {USA}},
pages = {226--244},
publisher = {{CSREA} Press},
year = {1997},
timestamp = {Fri, 28 Apr 2006 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pdpta/TurnerY97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/GeistCHT96,
author = {Robert Geist and
Madhu Chetuparambil and
Stephen T. Hedetniemi and
A. Joe Turner},
title = {Computing Research Programs in the {US}},
journal = {Commun. {ACM}},
volume = {39},
number = {12},
pages = {96--99},
year = {1996},
url = {https://doi.org/10.1145/240483.240505},
doi = {10.1145/240483.240505},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/GeistCHT96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esm/CuiT96,
author = {Qing Ming Cui and
Stephen J. Turner},
editor = {Andr{\'{a}}s J{\'{a}}vor and
Axel Lehmann and
Istvan Moln{\'{a}}r},
title = {A New Approach To The Distributed Simulation of Timed Petri Nets},
booktitle = {Modelling and Simulation, ESM96, June 2-6, 1996, Budapest University
of Economic Sciences},
pages = {90--94},
publisher = {SCS, The Society for Computer Simulation International},
year = {1996},
timestamp = {Mon, 27 Feb 2023 10:45:50 +0100},
biburl = {https://dblp.org/rec/conf/esm/CuiT96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/BlumeEFGLLHPPPPRTW96,
author = {William Blume and
Rudolf Eigenmann and
Keith Faigin and
John Grout and
Jaejin Lee and
Thomas Lawrence and
Jay P. Hoeflinger and
David A. Padua and
Yunheung Paek and
Paul Petersen and
William M. Pottenger and
Lawrence Rauchwerger and
Peng Tu and
Stephen Weatherford},
editor = {Howard Jay Siegel},
title = {Restructuring Programs for High-Speed Computers with Polaris},
booktitle = {Proceedings of the 1996 International Conference on Parallel Processing
Workshop, {ICCPW} 1996, Bloomingdale, IL, USA, August 12-16, 1996},
pages = {149--161},
publisher = {{IEEE} Computer Society},
year = {1996},
url = {https://doi.org/10.1109/ICPPW.1996.538601},
doi = {10.1109/ICPPW.1996.538601},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpp/BlumeEFGLLHPPPPRTW96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/idw/LeeC96,
author = {John W. T. Lee and
Stephen Chi{-}fai Chan},
editor = {Joseph Fong and
Brian Siu},
title = {Extending Path Expression to Tree Expression in {OODM}},
booktitle = {Multimedia, Knowledge-Based {\&} Object-Oriented Databases, 7th
International Hong Kong Computer Society Database Workshop, May 1996},
pages = {248--263},
publisher = {Springer, Singapore},
year = {1996},
timestamp = {Thu, 16 Mar 2017 15:23:09 +0100},
biburl = {https://dblp.org/rec/conf/idw/LeeC96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/osdi/FordHLTBC96,
author = {Bryan Ford and
Mike Hibler and
Jay Lepreau and
Patrick Tullmann and
Godmar Back and
Stephen Clawson},
editor = {Karin Petersen and
Willy Zwaenepoel},
title = {Microkernels Meet Recursive Virtual Machines},
booktitle = {Proceedings of the Second {USENIX} Symposium on Operating Systems
Design and Implementation (OSDI), Seattle, Washington, USA, October
28-31, 1996},
pages = {137--151},
publisher = {{ACM}},
year = {1996},
url = {https://doi.org/10.1145/238721.238769},
doi = {10.1145/238721.238769},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/osdi/FordHLTBC96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/TurnerNC95,
author = {Stephen W. Turner and
Lionel M. Ni and
Betty H. C. Cheng},
title = {Contention-Free 2D-Mesh Cluster Allocation in Hypercubes},
journal = {{IEEE} Trans. Computers},
volume = {44},
number = {8},
pages = {1051--1055},
year = {1995},
url = {https://doi.org/10.1109/12.403722},
doi = {10.1109/12.403722},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/TurnerNC95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anss/BackT95,
author = {Adam Back and
Stephen John Turner},
title = {Time-stamp generation for optimistic parallel computing},
booktitle = {Proceedings 28st Annual Simulation Symposium {(SS} '95), April 25-28,
1995, Santa Barbara, California, {USA}},
pages = {144},
publisher = {{IEEE} Computer Society},
year = {1995},
url = {https://doi.org/10.1109/SIMSYM.1995.393585},
doi = {10.1109/SIMSYM.1995.393585},
timestamp = {Fri, 05 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/anss/BackT95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpcn/BackT95,
author = {Adam Back and
Stephen John Turner},
editor = {Louis O. Hertzberger and
Giuseppe Serazzi},
title = {Using optimistic execution techniques as a parallelisation tool for
general purpose computing},
booktitle = {High-Performance Computing and Networking, International Conference
and Exhibition, {HPCN} Europe 1995, Milan, Italy, May 3-5, 1995, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {919},
pages = {21--26},
publisher = {Springer},
year = {1995},
url = {https://doi.org/10.1007/BFb0046604},
doi = {10.1007/BFB0046604},
timestamp = {Fri, 05 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hpcn/BackT95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icannga/RobertsT95,
author = {Stephen G. Roberts and
Mike Turega},
editor = {David W. Pearson and
Nigel C. Steele and
Rudolf F. Albrecht},
title = {Evolving Neural Network Structures: An Evaluation of Encoding Techniques},
booktitle = {Artificial Neural Nets and Genetic Algorithms, {ICANNGA} 1995, Proceedings
of the International Conference in Al{\`{e}}s, France, 1995},
pages = {96--99},
publisher = {Springer},
year = {1995},
url = {https://doi.org/10.1007/978-3-7091-7535-4\_27},
doi = {10.1007/978-3-7091-7535-4\_27},
timestamp = {Fri, 05 Jul 2019 13:13:56 +0200},
biburl = {https://dblp.org/rec/conf/icannga/RobertsT95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pdpcs/TanCT95,
author = {Hung{-}Khoon Tan and
Wentong Cai and
Stephen John Turner},
editor = {M. H. Hamza},
title = {{VPE:} {A} Visual Programming Environment for Parallel Processing},
booktitle = {Proceedings of the Seventh {IASTED/ISMM} International Conference
on Parallel and Distributed Computing and Systems, Washington, D.C.,
USA, October 19-21, 1995},
pages = {359--362},
publisher = {{IASTED/ACTA} Press},
year = {1995},
timestamp = {Wed, 10 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pdpcs/TanCT95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/CaiT94,
author = {Wentong Cai and
Stephen John Turner},
title = {An Approach to the Run-Time Monitoring of Parallel Programs},
journal = {Comput. J.},
volume = {37},
number = {4},
pages = {333--345},
year = {1994},
url = {https://doi.org/10.1093/comjnl/37.4.333},
doi = {10.1093/COMJNL/37.4.333},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cj/CaiT94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lcpc/BlumeEFGHPPPRTW94,
author = {William Blume and
Rudolf Eigenmann and
Keith Faigin and
John Grout and
Jay P. Hoeflinger and
David A. Padua and
Paul Petersen and
William M. Pottenger and
Lawrence Rauchwerger and
Peng Tu and
Stephen Weatherford},
editor = {Keshav Pingali and
Utpal Banerjee and
David Gelernter and
Alexandru Nicolau and
David A. Padua},
title = {Polaris: Improving the Effectiveness of Parallelizing Compilers},
booktitle = {Languages and Compilers for Parallel Computing, 7th International
Workshop, LCPC'94, Ithaca, NY, USA, August 8-10, 1994, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {892},
pages = {141--154},
publisher = {Springer},
year = {1994},
url = {https://doi.org/10.1007/BFb0025876},
doi = {10.1007/BFB0025876},
timestamp = {Fri, 24 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/lcpc/BlumeEFGHPPPRTW94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/BlanchardLT94,
author = {Timothy David Blanchard and
Thomas W. Lake and
Stephen John Turner},
editor = {D. K. Arvind and
Rajive L. Bagrodia and
Jason Yi{-}Bing Lin},
title = {Cooperative acceleration: robust conservative distributed discrete
event simulation},
booktitle = {Proceedings of the Eighth Workshop on Parallel and Distributed Simulation,
{PADS} 1994, Edinburgh, Scotland, United Kingdom, July 6-8, 1994},
pages = {58--64},
publisher = {{ACM}},
year = {1994},
url = {https://doi.org/10.1145/182478.182494},
doi = {10.1145/182478.182494},
timestamp = {Fri, 20 May 2022 12:42:41 +0200},
biburl = {https://dblp.org/rec/conf/pads/BlanchardLT94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/WoodT94,
author = {Kenneth R. Wood and
Stephen John Turner},
editor = {D. K. Arvind and
Rajive L. Bagrodia and
Jason Yi{-}Bing Lin},
title = {A generalized carrier-null method for conservative parallel simulation},
booktitle = {Proceedings of the Eighth Workshop on Parallel and Distributed Simulation,
{PADS} 1994, Edinburgh, Scotland, United Kingdom, July 6-8, 1994},
pages = {50--57},
publisher = {{ACM}},
year = {1994},
url = {https://doi.org/10.1145/182478.182492},
doi = {10.1145/182478.182492},
timestamp = {Fri, 05 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pads/WoodT94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/TurnerNC94,
author = {Stephen W. Turner and
Lionel M. Ni and
Betty H. C. Cheng},
editor = {Gary M. Johnson},
title = {Time and/or space sharing in a workstation cluster environment},
booktitle = {Proceedings Supercomputing '94, Washington, DC, USA, November 14-18,
1994},
pages = {630--639},
publisher = {{IEEE} Computer Society},
year = {1994},
url = {https://doi.org/10.1109/SUPERC.1994.344327},
doi = {10.1109/SUPERC.1994.344327},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/TurnerNC94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/TurnerV94,
author = {Stephen W. Turner and
Alexander V. Veidenbaum},
editor = {Gary M. Johnson},
title = {Scalability of the Cedar system},
booktitle = {Proceedings Supercomputing '94, Washington, DC, USA, November 14-18,
1994},
pages = {247--254},
publisher = {{IEEE} Computer Society},
year = {1994},
url = {https://doi.org/10.1109/SUPERC.1994.344284},
doi = {10.1109/SUPERC.1994.344284},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/TurnerV94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/WhiteAHKMOOTW93,
author = {Stephanie White and
Mack W. Alford and
Julian Holtzman and
C. Stephen Kuehl and
Brian McCay and
David Oliver and
David Owens and
Colin Tully and
Allan Willey},
title = {Systems Engineering of Computer-Based Systems, State of Practice Working
Group},
journal = {Computer},
volume = {26},
number = {11},
pages = {54--65},
year = {1993},
url = {http://doi.ieeecomputersociety.org/10.1109/MC.1993.10115},
doi = {10.1109/MC.1993.10115},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/computer/WhiteAHKMOOTW93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/CaiMT93,
author = {Wentong Cai and
Wendy J. Milne and
Stephen John Turner},
title = {Graphical Views of the Behavior of Parallel Programs},
journal = {J. Parallel Distributed Comput.},
volume = {18},
number = {2},
pages = {223--230},
year = {1993},
url = {https://doi.org/10.1006/jpdc.1993.1058},
doi = {10.1006/JPDC.1993.1058},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jpdc/CaiMT93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sp/HamiltonSTVW93,
author = {Lisa Hamilton and
Mark A. Stalzer and
R. Steven Turley and
John L. Visher and
Stephen M. Wandzura},
title = {FastScat\({}^{\mbox{TM}}\): An Object-Oriented Program for Fast Scattering
Computation},
journal = {Sci. Program.},
volume = {2},
number = {4},
pages = {171--178},
year = {1993},
url = {https://doi.org/10.1155/1993/213747},
doi = {10.1155/1993/213747},
timestamp = {Thu, 30 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sp/HamiltonSTVW93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ton/GibbensKT93,
author = {Richard J. Gibbens and
Frank P. Kelly and
Stephen R. E. Turner},
title = {Dynamic routing in multiparented networks},
journal = {{IEEE/ACM} Trans. Netw.},
volume = {1},
number = {2},
pages = {261--270},
year = {1993},
url = {https://doi.org/10.1109/90.222932},
doi = {10.1109/90.222932},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ton/GibbensKT93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icci/CzejdoTEL93,
author = {Bogdan D. Czejdo and
Ralph P. Tucci and
David W. Embley and
Stephen W. Liddle},
editor = {Osman Abou{-}Rabia and
Carl K. Chang and
Waldemar W. Koczkodaj},
title = {Graphical Query Specification with Participation Constraints},
booktitle = {Computing and Information - ICCI'93, Fifth International Conference
on Computing and Information, Sudbury, Ontario, Canada, May 27-29,
1993, Proceedings},
pages = {433--437},
publisher = {{IEEE} Computer Society},
year = {1993},
timestamp = {Thu, 21 Mar 2002 14:11:16 +0100},
biburl = {https://dblp.org/rec/conf/icci/CzejdoTEL93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/TurnerNC93,
author = {Stephen W. Turner and
Lionel M. Ni and
Betty H. C. Cheng},
editor = {Alok N. Choudhary and
P. Bruce Berra},
title = {Contention-Free 2D-Mesh Cluster Allocation in Hypercubes},
booktitle = {Proceedings of the 1993 International Conference on Parallel Processing,
Syracuse University, NY, USA, August 16-20, 1993. Volume {II:} Software},
pages = {125--129},
publisher = {{CRC} Press},
year = {1993},
url = {https://doi.org/10.1109/ICPP.1993.64},
doi = {10.1109/ICPP.1993.64},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpp/TurnerNC93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/KuckDLSZVKYGJWBYEPEHJLMAT93,
author = {David J. Kuck and
Edward S. Davidson and
Duncan H. Lawrie and
Ahmed H. Sameh and
Chuan{-}Qi Zhu and
Alexander V. Veidenbaum and
Jeff Konicek and
Pen{-}Chung Yew and
Kyle A. Gallivan and
William Jalby and
Harry A. G. Wijshoff and
Randall Bramley and
Ulrike Meier Yang and
Perry A. Emrath and
David A. Padua and
Rudolf Eigenmann and
Jay P. Hoeflinger and
Greg P. Jaxon and
Zhiyuan Li and
T. Murphy and
John T. Andrews and
Stephen W. Turner},
editor = {Alan Jay Smith},
title = {The Cedar System and an Initial Performance Study},
booktitle = {Proceedings of the 20th Annual International Symposium on Computer
Architecture, San Diego, CA, USA, May 1993},
pages = {213--223},
publisher = {{ACM}},
year = {1993},
url = {https://doi.org/10.1145/165123.165157},
doi = {10.1145/165123.165157},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isca/KuckDLSZVKYGJWBYEPEHJLMAT93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/WorthingtonT93,
author = {Stephen Worthington and
Laurence E. Turner},
title = {A method of evaluating the effects of signal quantization at arbitrary
locations in recursive digital filters},
booktitle = {1993 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
1993, Chicago, Illinois, USA, May 3-6, 1993},
pages = {615--618},
publisher = {{IEEE}},
year = {1993},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/WorthingtonT93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/air/Turner92,
author = {Stephen John Turner},
title = {A concurrent solution to computer security},
journal = {Artif. Intell. Rev.},
volume = {6},
number = {2},
pages = {191--201},
year = {1992},
url = {https://doi.org/10.1007/BF00150233},
doi = {10.1007/BF00150233},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/air/Turner92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccd/WhiteAMOTHKOW92,
author = {Stephanie White and
Mack W. Alford and
Brian McCay and
David Oliver and
Colin Tully and
Julian Holtzman and
C. Stephen Kuehl and
David Owens and
Allan Willey},
title = {Trends in Computer-Based Systems Engineering},
booktitle = {Proceedings 1992 {IEEE} International Conference on Computer Design:
{VLSI} in Computer {\&} Processors, {ICCD} '92, Cambridge, MA,
USA, October 11-14, 1992},
pages = {12--15},
publisher = {{IEEE} Computer Society},
year = {1992},
url = {https://doi.org/10.1109/ICCD.1992.276215},
doi = {10.1109/ICCD.1992.276215},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccd/WhiteAMOTHKOW92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mam/Turner91,
author = {Stephen Turner},
title = {Introduction to image processing with the {A100}},
journal = {Microprocess. Microsystems},
volume = {15},
number = {4},
pages = {219--229},
year = {1991},
url = {https://doi.org/10.1016/0141-9331(91)90121-U},
doi = {10.1016/0141-9331(91)90121-U},
timestamp = {Tue, 25 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mam/Turner91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/FeldmannNDR91,
author = {Peter Feldmann and
Tuyen V. Nguyen and
Stephen W. Director and
Ronald A. Rohrer},
title = {Sensitivity computation in piecewise approximate circuit simulation},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {10},
number = {2},
pages = {171--183},
year = {1991},
url = {https://doi.org/10.1109/43.68404},
doi = {10.1109/43.68404},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcad/FeldmannNDR91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/GallivanJTVW91,
author = {Kyle A. Gallivan and
William Jalby and
Stephen W. Turner and
Alexander V. Veidenbaum and
Harry A. G. Wijshoff},
title = {Preliminary Performance Analysis of the Cedar Multiprocessor Memory
System},
booktitle = {Proceedings of the International Conference on Parallel Processing,
{ICPP} '91, Austin, Texas, USA, August 1991. Volume {I:} Architecture/Hardware},
pages = {71--75},
publisher = {{CRC} Press},
year = {1991},
timestamp = {Tue, 09 Jan 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpp/GallivanJTVW91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/KonicekTVZDDHSYFKLLPABMTW91,
author = {Jeff Konicek and
Tracy Tilton and
Alexander V. Veidenbaum and
Chuan{-}Qi Zhu and
Edward S. Davidson and
Ruppert A. Downing and
Michael J. Haney and
Manish Sharma and
Pen{-}Chung Yew and
P. Michael Farmwald and
David J. Kuck and
Daniel M. Lavery and
Robert A. Lindsey and
D. Pointer and
John T. Andrews and
Thomas Beck and
T. Murphy and
Stephen W. Turner and
Nancy J. Warter},
title = {The Organization of the Cedar System},
booktitle = {Proceedings of the International Conference on Parallel Processing,
{ICPP} '91, Austin, Texas, USA, August 1991. Volume {I:} Architecture/Hardware},
pages = {49--56},
publisher = {{CRC} Press},
year = {1991},
timestamp = {Mon, 28 Jul 2014 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icpp/KonicekTVZDDHSYFKLLPABMTW91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mie/FraserT91,
author = {Robert B. Fraser and
Stephen Z. Turney},
editor = {Klaus{-}Peter Adlassnig and
Georg Grabner and
Stellan Bengtsson and
Rolf Hansen},
title = {A Bayesian Approach to the Detection of Acute Disorders in a Respiratory
Intensive Care Unit},
booktitle = {Medical Informatics Europe 1991, Proceedings, Vienna, Austria, August
19-22, 1991},
series = {Lecture Notes in Medical Informatics},
volume = {45},
pages = {265--269},
publisher = {Springer},
year = {1991},
url = {https://doi.org/10.1007/978-3-642-93503-9\_47},
doi = {10.1007/978-3-642-93503-9\_47},
timestamp = {Wed, 31 May 2017 13:20:44 +0200},
biburl = {https://dblp.org/rec/conf/mie/FraserT91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mie/FraserWDTCRE91,
author = {Robert B. Fraser and
Aizik Wolf and
C. Michael Dunham and
Stephen Z. Turney and
Brad M. Cushing and
Ameen I. Ramzy and
James N. Eastham},
editor = {Klaus{-}Peter Adlassnig and
Georg Grabner and
Stellan Bengtsson and
Rolf Hansen},
title = {An Expert System for the Diagnosis, Treatment, and Triage of Head
Injuries in Remote Environments},
booktitle = {Medical Informatics Europe 1991, Proceedings, Vienna, Austria, August
19-22, 1991},
series = {Lecture Notes in Medical Informatics},
volume = {45},
pages = {275--279},
publisher = {Springer},
year = {1991},
url = {https://doi.org/10.1007/978-3-642-93503-9\_49},
doi = {10.1007/978-3-642-93503-9\_49},
timestamp = {Wed, 31 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mie/FraserWDTCRE91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/MarksteinMNP91,
author = {Victoria Markstein and
Peter W. Markstein and
Tung Nguyen and
Steve Poole},
editor = {Joanne L. Martin},
title = {Wide format floating-point math libraries},
booktitle = {Proceedings Supercomputing '91, Albuquerque, NM, USA, November 18-22,
1991},
pages = {130--138},
publisher = {{ACM}},
year = {1991},
url = {https://doi.org/10.1145/125826.125903},
doi = {10.1145/125826.125903},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/MarksteinMNP91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigada/BrosgolFGMRT91,
author = {Ben Brosgol and
Stephen Faris and
Marc H. Graham and
James W. Moore and
Jean{-}Pierre Rosen and
S. Tucker Taft},
editor = {Judy Bamberger},
title = {Ada and {SQL}},
booktitle = {Proceedings of the Conference on TRI-Ada 1991 - Today's Accomplishments;
Tomorrow's Expectations, TRI-Ada 1991, San Jose, California, USA,
October 21-25, 1991},
pages = {257--266},
publisher = {{ACM}},
year = {1991},
url = {https://doi.org/10.1145/126551.126578},
doi = {10.1145/126551.126578},
timestamp = {Mon, 09 May 2022 14:25:34 +0200},
biburl = {https://dblp.org/rec/conf/sigada/BrosgolFGMRT91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:tr/tum/TUM-I-9014,
author = {Stephen L. Bloom and
Zolt{\'{a}}n {\'{E}}sik and
Dirk Taubner},
title = {Iteration theories of synchronization trees},
journal = {Forschungsberichte, {TU} Munich},
volume = {{TUM} {I} 9014},
pages = {1--60},
year = {1990},
url = {https://d-nb.info/901424242},
timestamp = {Sun, 10 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/tr/tum/TUM-I-9014.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:tr/tum/TUM-I-9034,
author = {Stephen F. McCormick and
Ulrich R{\"{u}}de},
title = {On local refinement higher order methods for elliptic partial differential
equations},
journal = {Forschungsberichte, {TU} Munich},
volume = {{TUM} {I} 9034},
pages = {1--22},
year = {1990},
url = {https://d-nb.info/910513376},
timestamp = {Sun, 10 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/tr/tum/TUM-I-9034.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/FloydTD89,
author = {Stephen A. Floyd and
Charles F. Turner III and
K. Roscoe Davis},
title = {Model-based decision support systems: An effective implementation
framework},
journal = {Comput. Oper. Res.},
volume = {16},
number = {5},
pages = {481--491},
year = {1989},
url = {https://doi.org/10.1016/0305-0548(89)90035-X},
doi = {10.1016/0305-0548(89)90035-X},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cor/FloydTD89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccad/NguyenFDR89,
author = {Tuyen V. Nguyen and
Peter Feldmann and
Stephen W. Director and
Ronald A. Rohrer},
title = {{SPECS} simulation validation with efficient transient sensitivity
computation},
booktitle = {1989 {IEEE} International Conference on Computer-Aided Design, {ICCAD}
1989, Santa Clara, CA, USA, November 5-9, 1989. Digest of Technical
Papers},
pages = {252--255},
publisher = {{IEEE} Computer Society},
year = {1989},
url = {https://doi.org/10.1109/ICCAD.1989.76947},
doi = {10.1109/ICCAD.1989.76947},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccad/NguyenFDR89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/TanPTH88,
author = {Robert K.{-}Z. Tan and
M. Prabhakaran and
C. S. Tung and
Stephen C. Harvey},
title = {{AUGUR:} a program to predict, display and analyze the tertiary structure
of {B-DNA}},
journal = {Comput. Appl. Biosci.},
volume = {4},
number = {1},
pages = {147--151},
year = {1988},
url = {https://doi.org/10.1093/bioinformatics/4.1.147},
doi = {10.1093/BIOINFORMATICS/4.1.147},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/TanPTH88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ics/TezduyarGLNP88,
author = {T. E. Tezduyar and
Roland Glowinski and
J. Liou and
Tung Nguyen and
Steve Poole},
editor = {Jacques Lenfant},
title = {Block-iterative finite element computations for incompressible flow
problems},
booktitle = {Proceedings of the 2nd international conference on Supercomputing,
{ICS} 1988, Saint Malo, France, July 4-8, 1988},
pages = {284--294},
publisher = {{ACM}},
year = {1988},
url = {https://doi.org/10.1145/55364.55392},
doi = {10.1145/55364.55392},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ics/TezduyarGLNP88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ics/TurnerV88,
author = {Stephen W. Turner and
Alexander V. Veidenbaum},
editor = {Jacques Lenfant},
title = {Performance of a shared memory system for vector multiprocessors},
booktitle = {Proceedings of the 2nd international conference on Supercomputing,
{ICS} 1988, Saint Malo, France, July 4-8, 1988},
pages = {315--325},
publisher = {{ACM}},
year = {1988},
url = {https://doi.org/10.1145/55364.55395},
doi = {10.1145/55364.55395},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ics/TurnerV88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/air/RossDMBKTMSAMa87,
author = {Simon Ross and
Tony Dodd and
Wendy J. Milne and
Mervyn Bennun and
Elpida T. Keravnou and
Stephen John Turner and
Stephen J. Maskell and
Kathryn Seifert and
Chris Alphey and
Yasmin Merali and
Jason Cooper and
Saad A. Mehdi},
title = {Book reviews},
journal = {Artif. Intell. Rev.},
volume = {1},
number = {4},
pages = {275--295},
year = {1987},
url = {https://doi.org/10.1007/BF00142927},
doi = {10.1007/BF00142927},
timestamp = {Wed, 24 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/air/RossDMBKTMSAMa87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/MaloneGTBC87,
author = {Thomas W. Malone and
Kenneth R. Grant and
Franklyn A. Turbak and
Stephen A. Brobst and
Michael D. Cohen},
title = {Intelligent Information-Sharing Systems},
journal = {Commun. {ACM}},
volume = {30},
number = {5},
pages = {390--402},
year = {1987},
url = {https://doi.org/10.1145/22899.22903},
doi = {10.1145/22899.22903},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/MaloneGTBC87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/TungH86,
author = {C. S. Tung and
Stephen C. Harvey},
title = {Computer graphics program to reveal the dependence of the gross three-
dimensional structure of the {B-DNA} double helix on primary structure},
journal = {Nucleic Acids Res.},
volume = {14},
number = {1},
pages = {381--387},
year = {1986},
url = {https://doi.org/10.1093/nar/14.1.381},
doi = {10.1093/NAR/14.1.381},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/TungH86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spe/HortonT86,
author = {I. A. Horton and
Stephen John Turner},
title = {Using Coroutines in Pascal},
journal = {Softw. Pract. Exp.},
volume = {16},
number = {1},
pages = {45--61},
year = {1986},
url = {https://doi.org/10.1002/spe.4380160105},
doi = {10.1002/SPE.4380160105},
timestamp = {Fri, 05 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/spe/HortonT86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/TurnerO84,
author = {Stephen J. Turner and
Gregory O'Brien},
title = {A fuzzy set theory approach to periodical binding decisions},
journal = {J. Am. Soc. Inf. Sci.},
volume = {35},
number = {4},
pages = {228--234},
year = {1984},
url = {https://doi.org/10.1002/asi.4630350406},
doi = {10.1002/ASI.4630350406},
timestamp = {Wed, 13 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jasis/TurnerO84.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/MaibaumT84,
author = {T. S. E. Maibaum and
Wladyslaw M. Turski},
editor = {Terry A. Straeter and
William E. Howden and
Jean{-}Claude Rault},
title = {On What Exactly Is Going On When Software Is Developed Step-by-Step},
booktitle = {Proceedings, 7th International Conference on Software Engineering,
Orlando, Florida, USA, March 26-29, 1984},
pages = {528--533},
publisher = {{IEEE} Computer Society},
year = {1984},
url = {http://dl.acm.org/citation.cfm?id=802014},
timestamp = {Mon, 14 May 2012 18:17:12 +0200},
biburl = {https://dblp.org/rec/conf/icse/MaibaumT84.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/eh/campbell84/Turner84,
author = {Stephen John Turner},
editor = {John A. Campbell},
title = {W-Grammars for Logic Programming},
booktitle = {Implementations of Prolog.},
pages = {352--368},
publisher = {Ellis Horwood/Halsted Press/Wiley},
year = {1984},
timestamp = {Mon, 05 Aug 2019 16:47:22 +0200},
biburl = {https://dblp.org/rec/books/eh/campbell84/Turner84.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/RobinsonT81,
author = {Earl J. Robinson and
Stephen J. Turner},
title = {Improving library effectiveness: {A} proposal for applying fuzzy set
concepts in the management of large collections},
journal = {J. Am. Soc. Inf. Sci.},
volume = {32},
number = {6},
pages = {458--462},
year = {1981},
url = {https://doi.org/10.1002/asi.4630320610},
doi = {10.1002/ASI.4630320610},
timestamp = {Wed, 13 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jasis/RobinsonT81.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/TrueswellT79,
author = {Richard W. Trueswell and
Stephen J. Turner},
title = {Simulating circulation-use characteristic curves using circulation
data},
journal = {J. Am. Soc. Inf. Sci.},
volume = {30},
number = {2},
pages = {83--87},
year = {1979},
url = {https://doi.org/10.1002/asi.4630300204},
doi = {10.1002/ASI.4630300204},
timestamp = {Wed, 13 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jasis/TrueswellT79.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmsj/EhrsamMMT78,
author = {William R. Ehrsam and
Stephen M. Matyas and
Carl H. Meyer and
Walter L. Tuchman},
title = {A Cryptographic Key Management Scheme for Implementing the Data Encryption
Standard},
journal = {{IBM} Syst. J.},
volume = {17},
number = {2},
pages = {106--125},
year = {1978},
url = {https://doi.org/10.1147/sj.172.0106},
doi = {10.1147/SJ.172.0106},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmsj/EhrsamMMT78.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/Turner77,
author = {Stephen J. Turner},
title = {The identifier method of measuring use as applied to modeling the
circulation use of books from a university library},
journal = {J. Am. Soc. Inf. Sci.},
volume = {28},
number = {2},
pages = {96--100},
year = {1977},
url = {https://doi.org/10.1002/asi.4630280206},
doi = {10.1002/ASI.4630280206},
timestamp = {Wed, 13 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jasis/Turner77.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/TuftsLR76,
author = {Donald W. Tufts and
Stephen E. Levinson and
R. Rao},
title = {Measuring pitch and formant frequencies for a speech understanding
system},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} '76, Philadelphia, Pennsylvania, USA, April 12-14, 1976},
pages = {314--317},
publisher = {{IEEE}},
year = {1976},
url = {https://doi.org/10.1109/ICASSP.1976.1169986},
doi = {10.1109/ICASSP.1976.1169986},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icassp/TuftsLR76.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/afips/MathisCDMWFHHTW74,
author = {Robert F. Mathis and
Stephen R. Crocker and
Marvin Denicoff and
Victor Mitchell and
Frederick W. Weingarten and
Edward A. Feustel and
Lance J. Hoffman and
David K. Hsiao and
Rein Turn and
William A. Wulf},
title = {Research in data security: policies and projects},
booktitle = {American Federation of Information Processing Societies: 1974 National
Computer Conference, 6-10 May 1974, Chicago, Illinois, {USA}},
series = {{AFIPS} Conference Proceedings},
volume = {43},
pages = {993--999},
publisher = {{AFIPS} Press},
year = {1974},
url = {https://doi.org/10.1145/1500175.1500368},
doi = {10.1145/1500175.1500368},
timestamp = {Wed, 14 Apr 2021 16:50:07 +0200},
biburl = {https://dblp.org/rec/conf/afips/MathisCDMWFHHTW74.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-11-14 04:19 CET from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
