Search dblp for Publications

export results for "Stephen Tu"

 download as .bib file

@article{DBLP:journals/compsec/TuptukH24,
  author       = {Nilufer Tuptuk and
                  Stephen Hailes},
  title        = {Identifying vulnerabilities of industrial control systems using evolutionary
                  multiobjective optimisation},
  journal      = {Comput. Secur.},
  volume       = {137},
  pages        = {103593},
  year         = {2024},
  url          = {https://doi.org/10.1016/j.cose.2023.103593},
  doi          = {10.1016/J.COSE.2023.103593},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/compsec/TuptukH24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fcomp/TurnerMU24,
  author       = {Adam Brian Turner and
                  Stephen James McCombie and
                  Allon J. Uhlmann},
  title        = {Editorial: The impacts of cyber threat in the maritime ecosystem},
  journal      = {Frontiers Comput. Sci.},
  volume       = {6},
  year         = {2024},
  url          = {https://doi.org/10.3389/fcomp.2024.1378160},
  doi          = {10.3389/FCOMP.2024.1378160},
  timestamp    = {Mon, 08 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/fcomp/TurnerMU24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmlr/TuFS24,
  author       = {Stephen Tu and
                  Roy Frostig and
                  Mahdi Soltanolkotabi},
  title        = {Learning from many trajectories},
  journal      = {J. Mach. Learn. Res.},
  volume       = {25},
  pages        = {216:1--216:109},
  year         = {2024},
  url          = {https://jmlr.org/papers/v25/23-1145.html},
  timestamp    = {Mon, 16 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jmlr/TuFS24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jors/PetropoulosLAAAABBBBBCCCCCCDDDEEEF24,
  author       = {Fotios Petropoulos and
                  Gilbert Laporte and
                  Emel Aktas and
                  Sibel A. Alumur and
                  Claudia Archetti and
                  Hayriye Ayhan and
                  Maria Battarra and
                  Julia A. Bennell and
                  Jean{-}Marie Bourjolly and
                  John E. Boylan and
                  Mich{\`{e}}le Breton and
                  David Canca and
                  Laurent Charlin and
                  Bo Chen and
                  Cihan Tugrul Cicek and
                  Louis Anthony Cox and
                  Christine S. M. Currie and
                  Erik Demeulemeester and
                  Li Ding and
                  Stephen M. Disney and
                  Matthias Ehrgott and
                  Martin J. Eppler and
                  G{\"{u}}nes Erdogan and
                  Bernard Fortz and
                  L. Alberto Franco and
                  Jens Frische and
                  Salvatore Greco and
                  Amanda J. Gregory and
                  Raimo P. H{\"{a}}m{\"{a}}l{\"{a}}inen and
                  Willy Herroelen and
                  Mike Hewitt and
                  Jan Holmstr{\"{o}}m and
                  John N. Hooker and
                  Tug{\c{c}}e Isik and
                  Jill Johnes and
                  Bahar Yetis Kara and
                  {\"{O}}zlem Karsu and
                  Katherine Kent and
                  Charlotte K{\"{o}}hler and
                  Martin H. Kunc and
                  Yong{-}Hong Kuo and
                  Adam N. Letchford and
                  Janny Leung and
                  Dong Li and
                  Haitao Li and
                  Judit Lienert and
                  Ivana Ljubic and
                  Andrea Lodi and
                  Sebasti{\'{a}}n Lozano and
                  Virginie Lurkin and
                  Silvano Martello and
                  Ian G. McHale and
                  Gerald Midgley and
                  John D. W. Morecroft and
                  Akshay Mutha and
                  Ceyda Oguz and
                  Sanja Petrovic and
                  Ulrich Pferschy and
                  Harilaos N. Psaraftis and
                  Sam Rose and
                  Lauri Saarinen and
                  Sa{\"{\i}}d Salhi and
                  Jing{-}Sheng Song and
                  Dimitrios Sotiros and
                  Kathryn E. Stecke and
                  Arne K. Strauss and
                  Isten{\c{c}} Tarhan and
                  Clemens Thielen and
                  Paolo Toth and
                  Tom Van Woensel and
                  Greet Vanden Berghe and
                  Christos Vasilakis and
                  Vikrant Vaze and
                  Daniele Vigo and
                  Kai Virtanen and
                  Xun Wang and
                  Rafal Weron and
                  Leroy White and
                  Mike Yearworth and
                  E. Alper Yildirim and
                  Georges Zaccour and
                  Xuying Zhao},
  title        = {Operational Research: methods and applications},
  journal      = {J. Oper. Res. Soc.},
  volume       = {75},
  number       = {3},
  pages        = {423--617},
  year         = {2024},
  url          = {https://doi.org/10.1080/01605682.2023.2253852},
  doi          = {10.1080/01605682.2023.2253852},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jors/PetropoulosLAAAABBBBBCCCCCCDDDEEEF24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NishiPTCSZTNWDG24,
  author       = {Yoshinori Nishi and
                  John W. Poulton and
                  Walker J. Turner and
                  Xi Chen and
                  Sanquan Song and
                  Brian Zimmer and
                  Stephen G. Tell and
                  Nikola Nedovic and
                  John M. Wilson and
                  William J. Dally and
                  C. Thomas Gray},
  title        = {A 0.190-pJ/bit 25.2-Gb/s/wire Inverter-Based AC-Coupled Transceiver
                  for Short-Reach Die-to-Die Interfaces in 5-nm {CMOS}},
  journal      = {{IEEE} J. Solid State Circuits},
  volume       = {59},
  number       = {4},
  pages        = {1146--1157},
  year         = {2024},
  url          = {https://doi.org/10.1109/JSSC.2023.3338478},
  doi          = {10.1109/JSSC.2023.3338478},
  timestamp    = {Mon, 15 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jssc/NishiPTCSZTNWDG24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/qmi/TullSZC24,
  author       = {Sean Tull and
                  Razin A. Shaikh and
                  Sara Sabrina Zemljic and
                  Stephen Clark},
  title        = {From conceptual spaces to quantum concepts: formalising and learning
                  structured conceptual models},
  journal      = {Quantum Mach. Intell.},
  volume       = {6},
  number       = {1},
  pages        = {21},
  year         = {2024},
  url          = {https://doi.org/10.1007/s42484-023-00134-z},
  doi          = {10.1007/S42484-023-00134-Z},
  timestamp    = {Mon, 29 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/qmi/TullSZC24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/BelyaevaGWWCSA24,
  author       = {Irina Belyaeva and
                  Ben Gabrielson and
                  Yu{-}Ping Wang and
                  Tony W. Wilson and
                  Vince D. Calhoun and
                  Julia M. Stephen and
                  T{\"{u}}lay Adali},
  title        = {Learning Spatiotemporal Brain Dynamics in Adolescents via Multimodal
                  {MEG} and fMRI Data Fusion Using Joint Tensor/Matrix Decomposition},
  journal      = {{IEEE} Trans. Biomed. Eng.},
  volume       = {71},
  number       = {7},
  pages        = {2189--2200},
  year         = {2024},
  url          = {https://doi.org/10.1109/TBME.2024.3364704},
  doi          = {10.1109/TBME.2024.3364704},
  timestamp    = {Fri, 02 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tbe/BelyaevaGWWCSA24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/DrummondTD24,
  author       = {Ross Drummond and
                  Matthew C. Turner and
                  Stephen R. Duncan},
  title        = {Reduced-Order Neural Network Synthesis With Robustness Guarantees},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {35},
  number       = {1},
  pages        = {1182--1191},
  year         = {2024},
  url          = {https://doi.org/10.1109/TNNLS.2022.3182893},
  doi          = {10.1109/TNNLS.2022.3182893},
  timestamp    = {Fri, 26 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnn/DrummondTD24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvt/AiZKXNT24,
  author       = {Zhengyang Ai and
                  Weiting Zhang and
                  Jiawen Kang and
                  Minrui Xu and
                  Dusit Niyato and
                  Stephen John Turner},
  title        = {Identifier-Driven Resource Orchestration With Quantum Computing for
                  Differentiated Services in IoT-MMEC Networks},
  journal      = {{IEEE} Trans. Veh. Technol.},
  volume       = {73},
  number       = {7},
  pages        = {9958--9971},
  year         = {2024},
  url          = {https://doi.org/10.1109/TVT.2024.3364210},
  doi          = {10.1109/TVT.2024.3364210},
  timestamp    = {Thu, 22 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tvt/AiZKXNT24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/CurryTCMKSHS24,
  author       = {Michael J. Curry and
                  Vinzenz Thoma and
                  Darshan Chakrabarti and
                  Stephen McAleer and
                  Christian Kroer and
                  Tuomas Sandholm and
                  Niao He and
                  Sven Seuken},
  editor       = {Michael J. Wooldridge and
                  Jennifer G. Dy and
                  Sriraam Natarajan},
  title        = {Automated Design of Affine Maximizer Mechanisms in Dynamic Settings},
  booktitle    = {Thirty-Eighth {AAAI} Conference on Artificial Intelligence, {AAAI}
                  2024, Thirty-Sixth Conference on Innovative Applications of Artificial
                  Intelligence, {IAAI} 2024, Fourteenth Symposium on Educational Advances
                  in Artificial Intelligence, {EAAI} 2014, February 20-27, 2024, Vancouver,
                  Canada},
  pages        = {9626--9635},
  publisher    = {{AAAI} Press},
  year         = {2024},
  url          = {https://doi.org/10.1609/aaai.v38i9.28819},
  doi          = {10.1609/AAAI.V38I9.28819},
  timestamp    = {Tue, 02 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/aaai/CurryTCMKSHS24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eucnc/FayeCSSFBCDFFKMMPPST24,
  author       = {S{\'{e}}bastien Faye and
                  Miguel Camelo and
                  Jean{-}S{\'{e}}bastien Sottet and
                  Christoph Sommer and
                  Mario Franke and
                  Julien Baudouin and
                  German Castellanos and
                  R{\'{e}}gis Decorme and
                  Maria Pia Fanti and
                  Ramin Fuladi and
                  Gunes Kesik and
                  Beatriz Mendes and
                  Chris Murphy and
                  Stephen Parker and
                  Simon Pryor and
                  Sidi Mohammed Senouci and
                  Ion Turcanu},
  title        = {Integrating Network Digital Twinning into Future AI-based 6G Systems:
                  The 6G-TWIN Vision},
  booktitle    = {Joint European Conference on Networks and Communications {\&}
                  6G Summit, EuCNC/6G Summit 2024, Antwerp, Belgium, June 3-6, 2024},
  pages        = {883--888},
  publisher    = {{IEEE}},
  year         = {2024},
  url          = {https://doi.org/10.1109/EuCNC/6GSummit60053.2024.10597058},
  doi          = {10.1109/EUCNC/6GSUMMIT60053.2024.10597058},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/eucnc/FayeCSSFBCDFFKMMPPST24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/Belyaeva0WCSA24,
  author       = {Irina Belyaeva and
                  Yu{-}Ping Wang and
                  Tony W. Wilson and
                  Vince D. Calhoun and
                  Julia M. Stephen and
                  T{\"{u}}lay Adali},
  title        = {Assessing Pediatric Cognitive Development via Multisensory Brain Imaging
                  Analysis},
  booktitle    = {32nd European Signal Processing Conference, {EUSIPCO} 2024, Lyon,
                  France, August 26-30, 2024},
  pages        = {1362--1366},
  publisher    = {{IEEE}},
  year         = {2024},
  url          = {https://ieeexplore.ieee.org/document/10714926},
  timestamp    = {Wed, 06 Nov 2024 15:31:16 +0100},
  biburl       = {https://dblp.org/rec/conf/eusipco/Belyaeva0WCSA24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/EloLTV24,
  author       = {Jenny Elo and
                  Juuli Lumivalo and
                  Tuure Tuunanen and
                  Stephen L. Vargo},
  editor       = {Tung X. Bui},
  title        = {Enabling Value Co-Creation in Partner Collaboration Ecosystems: An
                  Institutional Work Perspective},
  booktitle    = {57th Hawaii International Conference on System Sciences, {HICSS} 2024,
                  Hilton Hawaiian Village Waikiki Beach Resort, Hawaii, USA, January
                  3-6, 2024},
  pages        = {308--317},
  publisher    = {ScholarSpace},
  year         = {2024},
  url          = {https://hdl.handle.net/10125/106412},
  timestamp    = {Thu, 04 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/hicss/EloLTV24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hri/JansenMHTYBWL24,
  author       = {Chipp Jansen and
                  Zhengtao Ma and
                  Lissy Hatfield and
                  Boyuan Tuo and
                  Elif Ozden Yenigun and
                  Sharon Baurley and
                  Stephen Jia Wang and
                  Kun{-}Pyo Lee},
  editor       = {Dan Grollman and
                  Elizabeth Broadbent and
                  Wendy Ju and
                  Harold Soh and
                  Tom Williams},
  title        = {Textile Robotic Interaction for Designer-Robot Collaboration},
  booktitle    = {Companion of the 2024 {ACM/IEEE} International Conference on Human-Robot
                  Interaction, {HRI} 2024, Boulder, CO, USA, March 11-15, 2024},
  pages        = {563--567},
  publisher    = {{ACM}},
  year         = {2024},
  url          = {https://doi.org/10.1145/3610978.3640722},
  doi          = {10.1145/3610978.3640722},
  timestamp    = {Mon, 01 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/hri/JansenMHTYBWL24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/XieTSELZ24,
  author       = {Rong Xie and
                  Anqi Tu and
                  Chuang Shi and
                  Stephen Elliott and
                  Huiyong Li and
                  Le Zhang},
  title        = {Cognitive Virtual Sensing Technique for Feedforward Active Noise Control},
  booktitle    = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
                  {ICASSP} 2024, Seoul, Republic of Korea, April 14-19, 2024},
  pages        = {981--985},
  publisher    = {{IEEE}},
  year         = {2024},
  url          = {https://doi.org/10.1109/ICASSP48485.2024.10446463},
  doi          = {10.1109/ICASSP48485.2024.10446463},
  timestamp    = {Mon, 05 Aug 2024 15:26:37 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/XieTSELZ24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/LiangSZLESHM24,
  author       = {Yongyuan Liang and
                  Yanchao Sun and
                  Ruijie Zheng and
                  Xiangyu Liu and
                  Benjamin Eysenbach and
                  Tuomas Sandholm and
                  Furong Huang and
                  Stephen Marcus McAleer},
  title        = {Game-Theoretic Robust Reinforcement Learning Handles Temporally-Coupled
                  Perturbations},
  booktitle    = {The Twelfth International Conference on Learning Representations,
                  {ICLR} 2024, Vienna, Austria, May 7-11, 2024},
  publisher    = {OpenReview.net},
  year         = {2024},
  url          = {https://openreview.net/forum?id=wZWTHU7AsQ},
  timestamp    = {Wed, 07 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iclr/LiangSZLESHM24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/McAleerLWBSF24,
  author       = {Stephen Marcus McAleer and
                  JB Lanier and
                  Kevin A. Wang and
                  Pierre Baldi and
                  Tuomas Sandholm and
                  Roy Fox},
  title        = {Toward Optimal Policy Population Growth in Two-Player Zero-Sum Games},
  booktitle    = {The Twelfth International Conference on Learning Representations,
                  {ICLR} 2024, Vienna, Austria, May 7-11, 2024},
  publisher    = {OpenReview.net},
  year         = {2024},
  url          = {https://openreview.net/forum?id=J2TZgj3Tac},
  timestamp    = {Wed, 07 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iclr/McAleerLWBSF24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/MoskovitzSSSSDM24,
  author       = {Ted Moskovitz and
                  Aaditya K. Singh and
                  DJ Strouse and
                  Tuomas Sandholm and
                  Ruslan Salakhutdinov and
                  Anca D. Dragan and
                  Stephen Marcus McAleer},
  title        = {Confronting Reward Model Overoptimization with Constrained {RLHF}},
  booktitle    = {The Twelfth International Conference on Learning Representations,
                  {ICLR} 2024, Vienna, Austria, May 7-11, 2024},
  publisher    = {OpenReview.net},
  year         = {2024},
  url          = {https://openreview.net/forum?id=gkfUvn0fLU},
  timestamp    = {Mon, 29 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iclr/MoskovitzSSSSDM24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/LiPGYBGLDGMHLJL24,
  author       = {Nathaniel Li and
                  Alexander Pan and
                  Anjali Gopal and
                  Summer Yue and
                  Daniel Berrios and
                  Alice Gatti and
                  Justin D. Li and
                  Ann{-}Kathrin Dombrowski and
                  Shashwat Goel and
                  Gabriel Mukobi and
                  Nathan Helm{-}Burger and
                  Rassin Lababidi and
                  Lennart Justen and
                  Andrew B. Liu and
                  Michael Chen and
                  Isabelle Barrass and
                  Oliver Zhang and
                  Xiaoyuan Zhu and
                  Rishub Tamirisa and
                  Bhrugu Bharathi and
                  Ariel Herbert{-}Voss and
                  Cort B. Breuer and
                  Andy Zou and
                  Mantas Mazeika and
                  Zifan Wang and
                  Palash Oswal and
                  Weiran Lin and
                  Adam A. Hunt and
                  Justin Tienken{-}Harder and
                  Kevin Y. Shih and
                  Kemper Talley and
                  John Guan and
                  Ian Steneker and
                  David Campbell and
                  Brad Jokubaitis and
                  Steven Basart and
                  Stephen Fitz and
                  Ponnurangam Kumaraguru and
                  Kallol Krishna Karmakar and
                  Uday Kiran Tupakula and
                  Vijay Varadharajan and
                  Yan Shoshitaishvili and
                  Jimmy Ba and
                  Kevin M. Esvelt and
                  Alexandr Wang and
                  Dan Hendrycks},
  title        = {The {WMDP} Benchmark: Measuring and Reducing Malicious Use with Unlearning},
  booktitle    = {Forty-first International Conference on Machine Learning, {ICML} 2024,
                  Vienna, Austria, July 21-27, 2024},
  publisher    = {OpenReview.net},
  year         = {2024},
  url          = {https://openreview.net/forum?id=xlr6AUDuJz},
  timestamp    = {Mon, 02 Sep 2024 16:45:29 +0200},
  biburl       = {https://dblp.org/rec/conf/icml/LiPGYBGLDGMHLJL24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/TuDCGG24,
  author       = {Weijie Tu and
                  Weijian Deng and
                  Dylan Campbell and
                  Stephen Gould and
                  Tom Gedeon},
  title        = {An Empirical Study Into What Matters for Calibrating Vision-Language
                  Models},
  booktitle    = {Forty-first International Conference on Machine Learning, {ICML} 2024,
                  Vienna, Austria, July 21-27, 2024},
  publisher    = {OpenReview.net},
  year         = {2024},
  url          = {https://openreview.net/forum?id=qoxuPshrZb},
  timestamp    = {Mon, 02 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icml/TuDCGG24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/ZiemannTPM24,
  author       = {Ingvar M. Ziemann and
                  Stephen Tu and
                  George J. Pappas and
                  Nikolai Matni},
  title        = {Sharp Rates in Dependent Learning Theory: Avoiding Sample Size Deflation
                  for the Square Loss},
  booktitle    = {Forty-first International Conference on Machine Learning, {ICML} 2024,
                  Vienna, Austria, July 21-27, 2024},
  publisher    = {OpenReview.net},
  year         = {2024},
  url          = {https://openreview.net/forum?id=DHtF8Y6PqS},
  timestamp    = {Mon, 02 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icml/ZiemannTPM24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/ONeillRMGPLPGMJ24,
  author       = {Abby O'Neill and
                  Abdul Rehman and
                  Abhiram Maddukuri and
                  Abhishek Gupta and
                  Abhishek Padalkar and
                  Abraham Lee and
                  Acorn Pooley and
                  Agrim Gupta and
                  Ajay Mandlekar and
                  Ajinkya Jain and
                  Albert Tung and
                  Alex Bewley and
                  Alexander Herzog and
                  Alex Irpan and
                  Alexander Khazatsky and
                  Anant Rai and
                  Anchit Gupta and
                  Andrew Wang and
                  Anikait Singh and
                  Animesh Garg and
                  Aniruddha Kembhavi and
                  Annie Xie and
                  Anthony Brohan and
                  Antonin Raffin and
                  Archit Sharma and
                  Arefeh Yavary and
                  Arhan Jain and
                  Ashwin Balakrishna and
                  Ayzaan Wahid and
                  Ben Burgess{-}Limerick and
                  Beomjoon Kim and
                  Bernhard Sch{\"{o}}lkopf and
                  Blake Wulfe and
                  Brian Ichter and
                  Cewu Lu and
                  Charles Xu and
                  Charlotte Le and
                  Chelsea Finn and
                  Chen Wang and
                  Chenfeng Xu and
                  Cheng Chi and
                  Chenguang Huang and
                  Christine Chan and
                  Christopher Agia and
                  Chuer Pan and
                  Chuyuan Fu and
                  Coline Devin and
                  Danfei Xu and
                  Daniel Morton and
                  Danny Driess and
                  Daphne Chen and
                  Deepak Pathak and
                  Dhruv Shah and
                  Dieter B{\"{u}}chler and
                  Dinesh Jayaraman and
                  Dmitry Kalashnikov and
                  Dorsa Sadigh and
                  Edward Johns and
                  Ethan Paul Foster and
                  Fangchen Liu and
                  Federico Ceola and
                  Fei Xia and
                  Feiyu Zhao and
                  Freek Stulp and
                  Gaoyue Zhou and
                  Gaurav S. Sukhatme and
                  Gautam Salhotra and
                  Ge Yan and
                  Gilbert Feng and
                  Giulio Schiavi and
                  Glen Berseth and
                  Gregory Kahn and
                  Guanzhi Wang and
                  Hao Su and
                  Haoshu Fang and
                  Haochen Shi and
                  Henghui Bao and
                  Heni Ben Amor and
                  Henrik I. Christensen and
                  Hiroki Furuta and
                  Homer Walke and
                  Hongjie Fang and
                  Huy Ha and
                  Igor Mordatch and
                  Ilija Radosavovic and
                  Isabel Leal and
                  Jacky Liang and
                  Jad Abou{-}Chakra and
                  Jaehyung Kim and
                  Jaimyn Drake and
                  Jan Peters and
                  Jan Schneider and
                  Jasmine Hsu and
                  Jeannette Bohg and
                  Jeffrey Bingham and
                  Jeffrey Wu and
                  Jensen Gao and
                  Jiaheng Hu and
                  Jiajun Wu and
                  Jialin Wu and
                  Jiankai Sun and
                  Jianlan Luo and
                  Jiayuan Gu and
                  Jie Tan and
                  Jihoon Oh and
                  Jimmy Wu and
                  Jingpei Lu and
                  Jingyun Yang and
                  Jitendra Malik and
                  Jo{\~{a}}o Silv{\'{e}}rio and
                  Joey Hejna and
                  Jonathan Booher and
                  Jonathan Tompson and
                  Jonathan Yang and
                  Jordi Salvador and
                  Joseph J. Lim and
                  Junhyek Han and
                  Kaiyuan Wang and
                  Kanishka Rao and
                  Karl Pertsch and
                  Karol Hausman and
                  Keegan Go and
                  Keerthana Gopalakrishnan and
                  Ken Goldberg and
                  Kendra Byrne and
                  Kenneth Oslund and
                  Kento Kawaharazuka and
                  Kevin Black and
                  Kevin Lin and
                  Kevin Zhang and
                  Kiana Ehsani and
                  Kiran Lekkala and
                  Kirsty Ellis and
                  Krishan Rana and
                  Krishnan Srinivasan and
                  Kuan Fang and
                  Kunal Pratap Singh and
                  Kuo{-}Hao Zeng and
                  Kyle Hatch and
                  Kyle Hsu and
                  Laurent Itti and
                  Lawrence Yunliang Chen and
                  Lerrel Pinto and
                  Li Fei{-}Fei and
                  Liam Tan and
                  Linxi Jim Fan and
                  Lionel Ott and
                  Lisa Lee and
                  Luca Weihs and
                  Magnum Chen and
                  Marion Lepert and
                  Marius Memmel and
                  Masayoshi Tomizuka and
                  Masha Itkina and
                  Mateo Guaman Castro and
                  Max Spero and
                  Maximilian Du and
                  Michael Ahn and
                  Michael C. Yip and
                  Mingtong Zhang and
                  Mingyu Ding and
                  Minho Heo and
                  Mohan Kumar Srirama and
                  Mohit Sharma and
                  Moo Jin Kim and
                  Naoaki Kanazawa and
                  Nicklas Hansen and
                  Nicolas Heess and
                  Nikhil J. Joshi and
                  Niko S{\"{u}}nderhauf and
                  Ning Liu and
                  Norman Di Palo and
                  Nur Muhammad (Mahi) Shafiullah and
                  Oier Mees and
                  Oliver Kroemer and
                  Osbert Bastani and
                  Pannag R. Sanketi and
                  Patrick Tree Miller and
                  Patrick Yin and
                  Paul Wohlhart and
                  Peng Xu and
                  Peter David Fagan and
                  Peter Mitrano and
                  Pierre Sermanet and
                  Pieter Abbeel and
                  Priya Sundaresan and
                  Qiuyu Chen and
                  Quan Vuong and
                  Rafael Rafailov and
                  Ran Tian and
                  Ria Doshi and
                  Roberto Mart{\'{\i}}n{-}Mart{\'{\i}}n and
                  Rohan Baijal and
                  Rosario Scalise and
                  Rose Hendrix and
                  Roy Lin and
                  Runjia Qian and
                  Ruohan Zhang and
                  Russell Mendonca and
                  Rutav Shah and
                  Ryan Hoque and
                  Ryan Julian and
                  Samuel Bustamante and
                  Sean Kirmani and
                  Sergey Levine and
                  Shan Lin and
                  Sherry Moore and
                  Shikhar Bahl and
                  Shivin Dass and
                  Shubham D. Sonawani and
                  Shuran Song and
                  Sichun Xu and
                  Siddhant Haldar and
                  Siddharth Karamcheti and
                  Simeon Adebola and
                  Simon Guist and
                  Soroush Nasiriany and
                  Stefan Schaal and
                  Stefan Welker and
                  Stephen Tian and
                  Subramanian Ramamoorthy and
                  Sudeep Dasari and
                  Suneel Belkhale and
                  Sungjae Park and
                  Suraj Nair and
                  Suvir Mirchandani and
                  Takayuki Osa and
                  Tanmay Gupta and
                  Tatsuya Harada and
                  Tatsuya Matsushima and
                  Ted Xiao and
                  Thomas Kollar and
                  Tianhe Yu and
                  Tianli Ding and
                  Todor Davchev and
                  Tony Z. Zhao and
                  Travis Armstrong and
                  Trevor Darrell and
                  Trinity Chung and
                  Vidhi Jain and
                  Vincent Vanhoucke and
                  Wei Zhan and
                  Wenxuan Zhou and
                  Wolfram Burgard and
                  Xi Chen and
                  Xiaolong Wang and
                  Xinghao Zhu and
                  Xinyang Geng and
                  Xiyuan Liu and
                  Liangwei Xu and
                  Xuanlin Li and
                  Yao Lu and
                  Yecheng Jason Ma and
                  Yejin Kim and
                  Yevgen Chebotar and
                  Yifan Zhou and
                  Yifeng Zhu and
                  Yilin Wu and
                  Ying Xu and
                  Yixuan Wang and
                  Yonatan Bisk and
                  Yoonyoung Cho and
                  Youngwoon Lee and
                  Yuchen Cui and
                  Yue Cao and
                  Yueh{-}Hua Wu and
                  Yujin Tang and
                  Yuke Zhu and
                  Yunchu Zhang and
                  Yunfan Jiang and
                  Yunshuang Li and
                  Yunzhu Li and
                  Yusuke Iwasawa and
                  Yutaka Matsuo and
                  Zehan Ma and
                  Zhuo Xu and
                  Zichen Jeff Cui and
                  Zichen Zhang and
                  Zipeng Lin},
  title        = {Open X-Embodiment: Robotic Learning Datasets and {RT-X} Models : Open
                  X-Embodiment Collaboration},
  booktitle    = {{IEEE} International Conference on Robotics and Automation, {ICRA}
                  2024, Yokohama, Japan, May 13-17, 2024},
  pages        = {6892--6903},
  publisher    = {{IEEE}},
  year         = {2024},
  url          = {https://doi.org/10.1109/ICRA57147.2024.10611477},
  doi          = {10.1109/ICRA57147.2024.10611477},
  timestamp    = {Tue, 12 Nov 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icra/ONeillRMGPLPGMJ24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/InceBDFG24,
  author       = {Turker Ince and
                  Steven Beninati and
                  Ozer Can Devecioglu and
                  Stephen J. Frasier and
                  Moncef Gabbouj},
  title        = {Water Region Segmentation in {SAR} Images Based on Compact Operational
                  Unets},
  booktitle    = {{IGARSS} 2024 - 2024 {IEEE} International Geoscience and Remote Sensing
                  Symposium, Athens, Greece, July 7-12, 2024},
  pages        = {8237--8241},
  publisher    = {{IEEE}},
  year         = {2024},
  url          = {https://doi.org/10.1109/IGARSS53475.2024.10641981},
  doi          = {10.1109/IGARSS53475.2024.10641981},
  timestamp    = {Thu, 26 Sep 2024 12:36:11 +0200},
  biburl       = {https://dblp.org/rec/conf/igarss/InceBDFG24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/0001ZCDM0SS24,
  author       = {Paul Friedrich and
                  Yulun Zhang and
                  Michael J. Curry and
                  Ludwig Dierks and
                  Stephen McAleer and
                  Jiaoyang Li and
                  Tuomas Sandholm and
                  Sven Seuken},
  title        = {Scalable Mechanism Design for Multi-Agent Path Finding},
  booktitle    = {Proceedings of the Thirty-Third International Joint Conference on
                  Artificial Intelligence, {IJCAI} 2024, Jeju, South Korea, August 3-9,
                  2024},
  pages        = {58--66},
  publisher    = {ijcai.org},
  year         = {2024},
  url          = {https://www.ijcai.org/proceedings/2024/7},
  timestamp    = {Fri, 25 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ijcai/0001ZCDM0SS24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/memea/BuchananTCMF24,
  author       = {Russell Buchanan and
                  Shihfan Jack Tu and
                  Marco Camurri and
                  Stephen J. Mellon and
                  Maurice F. Fallon},
  title        = {3D Freehand Ultrasound using Visual Inertial and Deep Inertial Odometry
                  for Measuring Patellar Tracking},
  booktitle    = {{IEEE} International Symposium on Medical Measurements and Applications,
                  MeMeA 2024, Eindhoven, The Netherlands, June 26-28, 2024},
  pages        = {1--6},
  publisher    = {{IEEE}},
  year         = {2024},
  url          = {https://doi.org/10.1109/MeMeA60663.2024.10596905},
  doi          = {10.1109/MEMEA60663.2024.10596905},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/memea/BuchananTCMF24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mie/TurnerIGBSHHOVK24,
  author       = {Jonathan Turner and
                  Sin{\'{e}}ad Impey and
                  Frances Gibbons and
                  Anthony M. Bolger and
                  Gaye Stephens and
                  Lucy Hederman and
                  Ramisa Hamed and
                  Ciara O'Meara and
                  Ferran de la Varga and
                  John Kommala and
                  Matthew Nicholson and
                  Daniel Farrell and
                  Miriam Galvin and
                  Mark Heverin and
                  {\'{E}}anna Mac Domhnaill and
                  Robert McFarlane and
                  Dara Meldrum and
                  Deirdre Murray and
                  Orla Hardiman},
  editor       = {John Mantas and
                  Arie Hasman and
                  George Demiris and
                  Kaija Saranto and
                  Michael Marschollek and
                  Theodoros N. Arvanitis and
                  Ivana Ognjanovic and
                  Arriel Benis and
                  Parisis Gallos and
                  Emmanouil Zoulias and
                  Elisavet Andrikopoulou},
  title        = {Data and Process Harmonisation of Multi-National, Multi-Site Research
                  Data},
  booktitle    = {Digital Health and Informatics Innovations for Sustainable Health
                  Care Systems - Proceedings of {MIE} 2024, Athens, Greece, 25-29 August
                  2024},
  series       = {Studies in Health Technology and Informatics},
  volume       = {316},
  pages        = {1411--1412},
  publisher    = {{IOS} Press},
  year         = {2024},
  url          = {https://doi.org/10.3233/SHTI240675},
  doi          = {10.3233/SHTI240675},
  timestamp    = {Tue, 15 Oct 2024 14:17:47 +0200},
  biburl       = {https://dblp.org/rec/conf/mie/TurnerIGBSHHOVK24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigdial/TuPMFCDC24,
  author       = {Sichang Tu and
                  Abigail Powers and
                  Natalie Merrill and
                  Negar Fani and
                  Sierra Carter and
                  Stephen Doogan and
                  Jinho D. Choi},
  editor       = {Tatsuya Kawahara and
                  Vera Demberg and
                  Stefan Ultes and
                  Koji Inoue and
                  Shikib Mehri and
                  David M. Howcroft and
                  Kazunori Komatani},
  title        = {Automating {PTSD} Diagnostics in Clinical Interviews: Leveraging Large
                  Language Models for Trauma Assessments},
  booktitle    = {Proceedings of the 25th Annual Meeting of the Special Interest Group
                  on Discourse and Dialogue, {SIGDIAL} 2024, Kyoto, Japan, September
                  18 - 20, 2024},
  pages        = {644--663},
  publisher    = {Association for Computational Linguistics},
  year         = {2024},
  url          = {https://aclanthology.org/2024.sigdial-1.55},
  timestamp    = {Fri, 04 Oct 2024 16:06:14 +0200},
  biburl       = {https://dblp.org/rec/conf/sigdial/TuPMFCDC24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/VyasMPHKWZDLKMP24,
  author       = {Pratik B. Vyas and
                  Ludovico Megalini and
                  Ashish Pal and
                  Joshua Holt and
                  Archana Kumar and
                  Stephen Weeks and
                  Charisse Zhao and
                  Lucien Date and
                  Hansel Lo and
                  Michel Khoury and
                  Safdar Muhammad and
                  Fabian Piallat and
                  Ricky Fang and
                  William Charles and
                  Pratim Palit and
                  Jinghe Yang and
                  Qintao Zhang and
                  Jang Seok Oh and
                  Bryan Turner and
                  Samphy Hong and
                  Aswin Prathap Pitchiya and
                  Benjamin Briggs and
                  Jiao Yang and
                  Dae Yang and
                  Fengshou Wang and
                  Joseph Lee and
                  Gopal Prabhu and
                  Dustin Ho and
                  Carlos Caballero and
                  Durga Chaturvedula and
                  Zheng Yuan and
                  Yi Zheng and
                  David A. Britz and
                  Stephen Krause and
                  Raghav Sreenivasan and
                  Michael Chudzik and
                  Subi Kengeri and
                  Siddarth A. Krishnan and
                  El Mehdi Bazizi},
  title        = {Novel Material, Process and Device Innovations for Next Generation
                  Silicon Carbide (SiC) Trench {MOSFET} Technology},
  booktitle    = {{IEEE} Symposium on {VLSI} Technology and Circuits 2024, Honolulu,
                  HI, USA, June 16-20, 2024},
  pages        = {1--2},
  publisher    = {{IEEE}},
  year         = {2024},
  url          = {https://doi.org/10.1109/VLSITechnologyandCir46783.2024.10631445},
  doi          = {10.1109/VLSITECHNOLOGYANDCIR46783.2024.10631445},
  timestamp    = {Fri, 18 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/vlsit/VyasMPHKWZDLKMP24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/VuGHCI24,
  author       = {Tung T. Vu and
                  Swaroop Gopalam and
                  Stephen V. Hanly and
                  Iain B. Collings and
                  Hazer Inaltekin},
  title        = {Minimizing Clearing Time in mmWave Networks with Overlapping Coverage},
  booktitle    = {99th {IEEE} Vehicular Technology Conference, {VTC} Spring 2024, Singapore,
                  June 24-27, 2024},
  pages        = {1--6},
  publisher    = {{IEEE}},
  year         = {2024},
  url          = {https://doi.org/10.1109/VTC2024-Spring62846.2024.10683319},
  doi          = {10.1109/VTC2024-SPRING62846.2024.10683319},
  timestamp    = {Mon, 07 Oct 2024 22:58:56 +0200},
  biburl       = {https://dblp.org/rec/conf/vtc/VuGHCI24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-08585,
  author       = {Sean Tull and
                  Razin A. Shaikh and
                  Sara Sabrina Zemljic and
                  Stephen Clark},
  title        = {From Conceptual Spaces to Quantum Concepts: Formalising and Learning
                  Structured Conceptual Models},
  journal      = {CoRR},
  volume       = {abs/2401.08585},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2401.08585},
  doi          = {10.48550/ARXIV.2401.08585},
  eprinttype    = {arXiv},
  eprint       = {2401.08585},
  timestamp    = {Wed, 07 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2401-08585.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-17044,
  author       = {Paul Friedrich and
                  Yulun Zhang and
                  Michael J. Curry and
                  Ludwig Dierks and
                  Stephen McAleer and
                  Jiaoyang Li and
                  Tuomas Sandholm and
                  Sven Seuken},
  title        = {Scalable Mechanism Design for Multi-Agent Path Finding},
  journal      = {CoRR},
  volume       = {abs/2401.17044},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2401.17044},
  doi          = {10.48550/ARXIV.2401.17044},
  eprinttype    = {arXiv},
  eprint       = {2401.17044},
  timestamp    = {Fri, 25 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2401-17044.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-05928,
  author       = {Ingvar M. Ziemann and
                  Stephen Tu and
                  George J. Pappas and
                  Nikolai Matni},
  title        = {Sharp Rates in Dependent Learning Theory: Avoiding Sample Size Deflation
                  for the Square Loss},
  journal      = {CoRR},
  volume       = {abs/2402.05928},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2402.05928},
  doi          = {10.48550/ARXIV.2402.05928},
  eprinttype    = {arXiv},
  eprint       = {2402.05928},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2402-05928.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-07417,
  author       = {Weijie Tu and
                  Weijian Deng and
                  Dylan Campbell and
                  Stephen Gould and
                  Tom Gedeon},
  title        = {An Empirical Study Into What Matters for Calibrating Vision-Language
                  Models},
  journal      = {CoRR},
  volume       = {abs/2402.07417},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2402.07417},
  doi          = {10.48550/ARXIV.2402.07417},
  eprinttype    = {arXiv},
  eprint       = {2402.07417},
  timestamp    = {Fri, 16 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2402-07417.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-08129,
  author       = {Michael J. Curry and
                  Vinzenz Thoma and
                  Darshan Chakrabarti and
                  Stephen McAleer and
                  Christian Kroer and
                  Tuomas Sandholm and
                  Niao He and
                  Sven Seuken},
  title        = {Automated Design of Affine Maximizer Mechanisms in Dynamic Settings},
  journal      = {CoRR},
  volume       = {abs/2402.08129},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2402.08129},
  doi          = {10.48550/ARXIV.2402.08129},
  eprinttype    = {arXiv},
  eprint       = {2402.08129},
  timestamp    = {Mon, 19 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2402-08129.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-03218,
  author       = {Nathaniel Li and
                  Alexander Pan and
                  Anjali Gopal and
                  Summer Yue and
                  Daniel Berrios and
                  Alice Gatti and
                  Justin D. Li and
                  Ann{-}Kathrin Dombrowski and
                  Shashwat Goel and
                  Long Phan and
                  Gabriel Mukobi and
                  Nathan Helm{-}Burger and
                  Rassin Lababidi and
                  Lennart Justen and
                  Andrew B. Liu and
                  Michael Chen and
                  Isabelle Barrass and
                  Oliver Zhang and
                  Xiaoyuan Zhu and
                  Rishub Tamirisa and
                  Bhrugu Bharathi and
                  Adam Khoja and
                  Zhenqi Zhao and
                  Ariel Herbert{-}Voss and
                  Cort B. Breuer and
                  Andy Zou and
                  Mantas Mazeika and
                  Zifan Wang and
                  Palash Oswal and
                  Weiran Liu and
                  Adam A. Hunt and
                  Justin Tienken{-}Harder and
                  Kevin Y. Shih and
                  Kemper Talley and
                  John Guan and
                  Russell Kaplan and
                  Ian Steneker and
                  David Campbell and
                  Brad Jokubaitis and
                  Alex Levinson and
                  Jean Wang and
                  William Qian and
                  Kallol Krishna Karmakar and
                  Steven Basart and
                  Stephen Fitz and
                  Mindy Levine and
                  Ponnurangam Kumaraguru and
                  Uday Kiran Tupakula and
                  Vijay Varadharajan and
                  Yan Shoshitaishvili and
                  Jimmy Ba and
                  Kevin M. Esvelt and
                  Alexandr Wang and
                  Dan Hendrycks},
  title        = {The {WMDP} Benchmark: Measuring and Reducing Malicious Use With Unlearning},
  journal      = {CoRR},
  volume       = {abs/2403.03218},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2403.03218},
  doi          = {10.48550/ARXIV.2403.03218},
  eprinttype    = {arXiv},
  eprint       = {2403.03218},
  timestamp    = {Tue, 20 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2403-03218.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-07953,
  author       = {Geonhwa Jeong and
                  Po{-}An Tsai and
                  Abhimanyu Rajeshkumar Bambhaniya and
                  Stephen W. Keckler and
                  Tushar Krishna},
  title        = {Abstracting Sparse {DNN} Acceleration via Structured Sparse Tensor
                  Decomposition},
  journal      = {CoRR},
  volume       = {abs/2403.07953},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2403.07953},
  doi          = {10.48550/ARXIV.2403.07953},
  eprinttype    = {arXiv},
  eprint       = {2403.07953},
  timestamp    = {Thu, 04 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2403-07953.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-09097,
  author       = {Naifeng Zhang and
                  Stephen McAleer and
                  Tuomas Sandholm},
  title        = {Faster Game Solving via Hyperparameter Schedules},
  journal      = {CoRR},
  volume       = {abs/2404.09097},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2404.09097},
  doi          = {10.48550/ARXIV.2404.09097},
  eprinttype    = {arXiv},
  eprint       = {2404.09097},
  timestamp    = {Wed, 15 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2404-09097.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-09932,
  author       = {Usman Anwar and
                  Abulhair Saparov and
                  Javier Rando and
                  Daniel Paleka and
                  Miles Turpin and
                  Peter Hase and
                  Ekdeep Singh Lubana and
                  Erik Jenner and
                  Stephen Casper and
                  Oliver Sourbut and
                  Benjamin L. Edelman and
                  Zhaowei Zhang and
                  Mario G{\"{u}}nther and
                  Anton Korinek and
                  Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
                  Lewis Hammond and
                  Eric J. Bigelow and
                  Alexander Pan and
                  Lauro Langosco and
                  Tomasz Korbak and
                  Heidi Zhang and
                  Ruiqi Zhong and
                  Se{\'{a}}n {\'{O}} h{\'{E}}igeartaigh and
                  Gabriel Recchia and
                  Giulio Corsi and
                  Alan Chan and
                  Markus Anderljung and
                  Lilian Edwards and
                  Yoshua Bengio and
                  Danqi Chen and
                  Samuel Albanie and
                  Tegan Maharaj and
                  Jakob N. Foerster and
                  Florian Tram{\`{e}}r and
                  He He and
                  Atoosa Kasirzadeh and
                  Yejin Choi and
                  David Krueger},
  title        = {Foundational Challenges in Assuring Alignment and Safety of Large
                  Language Models},
  journal      = {CoRR},
  volume       = {abs/2404.09932},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2404.09932},
  doi          = {10.48550/ARXIV.2404.09932},
  eprinttype    = {arXiv},
  eprint       = {2404.09932},
  timestamp    = {Wed, 07 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2404-09932.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-15847,
  author       = {Russell Buchanan and
                  Shihfan Jack Tu and
                  Marco Camurri and
                  Stephen J. Mellon and
                  Maurice F. Fallon},
  title        = {3D Freehand Ultrasound using Visual Inertial and Deep Inertial Odometry
                  for Measuring Patellar Tracking},
  journal      = {CoRR},
  volume       = {abs/2404.15847},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2404.15847},
  doi          = {10.48550/ARXIV.2404.15847},
  eprinttype    = {arXiv},
  eprint       = {2404.15847},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2404-15847.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-11178,
  author       = {Sichang Tu and
                  Abigail Powers and
                  Natalie Merrill and
                  Negar Fani and
                  Sierra Carter and
                  Stephen Doogan and
                  Jinho D. Choi},
  title        = {Automating {PTSD} Diagnostics in Clinical Interviews: Leveraging Large
                  Language Models for Trauma Assessments},
  journal      = {CoRR},
  volume       = {abs/2405.11178},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2405.11178},
  doi          = {10.48550/ARXIV.2405.11178},
  eprinttype    = {arXiv},
  eprint       = {2405.11178},
  timestamp    = {Wed, 12 Jun 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2405-11178.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2406-13868,
  author       = {Geonhwa Jeong and
                  Po{-}An Tsai and
                  Stephen W. Keckler and
                  Tushar Krishna},
  title        = {{SDQ:} Sparse Decomposed Quantization for {LLM} Inference},
  journal      = {CoRR},
  volume       = {abs/2406.13868},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2406.13868},
  doi          = {10.48550/ARXIV.2406.13868},
  eprinttype    = {arXiv},
  eprint       = {2406.13868},
  timestamp    = {Fri, 12 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2406-13868.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2406-17583,
  author       = {Sean Tull and
                  Robin Lorenz and
                  Stephen Clark and
                  Ilyas Khan and
                  Bob Coecke},
  title        = {Towards Compositional Interpretability for {XAI}},
  journal      = {CoRR},
  volume       = {abs/2406.17583},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2406.17583},
  doi          = {10.48550/ARXIV.2406.17583},
  eprinttype    = {arXiv},
  eprint       = {2406.17583},
  timestamp    = {Mon, 22 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2406-17583.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2409-12382,
  author       = {Paul Lutkus and
                  Deepika Anantharaman and
                  Stephen Tu and
                  Lars Lindemann},
  title        = {Incremental Composition of Learned Control Barrier Functions in Unknown
                  Environments},
  journal      = {CoRR},
  volume       = {abs/2409.12382},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2409.12382},
  doi          = {10.48550/ARXIV.2409.12382},
  eprinttype    = {arXiv},
  eprint       = {2409.12382},
  timestamp    = {Thu, 17 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2409-12382.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/TurnerKGU23,
  author       = {Stephen W. Turner and
                  Murat Karakus and
                  Evrim Guler and
                  Suleyman Uludag},
  title        = {A Promising Integration of {SDN} and Blockchain for IoT Networks:
                  {A} Survey},
  journal      = {{IEEE} Access},
  volume       = {11},
  pages        = {29800--29822},
  year         = {2023},
  url          = {https://doi.org/10.1109/ACCESS.2023.3260777},
  doi          = {10.1109/ACCESS.2023.3260777},
  timestamp    = {Sat, 29 Apr 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/TurnerKGU23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/CoudertGCPBNSRBBAAAABBNB23,
  author       = {Elisabeth Coudert and
                  Sebastien Gehant and
                  Edouard De Castro and
                  Monica Pozzato and
                  Delphine Baratin and
                  Teresa Batista Neto and
                  Christian J. A. Sigrist and
                  Nicole Redaschi and
                  Alan J. Bridge and
                  Lucila Aimo and
                  Ghislaine Argoud{-}Puy and
                  Andrea H. Auchincloss and
                  Kristian B. Axelsen and
                  Parit Bansal and
                  Marie{-}Claude Blatter and
                  Jerven T. Bolleman and
                  Emmanuel Boutet and
                  Lionel Breuza and
                  Blanca Cabrera Gil and
                  Cristina Casals{-}Casas and
                  Kamal Chikh Echioukh and
                  B{\'{e}}atrice A. Cuche and
                  Anne Estreicher and
                  Maria Livia Famiglietti and
                  Marc Feuermann and
                  Elisabeth Gasteiger and
                  Pascale Gaudet and
                  Vivienne Baillie Gerritsen and
                  Arnaud Gos and
                  Nadine Gruaz{-}Gumowski and
                  Chantal Hulo and
                  Nevila Hyka{-}Nouspikel and
                  Florence Jungo and
                  Arnaud Kerhornou and
                  Philippe Le Mercier and
                  Damien Lieberherr and
                  Patrick Masson and
                  Anne Morgat and
                  Venkatesh Muthukrishnan and
                  Salvo Paesano and
                  Ivo Pedruzzi and
                  Sandrine Pilbout and
                  Lucille Pourcel and
                  Sylvain Poux and
                  Manuela Pruess and
                  Catherine Rivoire and
                  Karin Sonesson and
                  Shyamala Sundaram and
                  Alex Bateman and
                  Maria Jesus Martin and
                  Sandra E. Orchard and
                  Michele Magrane and
                  Shadab Ahmad and
                  Emanuele Alpi and
                  Emily H. Bowler{-}Barnett and
                  Ramona Britto and
                  Hema Bye{-}A{-}Jee and
                  Austra Cukura and
                  Paul Denny and
                  Tunca Dogan and
                  Thankgod Ebenezer and
                  Jun Fan and
                  Penelope Garmiri and
                  Leonardo Jose da Costa Gonzales and
                  Emma Hatton{-}Ellis and
                  Abdulrahman Hussein and
                  Alexandr Ignatchenko and
                  Giuseppe Insana and
                  Rizwan Ishtiaq and
                  Vishal Joshi and
                  Dushyanth Jyothi and
                  Swaathi Kandasamy and
                  Antonia Lock and
                  Aurelien Luciani and
                  Marija Lugaric and
                  Jie Luo and
                  Yvonne Lussi and
                  Alistair MacDougall and
                  F{\'{a}}bio Madeira and
                  Mahdi Mahmoudy and
                  Alok Mishra and
                  Katie Moulang and
                  Andrew Nightingale and
                  Sangya Pundir and
                  Guoying Qi and
                  Shriya Raj and
                  Pedro Raposo and
                  Daniel Rice and
                  Rabie Saidi and
                  Rafael Santos and
                  Elena Speretta and
                  James D. Stephenson and
                  Prabhat Totoo and
                  Edward Turner and
                  Nidhi Tyagi and
                  Preethi Vasudev and
                  Kate Warner and
                  Xavier Watkins and
                  Rossana Zaru and
                  Hermann Zellner and
                  Cathy H. Wu and
                  Cecilia N. Arighi and
                  Leslie Arminski and
                  Chuming Chen and
                  Yongxing Chen and
                  Hongzhan Huang and
                  Kati Laiho and
                  Peter B. McGarvey and
                  Darren A. Natale and
                  Karen Ross and
                  C. R. Vinayaka and
                  Qinghua Wang and
                  Yuqi Wang},
  title        = {Annotation of biologically relevant ligands in UniProtKB using ChEBI},
  journal      = {Bioinform.},
  volume       = {39},
  number       = {1},
  year         = {2023},
  url          = {https://doi.org/10.1093/bioinformatics/btac793},
  doi          = {10.1093/BIOINFORMATICS/BTAC793},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/bioinformatics/CoudertGCPBNSRBBAAAABBNB23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cphysics/FattebertDPT23,
  author       = {Jean{-}Luc Fattebert and
                  Stephen Dewitt and
                  Aurelien Perron and
                  John Turner},
  title        = {Thermo4PFM: Facilitating Phase-field simulations of alloys with thermodynamic
                  driving forces},
  journal      = {Comput. Phys. Commun.},
  volume       = {288},
  pages        = {108739},
  year         = {2023},
  url          = {https://doi.org/10.1016/j.cpc.2023.108739},
  doi          = {10.1016/J.CPC.2023.108739},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cphysics/FattebertDPT23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csm/GuoNRSORYSKIB23,
  author       = {Jianlin Guo and
                  Yukimasa Nagai and
                  Benjamin A. Rolfe and
                  Takenori Sumi and
                  Philip V. Orlik and
                  Joerg Robert and
                  Kazuto Yano and
                  Steve Shellhammer and
                  Shoichi Kitazawa and
                  Yasuhiko Inoue and
                  Tuncer Baykas},
  title        = {{IEEE} 802.19.3 Coexistence Recommendations for {IEEE} 802.11 and
                  {IEEE} 802.15.4 Based Systems Operating in {SUB-1} GHz Frequency Bands},
  journal      = {{IEEE} Commun. Stand. Mag.},
  volume       = {7},
  number       = {2},
  pages        = {72--82},
  year         = {2023},
  url          = {https://doi.org/10.1109/MCOMSTD.0009.2100046},
  doi          = {10.1109/MCOMSTD.0009.2100046},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/csm/GuoNRSORYSKIB23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/KeletiLLLR23,
  author       = {Tam{\'{a}}s Keleti and
                  Stephen Lacina and
                  Changshuo Liu and
                  Mengzhen Liu and
                  Jos{\'{e}} Ram{\'{o}}n Tuir{\'{a}}n Rangel},
  title        = {Tiling of rectangles with squares and related problems via Diophantine
                  approximation},
  journal      = {Discret. Math.},
  volume       = {346},
  number       = {9},
  pages        = {113442},
  year         = {2023},
  url          = {https://doi.org/10.1016/j.disc.2023.113442},
  doi          = {10.1016/J.DISC.2023.113442},
  timestamp    = {Tue, 12 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/dm/KeletiLLLR23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fini/WangAABDHKLMMPRSTWWT23,
  author       = {Lei Wang and
                  Jos{\'{e}} Luis Ambite and
                  Abhishek M. Appaji and
                  Janine Bijsterbosch and
                  J{\'{e}}r{\^{o}}me Dock{\`{e}}s and
                  Rick Herrick and
                  Alexander Kogan and
                  Howard Lander and
                  Daniel S. Marcus and
                  Stephen Moore and
                  Jean{-}Baptiste Poline and
                  Arcot Rajasekar and
                  Satya S. Sahoo and
                  Matthew D. Turner and
                  Xiaochen Wang and
                  Yue Wang and
                  Jessica A. Turner},
  title        = {NeuroBridge: a prototype platform for discovery of the long-tail neuroimaging
                  data},
  journal      = {Frontiers Neuroinformatics},
  volume       = {17},
  year         = {2023},
  url          = {https://doi.org/10.3389/fninf.2023.1215261},
  doi          = {10.3389/FNINF.2023.1215261},
  timestamp    = {Tue, 13 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/fini/WangAABDHKLMMPRSTWWT23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieeesp/TurnerMU23,
  author       = {Adam Brian Turner and
                  Stephen McCombie and
                  Allon J. Uhlmann},
  title        = {Ransomware-Bitcoin Threat Intelligence Sharing Using Structured Threat
                  Information Expression},
  journal      = {{IEEE} Secur. Priv.},
  volume       = {21},
  number       = {3},
  pages        = {47--57},
  year         = {2023},
  url          = {https://doi.org/10.1109/MSEC.2022.3166282},
  doi          = {10.1109/MSEC.2022.3166282},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ieeesp/TurnerMU23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ior/AravenaMZPCTWWW23,
  author       = {Ignacio Aravena and
                  Daniel K. Molzahn and
                  Shixuan Zhang and
                  Cosmin G. Petra and
                  Frank E. Curtis and
                  Shenyinying Tu and
                  Andreas W{\"{a}}chter and
                  Ermin Wei and
                  Elizabeth Wong and
                  Amin Gholami and
                  Kaizhao Sun and
                  Xu Andy Sun and
                  Stephen T. Elbert and
                  Jesse Holzer and
                  Arun Veeramany},
  title        = {Recent Developments in Security-Constrained {AC} Optimal Power Flow:
                  Overview of Challenge 1 in the {ARPA-E} Grid Optimization Competition},
  journal      = {Oper. Res.},
  volume       = {71},
  number       = {6},
  pages        = {1997--2014},
  year         = {2023},
  url          = {https://doi.org/10.1287/opre.2022.0315},
  doi          = {10.1287/OPRE.2022.0315},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ior/AravenaMZPCTWWW23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/YangVSTG23,
  author       = {Siyue Yang and
                  Paul Varghese and
                  Ellen Stephenson and
                  Karen Tu and
                  Jessica L. Gronsbell},
  title        = {Machine learning approaches for electronic health records phenotyping:
                  a methodical review},
  journal      = {J. Am. Medical Informatics Assoc.},
  volume       = {30},
  number       = {2},
  pages        = {367--381},
  year         = {2023},
  url          = {https://doi.org/10.1093/jamia/ocac216},
  doi          = {10.1093/JAMIA/OCAC216},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jamia/YangVSTG23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/WoenselTMAAABCEHRKKMMMPRTWP23,
  author       = {William Van Woensel and
                  Samson W. Tu and
                  Wojtek Michalowski and
                  Syed Sibte Raza Abidi and
                  Samina Abidi and
                  Jos{\'{e}} Ram{\'{o}}n Alonso and
                  Alessio Bottrighi and
                  Marc Carrier and
                  Ruth Edry and
                  Irit Hochberg and
                  Malvika Rao and
                  Stephen P. Kingwell and
                  Alexandra Kogan and
                  Mar Marcos and
                  Bego{\~{n}}a Mart{\'{\i}}nez{-}Salvador and
                  Martin Michalowski and
                  Luca Piovesan and
                  David Ria{\~{n}}o and
                  Paolo Terenziani and
                  Szymon Wilk and
                  Mor Peleg},
  title        = {A community-of-practice-based evaluation methodology for knowledge
                  intensive computational methods and its application to multimorbidity
                  decision support},
  journal      = {J. Biomed. Informatics},
  volume       = {142},
  pages        = {104395},
  year         = {2023},
  url          = {https://doi.org/10.1016/j.jbi.2023.104395},
  doi          = {10.1016/J.JBI.2023.104395},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jbi/WoenselTMAAABCEHRKKMMMPRTWP23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/NishiPTCSZTNWDG23,
  author       = {Yoshinori Nishi and
                  John W. Poulton and
                  Walker J. Turner and
                  Xi Chen and
                  Sanquan Song and
                  Brian Zimmer and
                  Stephen G. Tell and
                  Nikola Nedovic and
                  John M. Wilson and
                  William J. Dally and
                  C. Thomas Gray},
  title        = {A 0.297-pJ/Bit 50.4-Gb/s/Wire Inverter-Based Short-Reach Simultaneous
                  Bi-Directional Transceiver for Die-to-Die Interface in 5-nm {CMOS}},
  journal      = {{IEEE} J. Solid State Circuits},
  volume       = {58},
  number       = {4},
  pages        = {1062--1073},
  year         = {2023},
  url          = {https://doi.org/10.1109/JSSC.2022.3232024},
  doi          = {10.1109/JSSC.2022.3232024},
  timestamp    = {Sat, 29 Apr 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jssc/NishiPTCSZTNWDG23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/KelleherSMYMSNJVSHSPBEMO23,
  author       = {Keith J. Kelleher and
                  Timothy Sheils and
                  Stephen L. Mathias and
                  Jeremy J. Yang and
                  Vincent T. Metzger and
                  Vishal B. Siramshetty and
                  Dac{-}Trung Nguyen and
                  Lars Juhl Jensen and
                  Dusica Vidovic and
                  Stephan C. Sch{\"{u}}rer and
                  Jayme Holmes and
                  Karlie R. Sharma and
                  Ajay Pillai and
                  Cristian Bologa and
                  Jeremy S. Edwards and
                  Ewy A. Math{\'{e}} and
                  Tudor I. Oprea},
  title        = {Pharos 2023: an integrated resource for the understudied human proteome},
  journal      = {Nucleic Acids Res.},
  volume       = {51},
  number       = {{D1}},
  pages        = {1405--1416},
  year         = {2023},
  url          = {https://doi.org/10.1093/nar/gkac1033},
  doi          = {10.1093/NAR/GKAC1033},
  timestamp    = {Tue, 08 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/KelleherSMYMSNJVSHSPBEMO23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/MartinAAAABBBBBBBBLBRCCfDDDHNFGGGMG23,
  author       = {Fergal J. Martin and
                  M. Ridwan Amode and
                  Alisha Aneja and
                  Olanrewaju Austine{-}Orimoloye and
                  Andrey G. Azov and
                  If Barnes and
                  Arne Becker and
                  Ruth Bennett and
                  Andrew E. Berry and
                  Jyothish Bhai and
                  Simarpreet Kaur Bhurji and
                  Alexandra Bignell and
                  Sanjay Boddu and
                  Paulo R. B. Lins and
                  Lucy Brooks and
                  Shashank Budhanuru Ramaraju and
                  Mehrnaz Charkhchi and
                  Alexander Cockburn and
                  Luca Da Rin Fioretto and
                  Claire Davidson and
                  Kamalkumar Jayantilal Dodiya and
                  Sarah M. Donaldson and
                  Bilal El Houdaigui and
                  Tamara El Naboulsi and
                  Reham Fatima and
                  Carlos Garc{\'{\i}}a{-}Gir{\'{o}}n and
                  Thiago Augusto Lopes Genez and
                  Gurpreet S. Ghattaoraya and
                  Jose Gonzalez Martinez and
                  Cristi Guijarro and
                  Matthew Hardy and
                  Zoe Hollis and
                  Thibaut Hourlier and
                  Toby Hunt and
                  Mike P. Kay and
                  Vinay Kaykala and
                  Tuan Le and
                  Diana Lemos and
                  Diego Marques{-}Coelho and
                  Jos{\'{e}} Carlos Marug{\'{a}}n and
                  Gabriela Alejandra Merino and
                  Louisse Paola Mirabueno and
                  Aleena Mushtaq and
                  Syed Nakib Hossain and
                  Denye N. Ogeh and
                  Manoj Pandian Sakthivel and
                  Anne Parker and
                  Malcolm Perry and
                  Ivana Pilizota and
                  Irina Prosovetskaia and
                  Jos{\'{e}} G. P{\'{e}}rez{-}Silva and
                  Ahamed Imran Abdul Salam and
                  Nuno Saraiva{-}Agostinho and
                  Helen Schuilenburg and
                  Dan Sheppard and
                  Swati Sinha and
                  Botond Sipos and
                  William Stark and
                  Emily Steed and
                  Ranjit Sukumaran and
                  Dulika Sumathipala and
                  Marie{-}Marthe Suner and
                  Likhitha Surapaneni and
                  Ky{\"{o}}sti Sutinen and
                  Michal Szpak and
                  Francesca Floriana Tricomi and
                  David Urbina{-}G{\'{o}}mez and
                  Andres Veidenberg and
                  Thomas A. Walsh and
                  Brandon Walts and
                  Elizabeth Wass and
                  Natalie L. Willhoft and
                  Jamie Allen and
                  Jorge {\'{A}}lvarez{-}Jarreta and
                  Marc Chakiachvili and
                  Bethany Flint and
                  Stefano Giorgetti and
                  Leanne Haggerty and
                  Garth R Ilsley and
                  Jane E. Loveland and
                  Benjamin Moore and
                  Jonathan M. Mudge and
                  John G. Tate and
                  David Thybert and
                  Stephen J. Trevanion and
                  Andrea Winterbottom and
                  Adam Frankish and
                  Sarah E. Hunt and
                  Magali Ruffier and
                  Fiona Cunningham and
                  Sarah Dyer and
                  Robert D. Finn and
                  Kevin L. Howe and
                  Peter W. Harrison and
                  Andrew D. Yates and
                  Paul Flicek},
  title        = {Ensembl 2023},
  journal      = {Nucleic Acids Res.},
  volume       = {51},
  number       = {{D1}},
  pages        = {933--941},
  year         = {2023},
  url          = {https://doi.org/10.1093/nar/gkac958},
  doi          = {10.1093/NAR/GKAC958},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/MartinAAAABBBBBBBBLBRCCfDDDHNFGGGMG23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/MankowitzMZGSPL23,
  author       = {Daniel J. Mankowitz and
                  Andrea Michi and
                  Anton Zhernov and
                  Marco Gelmi and
                  Marco Selvi and
                  Cosmin Paduraru and
                  Edouard Leurent and
                  Shariq Iqbal and
                  Jean{-}Baptiste Lespiau and
                  Alex Ahern and
                  Thomas K{\"{o}}ppe and
                  Kevin Millikin and
                  Stephen Gaffney and
                  Sophie Elster and
                  Jackson Broshear and
                  Chris Gamble and
                  Kieran Milan and
                  Robert Tung and
                  Minjae Hwang and
                  A. Taylan Cemgil and
                  Mohammadamin Barekatain and
                  Yujia Li and
                  Amol Mandhane and
                  Thomas Hubert and
                  Julian Schrittwieser and
                  Demis Hassabis and
                  Pushmeet Kohli and
                  Martin A. Riedmiller and
                  Oriol Vinyals and
                  David Silver},
  title        = {Faster sorting algorithms discovered using deep reinforcement learning},
  journal      = {Nat.},
  volume       = {618},
  number       = {7964},
  pages        = {257--263},
  year         = {2023},
  url          = {https://doi.org/10.1038/s41586-023-06004-9},
  doi          = {10.1038/S41586-023-06004-9},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nature/MankowitzMZGSPL23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/BelyaevaGWWCSA23,
  author       = {Irina Belyaeva and
                  Ben Gabrielson and
                  Yu{-}Ping Wang and
                  Tony W. Wilson and
                  Vince D. Calhoun and
                  Julia M. Stephen and
                  T{\"{u}}lay Adali},
  title        = {Multi-Subject Analysis for Brain Developmental Patterns Discovery
                  via Tensor Decomposition of {MEG} Data},
  journal      = {Neuroinformatics},
  volume       = {21},
  number       = {1},
  pages        = {115--141},
  year         = {2023},
  url          = {https://doi.org/10.1007/s12021-022-09599-y},
  doi          = {10.1007/S12021-022-09599-Y},
  timestamp    = {Mon, 28 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ni/BelyaevaGWWCSA23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/BelyaevaGWWCSA23a,
  author       = {Irina Belyaeva and
                  Ben Gabrielson and
                  Yu{-}Ping Wang and
                  Tony W. Wilson and
                  Vince D. Calhoun and
                  Julia M. Stephen and
                  T{\"{u}}lay Adali},
  title        = {Correction to: Multi-Subject Analysis for Brain Developmental Patterns
                  Discovery via Tensor Decomposition of {MEG} Data},
  journal      = {Neuroinformatics},
  volume       = {21},
  number       = {1},
  pages        = {143},
  year         = {2023},
  url          = {https://doi.org/10.1007/s12021-023-09620-y},
  doi          = {10.1007/S12021-023-09620-Y},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ni/BelyaevaGWWCSA23a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/KelaherMMSMTB23,
  author       = {Brendan P. Kelaher and
                  Kim I. Monteforte and
                  Stephen G. Morris and
                  Thomas A. Schlacher and
                  Duane T. March and
                  James P. Tucker and
                  Paul A. Butcher},
  title        = {Drone-Based Assessment of Marine Megafauna off Wave-Exposed Sandy
                  Beaches},
  journal      = {Remote. Sens.},
  volume       = {15},
  number       = {16},
  pages        = {4018},
  year         = {2023},
  url          = {https://doi.org/10.3390/rs15164018},
  doi          = {10.3390/RS15164018},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/remotesensing/KelaherMMSMTB23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/TurnerHS23,
  author       = {Alexander P. Turner and
                  Stephen Hayes and
                  Don Sharkey},
  title        = {The Classification of Movement in Infants for the Autonomous Monitoring
                  of Neurological Development},
  journal      = {Sensors},
  volume       = {23},
  number       = {10},
  pages        = {4800},
  year         = {2023},
  url          = {https://doi.org/10.3390/s23104800},
  doi          = {10.3390/S23104800},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sensors/TurnerHS23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/BassSSWSTAFGSR23,
  author       = {Cher Bass and
                  Mariana da Silva and
                  Carole H. Sudre and
                  Logan Z. J. Williams and
                  Helena S. Sousa and
                  Petru{-}Daniel Tudosiu and
                  Fidel Alfaro{-}Almagro and
                  Sean P. Fitzgibbon and
                  Matthew F. Glasser and
                  Stephen M. Smith and
                  Emma C. Robinson},
  title        = {ICAM-Reg: Interpretable Classification and Regression With Feature
                  Attribution for Mapping Neurological Phenotypes in Individual Scans},
  journal      = {{IEEE} Trans. Medical Imaging},
  volume       = {42},
  number       = {4},
  pages        = {959--970},
  year         = {2023},
  url          = {https://doi.org/10.1109/TMI.2022.3221890},
  doi          = {10.1109/TMI.2022.3221890},
  timestamp    = {Thu, 27 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tmi/BassSSWSTAFGSR23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmlr/SrivastavaRRSAF23,
  author       = {Aarohi Srivastava and
                  Abhinav Rastogi and
                  Abhishek Rao and
                  Abu Awal Md Shoeb and
                  Abubakar Abid and
                  Adam Fisch and
                  Adam R. Brown and
                  Adam Santoro and
                  Aditya Gupta and
                  Adri{\`{a}} Garriga{-}Alonso and
                  Agnieszka Kluska and
                  Aitor Lewkowycz and
                  Akshat Agarwal and
                  Alethea Power and
                  Alex Ray and
                  Alex Warstadt and
                  Alexander W. Kocurek and
                  Ali Safaya and
                  Ali Tazarv and
                  Alice Xiang and
                  Alicia Parrish and
                  Allen Nie and
                  Aman Hussain and
                  Amanda Askell and
                  Amanda Dsouza and
                  Ambrose Slone and
                  Ameet Rahane and
                  Anantharaman S. Iyer and
                  Anders Andreassen and
                  Andrea Madotto and
                  Andrea Santilli and
                  Andreas Stuhlm{\"{u}}ller and
                  Andrew M. Dai and
                  Andrew La and
                  Andrew K. Lampinen and
                  Andy Zou and
                  Angela Jiang and
                  Angelica Chen and
                  Anh Vuong and
                  Animesh Gupta and
                  Anna Gottardi and
                  Antonio Norelli and
                  Anu Venkatesh and
                  Arash Gholamidavoodi and
                  Arfa Tabassum and
                  Arul Menezes and
                  Arun Kirubarajan and
                  Asher Mullokandov and
                  Ashish Sabharwal and
                  Austin Herrick and
                  Avia Efrat and
                  Aykut Erdem and
                  Ayla Karakas and
                  B. Ryan Roberts and
                  Bao Sheng Loe and
                  Barret Zoph and
                  Bartlomiej Bojanowski and
                  Batuhan {\"{O}}zyurt and
                  Behnam Hedayatnia and
                  Behnam Neyshabur and
                  Benjamin Inden and
                  Benno Stein and
                  Berk Ekmekci and
                  Bill Yuchen Lin and
                  Blake Howald and
                  Bryan Orinion and
                  Cameron Diao and
                  Cameron Dour and
                  Catherine Stinson and
                  Cedrick Argueta and
                  C{\`{e}}sar Ferri Ram{\'{\i}}rez and
                  Chandan Singh and
                  Charles Rathkopf and
                  Chenlin Meng and
                  Chitta Baral and
                  Chiyu Wu and
                  Chris Callison{-}Burch and
                  Chris Waites and
                  Christian Voigt and
                  Christopher D. Manning and
                  Christopher Potts and
                  Cindy Ramirez and
                  Clara E. Rivera and
                  Clemencia Siro and
                  Colin Raffel and
                  Courtney Ashcraft and
                  Cristina Garbacea and
                  Damien Sileo and
                  Dan Garrette and
                  Dan Hendrycks and
                  Dan Kilman and
                  Dan Roth and
                  Daniel Freeman and
                  Daniel Khashabi and
                  Daniel Levy and
                  Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and
                  Danielle Perszyk and
                  Danny Hernandez and
                  Danqi Chen and
                  Daphne Ippolito and
                  Dar Gilboa and
                  David Dohan and
                  David Drakard and
                  David Jurgens and
                  Debajyoti Datta and
                  Deep Ganguli and
                  Denis Emelin and
                  Denis Kleyko and
                  Deniz Yuret and
                  Derek Chen and
                  Derek Tam and
                  Dieuwke Hupkes and
                  Diganta Misra and
                  Dilyar Buzan and
                  Dimitri Coelho Mollo and
                  Diyi Yang and
                  Dong{-}Ho Lee and
                  Dylan Schrader and
                  Ekaterina Shutova and
                  Ekin Dogus Cubuk and
                  Elad Segal and
                  Eleanor Hagerman and
                  Elizabeth Barnes and
                  Elizabeth Donoway and
                  Ellie Pavlick and
                  Emanuele Rodol{\`{a}} and
                  Emma Lam and
                  Eric Chu and
                  Eric Tang and
                  Erkut Erdem and
                  Ernie Chang and
                  Ethan A. Chi and
                  Ethan Dyer and
                  Ethan J. Jerzak and
                  Ethan Kim and
                  Eunice Engefu Manyasi and
                  Evgenii Zheltonozhskii and
                  Fanyue Xia and
                  Fatemeh Siar and
                  Fernando Mart{\'{\i}}nez{-}Plumed and
                  Francesca Happ{\'{e}} and
                  Fran{\c{c}}ois Chollet and
                  Frieda Rong and
                  Gaurav Mishra and
                  Genta Indra Winata and
                  Gerard de Melo and
                  Germ{\'{a}}n Kruszewski and
                  Giambattista Parascandolo and
                  Giorgio Mariani and
                  Gloria Wang and
                  Gonzalo Jaimovitch{-}L{\'{o}}pez and
                  Gregor Betz and
                  Guy Gur{-}Ari and
                  Hana Galijasevic and
                  Hannah Kim and
                  Hannah Rashkin and
                  Hannaneh Hajishirzi and
                  Harsh Mehta and
                  Hayden Bogar and
                  Henry Shevlin and
                  Hinrich Sch{\"{u}}tze and
                  Hiromu Yakura and
                  Hongming Zhang and
                  Hugh Mee Wong and
                  Ian Ng and
                  Isaac Noble and
                  Jaap Jumelet and
                  Jack Geissinger and
                  Jackson Kernion and
                  Jacob Hilton and
                  Jaehoon Lee and
                  Jaime Fern{\'{a}}ndez Fisac and
                  James B. Simon and
                  James Koppel and
                  James Zheng and
                  James Zou and
                  Jan Kocon and
                  Jana Thompson and
                  Janelle Wingfield and
                  Jared Kaplan and
                  Jarema Radom and
                  Jascha Sohl{-}Dickstein and
                  Jason Phang and
                  Jason Wei and
                  Jason Yosinski and
                  Jekaterina Novikova and
                  Jelle Bosscher and
                  Jennifer Marsh and
                  Jeremy Kim and
                  Jeroen Taal and
                  Jesse H. Engel and
                  Jesujoba Alabi and
                  Jiacheng Xu and
                  Jiaming Song and
                  Jillian Tang and
                  Joan Waweru and
                  John Burden and
                  John Miller and
                  John U. Balis and
                  Jonathan Batchelder and
                  Jonathan Berant and
                  J{\"{o}}rg Frohberg and
                  Jos Rozen and
                  Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
                  Joseph Boudeman and
                  Joseph Guerr and
                  Joseph Jones and
                  Joshua B. Tenenbaum and
                  Joshua S. Rule and
                  Joyce Chua and
                  Kamil Kanclerz and
                  Karen Livescu and
                  Karl Krauth and
                  Karthik Gopalakrishnan and
                  Katerina Ignatyeva and
                  Katja Markert and
                  Kaustubh D. Dhole and
                  Kevin Gimpel and
                  Kevin Omondi and
                  Kory Mathewson and
                  Kristen Chiafullo and
                  Ksenia Shkaruta and
                  Kumar Shridhar and
                  Kyle McDonell and
                  Kyle Richardson and
                  Laria Reynolds and
                  Leo Gao and
                  Li Zhang and
                  Liam Dugan and
                  Lianhui Qin and
                  Lidia Contreras Ochando and
                  Louis{-}Philippe Morency and
                  Luca Moschella and
                  Lucas Lam and
                  Lucy Noble and
                  Ludwig Schmidt and
                  Luheng He and
                  Luis Oliveros Col{\'{o}}n and
                  Luke Metz and
                  L{\"{u}}tfi Kerem Senel and
                  Maarten Bosma and
                  Maarten Sap and
                  Maartje ter Hoeve and
                  Maheen Farooqi and
                  Manaal Faruqui and
                  Mantas Mazeika and
                  Marco Baturan and
                  Marco Marelli and
                  Marco Maru and
                  Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and
                  Marie Tolkiehn and
                  Mario Giulianelli and
                  Martha Lewis and
                  Martin Potthast and
                  Matthew L. Leavitt and
                  Matthias Hagen and
                  M{\'{a}}ty{\'{a}}s Schubert and
                  Medina Baitemirova and
                  Melody Arnaud and
                  Melvin McElrath and
                  Michael A. Yee and
                  Michael Cohen and
                  Michael Gu and
                  Michael I. Ivanitskiy and
                  Michael Starritt and
                  Michael Strube and
                  Michal Swedrowski and
                  Michele Bevilacqua and
                  Michihiro Yasunaga and
                  Mihir Kale and
                  Mike Cain and
                  Mimee Xu and
                  Mirac Suzgun and
                  Mitch Walker and
                  Mo Tiwari and
                  Mohit Bansal and
                  Moin Aminnaseri and
                  Mor Geva and
                  Mozhdeh Gheini and
                  Mukund Varma T. and
                  Nanyun Peng and
                  Nathan A. Chi and
                  Nayeon Lee and
                  Neta Gur{-}Ari Krakover and
                  Nicholas Cameron and
                  Nicholas Roberts and
                  Nick Doiron and
                  Nicole Martinez and
                  Nikita Nangia and
                  Niklas Deckers and
                  Niklas Muennighoff and
                  Nitish Shirish Keskar and
                  Niveditha Iyer and
                  Noah Constant and
                  Noah Fiedel and
                  Nuan Wen and
                  Oliver Zhang and
                  Omar Agha and
                  Omar Elbaghdadi and
                  Omer Levy and
                  Owain Evans and
                  Pablo Antonio Moreno Casares and
                  Parth Doshi and
                  Pascale Fung and
                  Paul Pu Liang and
                  Paul Vicol and
                  Pegah Alipoormolabashi and
                  Peiyuan Liao and
                  Percy Liang and
                  Peter Chang and
                  Peter Eckersley and
                  Phu Mon Htut and
                  Pinyu Hwang and
                  Piotr Milkowski and
                  Piyush Patil and
                  Pouya Pezeshkpour and
                  Priti Oli and
                  Qiaozhu Mei and
                  Qing Lyu and
                  Qinlang Chen and
                  Rabin Banjade and
                  Rachel Etta Rudolph and
                  Raefer Gabriel and
                  Rahel Habacker and
                  Ramon Risco and
                  Rapha{\"{e}}l Milli{\`{e}}re and
                  Rhythm Garg and
                  Richard Barnes and
                  Rif A. Saurous and
                  Riku Arakawa and
                  Robbe Raymaekers and
                  Robert Frank and
                  Rohan Sikand and
                  Roman Novak and
                  Roman Sitelew and
                  Ronan LeBras and
                  Rosanne Liu and
                  Rowan Jacobs and
                  Rui Zhang and
                  Ruslan Salakhutdinov and
                  Ryan Chi and
                  Ryan Lee and
                  Ryan Stovall and
                  Ryan Teehan and
                  Rylan Yang and
                  Sahib Singh and
                  Saif M. Mohammad and
                  Sajant Anand and
                  Sam Dillavou and
                  Sam Shleifer and
                  Sam Wiseman and
                  Samuel Gruetter and
                  Samuel R. Bowman and
                  Samuel S. Schoenholz and
                  Sanghyun Han and
                  Sanjeev Kwatra and
                  Sarah A. Rous and
                  Sarik Ghazarian and
                  Sayan Ghosh and
                  Sean Casey and
                  Sebastian Bischoff and
                  Sebastian Gehrmann and
                  Sebastian Schuster and
                  Sepideh Sadeghi and
                  Shadi Hamdan and
                  Sharon Zhou and
                  Shashank Srivastava and
                  Sherry Shi and
                  Shikhar Singh and
                  Shima Asaadi and
                  Shixiang Shane Gu and
                  Shubh Pachchigar and
                  Shubham Toshniwal and
                  Shyam Upadhyay and
                  Shyamolima (Shammie) Debnath and
                  Siamak Shakeri and
                  Simon Thormeyer and
                  Simone Melzi and
                  Siva Reddy and
                  Sneha Priscilla Makini and
                  Soo{-}Hwan Lee and
                  Spencer Torene and
                  Sriharsha Hatwar and
                  Stanislas Dehaene and
                  Stefan Divic and
                  Stefano Ermon and
                  Stella Biderman and
                  Stephanie Lin and
                  Stephen Prasad and
                  Steven T. Piantadosi and
                  Stuart M. Shieber and
                  Summer Misherghi and
                  Svetlana Kiritchenko and
                  Swaroop Mishra and
                  Tal Linzen and
                  Tal Schuster and
                  Tao Li and
                  Tao Yu and
                  Tariq Ali and
                  Tatsu Hashimoto and
                  Te{-}Lin Wu and
                  Th{\'{e}}o Desbordes and
                  Theodore Rothschild and
                  Thomas Phan and
                  Tianle Wang and
                  Tiberius Nkinyili and
                  Timo Schick and
                  Timofei Kornev and
                  Titus Tunduny and
                  Tobias Gerstenberg and
                  Trenton Chang and
                  Trishala Neeraj and
                  Tushar Khot and
                  Tyler Shultz and
                  Uri Shaham and
                  Vedant Misra and
                  Vera Demberg and
                  Victoria Nyamai and
                  Vikas Raunak and
                  Vinay V. Ramasesh and
                  Vinay Uday Prabhu and
                  Vishakh Padmakumar and
                  Vivek Srikumar and
                  William Fedus and
                  William Saunders and
                  William Zhang and
                  Wout Vossen and
                  Xiang Ren and
                  Xiaoyu Tong and
                  Xinran Zhao and
                  Xinyi Wu and
                  Xudong Shen and
                  Yadollah Yaghoobzadeh and
                  Yair Lakretz and
                  Yangqiu Song and
                  Yasaman Bahri and
                  Yejin Choi and
                  Yichi Yang and
                  Yiding Hao and
                  Yifu Chen and
                  Yonatan Belinkov and
                  Yu Hou and
                  Yufang Hou and
                  Yuntao Bai and
                  Zachary Seid and
                  Zhuoye Zhao and
                  Zijian Wang and
                  Zijie J. Wang and
                  Zirui Wang and
                  Ziyi Wu},
  title        = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities
                  of language models},
  journal      = {Trans. Mach. Learn. Res.},
  volume       = {2023},
  year         = {2023},
  url          = {https://openreview.net/forum?id=uyTL5Bvosj},
  timestamp    = {Tue, 06 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tmlr/SrivastavaRRSAF23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/toms/BestuzhevaBCCDDEGGGGGHHHHKLMMMMPRS23,
  author       = {Ksenia Bestuzheva and
                  Mathieu Besan{\c{c}}on and
                  Weikun Chen and
                  Antonia Chmiela and
                  Tim Donkiewicz and
                  Jasper van Doornmalen and
                  Leon Eifler and
                  Oliver Gaul and
                  Gerald Gamrath and
                  Ambros M. Gleixner and
                  Leona Gottwald and
                  Christoph Graczyk and
                  Katrin Halbig and
                  Alexander Hoen and
                  Christopher Hojny and
                  Rolf van der Hulst and
                  Thorsten Koch and
                  Marco E. L{\"{u}}bbecke and
                  Stephen J. Maher and
                  Frederic Matter and
                  Erik M{\"{u}}hmer and
                  Benjamin M{\"{u}}ller and
                  Marc E. Pfetsch and
                  Daniel Rehfeldt and
                  Steffan Schlein and
                  Franziska Schl{\"{o}}sser and
                  Felipe Serrano and
                  Yuji Shinano and
                  Boro Sofranac and
                  Mark Turner and
                  Stefan Vigerske and
                  Fabian Wegscheider and
                  Philipp Wellner and
                  Dieter Weninger and
                  Jakob Witzig},
  title        = {Enabling Research through the {SCIP} Optimization Suite 8.0},
  journal      = {{ACM} Trans. Math. Softw.},
  volume       = {49},
  number       = {2},
  pages        = {22:1--22:21},
  year         = {2023},
  url          = {https://doi.org/10.1145/3585516},
  doi          = {10.1145/3585516},
  timestamp    = {Tue, 16 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/toms/BestuzhevaBCCDDEGGGGGHHHHKLMMMMPRS23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acivs/DuongTKNLBN23,
  author       = {Dat Q. Duong and
                  Tuan{-}Anh Tran and
                  Phuong Nhi Nguyen Kieu and
                  Tien K. Nguyen and
                  Bao Le and
                  Stephen Baker and
                  Binh T. Nguyen},
  editor       = {Jacques Blanc{-}Talon and
                  Patrice Delmas and
                  Wilfried Philips and
                  Paul Scheunders},
  title        = {A Deep Learning Approach to Segment High-Content Images of the E.
                  coli Bacteria},
  booktitle    = {Advanced Concepts for Intelligent Vision Systems - 21st International
                  Conference, {ACIVS} 2023 Kumamoto, Japan, August 21-23, 2023 Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {14124},
  pages        = {184--195},
  publisher    = {Springer},
  year         = {2023},
  url          = {https://doi.org/10.1007/978-3-031-45382-3\_16},
  doi          = {10.1007/978-3-031-45382-3\_16},
  timestamp    = {Tue, 28 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/acivs/DuongTKNLBN23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/blockchain2/LiuWTO23,
  author       = {Liang Liu and
                  Qiao Wang and
                  Stephen John Turnbull and
                  Kazumasa Omote},
  title        = {The Validator's Dilemma in PoW Blockchain: An Evolutionary Game Perspective},
  booktitle    = {{IEEE} International Conference on Blockchain, Blockchain 2023, Danzhou,
                  China, December 17-21, 2023},
  pages        = {17--24},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/Blockchain60715.2023.00013},
  doi          = {10.1109/BLOCKCHAIN60715.2023.00013},
  timestamp    = {Thu, 22 Feb 2024 20:11:26 +0100},
  biburl       = {https://dblp.org/rec/conf/blockchain2/LiuWTO23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/TullSZC23,
  author       = {Sean Tull and
                  Razin A. Shaikh and
                  Sara Sabrina Zemljic and
                  Stephen Clark},
  editor       = {Micah B. Goldwater and
                  Florencia K. Anggoro and
                  Brett K. Hayes and
                  Desmond C. Ong},
  title        = {A Quantum Model of Concepts},
  booktitle    = {Proceedings of the 45th Annual Meeting of the Cognitive Science Society,
                  CogSci 2023, Sydney, NSW, Australia, July 26-29, 2023},
  publisher    = {cognitivesciencesociety.org},
  year         = {2023},
  url          = {https://escholarship.org/uc/item/5vj7c6d8},
  timestamp    = {Thu, 02 May 2024 16:36:09 +0200},
  biburl       = {https://dblp.org/rec/conf/cogsci/TullSZC23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/corl/RenDBSTBXTXVXSZ23,
  author       = {Allen Z. Ren and
                  Anushri Dixit and
                  Alexandra Bodrova and
                  Sumeet Singh and
                  Stephen Tu and
                  Noah Brown and
                  Peng Xu and
                  Leila Takayama and
                  Fei Xia and
                  Jake Varley and
                  Zhenjia Xu and
                  Dorsa Sadigh and
                  Andy Zeng and
                  Anirudha Majumdar},
  editor       = {Jie Tan and
                  Marc Toussaint and
                  Kourosh Darvish},
  title        = {Robots That Ask For Help: Uncertainty Alignment for Large Language
                  Model Planners},
  booktitle    = {Conference on Robot Learning, CoRL 2023, 6-9 November 2023, Atlanta,
                  GA, {USA}},
  series       = {Proceedings of Machine Learning Research},
  volume       = {229},
  pages        = {661--682},
  publisher    = {{PMLR}},
  year         = {2023},
  url          = {https://proceedings.mlr.press/v229/ren23a.html},
  timestamp    = {Tue, 12 Nov 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/corl/RenDBSTBXTXVXSZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/WangNSLCSZHL23,
  author       = {Ziyan Wang and
                  Giljoo Nam and
                  Tuur Stuyck and
                  Stephen Lombardi and
                  Chen Cao and
                  Jason M. Saragih and
                  Michael Zollh{\"{o}}fer and
                  Jessica K. Hodgins and
                  Christoph Lassner},
  title        = {NeuWigs: {A} Neural Dynamic Model for Volumetric Hair Capture and
                  Animation},
  booktitle    = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2023, Vancouver, BC, Canada, June 17-24, 2023},
  pages        = {8641--8651},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/CVPR52729.2023.00835},
  doi          = {10.1109/CVPR52729.2023.00835},
  timestamp    = {Mon, 28 Aug 2023 16:14:07 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/WangNSLCSZHL23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/OgundepoGRCRADD23,
  author       = {Odunayo Ogundepo and
                  Tajuddeen Gwadabe and
                  Clara Rivera and
                  Jonathan H. Clark and
                  Sebastian Ruder and
                  David Ifeoluwa Adelani and
                  Bonaventure Dossou and
                  Abdou Aziz Diop and
                  Claytone Sikasote and
                  Gilles Hacheme and
                  Happy Buzaaba and
                  Ignatius Ezeani and
                  Rooweither Mabuya and
                  Salomey Osei and
                  Chris Emezue and
                  Albert Kahira and
                  Shamsuddeen Hassan Muhammad and
                  Akintunde Oladipo and
                  Abraham Toluwase Owodunni and
                  Atnafu Lambebo Tonja and
                  Iyanuoluwa Shode and
                  Akari Asai and
                  Aremu Anuoluwapo and
                  Ayodele Awokoya and
                  Bernard Opoku and
                  Chiamaka Chukwuneke and
                  Christine Mwase and
                  Clemencia Siro and
                  Stephen Arthur and
                  Tunde Ajayi and
                  Verrah Otiende and
                  Andre Niyongabo Rubungo and
                  Boyd Sinkala and
                  Daniel A. Ajisafe and
                  Emeka Onwuegbuzia and
                  Falalu Ibrahim Lawan and
                  Ibrahim Said Ahmad and
                  Jesujoba O. Alabi and
                  Chinedu E. Mbonu and
                  Mofetoluwa Adeyemi and
                  Mofya Phiri and
                  Orevaoghene Ahia and
                  Ruqayya Nasir Iro and
                  Sonia Adhiambo},
  editor       = {Houda Bouamor and
                  Juan Pino and
                  Kalika Bali},
  title        = {Cross-lingual Open-Retrieval Question Answering for African Languages},
  booktitle    = {Findings of the Association for Computational Linguistics: {EMNLP}
                  2023, Singapore, December 6-10, 2023},
  pages        = {14957--14972},
  publisher    = {Association for Computational Linguistics},
  year         = {2023},
  url          = {https://doi.org/10.18653/v1/2023.findings-emnlp.997},
  doi          = {10.18653/V1/2023.FINDINGS-EMNLP.997},
  timestamp    = {Fri, 12 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/emnlp/OgundepoGRCRADD23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/KoldovskyCAO23,
  author       = {Zbynek Koldovsk{\'{y}} and
                  Jaroslav Cmejla and
                  T{\"{u}}lay Adali and
                  Stephen O'Regan},
  title        = {Independent Vector Extraction Constrained on Manifold of Half-Length
                  Filters},
  booktitle    = {31st European Signal Processing Conference, {EUSIPCO} 2023, Helsinki,
                  Finland, September 4-8, 2023},
  pages        = {940--944},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.23919/EUSIPCO58844.2023.10289896},
  doi          = {10.23919/EUSIPCO58844.2023.10289896},
  timestamp    = {Mon, 06 Nov 2023 12:35:15 +0100},
  biburl       = {https://dblp.org/rec/conf/eusipco/KoldovskyCAO23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gsi/TumpachP23,
  author       = {Alice Barbara Tumpach and
                  Stephen C. Preston},
  editor       = {Frank Nielsen and
                  Fr{\'{e}}d{\'{e}}ric Barbaresco},
  title        = {Three Methods to Put a Riemannian Metric on Shape Space},
  booktitle    = {Geometric Science of Information - 6th International Conference, {GSI}
                  2023, St. Malo, France, August 30 - September 1, 2023, Proceedings,
                  Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {14071},
  pages        = {3--11},
  publisher    = {Springer},
  year         = {2023},
  url          = {https://doi.org/10.1007/978-3-031-38271-0\_1},
  doi          = {10.1007/978-3-031-38271-0\_1},
  timestamp    = {Mon, 14 Aug 2023 16:16:24 +0200},
  biburl       = {https://dblp.org/rec/conf/gsi/TumpachP23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icacit/TurnerJMU23,
  author       = {Stephen W. Turner and
                  Tyler Judd and
                  Aaron Moore and
                  Suleyman Uludag},
  title        = {A Framework for an Automated Assessment System},
  booktitle    = {International Symposium on Accreditation of Engineering and Computing
                  Education, {ICACIT} 2023, Lima, Peru, November 2-3, 2023},
  pages        = {1--6},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/ICACIT59946.2023.10403674},
  doi          = {10.1109/ICACIT59946.2023.10403674},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icacit/TurnerJMU23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/NikunramMTS23,
  author       = {Chanikarn Nikunram and
                  Wasin Meesena and
                  Stephen John Turner and
                  Sucha Supittayapornpong},
  title        = {Minimizing Age of Processed Information in Wireless Networks},
  booktitle    = {{IEEE} International Conference on Communications, {ICC} 2023, Rome,
                  Italy, May 28 - June 1, 2023},
  pages        = {69--75},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/ICC45041.2023.10278805},
  doi          = {10.1109/ICC45041.2023.10278805},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icc/NikunramMTS23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccps/GaoSCFPGGTP23,
  author       = {Qitong Gao and
                  Stephen L. Schmidt and
                  Afsana Chowdhury and
                  Guangyu Feng and
                  Jennifer J. Peters and
                  Katherine Genty and
                  Warren M. Grill and
                  Dennis A. Turner and
                  Miroslav Pajic},
  editor       = {Sayan Mitra and
                  Nalini Venkatasubramanian and
                  Abhishek Dubey and
                  Lu Feng and
                  Mahsa Ghasemi and
                  Jonathan Sprinkle},
  title        = {Offline Learning of Closed-Loop Deep Brain Stimulation Controllers
                  for Parkinson Disease Treatment},
  booktitle    = {Proceedings of the {ACM/IEEE} 14th International Conference on Cyber-Physical
                  Systems, {ICCPS} 2023, (with CPS-IoT Week 2023), San Antonio, TX,
                  USA, May 9-12, 2023},
  pages        = {44--55},
  publisher    = {{ACM}},
  year         = {2023},
  url          = {https://doi.org/10.1145/3576841.3585925},
  doi          = {10.1145/3576841.3585925},
  timestamp    = {Wed, 17 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iccps/GaoSCFPGGTP23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/McAleerFLS23,
  author       = {Stephen Marcus McAleer and
                  Gabriele Farina and
                  Marc Lanctot and
                  Tuomas Sandholm},
  title        = {{ESCHER:} Eschewing Importance Sampling in Games by Computing a History
                  Value Function to Estimate Regret},
  booktitle    = {The Eleventh International Conference on Learning Representations,
                  {ICLR} 2023, Kigali, Rwanda, May 1-5, 2023},
  publisher    = {OpenReview.net},
  year         = {2023},
  url          = {https://openreview.net/forum?id=35QyoZv8cKO},
  timestamp    = {Wed, 24 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iclr/McAleerFLS23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/LanTRHABD23,
  author       = {Charline Le Lan and
                  Stephen Tu and
                  Mark Rowland and
                  Anna Harutyunyan and
                  Rishabh Agarwal and
                  Marc G. Bellemare and
                  Will Dabney},
  editor       = {Andreas Krause and
                  Emma Brunskill and
                  Kyunghyun Cho and
                  Barbara Engelhardt and
                  Sivan Sabato and
                  Jonathan Scarlett},
  title        = {Bootstrapped Representations in Reinforcement Learning},
  booktitle    = {International Conference on Machine Learning, {ICML} 2023, 23-29 July
                  2023, Honolulu, Hawaii, {USA}},
  series       = {Proceedings of Machine Learning Research},
  volume       = {202},
  pages        = {18686--18713},
  publisher    = {{PMLR}},
  year         = {2023},
  url          = {https://proceedings.mlr.press/v202/le-lan23a.html},
  timestamp    = {Wed, 02 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icml/LanTRHABD23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/PfrommerSWMT23,
  author       = {Daniel Pfrommer and
                  Max Simchowitz and
                  Tyler Westenbroek and
                  Nikolai Matni and
                  Stephen Tu},
  editor       = {Andreas Krause and
                  Emma Brunskill and
                  Kyunghyun Cho and
                  Barbara Engelhardt and
                  Sivan Sabato and
                  Jonathan Scarlett},
  title        = {The Power of Learned Locally Linear Models for Nonlinear Policy Optimization},
  booktitle    = {International Conference on Machine Learning, {ICML} 2023, 23-29 July
                  2023, Honolulu, Hawaii, {USA}},
  series       = {Proceedings of Machine Learning Research},
  volume       = {202},
  pages        = {27737--27821},
  publisher    = {{PMLR}},
  year         = {2023},
  url          = {https://proceedings.mlr.press/v202/pfrommer23a.html},
  timestamp    = {Mon, 28 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icml/PfrommerSWMT23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/BrandfonbrenerTSWBMV23,
  author       = {David Brandfonbrener and
                  Stephen Tu and
                  Avi Singh and
                  Stefan Welker and
                  Chad Boodoo and
                  Nikolai Matni and
                  Jake Varley},
  title        = {Visual Backtracking Teleoperation: {A} Data Collection Protocol for
                  Offline Image-Based Reinforcement Learning},
  booktitle    = {{IEEE} International Conference on Robotics and Automation, {ICRA}
                  2023, London, UK, May 29 - June 2, 2023},
  pages        = {11336--11342},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/ICRA48891.2023.10161096},
  doi          = {10.1109/ICRA48891.2023.10161096},
  timestamp    = {Tue, 08 Aug 2023 10:24:29 +0200},
  biburl       = {https://dblp.org/rec/conf/icra/BrandfonbrenerTSWBMV23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsrs/TullinoKBCJ23,
  author       = {Stephen K. Tullino and
                  Andrew S. Keys and
                  Robert A. Bettinger and
                  Amy M. Cox and
                  David R. Jacques},
  title        = {A Conceptual Spacecraft Operational Survivability Estimation Based
                  on Pre-Launch Test and Evaluation},
  booktitle    = {7th International Conference on System Reliability and Safety, {ICSRS}
                  2023, Bologna, Italy, November 22-24, 2023},
  pages        = {265--271},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/ICSRS59833.2023.10381447},
  doi          = {10.1109/ICSRS59833.2023.10381447},
  timestamp    = {Fri, 09 Feb 2024 20:38:51 +0100},
  biburl       = {https://dblp.org/rec/conf/icsrs/TullinoKBCJ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/ZhangWSWTLPF23,
  author       = {Yulun Zhang and
                  Donglai Wei and
                  Richard Schalek and
                  Yuelong Wu and
                  Stephen G. Turney and
                  Jeff Lichtman and
                  Hanspeter Pfister and
                  Yun Fu},
  title        = {High-Throughput Microscopy Image Deblurring with Graph Reasoning Attention
                  Network},
  booktitle    = {20th {IEEE} International Symposium on Biomedical Imaging, {ISBI}
                  2023, Cartagena, Colombia, April 18-21, 2023},
  pages        = {1--5},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/ISBI53787.2023.10230473},
  doi          = {10.1109/ISBI53787.2023.10230473},
  timestamp    = {Fri, 25 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/isbi/ZhangWSWTLPF23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/AbeyruwanBBCDJS23,
  author       = {Saminda Abeyruwan and
                  Alex Bewley and
                  Nicholas Matthew Boffi and
                  Krzysztof Marcin Choromanski and
                  David B. D'Ambrosio and
                  Deepali Jain and
                  Pannag R. Sanketi and
                  Anish Shankar and
                  Vikas Sindhwani and
                  Sumeet Singh and
                  Jean{-}Jacques E. Slotine and
                  Stephen Tu},
  editor       = {Nikolai Matni and
                  Manfred Morari and
                  George J. Pappas},
  title        = {Agile Catching with Whole-Body {MPC} and Blackbox Policy Learning},
  booktitle    = {Learning for Dynamics and Control Conference, {L4DC} 2023, 15-16 June
                  2023, Philadelphia, PA, {USA}},
  series       = {Proceedings of Machine Learning Research},
  volume       = {211},
  pages        = {851--863},
  publisher    = {{PMLR}},
  year         = {2023},
  url          = {https://proceedings.mlr.press/v211/abeyruwan23a.html},
  timestamp    = {Fri, 16 Jun 2023 14:48:17 +0200},
  biburl       = {https://dblp.org/rec/conf/l4dc/AbeyruwanBBCDJS23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/ZhangKLTLTM23,
  author       = {Thomas T. C. K. Zhang and
                  Katie Kang and
                  Bruce D. Lee and
                  Claire J. Tomlin and
                  Sergey Levine and
                  Stephen Tu and
                  Nikolai Matni},
  editor       = {Nikolai Matni and
                  Manfred Morari and
                  George J. Pappas},
  title        = {Multi-Task Imitation Learning for Linear Dynamical Systems},
  booktitle    = {Learning for Dynamics and Control Conference, {L4DC} 2023, 15-16 June
                  2023, Philadelphia, PA, {USA}},
  series       = {Proceedings of Machine Learning Research},
  volume       = {211},
  pages        = {586--599},
  publisher    = {{PMLR}},
  year         = {2023},
  url          = {https://proceedings.mlr.press/v211/zhang23b.html},
  timestamp    = {Fri, 16 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/l4dc/ZhangKLTLTM23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/McAleerFZW0S23,
  author       = {Stephen McAleer and
                  Gabriele Farina and
                  Gaoyue Zhou and
                  Mingzhi Wang and
                  Yaodong Yang and
                  Tuomas Sandholm},
  editor       = {Alice Oh and
                  Tristan Naumann and
                  Amir Globerson and
                  Kate Saenko and
                  Moritz Hardt and
                  Sergey Levine},
  title        = {Team-PSRO for Learning Approximate TMECor in Large Team Games via
                  Cooperative Reinforcement Learning},
  booktitle    = {Advances in Neural Information Processing Systems 36: Annual Conference
                  on Neural Information Processing Systems 2023, NeurIPS 2023, New Orleans,
                  LA, USA, December 10 - 16, 2023},
  year         = {2023},
  url          = {http://papers.nips.cc/paper\_files/paper/2023/hash/8e4ccc9ca6ae2225c4cbb7782ab48daf-Abstract-Conference.html},
  timestamp    = {Fri, 01 Mar 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/nips/McAleerFZW0S23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ZhangFACMHC0CS23,
  author       = {Brian Hu Zhang and
                  Gabriele Farina and
                  Ioannis Anagnostides and
                  Federico Cacciamani and
                  Stephen McAleer and
                  Andreas A. Haupt and
                  Andrea Celli and
                  Nicola Gatti and
                  Vincent Conitzer and
                  Tuomas Sandholm},
  editor       = {Alice Oh and
                  Tristan Naumann and
                  Amir Globerson and
                  Kate Saenko and
                  Moritz Hardt and
                  Sergey Levine},
  title        = {Computing Optimal Equilibria and Mechanisms via Learning in Zero-Sum
                  Extensive-Form Games},
  booktitle    = {Advances in Neural Information Processing Systems 36: Annual Conference
                  on Neural Information Processing Systems 2023, NeurIPS 2023, New Orleans,
                  LA, USA, December 10 - 16, 2023},
  year         = {2023},
  url          = {http://papers.nips.cc/paper\_files/paper/2023/hash/07be1a0850e58ca29e2b6ce31fc0c791-Abstract-Conference.html},
  timestamp    = {Fri, 01 Mar 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/nips/ZhangFACMHC0CS23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ZiemannTPM23,
  author       = {Ingvar M. Ziemann and
                  Stephen Tu and
                  George J. Pappas and
                  Nikolai Matni},
  editor       = {Alice Oh and
                  Tristan Naumann and
                  Amir Globerson and
                  Kate Saenko and
                  Moritz Hardt and
                  Sergey Levine},
  title        = {The noise level in linear regression with dependent data},
  booktitle    = {Advances in Neural Information Processing Systems 36: Annual Conference
                  on Neural Information Processing Systems 2023, NeurIPS 2023, New Orleans,
                  LA, USA, December 10 - 16, 2023},
  year         = {2023},
  url          = {http://papers.nips.cc/paper\_files/paper/2023/hash/ecffd829f90b0a4b6aa017b6df15904f-Abstract-Conference.html},
  timestamp    = {Fri, 01 Mar 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/nips/ZiemannTPM23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/BaderBBBCCCCDDF23,
  author       = {Jonathan Bader and
                  Jim Belak and
                  Matthew T. Bement and
                  Matthew Berry and
                  Robert Carson and
                  Daniela Cassol and
                  Stephen Chan and
                  John Coleman and
                  Kastan Day and
                  Alejandro Duque and
                  Kjiersten Fagnan and
                  Jeff Froula and
                  Shantenu Jha and
                  Daniel S. Katz and
                  Piotr Kica and
                  Volodymyr V. Kindratenko and
                  Edward Kirton and
                  Ramani Kothadia and
                  Daniel E. Laney and
                  Fabian Lehmann and
                  Ulf Leser and
                  Sabina Licholai and
                  Maciej Malawski and
                  Mario Melara and
                  Elais Player Jackson and
                  Matthew Rolchigo and
                  Setareh Sarrafan and
                  Seung{-}Jin Sul and
                  Abdullah Syed and
                  Lauritz Thamsen and
                  Mikhail Titov and
                  Matteo Turilli and
                  Silvina Ca{\'{\i}}no{-}Lores and
                  Anirban Mandal},
  title        = {Novel Approaches Toward Scalable Composable Workflows in Hyper-Heterogeneous
                  Computing Environments},
  booktitle    = {Proceedings of the {SC} '23 Workshops of The International Conference
                  on High Performance Computing, Network, Storage, and Analysis, {SC-W}
                  2023, Denver, CO, USA, November 12-17, 2023},
  pages        = {2097--2108},
  publisher    = {{ACM}},
  year         = {2023},
  url          = {https://doi.org/10.1145/3624062.3626283},
  doi          = {10.1145/3624062.3626283},
  timestamp    = {Tue, 28 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sc/BaderBBBCCCCDDF23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/LyonsDBFTR23,
  author       = {Deirdre V. Lyons and
                  Christopher Lane Davis and
                  Stephen Butchko and
                  Whitton Frank and
                  Brian Tull and
                  Braden Roy},
  editor       = {Erik Brunvand and
                  Anna Carolina Muller Queiroz},
  title        = {Gumball Dreams: Live Theatre in {VR}},
  booktitle    = {{ACM} {SIGGRAPH} 2023 Immersive Pavilion, {SIGGRAPH} 2023, Los Angeles,
                  CA, USA, August 6-10, 2023},
  pages        = {8:1--8:2},
  publisher    = {{ACM}},
  year         = {2023},
  url          = {https://doi.org/10.1145/3588027.3595593},
  doi          = {10.1145/3588027.3595593},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/siggraph/LyonsDBFTR23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/NishiPCSZTTN0DG23,
  author       = {Yoshinori Nishi and
                  John W. Poulton and
                  Xi Chen and
                  Sanquan Song and
                  Brian Zimmer and
                  Walker J. Turner and
                  Stephen G. Tell and
                  Nikola Nedovic and
                  John M. Wilson and
                  William J. Dally and
                  C. Thomas Gray},
  title        = {A 0.190-pJ/bit 25.2-Gb/s/wire Inverter-Based AC-Coupled Transceiver
                  for Short-Reach Die-to-Die Interfaces in 5-nm {CMOS}},
  booktitle    = {2023 {IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
                  and Circuits), Kyoto, Japan, June 11-16, 2023},
  pages        = {1--2},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.23919/VLSITechnologyandCir57934.2023.10185334},
  doi          = {10.23919/VLSITECHNOLOGYANDCIR57934.2023.10185334},
  timestamp    = {Sun, 30 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/vlsit/NishiPCSZTTN0DG23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/WanigasekaraAGG23,
  author       = {Prashan Wanigasekara and
                  Rafid Al{-}Humaimidi and
                  Turan Gojayev and
                  Niloofar Gheissari and
                  Achal Dave and
                  Stephen Rawls and
                  Fan Yang and
                  Kechen Qin and
                  Nalin Gupta and
                  Spurthi Sandiri and
                  Chevanthie Dissanayake and
                  Zeynab Raeesy and
                  Emre Barut and
                  Chengwei Su},
  editor       = {Ying Ding and
                  Jie Tang and
                  Juan F. Sequeda and
                  Lora Aroyo and
                  Carlos Castillo and
                  Geert{-}Jan Houben},
  title        = {Visual Item Selection With Voice Assistants: {A} systems perspective},
  booktitle    = {Companion Proceedings of the {ACM} Web Conference 2023, {WWW} 2023,
                  Austin, TX, USA, 30 April 2023 - 4 May 2023},
  pages        = {500--507},
  publisher    = {{ACM}},
  year         = {2023},
  url          = {https://doi.org/10.1145/3543873.3584655},
  doi          = {10.1145/3543873.3584655},
  timestamp    = {Mon, 28 Aug 2023 21:17:11 +0200},
  biburl       = {https://dblp.org/rec/conf/www/WanigasekaraAGG23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-02477,
  author       = {Qitong Gao and
                  Stephen L. Schmidt and
                  Afsana Chowdhury and
                  Guangyu Feng and
                  Jennifer J. Peters and
                  Katherine Genty and
                  Warren M. Grill and
                  Dennis A. Turner and
                  Miroslav Pajic},
  title        = {Offline Learning of Closed-Loop Deep Brain Stimulation Controllers
                  for Parkinson Disease Treatment},
  journal      = {CoRR},
  volume       = {abs/2302.02477},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2302.02477},
  doi          = {10.48550/ARXIV.2302.02477},
  eprinttype    = {arXiv},
  eprint       = {2302.02477},
  timestamp    = {Fri, 10 Feb 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2302-02477.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-14822,
  author       = {Sean Tull and
                  Razin A. Shaikh and
                  Sara Sabrina Zemljic and
                  Stephen Clark},
  title        = {Formalising and Learning a Quantum Model of Concepts},
  journal      = {CoRR},
  volume       = {abs/2302.14822},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2302.14822},
  doi          = {10.48550/ARXIV.2302.14822},
  eprinttype    = {arXiv},
  eprint       = {2302.14822},
  timestamp    = {Thu, 02 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2302-14822.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-01778,
  author       = {Zbynek Koldovsk{\'{y}} and
                  Jaroslav Cmejla and
                  T{\"{u}}lay Adali and
                  Stephen O'Regan},
  title        = {Independent Vector Extraction Constrained on Manifold of Half-Length
                  Filters},
  journal      = {CoRR},
  volume       = {abs/2304.01778},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2304.01778},
  doi          = {10.48550/ARXIV.2304.01778},
  eprinttype    = {arXiv},
  eprint       = {2304.01778},
  timestamp    = {Thu, 20 Apr 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2304-01778.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-03949,
  author       = {Sathya R. Chitturi and
                  Zhurun Ji and
                  Alexander Petsch and
                  Cheng Peng and
                  Zhantao Chen and
                  Rajan Plumley and
                  Mike Dunne and
                  Sougata Mardanya and
                  Sugata Chowdhury and
                  Hongwei Chen and
                  Arun Bansil and
                  Adrian E. Feiguin and
                  Alexander Kolesnikov and
                  Dharmalingam Prabhakaran and
                  Stephen Hayden and
                  Daniel Ratner and
                  Chunjing Jia and
                  Youssef Nashed and
                  Joshua J. Turner},
  title        = {Capturing dynamical correlations using implicit neural representations},
  journal      = {CoRR},
  volume       = {abs/2304.03949},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2304.03949},
  doi          = {10.48550/ARXIV.2304.03949},
  eprinttype    = {arXiv},
  eprint       = {2304.03949},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2304-03949.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-04425,
  author       = {Rakpong Kaewpuang and
                  Minrui Xu and
                  Stephen John Turner and
                  Dusit Niyato and
                  Han Yu and
                  Dong In Kim},
  title        = {Entangled Pair Resource Allocation under Uncertain Fidelity Requirements},
  journal      = {CoRR},
  volume       = {abs/2304.04425},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2304.04425},
  doi          = {10.48550/ARXIV.2304.04425},
  eprinttype    = {arXiv},
  eprint       = {2304.04425},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2304-04425.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-04640,
  author       = {Jason Yik and
                  Soikat Hasan Ahmed and
                  Zergham Ahmed and
                  Brian Anderson and
                  Andreas G. Andreou and
                  Chiara Bartolozzi and
                  Arindam Basu and
                  Douwe den Blanken and
                  Petrut Bogdan and
                  Sander M. Boht{\'{e}} and
                  Younes Bouhadjar and
                  Sonia M. Buckley and
                  Gert Cauwenberghs and
                  Federico Corradi and
                  Guido de Croon and
                  Andreea Danielescu and
                  Anurag Reddy Daram and
                  Mike Davies and
                  Yigit Demirag and
                  Jason Eshraghian and
                  Jeremy Forest and
                  Steve B. Furber and
                  Michael Furlong and
                  Aditya Gilra and
                  Giacomo Indiveri and
                  Siddharth Joshi and
                  Vedant Karia and
                  Lyes Khacef and
                  James C. Knight and
                  Laura Kriener and
                  Rajkumar Kubendran and
                  Dhireesha Kudithipudi and
                  Gregor Lenz and
                  Rajit Manohar and
                  Christian Mayr and
                  Konstantinos P. Michmizos and
                  Dylan R. Muir and
                  Emre Neftci and
                  Thomas Nowotny and
                  Fabrizio Ottati and
                  Ay{\c{c}}a {\"{O}}zcelikkale and
                  Noah Pacik{-}Nelson and
                  Priyadarshini Panda and
                  Pao{-}Sheng Sun and
                  Melika Payvand and
                  Christian Pehle and
                  Mihai A. Petrovici and
                  Christoph Posch and
                  Alpha Renner and
                  Yulia Sandamirskaya and
                  Clemens JS Schaefer and
                  Andr{\'{e}} van Schaik and
                  Johannes Schemmel and
                  Catherine D. Schuman and
                  Jae{-}sun Seo and
                  Sumit Bam Shrestha and
                  Manolis Sifalakis and
                  Amos Sironi and
                  Kenneth Michael Stewart and
                  Terrence C. Stewart and
                  Philipp Stratmann and
                  Guangzhi Tang and
                  Jonathan Timcheck and
                  Marian Verhelst and
                  Craig M. Vineyard and
                  Bernhard Vogginger and
                  Amirreza Yousefzadeh and
                  Biyan Zhou and
                  Fatima Tuz Zohora and
                  Charlotte Frenkel and
                  Vijay Janapa Reddi},
  title        = {NeuroBench: Advancing Neuromorphic Computing through Collaborative,
                  Fair and Representative Benchmarking},
  journal      = {CoRR},
  volume       = {abs/2304.04640},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2304.04640},
  doi          = {10.48550/ARXIV.2304.04640},
  eprinttype    = {arXiv},
  eprint       = {2304.04640},
  timestamp    = {Fri, 18 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2304-04640.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-05108,
  author       = {Uchenna Daniel Ani and
                  Jeremy M. Watson and
                  Nilufer Tuptuk and
                  Steve Hailes and
                  Aslam Jawar},
  title        = {Socio-Technical Security Modelling: Analysis of State-of-the-Art,
                  Application, and Maturity in Critical Industrial Infrastructure Environments/Domains},
  journal      = {CoRR},
  volume       = {abs/2305.05108},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2305.05108},
  doi          = {10.48550/ARXIV.2305.05108},
  eprinttype    = {arXiv},
  eprint       = {2305.05108},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2305-05108.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-09617,
  author       = {Karan Singhal and
                  Tao Tu and
                  Juraj Gottweis and
                  Rory Sayres and
                  Ellery Wulczyn and
                  Le Hou and
                  Kevin Clark and
                  Stephen Pfohl and
                  Heather Cole{-}Lewis and
                  Darlene Neal and
                  Mike Schaekermann and
                  Amy Wang and
                  Mohamed Amin and
                  Sami Lachgar and
                  Philip Andrew Mansfield and
                  Sushant Prakash and
                  Bradley Green and
                  Ewa Dominowska and
                  Blaise Ag{\"{u}}era y Arcas and
                  Nenad Tomasev and
                  Yun Liu and
                  Renee Wong and
                  Christopher Semturs and
                  S. Sara Mahdavi and
                  Joelle K. Barral and
                  Dale R. Webster and
                  Gregory S. Corrado and
                  Yossi Matias and
                  Shekoofeh Azizi and
                  Alan Karthikesalingam and
                  Vivek Natarajan},
  title        = {Towards Expert-Level Medical Question Answering with Large Language
                  Models},
  journal      = {CoRR},
  volume       = {abs/2305.09617},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2305.09617},
  doi          = {10.48550/ARXIV.2305.09617},
  eprinttype    = {arXiv},
  eprint       = {2305.09617},
  timestamp    = {Wed, 06 Nov 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2305-09617.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-09619,
  author       = {Daniel Pfrommer and
                  Max Simchowitz and
                  Tyler Westenbroek and
                  Nikolai Matni and
                  Stephen Tu},
  title        = {The Power of Learned Locally Linear Models for Nonlinear Policy Optimization},
  journal      = {CoRR},
  volume       = {abs/2305.09619},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2305.09619},
  doi          = {10.48550/ARXIV.2305.09619},
  eprinttype    = {arXiv},
  eprint       = {2305.09619},
  timestamp    = {Wed, 24 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2305-09619.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-11165,
  author       = {Ingvar M. Ziemann and
                  Stephen Tu and
                  George J. Pappas and
                  Nikolai Matni},
  title        = {The noise level in linear regression with dependent data},
  journal      = {CoRR},
  volume       = {abs/2305.11165},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2305.11165},
  doi          = {10.48550/ARXIV.2305.11165},
  eprinttype    = {arXiv},
  eprint       = {2305.11165},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2305-11165.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-12284,
  author       = {Amir Ali Ahmadi and
                  Abraar Chaudhry and
                  Vikas Sindhwani and
                  Stephen Tu},
  title        = {Safely Learning Dynamical Systems},
  journal      = {CoRR},
  volume       = {abs/2305.12284},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2305.12284},
  doi          = {10.48550/ARXIV.2305.12284},
  eprinttype    = {arXiv},
  eprint       = {2305.12284},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2305-12284.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-05216,
  author       = {Brian Hu Zhang and
                  Gabriele Farina and
                  Ioannis Anagnostides and
                  Federico Cacciamani and
                  Stephen Marcus McAleer and
                  Andreas Alexander Haupt and
                  Andrea Celli and
                  Nicola Gatti and
                  Vincent Conitzer and
                  Tuomas Sandholm},
  title        = {Computing Optimal Equilibria and Mechanisms via Learning in Zero-Sum
                  Extensive-Form Games},
  journal      = {CoRR},
  volume       = {abs/2306.05216},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2306.05216},
  doi          = {10.48550/ARXIV.2306.05216},
  eprinttype    = {arXiv},
  eprint       = {2306.05216},
  timestamp    = {Wed, 14 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2306-05216.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-05221,
  author       = {Brian Hu Zhang and
                  Gabriele Farina and
                  Ioannis Anagnostides and
                  Federico Cacciamani and
                  Stephen Marcus McAleer and
                  Andreas Alexander Haupt and
                  Andrea Celli and
                  Nicola Gatti and
                  Vincent Conitzer and
                  Tuomas Sandholm},
  title        = {Steering No-Regret Learners to Optimal Equilibria},
  journal      = {CoRR},
  volume       = {abs/2306.05221},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2306.05221},
  doi          = {10.48550/ARXIV.2306.05221},
  eprinttype    = {arXiv},
  eprint       = {2306.05221},
  timestamp    = {Wed, 14 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2306-05221.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-08205,
  author       = {Saminda Abeyruwan and
                  Alex Bewley and
                  Nicholas M. Boffi and
                  Krzysztof Choromanski and
                  David B. D'Ambrosio and
                  Deepali Jain and
                  Pannag Sanketi and
                  Anish Shankar and
                  Vikas Sindhwani and
                  Sumeet Singh and
                  Jean{-}Jacques E. Slotine and
                  Stephen Tu},
  title        = {Agile Catching with Whole-Body {MPC} and Blackbox Policy Learning},
  journal      = {CoRR},
  volume       = {abs/2306.08205},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2306.08205},
  doi          = {10.48550/ARXIV.2306.08205},
  eprinttype    = {arXiv},
  eprint       = {2306.08205},
  timestamp    = {Sun, 18 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2306-08205.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-10171,
  author       = {Charline Le Lan and
                  Stephen Tu and
                  Mark Rowland and
                  Anna Harutyunyan and
                  Rishabh Agarwal and
                  Marc G. Bellemare and
                  Will Dabney},
  title        = {Bootstrapped Representations in Reinforcement Learning},
  journal      = {CoRR},
  volume       = {abs/2306.10171},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2306.10171},
  doi          = {10.48550/ARXIV.2306.10171},
  eprinttype    = {arXiv},
  eprint       = {2306.10171},
  timestamp    = {Wed, 02 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2306-10171.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-01928,
  author       = {Allen Z. Ren and
                  Anushri Dixit and
                  Alexandra Bodrova and
                  Sumeet Singh and
                  Stephen Tu and
                  Noah Brown and
                  Peng Xu and
                  Leila Takayama and
                  Fei Xia and
                  Jake Varley and
                  Zhenjia Xu and
                  Dorsa Sadigh and
                  Andy Zeng and
                  Anirudha Majumdar},
  title        = {Robots That Ask For Help: Uncertainty Alignment for Large Language
                  Model Planners},
  journal      = {CoRR},
  volume       = {abs/2307.01928},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2307.01928},
  doi          = {10.48550/ARXIV.2307.01928},
  eprinttype    = {arXiv},
  eprint       = {2307.01928},
  timestamp    = {Tue, 12 Nov 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2307-01928.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-12062,
  author       = {Yongyuan Liang and
                  Yanchao Sun and
                  Ruijie Zheng and
                  Xiangyu Liu and
                  Tuomas Sandholm and
                  Furong Huang and
                  Stephen McAleer},
  title        = {Game-Theoretic Robust Reinforcement Learning Handles Temporally-Coupled
                  Perturbations},
  journal      = {CoRR},
  volume       = {abs/2307.12062},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2307.12062},
  doi          = {10.48550/ARXIV.2307.12062},
  eprinttype    = {arXiv},
  eprint       = {2307.12062},
  timestamp    = {Tue, 01 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2307-12062.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-05803,
  author       = {Sumeet Singh and
                  Stephen Tu and
                  Vikas Sindhwani},
  title        = {Revisiting Energy Based Models as Policies: Ranking Noise Contrastive
                  Estimation and Interpolating Energy Models},
  journal      = {CoRR},
  volume       = {abs/2309.05803},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2309.05803},
  doi          = {10.48550/ARXIV.2309.05803},
  eprinttype    = {arXiv},
  eprint       = {2309.05803},
  timestamp    = {Fri, 15 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2309-05803.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-04373,
  author       = {Ted Moskovitz and
                  Aaditya K. Singh and
                  DJ Strouse and
                  Tuomas Sandholm and
                  Ruslan Salakhutdinov and
                  Anca D. Dragan and
                  Stephen McAleer},
  title        = {Confronting Reward Model Overoptimization with Constrained {RLHF}},
  journal      = {CoRR},
  volume       = {abs/2310.04373},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2310.04373},
  doi          = {10.48550/ARXIV.2310.04373},
  eprinttype    = {arXiv},
  eprint       = {2310.04373},
  timestamp    = {Fri, 20 Oct 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2310-04373.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-07843,
  author       = {Roya Firoozi and
                  Johnathan Tucker and
                  Stephen Tian and
                  Anirudha Majumdar and
                  Jiankai Sun and
                  Weiyu Liu and
                  Yuke Zhu and
                  Shuran Song and
                  Ashish Kapoor and
                  Karol Hausman and
                  Brian Ichter and
                  Danny Driess and
                  Jiajun Wu and
                  Cewu Lu and
                  Mac Schwager},
  title        = {Foundation Models in Robotics: Applications, Challenges, and the Future},
  journal      = {CoRR},
  volume       = {abs/2312.07843},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2312.07843},
  doi          = {10.48550/ARXIV.2312.07843},
  eprinttype    = {arXiv},
  eprint       = {2312.07843},
  timestamp    = {Wed, 12 Jun 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2312-07843.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/AleneziH22,
  author       = {Turki Alenezi and
                  Stephen C. Hirtle},
  title        = {Normalized Attraction Travel Personality Representation for Improving
                  Travel Recommender Systems},
  journal      = {{IEEE} Access},
  volume       = {10},
  pages        = {56493--56503},
  year         = {2022},
  url          = {https://doi.org/10.1109/ACCESS.2022.3178439},
  doi          = {10.1109/ACCESS.2022.3178439},
  timestamp    = {Mon, 13 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/AleneziH22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/BaruPABCCFFJLLL22,
  author       = {Chaitanya K. Baru and
                  Michael Pozmantier and
                  Ilkay Altintas and
                  Stephen Baek and
                  Jonathan Cohen and
                  Laura E. Condon and
                  Giulia Fanti and
                  Raul Castro Fernandez and
                  Ethan Jackson and
                  Upmanu Lall and
                  Bennett A. Landman and
                  Hai Li and
                  Claudia Marin and
                  Beatriz Mart{\'{\i}}nez{-}L{\'{o}}pez and
                  Dimitris N. Metaxas and
                  Bradley D. Olsen and
                  Grier P. Page and
                  Yelda Turkan and
                  Jingbo Zhang and
                  Peng Zhang},
  title        = {Enabling {AI} Innovation via Data and Model Sharing: An Overview of
                  the Nsf Convergence Accelerator Track {D}},
  journal      = {{AI} Mag.},
  volume       = {43},
  number       = {1},
  pages        = {93--104},
  year         = {2022},
  url          = {https://doi.org/10.1609/aimag.v43i1.19130},
  doi          = {10.1609/AIMAG.V43I1.19130},
  timestamp    = {Wed, 06 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/aim/BaruPABCCFFJLLL22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fdgth/HabererBTTTTMGDMA22,
  author       = {Jessica E. Haberer and
                  Robert Baijuka and
                  John Bosco Tumuhairwe and
                  Edna B. Tindimwebwa and
                  James Tinkamanyire and
                  Ellyk Tuhanamagyezi and
                  Lawrence Musoke and
                  Lindsey E. Garrison and
                  Marisa Delsignore and
                  Nicholas Musinguzi and
                  Stephen Asiimwe},
  title        = {Implementation of Electronic Adherence Monitors and Associated Interventions
                  for Routine {HIV} Antiretroviral Therapy in Uganda: Promising Findings},
  journal      = {Frontiers Digit. Health},
  volume       = {4},
  year         = {2022},
  url          = {https://doi.org/10.3389/fdgth.2022.899643},
  doi          = {10.3389/FDGTH.2022.899643},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/fdgth/HabererBTTTTMGDMA22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpca/TurnerBBBCCDFHJ22,
  author       = {John A. Turner and
                  James F. Belak and
                  Nathan Barton and
                  Matthew T. Bement and
                  Neil N. Carlson and
                  Robert Carson and
                  Stephen Dewitt and
                  Jean{-}Luc Fattebert and
                  Neil Eugene Hodge and
                  Zechariah Jibben and
                  Wayne E. King and
                  Lyle Levine and
                  Christopher K. Newman and
                  Alex Plotkowski and
                  Balasubramaniam Radhakrishnan and
                  Samuel Temple Reeve and
                  Matthew Rolchigo and
                  Adrian S. Sabau and
                  Stuart R. Slattery and
                  Benjamin Stump},
  title        = {ExaAM: Metal additive manufacturing simulation at the fidelity of
                  the microstructure},
  journal      = {Int. J. High Perform. Comput. Appl.},
  volume       = {36},
  number       = {1},
  pages        = {13--39},
  year         = {2022},
  url          = {https://doi.org/10.1177/10943420211042558},
  doi          = {10.1177/10943420211042558},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijhpca/TurnerBBBCCDFHJ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iotj/NgoenriangTNS22,
  author       = {Napat Ngoenriang and
                  Stephen John Turner and
                  Dusit Niyato and
                  Sucha Supittayapornpong},
  title        = {Joint {UAV} Placement and Data Delivery in Aerial Inspection Under
                  Uncertainties},
  journal      = {{IEEE} Internet Things J.},
  volume       = {9},
  number       = {9},
  pages        = {6389--6403},
  year         = {2022},
  url          = {https://doi.org/10.1109/JIOT.2021.3113713},
  doi          = {10.1109/JIOT.2021.3113713},
  timestamp    = {Wed, 18 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/iotj/NgoenriangTNS22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcphy/WaltersTF22,
  author       = {Stephen J. Walters and
                  Ross J. Turner and
                  Lawrence K. Forbes},
  title        = {Computing interfacial flows of viscous fluids},
  journal      = {J. Comput. Phys.},
  volume       = {471},
  pages        = {111626},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.jcp.2022.111626},
  doi          = {10.1016/J.JCP.2022.111626},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jcphy/WaltersTF22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmlr/BoffiTS22,
  author       = {Nicholas M. Boffi and
                  Stephen Tu and
                  Jean{-}Jacques E. Slotine},
  title        = {Nonparametric adaptive control and prediction: theory and randomized
                  algorithms},
  journal      = {J. Mach. Learn. Res.},
  volume       = {23},
  pages        = {281:1--281:46},
  year         = {2022},
  url          = {https://jmlr.org/papers/v23/22-0022.html},
  timestamp    = {Wed, 11 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jmlr/BoffiTS22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MaiDKTBGCBSK22,
  author       = {Dawei Mai and
                  Yann Donnelly and
                  Michael Peter Kennedy and
                  Stefano Tulisi and
                  James Breslin and
                  Patrick Griffin and
                  Michael Connor and
                  Stephen Brookes and
                  Brian Shelly and
                  Mike Keaveney},
  title        = {Wandering Spur Suppression in a 4.9-GHz Fractional-N Frequency Synthesizer},
  journal      = {{IEEE} J. Solid State Circuits},
  volume       = {57},
  number       = {7},
  pages        = {2011--2023},
  year         = {2022},
  url          = {https://doi.org/10.1109/JSSC.2022.3163080},
  doi          = {10.1109/JSSC.2022.3163080},
  timestamp    = {Thu, 27 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jssc/MaiDKTBGCBSK22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MehtaTTTGG22,
  author       = {Nandish Mehta and
                  Stephen G. Tell and
                  Walker J. Turner and
                  Lamar Tatro and
                  Jih Ren Goh and
                  C. Thomas Gray},
  title        = {An On-Chip Relaxation Oscillator in 5-nm FinFET Using a Frequency-Error
                  Feedback Loop},
  journal      = {{IEEE} J. Solid State Circuits},
  volume       = {57},
  number       = {10},
  pages        = {2898--2908},
  year         = {2022},
  url          = {https://doi.org/10.1109/JSSC.2022.3183208},
  doi          = {10.1109/JSSC.2022.3183208},
  timestamp    = {Tue, 18 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jssc/MehtaTTTGG22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/CunninghamAAAAA22,
  author       = {Fiona Cunningham and
                  James E. Allen and
                  Jamie Allen and
                  Jorge {\'{A}}lvarez{-}Jarreta and
                  M. Ridwan Amode and
                  Irina M. Armean and
                  Olanrewaju Austine{-}Orimoloye and
                  Andrey G. Azov and
                  If Barnes and
                  Ruth Bennett and
                  Andrew E. Berry and
                  Jyothish Bhai and
                  Alexandra Bignell and
                  Konstantinos Billis and
                  Sanjay Boddu and
                  Lucy Brooks and
                  Mehrnaz Charkhchi and
                  Carla A. Cummins and
                  Luca Da Rin Fioretto and
                  Claire Davidson and
                  Kamalkumar Jayantilal Dodiya and
                  Sarah M. Donaldson and
                  Bilal El Houdaigui and
                  Tamara El Naboulsi and
                  Reham Fatima and
                  Carlos Garc{\'{\i}}a{-}Gir{\'{o}}n and
                  Thiago A. L. Genez and
                  Jose Gonzalez Martinez and
                  Cristina Guijarro{-}Clarke and
                  Arthur Gymer and
                  Matthew Hardy and
                  Zoe Hollis and
                  Thibaut Hourlier and
                  Toby Hunt and
                  Thomas Juettemann and
                  Vinay Kaikala and
                  Mike P. Kay and
                  Ilias Lavidas and
                  Tuan Le and
                  Diana Lemos and
                  Jos{\'{e}} Carlos Marug{\'{a}}n and
                  Shamika Mohanan and
                  Aleena Mushtaq and
                  Marc Naven and
                  Denye N. Oheh and
                  Anne Parker and
                  Andrew Parton and
                  Malcolm Perry and
                  Ivana Pilizota and
                  Irina Prosovetskaia and
                  Manoj Pandian Sakthivel and
                  Ahamed Imran Abdul Salam and
                  Bianca M. Schmitt and
                  Helen Schuilenburg and
                  Dan Sheppard and
                  Jos{\'{e}} G. P{\'{e}}rez{-}Silva and
                  William Stark and
                  Emily Steed and
                  Ky{\"{o}}sti Sutinen and
                  Ranjit Sukumaran and
                  Dulika Sumathipala and
                  Marie{-}Marthe Suner and
                  Michal Szpak and
                  Anja Thormann and
                  Francesca Floriana Tricomi and
                  David Urbina{-}G{\'{o}}mez and
                  Andres Veidenberg and
                  Thomas A. Walsh and
                  Brandon Walts and
                  Natalie L. Willhoft and
                  Andrea Winterbottom and
                  Elizabeth Wass and
                  Marc Chakiachvili and
                  Bethany Flint and
                  Adam Frankish and
                  Stefano Giorgetti and
                  Leanne Haggerty and
                  Sarah E. Hunt and
                  Garth IIsley and
                  Jane E. Loveland and
                  Fergal J. Martin and
                  Benjamin Moore and
                  Jonathan M. Mudge and
                  Matthieu Muffato and
                  Emily Perry and
                  Magali Ruffier and
                  John G. Tate and
                  David Thybert and
                  Stephen J. Trevanion and
                  Sarah Dyer and
                  Peter W. Harrison and
                  Kevin L. Howe and
                  Andrew D. Yates and
                  Daniel R. Zerbino and
                  Paul Flicek},
  title        = {Ensembl 2022},
  journal      = {Nucleic Acids Res.},
  volume       = {50},
  number       = {{D1}},
  pages        = {988--995},
  year         = {2022},
  url          = {https://doi.org/10.1093/nar/gkab1049},
  doi          = {10.1093/NAR/GKAB1049},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/CunninghamAAAAA22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/VaradiADNNYYSWL22,
  author       = {Mihaly Varadi and
                  Stephen Anyango and
                  Mandar S. Deshpande and
                  Sreenath Nair and
                  Cindy Natassia and
                  Galabina Yordanova and
                  David Yuan and
                  Oana Stroe and
                  Gemma Wood and
                  Agata Laydon and
                  Augustin Z{\'{\i}}dek and
                  Tim Green and
                  Kathryn Tunyasuvunakool and
                  Stig Petersen and
                  John Jumper and
                  Ellen Clancy and
                  Richard Green and
                  Ankur Vora and
                  Mira Lutfi and
                  Michael Figurnov and
                  Andrew Cowie and
                  Nicole Hobbs and
                  Pushmeet Kohli and
                  Gerard J. Kleywegt and
                  Ewan Birney and
                  Demis Hassabis and
                  Sameer Velankar},
  title        = {AlphaFold Protein Structure Database: massively expanding the structural
                  coverage of protein-sequence space with high-accuracy models},
  journal      = {Nucleic Acids Res.},
  volume       = {50},
  number       = {{D1}},
  pages        = {439--444},
  year         = {2022},
  url          = {https://doi.org/10.1093/nar/gkab1061},
  doi          = {10.1093/NAR/GKAB1061},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/VaradiADNNYYSWL22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/YatesAAABBBCMCC22,
  author       = {Andrew D. Yates and
                  James E. Allen and
                  M. Ridwan Amode and
                  Andrey G. Azov and
                  Matthieu Barba and
                  Andr{\'{e}}s Becerra and
                  Jyothish Bhai and
                  Lahcen I. Campbell and
                  Manuel Carbajo Martinez and
                  Marc Chakiachvili and
                  Kapeel Chougule and
                  Mikkel B. Christensen and
                  Bruno Contreras{-}Moreira and
                  Alayne Cuzick and
                  Luca Da Rin Fioretto and
                  Paul Davis and
                  Nishadi De Silva and
                  Stavros Diamantakis and
                  Sarah Dyer and
                  Justin Elser and
                  Carla V. Filippi and
                  Astrid Gall and
                  Dionysios Grigoriadis and
                  Cristina Guijarro{-}Clarke and
                  Parul Gupta and
                  Kim E. Hammond{-}Kosack and
                  Kevin L. Howe and
                  Pankaj Jaiswal and
                  Vinay Kaikala and
                  Vivek Kumar and
                  Sunita Kumari and
                  Nick Langridge and
                  Tuan Le and
                  Manuel Luypaert and
                  Gareth Maslen and
                  Thomas Maurel and
                  Benjamin Moore and
                  Matthieu Muffato and
                  Aleena Mushtaq and
                  Guy Naamati and
                  Sushma Naithani and
                  Andrew Olson and
                  Anne Parker and
                  Michael Paulini and
                  Helder Pedro and
                  Emily Perry and
                  Justin Preece and
                  Mark Quinton{-}Tulloch and
                  Faye Rodgers and
                  Marc Rosello and
                  Magali Ruffier and
                  James Seager and
                  Vasily Sitnik and
                  Michal Szpak and
                  John G. Tate and
                  Marcela K. Tello{-}Ruiz and
                  Stephen J. Trevanion and
                  Martin Urban and
                  Doreen Ware and
                  Sharon Wei and
                  Gary Williams and
                  Andrea Winterbottom and
                  Magdalena Zarowiecki and
                  Robert D. Finn and
                  Paul Flicek},
  title        = {Ensembl Genomes 2022: an expanding genome resource for non-vertebrates},
  journal      = {Nucleic Acids Res.},
  volume       = {50},
  number       = {{D1}},
  pages        = {996--1003},
  year         = {2022},
  url          = {https://doi.org/10.1093/nar/gkab1007},
  doi          = {10.1093/NAR/GKAB1007},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/YatesAAABBBCMCC22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/WallacePBMZSMLT22,
  author       = {Grant Wallace and
                  Stephen Polcyn and
                  Paula P. Brooks and
                  Anne C. Mennen and
                  Ke Zhao and
                  Paul S. Scotti and
                  Sebastian Michelmann and
                  Kai Li and
                  Nicholas B. Turk{-}Browne and
                  Jonathan D. Cohen and
                  Kenneth A. Norman},
  title        = {RT-Cloud: {A} cloud-based software framework to simplify and standardize
                  real-time fMRI},
  journal      = {NeuroImage},
  volume       = {257},
  pages        = {119295},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.neuroimage.2022.119295},
  doi          = {10.1016/J.NEUROIMAGE.2022.119295},
  timestamp    = {Thu, 30 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/neuroimage/WallacePBMZSMLT22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/ZhangCZTXSWCW22,
  author       = {Gemeng Zhang and
                  Biao Cai and
                  Aiying Zhang and
                  Zhuozhuo Tu and
                  Li Xiao and
                  Julia M. Stephen and
                  Tony W. Wilson and
                  Vince D. Calhoun and
                  Yu{-}Ping Wang},
  title        = {Detecting abnormal connectivity in schizophrenia via a joint directed
                  acyclic graph estimation model},
  journal      = {NeuroImage},
  volume       = {260},
  pages        = {119451},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.neuroimage.2022.119451},
  doi          = {10.1016/J.NEUROIMAGE.2022.119451},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/neuroimage/ZhangCZTXSWCW22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spm/AdaliGHMS22,
  author       = {T{\"{u}}lay Adali and
                  Rodrigo Capobianco Guido and
                  Tin Kam Ho and
                  Klaus{-}Robert M{\"{u}}ller and
                  Stephen C. Strother},
  title        = {Interpretability, Reproducibility, and Replicability [From the Guest
                  Editors]},
  journal      = {{IEEE} Signal Process. Mag.},
  volume       = {39},
  number       = {4},
  pages        = {5--7},
  year         = {2022},
  url          = {https://doi.org/10.1109/MSP.2022.3170665},
  doi          = {10.1109/MSP.2022.3170665},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/spm/AdaliGHMS22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spm/AdaliKASCA22,
  author       = {T{\"{u}}lay Adali and
                  Furkan Kantar and
                  Mohammad Abu Baker Siddique Akhonda and
                  Stephen C. Strother and
                  Vince D. Calhoun and
                  Evrim Acar},
  title        = {Reproducibility in Matrix and Tensor Decompositions: Focus on model
                  match, interpretability, and uniqueness},
  journal      = {{IEEE} Signal Process. Mag.},
  volume       = {39},
  number       = {4},
  pages        = {8--24},
  year         = {2022},
  url          = {https://doi.org/10.1109/MSP.2022.3163870},
  doi          = {10.1109/MSP.2022.3163870},
  timestamp    = {Mon, 28 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/spm/AdaliKASCA22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcc/HollimanACDJT22,
  author       = {Nicolas S. Holliman and
                  Manu Antony and
                  James Charlton and
                  Stephen Dowsland and
                  Philip James and
                  Mark Turner},
  title        = {Petascale Cloud Supercomputing for Terapixel Visualization of a Digital
                  Twin},
  journal      = {{IEEE} Trans. Cloud Comput.},
  volume       = {10},
  number       = {1},
  pages        = {583--594},
  year         = {2022},
  url          = {https://doi.org/10.1109/TCC.2019.2958087},
  doi          = {10.1109/TCC.2019.2958087},
  timestamp    = {Fri, 01 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcc/HollimanACDJT22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/KuhrmannTHKMLPF22,
  author       = {Marco Kuhrmann and
                  Paolo Tell and
                  Regina Hebig and
                  Jil Kl{\"{u}}nder and
                  J{\"{u}}rgen M{\"{u}}nch and
                  Oliver Linssen and
                  Dietmar Pfahl and
                  Michael Felderer and
                  Christian R. Prause and
                  Stephen G. MacDonell and
                  Joyce Nakatumba{-}Nabende and
                  David Raffo and
                  Sarah Beecham and
                  Eray T{\"{u}}z{\"{u}}n and
                  Gustavo L{\'{o}}pez and
                  Nicol{\'{a}}s Paez and
                  Diego Fontdevila and
                  Sherlock A. Licorish and
                  Steffen K{\"{u}}pper and
                  G{\"{u}}nther Ruhe and
                  Eric Knauss and
                  {\"{O}}zden {\"{O}}zcan{-}Top and
                  Paul M. Clarke and
                  Fergal McCaffery and
                  Marcela Genero and
                  Aurora Vizca{\'{\i}}no and
                  Mario Piattini and
                  Marcos Kalinowski and
                  Tayana Conte and
                  Rafael Prikladnicki and
                  Stephan Krusche and
                  Ahmet Coskun{\c{c}}ay and
                  Ezequiel Scott and
                  Fabio Calefato and
                  Svetlana Pimonova and
                  Rolf{-}Helge Pfeiffer and
                  Ulrik Pagh Schultz and
                  Rogardt Heldal and
                  Masud Fazal{-}Baqaie and
                  Craig Anslow and
                  Maleknaz Nayebi and
                  Kurt Schneider and
                  Stefan Sauer and
                  Dietmar Winkler and
                  Stefan Biffl and
                  Mar{\'{\i}}a Cecilia Bastarrica and
                  Ita Richardson},
  title        = {What Makes Agile Software Development Agile?},
  journal      = {{IEEE} Trans. Software Eng.},
  volume       = {48},
  number       = {9},
  pages        = {3523--3539},
  year         = {2022},
  url          = {https://doi.org/10.1109/TSE.2021.3099532},
  doi          = {10.1109/TSE.2021.3099532},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tse/KuhrmannTHKMLPF22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acis/Lam0S22,
  author       = {Yuk Tung Tonnie Lam and
                  Peter Busch and
                  Stephen Smith},
  title        = {Australia's Embrace of a Cashless Society: {A} Quantitative Analysis},
  booktitle    = {Australasian Conference on Information Systems, {ACIS} 2022, Melbourne,
                  Australia, December 4-7, 2022},
  pages        = {24},
  year         = {2022},
  url          = {https://aisel.aisnet.org/acis2022/24},
  timestamp    = {Thu, 16 May 2024 17:06:12 +0200},
  biburl       = {https://dblp.org/rec/conf/acis/Lam0S22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl-louhi/TuDC22,
  author       = {Sichang Tu and
                  Stephen Doogan and
                  Jinho D. Choi},
  editor       = {Alberto Lavelli and
                  Eben Holderness and
                  Antonio Jimeno{-}Yepes and
                  Anne{-}Lyse Minard and
                  James Pustejovsky and
                  Fabio Rinaldi},
  title        = {Condition-Treatment Relation Extraction on Disease-related Social
                  Media Data},
  booktitle    = {Proceedings of the 13th International Workshop on Health Text Mining
                  and Information Analysis, LOUHI@EMNLP 2022, Abu Dhabi, United Arab
                  Emirates (Hybrid), December 7, 2022},
  pages        = {218--228},
  publisher    = {Association for Computational Linguistics},
  year         = {2022},
  url          = {https://doi.org/10.18653/v1/2022.louhi-1.24},
  doi          = {10.18653/V1/2022.LOUHI-1.24},
  timestamp    = {Thu, 10 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/acl-louhi/TuDC22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aistats/BoffiTS22,
  author       = {Nicholas M. Boffi and
                  Stephen Tu and
                  Jean{-}Jacques E. Slotine},
  editor       = {Gustau Camps{-}Valls and
                  Francisco J. R. Ruiz and
                  Isabel Valera},
  title        = {The role of optimization geometry in single neuron learning},
  booktitle    = {International Conference on Artificial Intelligence and Statistics,
                  {AISTATS} 2022, 28-30 March 2022, Virtual Event},
  series       = {Proceedings of Machine Learning Research},
  volume       = {151},
  pages        = {11528--11549},
  publisher    = {{PMLR}},
  year         = {2022},
  url          = {https://proceedings.mlr.press/v151/boffi22a.html},
  timestamp    = {Sat, 30 Sep 2023 09:34:08 +0200},
  biburl       = {https://dblp.org/rec/conf/aistats/BoffiTS22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aistats/LanTOAB22,
  author       = {Charline Le Lan and
                  Stephen Tu and
                  Adam Oberman and
                  Rishabh Agarwal and
                  Marc G. Bellemare},
  editor       = {Gustau Camps{-}Valls and
                  Francisco J. R. Ruiz and
                  Isabel Valera},
  title        = {On the Generalization of Representations in Reinforcement Learning},
  booktitle    = {International Conference on Artificial Intelligence and Statistics,
                  {AISTATS} 2022, 28-30 March 2022, Virtual Event},
  series       = {Proceedings of Machine Learning Research},
  volume       = {151},
  pages        = {4132--4157},
  publisher    = {{PMLR}},
  year         = {2022},
  url          = {https://proceedings.mlr.press/v151/le-lan22a.html},
  timestamp    = {Fri, 20 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/aistats/LanTOAB22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aistats/ShengCCSJ22,
  author       = {Stephen Sheng and
                  Keerthi Vasan G. C and
                  Chi Po P. Choi and
                  James Sharpnack and
                  Tucker Jones},
  editor       = {Gustau Camps{-}Valls and
                  Francisco J. R. Ruiz and
                  Isabel Valera},
  title        = {An Unsupervised Hunt for Gravitational Lenses},
  booktitle    = {International Conference on Artificial Intelligence and Statistics,
                  {AISTATS} 2022, 28-30 March 2022, Virtual Event},
  series       = {Proceedings of Machine Learning Research},
  volume       = {151},
  pages        = {9827--9843},
  publisher    = {{PMLR}},
  year         = {2022},
  url          = {https://proceedings.mlr.press/v151/sheng22a.html},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/aistats/ShengCCSJ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/WangWAALMRTT0S22,
  author       = {Xiaochen Wang and
                  Yue Wang and
                  Jos{\'{e}} Luis Ambite and
                  Abhishek M. Appaji and
                  Howard Lander and
                  Stephen Moore and
                  Arcot Rajasekar and
                  Jessica A. D. Turner and
                  Matthew D. Turner and
                  Lei Wang and
                  Satya S. Sahoo},
  title        = {Enabling Scientific Reproducibility through {FAIR} Data Management:
                  An ontology-driven deep learning approach in the NeuroBridge Project},
  booktitle    = {{AMIA} 2022, American Medical Informatics Association Annual Symposium,
                  Washington, DC, USA, November 5-9, 2022},
  publisher    = {{AMIA}},
  year         = {2022},
  url          = {https://knowledge.amia.org/76677-amia-1.4637602/f006-1.4642154/f006-1.4642155/1055-1.4642198/1165-1.4642195},
  timestamp    = {Wed, 14 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/amia/WangWAALMRTT0S22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/corl/XiaoZCLFVTSXXPK22,
  author       = {Xuesu Xiao and
                  Tingnan Zhang and
                  Krzysztof Marcin Choromanski and
                  Tsang{-}Wei Edward Lee and
                  Anthony G. Francis and
                  Jake Varley and
                  Stephen Tu and
                  Sumeet Singh and
                  Peng Xu and
                  Fei Xia and
                  Sven Mikael Persson and
                  Dmitry Kalashnikov and
                  Leila Takayama and
                  Roy Frostig and
                  Jie Tan and
                  Carolina Parada and
                  Vikas Sindhwani},
  editor       = {Karen Liu and
                  Dana Kulic and
                  Jeffrey Ichnowski},
  title        = {Learning Model Predictive Controllers with Real-Time Attention for
                  Real-World Navigation},
  booktitle    = {Conference on Robot Learning, CoRL 2022, 14-18 December 2022, Auckland,
                  New Zealand},
  series       = {Proceedings of Machine Learning Research},
  volume       = {205},
  pages        = {1708--1721},
  publisher    = {{PMLR}},
  year         = {2022},
  url          = {https://proceedings.mlr.press/v205/xiao23a.html},
  timestamp    = {Tue, 12 Nov 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/corl/XiaoZCLFVTSXXPK22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/WangNSLZHL22,
  author       = {Ziyan Wang and
                  Giljoo Nam and
                  Tuur Stuyck and
                  Stephen Lombardi and
                  Michael Zollh{\"{o}}fer and
                  Jessica K. Hodgins and
                  Christoph Lassner},
  title        = {{HVH:} Learning a Hybrid Neural Volumetric Representation for Dynamic
                  Hair Performance Capture},
  booktitle    = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2022, New Orleans, LA, USA, June 18-24, 2022},
  pages        = {6133--6144},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/CVPR52688.2022.00605},
  doi          = {10.1109/CVPR52688.2022.00605},
  timestamp    = {Wed, 05 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/WangNSLZHL22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/data/OdebodeTAS22,
  author       = {Afees Adegoke Odebode and
                  Allan Tucker and
                  Mahir Arzoky and
                  Stephen Swift},
  editor       = {Alfredo Cuzzocrea and
                  Oleg Gusikhin and
                  Wil M. P. van der Aalst and
                  Slimane Hammoudi},
  title        = {Estimating the Optimal Number of Clusters from Subsets of Ensembles},
  booktitle    = {Proceedings of the 11th International Conference on Data Science,
                  Technology and Applications, {DATA} 2022, Lisbon, Portugal, July 11-13,
                  2022},
  pages        = {383--391},
  publisher    = {{SCITEPRESS}},
  year         = {2022},
  url          = {https://doi.org/10.5220/0011275000003269},
  doi          = {10.5220/0011275000003269},
  timestamp    = {Tue, 06 Jun 2023 14:58:01 +0200},
  biburl       = {https://dblp.org/rec/conf/data/OdebodeTAS22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/BoonyakitanontG22,
  author       = {Poomipat Boonyakitanont and
                  Ben Gabrielson and
                  Irina Belyaeva and
                  Parthan Olikkal and
                  Jitkomut Songsiri and
                  Yu{-}Ping Wang and
                  Tony W. Wilson and
                  Vince D. Calhoun and
                  Julia M. Stephen and
                  T{\"{u}}lay Adali},
  title        = {An ICA-based framework for joint analysis of cognitive scores and
                  {MEG} event-related fields},
  booktitle    = {44th Annual International Conference of the {IEEE} Engineering in
                  Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland,
                  United Kingdom, July 11-15, 2022},
  pages        = {3594--3598},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/EMBC48229.2022.9871122},
  doi          = {10.1109/EMBC48229.2022.9871122},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/embc/BoonyakitanontG22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/RojasSCPTW22,
  author       = {Erick Rojas and
                  Stephen L. Schmidt and
                  Afsana Chowdhury and
                  Miroslav Pajic and
                  Dennis A. Turner and
                  Deborah S. Won},
  title        = {A comparison of an implanted accelerometer with a wearable accelerometer
                  for closed-loop {DBS}},
  booktitle    = {44th Annual International Conference of the {IEEE} Engineering in
                  Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland,
                  United Kingdom, July 11-15, 2022},
  pages        = {3439--3442},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/EMBC48229.2022.9871232},
  doi          = {10.1109/EMBC48229.2022.9871232},
  timestamp    = {Thu, 22 Sep 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/embc/RojasSCPTW22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccps/GaoSKTGP22,
  author       = {Qitong Gao and
                  Stephen L. Schmidt and
                  Karthik Kamaravelu and
                  Dennis A. Turner and
                  Warren M. Grill and
                  Miroslav Pajic},
  title        = {Offline Policy Evaluation for Learning-based Deep Brain Stimulation
                  Controllers},
  booktitle    = {13th {ACM/IEEE} International Conference on Cyber-Physical Systems,
                  {ICCPS} 2022, Milano, Italy, May 4-6, 2022},
  pages        = {80--91},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/ICCPS54341.2022.00014},
  doi          = {10.1109/ICCPS54341.2022.00014},
  timestamp    = {Wed, 29 Jun 2022 17:24:41 +0200},
  biburl       = {https://dblp.org/rec/conf/iccps/GaoSKTGP22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdh/TurnerSH22,
  author       = {Alexander P. Turner and
                  David Scott and
                  Stephen Hayes},
  editor       = {Sheikh Iqbal Ahamed and
                  Claudio Agostino Ardagna and
                  Hongyi Bian and
                  Mario A. Bochicchio and
                  Carl K. Chang and
                  Rong N. Chang and
                  Ernesto Damiani and
                  Lin Liu and
                  Misha Pavel and
                  Corrado Priami and
                  Hossain Shahriar and
                  Robert Ward and
                  Fatos Xhafa and
                  Jia Zhang and
                  Farhana H. Zulkernine},
  title        = {The Classification of Multiple Interacting Gait Abnormalities Using
                  Insole Sensors and Machine Learning},
  booktitle    = {{IEEE} International Conference on Digital Health, {ICDH} 2022, Barcelona,
                  Spain, July 10-16, 2022},
  pages        = {69--76},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/ICDH55609.2022.00020},
  doi          = {10.1109/ICDH55609.2022.00020},
  timestamp    = {Tue, 20 Aug 2024 07:54:45 +0200},
  biburl       = {https://dblp.org/rec/conf/icdh/TurnerSH22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icimth/BranescuaST22,
  author       = {Marinela Branescu and
                  Stephen Swift and
                  Allan Tucker},
  editor       = {John Mantas and
                  Parisis Gallos and
                  Emmanouil Zoulias and
                  Arie Hasman and
                  Mowafa S. Househ and
                  Marianna Diomidous and
                  Joseph Liaskos and
                  Martha Charalampidou},
  title        = {A Comparison of Convolutional Neural Networks and Traditional Feature-Based
                  Classification Applied to Leukaemia Image Analysis},
  booktitle    = {Advances in Informatics, Management and Technology in Healthcare,
                  {ICIMTH} 2022, 20th International Conference on Informatics, Management,
                  and Technology in Healthcare, Virtual Event / Athens, Greece, 1-3
                  July 2022},
  series       = {Studies in Health Technology and Informatics},
  volume       = {295},
  pages        = {545--550},
  publisher    = {{IOS} Press},
  year         = {2022},
  url          = {https://doi.org/10.3233/SHTI220786},
  doi          = {10.3233/SHTI220786},
  timestamp    = {Wed, 03 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icimth/BranescuaST22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmla/AlLuhaybiSCT22,
  author       = {Mashael Al{-}Luhaybi and
                  Stephen Swift and
                  Steve Counsell and
                  Allan Tucker},
  editor       = {M. Arif Wani and
                  Mehmed M. Kantardzic and
                  Vasile Palade and
                  Daniel Neagu and
                  Longzhi Yang and
                  Kit Yan Chan},
  title        = {Exploring the Explicit Modelling of Bias in Machine Learning Classifiers:
                  {A} Deep Multi-label ConvNet Approach},
  booktitle    = {21st {IEEE} International Conference on Machine Learning and Applications,
                  {ICMLA} 2022, Nassau, Bahamas, December 12-14, 2022},
  pages        = {1799--1806},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/ICMLA55696.2022.00277},
  doi          = {10.1109/ICMLA55696.2022.00277},
  timestamp    = {Wed, 29 Mar 2023 19:23:50 +0200},
  biburl       = {https://dblp.org/rec/conf/icmla/AlLuhaybiSCT22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kdd/FitzGeraldAABBB22,
  author       = {Jack FitzGerald and
                  Shankar Ananthakrishnan and
                  Konstantine Arkoudas and
                  Davide Bernardi and
                  Abhishek Bhagia and
                  Claudio Delli Bovi and
                  Jin Cao and
                  Rakesh Chada and
                  Amit Chauhan and
                  Luoxin Chen and
                  Anurag Dwarakanath and
                  Satyam Dwivedi and
                  Turan Gojayev and
                  Karthik Gopalakrishnan and
                  Thomas Gueudr{\'{e}} and
                  Dilek Hakkani{-}Tur and
                  Wael Hamza and
                  Jonathan J. H{\"{u}}ser and
                  Kevin Martin Jose and
                  Haidar Khan and
                  Beiye Liu and
                  Jianhua Lu and
                  Alessandro Manzotti and
                  Pradeep Natarajan and
                  Karolina Owczarzak and
                  Gokmen Oz and
                  Enrico Palumbo and
                  Charith Peris and
                  Chandana Satya Prakash and
                  Stephen Rawls and
                  Andy Rosenbaum and
                  Anjali Shenoy and
                  Saleh Soltan and
                  Mukund Harakere Sridhar and
                  Lizhen Tan and
                  Fabian Triefenbach and
                  Pan Wei and
                  Haiyang Yu and
                  Shuai Zheng and
                  G{\"{o}}khan T{\"{u}}r and
                  Prem Natarajan},
  editor       = {Aidong Zhang and
                  Huzefa Rangwala},
  title        = {Alexa Teacher Model: Pretraining and Distilling Multi-Billion-Parameter
                  Encoders for Natural Language Understanding Systems},
  booktitle    = {{KDD} '22: The 28th {ACM} {SIGKDD} Conference on Knowledge Discovery
                  and Data Mining, Washington, DC, USA, August 14 - 18, 2022},
  pages        = {2893--2902},
  publisher    = {{ACM}},
  year         = {2022},
  url          = {https://doi.org/10.1145/3534678.3539173},
  doi          = {10.1145/3534678.3539173},
  timestamp    = {Tue, 06 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/kdd/FitzGeraldAABBB22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/DrummondDTPA22,
  author       = {Ross Drummond and
                  Stephen Duncan and
                  Mathew Turner and
                  Patricia Pauli and
                  Frank Allg{\"{o}}wer},
  editor       = {Roya Firoozi and
                  Negar Mehr and
                  Esen Yel and
                  Rika Antonova and
                  Jeannette Bohg and
                  Mac Schwager and
                  Mykel J. Kochenderfer},
  title        = {Bounding the Difference Between Model Predictive Control and Neural
                  Networks},
  booktitle    = {Learning for Dynamics and Control Conference, {L4DC} 2022, 23-24 June
                  2022, Stanford University, Stanford, CA, {USA}},
  series       = {Proceedings of Machine Learning Research},
  volume       = {168},
  pages        = {817--829},
  publisher    = {{PMLR}},
  year         = {2022},
  url          = {https://proceedings.mlr.press/v168/drummond22a.html},
  timestamp    = {Fri, 20 May 2022 14:36:40 +0200},
  biburl       = {https://dblp.org/rec/conf/l4dc/DrummondDTPA22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/TuRZM22,
  author       = {Stephen Tu and
                  Alexander Robey and
                  Tingnan Zhang and
                  Nikolai Matni},
  editor       = {Roya Firoozi and
                  Negar Mehr and
                  Esen Yel and
                  Rika Antonova and
                  Jeannette Bohg and
                  Mac Schwager and
                  Mykel J. Kochenderfer},
  title        = {On the Sample Complexity of Stability Constrained Imitation Learning},
  booktitle    = {Learning for Dynamics and Control Conference, {L4DC} 2022, 23-24 June
                  2022, Stanford University, Stanford, CA, {USA}},
  series       = {Proceedings of Machine Learning Research},
  volume       = {168},
  pages        = {180--191},
  publisher    = {{PMLR}},
  year         = {2022},
  url          = {https://proceedings.mlr.press/v168/tu22a.html},
  timestamp    = {Fri, 20 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/l4dc/TuRZM22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/ZhangTBSM22,
  author       = {Thomas T. C. K. Zhang and
                  Stephen Tu and
                  Nicholas M. Boffi and
                  Jean{-}Jacques E. Slotine and
                  Nikolai Matni},
  editor       = {Roya Firoozi and
                  Negar Mehr and
                  Esen Yel and
                  Rika Antonova and
                  Jeannette Bohg and
                  Mac Schwager and
                  Mykel J. Kochenderfer},
  title        = {Adversarially Robust Stability Certificates can be Sample-Efficient},
  booktitle    = {Learning for Dynamics and Control Conference, {L4DC} 2022, 23-24 June
                  2022, Stanford University, Stanford, CA, {USA}},
  series       = {Proceedings of Machine Learning Research},
  volume       = {168},
  pages        = {532--545},
  publisher    = {{PMLR}},
  year         = {2022},
  url          = {https://proceedings.mlr.press/v168/zhang22a.html},
  timestamp    = {Fri, 20 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/l4dc/ZhangTBSM22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mibam/ShieldsWVTIBR22,
  author       = {Allison Shields and
                  Kyle A. Williams and
                  Sricharan S. Veeturi and
                  Vincent M. Tutino and
                  Ciprian N. Ionita and
                  Daniel R. Bednarek and
                  Stephen Rudin},
  editor       = {Barjor S. Gimi and
                  Andrzej Kr{\'{o}}l},
  title        = {Initial evaluation of 2D and 3D simulated high-speed 1000 fps vascular
                  contrast-flow image sequences using computational fluid dynamics {(CFD)}},
  booktitle    = {Medical Imaging 2022: Biomedical Applications in Molecular, Structural,
                  and Functional Imaging, San Diego, CA, USA, February 20-24, 2022 /
                  Online, March 21-27, 2022},
  series       = {{SPIE} Proceedings},
  volume       = {12036},
  publisher    = {{SPIE}},
  year         = {2022},
  url          = {https://doi.org/10.1117/12.2611170},
  doi          = {10.1117/12.2611170},
  timestamp    = {Thu, 21 Mar 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/mibam/ShieldsWVTIBR22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mtsr/TuM22,
  author       = {Wen Ting Maria Tu and
                  Stephen Makonin},
  editor       = {Emmanouel Garoufallou and
                  Andreas Vlachidis},
  title        = {Designing PIDs for Reproducible Science Using Time-Series Data},
  booktitle    = {Metadata and Semantic Research - 16th Research Conference, {MTSR}
                  2022, London, UK, November 7-11, 2022, Revised Selected Papers},
  series       = {Communications in Computer and Information Science},
  volume       = {1789},
  pages        = {295--301},
  publisher    = {Springer},
  year         = {2022},
  url          = {https://doi.org/10.1007/978-3-031-39141-5\_25},
  doi          = {10.1007/978-3-031-39141-5\_25},
  timestamp    = {Tue, 05 Sep 2023 18:04:38 +0200},
  biburl       = {https://dblp.org/rec/conf/mtsr/TuM22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/PfrommerZTM22,
  author       = {Daniel Pfrommer and
                  Thomas T. C. K. Zhang and
                  Stephen Tu and
                  Nikolai Matni},
  editor       = {Sanmi Koyejo and
                  S. Mohamed and
                  A. Agarwal and
                  Danielle Belgrave and
                  K. Cho and
                  A. Oh},
  title        = {TaSIL: Taylor Series Imitation Learning},
  booktitle    = {Advances in Neural Information Processing Systems 35: Annual Conference
                  on Neural Information Processing Systems 2022, NeurIPS 2022, New Orleans,
                  LA, USA, November 28 - December 9, 2022},
  year         = {2022},
  url          = {http://papers.nips.cc/paper\_files/paper/2022/hash/7f10c3d66c3b7863a9cda255dcac5bb7-Abstract-Conference.html},
  timestamp    = {Mon, 08 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/nips/PfrommerZTM22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ZiemannT22,
  author       = {Ingvar M. Ziemann and
                  Stephen Tu},
  editor       = {Sanmi Koyejo and
                  S. Mohamed and
                  A. Agarwal and
                  Danielle Belgrave and
                  K. Cho and
                  A. Oh},
  title        = {Learning with little mixing},
  booktitle    = {Advances in Neural Information Processing Systems 35: Annual Conference
                  on Neural Information Processing Systems 2022, NeurIPS 2022, New Orleans,
                  LA, USA, November 28 - December 9, 2022},
  year         = {2022},
  url          = {http://papers.nips.cc/paper\_files/paper/2022/hash/1dc9fbdb6b4d9955ad377cb983232c9f-Abstract-Conference.html},
  timestamp    = {Mon, 08 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/nips/ZiemannT22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pkdd/Kara-IsittST22,
  author       = {Fawzia Zehra Kara{-}Isitt and
                  Stephen Swift and
                  Allan Tucker},
  editor       = {Irena Koprinska and
                  Paolo Mignone and
                  Riccardo Guidotti and
                  Szymon Jaroszewicz and
                  Holger Fr{\"{o}}ning and
                  Francesco Gullo and
                  Pedro M. Ferreira and
                  Damian Roqueiro and
                  Gaia Ceddia and
                  Slawomir Nowaczyk and
                  Jo{\~{a}}o Gama and
                  Rita P. Ribeiro and
                  Ricard Gavald{\`{a}} and
                  Elio Masciari and
                  Zbigniew W. Ras and
                  Ettore Ritacco and
                  Francesca Naretto and
                  Andreas Theissler and
                  Przemyslaw Biecek and
                  Wouter Verbeke and
                  Gregor Schiele and
                  Franz Pernkopf and
                  Michaela Blott and
                  Ilaria Bordino and
                  Ivan Luciano Danesi and
                  Giovanni Ponti and
                  Lorenzo Severini and
                  Annalisa Appice and
                  Giuseppina Andresini and
                  Ib{\'{e}}ria Medeiros and
                  Guilherme Gra{\c{c}}a and
                  Lee A. D. Cooper and
                  Naghmeh Ghazaleh and
                  Jonas Richiardi and
                  Diego Saldana Miranda and
                  Konstantinos Sechidis and
                  Arif Canakoglu and
                  Sara Pid{\`{o}} and
                  Pietro Pinoli and
                  Albert Bifet and
                  Sepideh Pashami},
  title        = {Intelligently Detecting Information Online-Weaponisation Trends {(IDIOT)}},
  booktitle    = {Machine Learning and Principles and Practice of Knowledge Discovery
                  in Databases - International Workshops of {ECML} {PKDD} 2022, Grenoble,
                  France, September 19-23, 2022, Proceedings, Part {I}},
  series       = {Communications in Computer and Information Science},
  volume       = {1752},
  pages        = {197--214},
  publisher    = {Springer},
  year         = {2022},
  url          = {https://doi.org/10.1007/978-3-031-23618-1\_13},
  doi          = {10.1007/978-3-031-23618-1\_13},
  timestamp    = {Fri, 11 Oct 2024 07:47:20 +0200},
  biburl       = {https://dblp.org/rec/conf/pkdd/Kara-IsittST22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/NishiPCSZTTN0DG22,
  author       = {Yoshinori Nishi and
                  John W. Poulton and
                  Xi Chen and
                  Sanquan Song and
                  Brian Zimmer and
                  Walker J. Turner and
                  Stephen G. Tell and
                  Nikola Nedovic and
                  John M. Wilson and
                  William J. Dally and
                  C. Thomas Gray},
  title        = {A 0.297-pJ/bit 50.4-Gb/s/wire Inverter-Based Short-Reach Simultaneous
                  Bidirectional Transceiver for Die-to-Die Interface in 5nm {CMOS}},
  booktitle    = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
                  and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022},
  pages        = {154--155},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830174},
  doi          = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830174},
  timestamp    = {Fri, 05 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/vlsit/NishiPCSZTTN0DG22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/PerolatVHTSBMCBAMECWGMK22,
  author       = {Julien P{\'{e}}rolat and
                  Bart De Vylder and
                  Daniel Hennes and
                  Eugene Tarassov and
                  Florian Strub and
                  Vincent de Boer and
                  Paul Muller and
                  Jerome T. Connor and
                  Neil Burch and
                  Thomas Anthony and
                  Stephen McAleer and
                  Romuald Elie and
                  Sarah H. Cen and
                  Zhe Wang and
                  Audrunas Gruslys and
                  Aleksandra Malysheva and
                  Mina Khan and
                  Sherjil Ozair and
                  Finbarr Timbers and
                  Toby Pohlen and
                  Tom Eccles and
                  Mark Rowland and
                  Marc Lanctot and
                  Jean{-}Baptiste Lespiau and
                  Bilal Piot and
                  Shayegan Omidshafiei and
                  Edward Lockhart and
                  Laurent Sifre and
                  Nathalie Beauguerlange and
                  R{\'{e}}mi Munos and
                  David Silver and
                  Satinder Singh and
                  Demis Hassabis and
                  Karl Tuyls},
  title        = {Figure Data for the paper "Mastering the Game of Stratego with Model-Free
                  Multiagent Reinforcement Learning" (Version 1)},
  publisher    = {Zenodo},
  year         = {2022},
  month        = oct,
  howpublished = {\url{https://doi.org/10.5281/zenodo.7118519}},
  note         = {Accessed on YYYY-MM-DD.},
  url          = {https://doi.org/10.5281/zenodo.7118519},
  doi          = {10.5281/ZENODO.7118519},
  timestamp    = {Mon, 28 Oct 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/data/10/PerolatVHTSBMCBAMECWGMK22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-07700,
  author       = {Stephen McAleer and
                  Kevin Wang and
                  John B. Lanier and
                  Marc Lanctot and
                  Pierre Baldi and
                  Tuomas Sandholm and
                  Roy Fox},
  title        = {Anytime {PSRO} for Two-Player Zero-Sum Games},
  journal      = {CoRR},
  volume       = {abs/2201.07700},
  year         = {2022},
  url          = {https://arxiv.org/abs/2201.07700},
  eprinttype    = {arXiv},
  eprint       = {2201.07700},
  timestamp    = {Thu, 28 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2201-07700.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-00543,
  author       = {Charline Le Lan and
                  Stephen Tu and
                  Adam Oberman and
                  Rishabh Agarwal and
                  Marc G. Bellemare},
  title        = {On the Generalization of Representations in Reinforcement Learning},
  journal      = {CoRR},
  volume       = {abs/2203.00543},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2203.00543},
  doi          = {10.48550/ARXIV.2203.00543},
  eprinttype    = {arXiv},
  eprint       = {2203.00543},
  timestamp    = {Wed, 16 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2203-00543.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-11216,
  author       = {Razin A. Shaikh and
                  Sara Sabrina Zemljic and
                  Sean Tull and
                  Stephen Clark},
  title        = {The Conceptual {VAE}},
  journal      = {CoRR},
  volume       = {abs/2203.11216},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2203.11216},
  doi          = {10.48550/ARXIV.2203.11216},
  eprinttype    = {arXiv},
  eprint       = {2203.11216},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2203-11216.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-17193,
  author       = {Stephen Tu and
                  Roy Frostig and
                  Mahdi Soltanolkotabi},
  title        = {Learning from many trajectories},
  journal      = {CoRR},
  volume       = {abs/2203.17193},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2203.17193},
  doi          = {10.48550/ARXIV.2203.17193},
  eprinttype    = {arXiv},
  eprint       = {2203.17193},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2203-17193.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-06486,
  author       = {Ross Drummond and
                  Stephen R. Duncan and
                  Matthew C. Turner and
                  Patricia Pauli and
                  Frank Allg{\"{o}}wer},
  title        = {Bounding the difference between model predictive control and neural
                  networks},
  journal      = {CoRR},
  volume       = {abs/2204.06486},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2204.06486},
  doi          = {10.48550/ARXIV.2204.06486},
  eprinttype    = {arXiv},
  eprint       = {2204.06486},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2204-06486.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-14812,
  author       = {Daniel Pfrommer and
                  Thomas T. C. K. Zhang and
                  Stephen Tu and
                  Nikolai Matni},
  title        = {TaSIL: Taylor Series Imitation Learning},
  journal      = {CoRR},
  volume       = {abs/2205.14812},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2205.14812},
  doi          = {10.48550/ARXIV.2205.14812},
  eprinttype    = {arXiv},
  eprint       = {2205.14812},
  timestamp    = {Wed, 01 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2205-14812.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-04122,
  author       = {Stephen McAleer and
                  Gabriele Farina and
                  Marc Lanctot and
                  Tuomas Sandholm},
  title        = {{ESCHER:} Eschewing Importance Sampling in Games by Computing a History
                  Value Function to Estimate Regret},
  journal      = {CoRR},
  volume       = {abs/2206.04122},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2206.04122},
  doi          = {10.48550/ARXIV.2206.04122},
  eprinttype    = {arXiv},
  eprint       = {2206.04122},
  timestamp    = {Tue, 14 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2206-04122.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-04615,
  author       = {Aarohi Srivastava and
                  Abhinav Rastogi and
                  Abhishek Rao and
                  Abu Awal Md Shoeb and
                  Abubakar Abid and
                  Adam Fisch and
                  Adam R. Brown and
                  Adam Santoro and
                  Aditya Gupta and
                  Adri{\`{a}} Garriga{-}Alonso and
                  Agnieszka Kluska and
                  Aitor Lewkowycz and
                  Akshat Agarwal and
                  Alethea Power and
                  Alex Ray and
                  Alex Warstadt and
                  Alexander W. Kocurek and
                  Ali Safaya and
                  Ali Tazarv and
                  Alice Xiang and
                  Alicia Parrish and
                  Allen Nie and
                  Aman Hussain and
                  Amanda Askell and
                  Amanda Dsouza and
                  Ambrose Slone and
                  Ameet Rahane and
                  Anantharaman S. Iyer and
                  Anders Andreassen and
                  Andrea Madotto and
                  Andrea Santilli and
                  Andreas Stuhlm{\"{u}}ller and
                  Andrew M. Dai and
                  Andrew La and
                  Andrew K. Lampinen and
                  Andy Zou and
                  Angela Jiang and
                  Angelica Chen and
                  Anh Vuong and
                  Animesh Gupta and
                  Anna Gottardi and
                  Antonio Norelli and
                  Anu Venkatesh and
                  Arash Gholamidavoodi and
                  Arfa Tabassum and
                  Arul Menezes and
                  Arun Kirubarajan and
                  Asher Mullokandov and
                  Ashish Sabharwal and
                  Austin Herrick and
                  Avia Efrat and
                  Aykut Erdem and
                  Ayla Karakas and
                  B. Ryan Roberts and
                  Bao Sheng Loe and
                  Barret Zoph and
                  Bartlomiej Bojanowski and
                  Batuhan {\"{O}}zyurt and
                  Behnam Hedayatnia and
                  Behnam Neyshabur and
                  Benjamin Inden and
                  Benno Stein and
                  Berk Ekmekci and
                  Bill Yuchen Lin and
                  Blake Howald and
                  Bryan Orinion and
                  Cameron Diao and
                  Cameron Dour and
                  Catherine Stinson and
                  Cedrick Argueta and
                  C{\`{e}}sar Ferri Ram{\'{\i}}rez and
                  Chandan Singh and
                  Charles Rathkopf and
                  Chenlin Meng and
                  Chitta Baral and
                  Chiyu Wu and
                  Chris Callison{-}Burch and
                  Chris Waites and
                  Christian Voigt and
                  Christopher D. Manning and
                  Christopher Potts and
                  Cindy Ramirez and
                  Clara E. Rivera and
                  Clemencia Siro and
                  Colin Raffel and
                  Courtney Ashcraft and
                  Cristina Garbacea and
                  Damien Sileo and
                  Dan Garrette and
                  Dan Hendrycks and
                  Dan Kilman and
                  Dan Roth and
                  Daniel Freeman and
                  Daniel Khashabi and
                  Daniel Levy and
                  Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and
                  Danielle Perszyk and
                  Danny Hernandez and
                  Danqi Chen and
                  Daphne Ippolito and
                  Dar Gilboa and
                  David Dohan and
                  David Drakard and
                  David Jurgens and
                  Debajyoti Datta and
                  Deep Ganguli and
                  Denis Emelin and
                  Denis Kleyko and
                  Deniz Yuret and
                  Derek Chen and
                  Derek Tam and
                  Dieuwke Hupkes and
                  Diganta Misra and
                  Dilyar Buzan and
                  Dimitri Coelho Mollo and
                  Diyi Yang and
                  Dong{-}Ho Lee and
                  Dylan Schrader and
                  Ekaterina Shutova and
                  Ekin Dogus Cubuk and
                  Elad Segal and
                  Eleanor Hagerman and
                  Elizabeth Barnes and
                  Elizabeth Donoway and
                  Ellie Pavlick and
                  Emanuele Rodol{\`{a}} and
                  Emma Lam and
                  Eric Chu and
                  Eric Tang and
                  Erkut Erdem and
                  Ernie Chang and
                  Ethan A. Chi and
                  Ethan Dyer and
                  Ethan J. Jerzak and
                  Ethan Kim and
                  Eunice Engefu Manyasi and
                  Evgenii Zheltonozhskii and
                  Fanyue Xia and
                  Fatemeh Siar and
                  Fernando Mart{\'{\i}}nez{-}Plumed and
                  Francesca Happ{\'{e}} and
                  Fran{\c{c}}ois Chollet and
                  Frieda Rong and
                  Gaurav Mishra and
                  Genta Indra Winata and
                  Gerard de Melo and
                  Germ{\'{a}}n Kruszewski and
                  Giambattista Parascandolo and
                  Giorgio Mariani and
                  Gloria Wang and
                  Gonzalo Jaimovitch{-}L{\'{o}}pez and
                  Gregor Betz and
                  Guy Gur{-}Ari and
                  Hana Galijasevic and
                  Hannah Kim and
                  Hannah Rashkin and
                  Hannaneh Hajishirzi and
                  Harsh Mehta and
                  Hayden Bogar and
                  Henry Shevlin and
                  Hinrich Sch{\"{u}}tze and
                  Hiromu Yakura and
                  Hongming Zhang and
                  Hugh Mee Wong and
                  Ian Ng and
                  Isaac Noble and
                  Jaap Jumelet and
                  Jack Geissinger and
                  Jackson Kernion and
                  Jacob Hilton and
                  Jaehoon Lee and
                  Jaime Fern{\'{a}}ndez Fisac and
                  James B. Simon and
                  James Koppel and
                  James Zheng and
                  James Zou and
                  Jan Kocon and
                  Jana Thompson and
                  Janelle Wingfield and
                  Jared Kaplan and
                  Jarema Radom and
                  Jascha Sohl{-}Dickstein and
                  Jason Phang and
                  Jason Wei and
                  Jason Yosinski and
                  Jekaterina Novikova and
                  Jelle Bosscher and
                  Jennifer Marsh and
                  Jeremy Kim and
                  Jeroen Taal and
                  Jesse H. Engel and
                  Jesujoba Alabi and
                  Jiacheng Xu and
                  Jiaming Song and
                  Jillian Tang and
                  Joan Waweru and
                  John Burden and
                  John Miller and
                  John U. Balis and
                  Jonathan Batchelder and
                  Jonathan Berant and
                  J{\"{o}}rg Frohberg and
                  Jos Rozen and
                  Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
                  Joseph Boudeman and
                  Joseph Guerr and
                  Joseph Jones and
                  Joshua B. Tenenbaum and
                  Joshua S. Rule and
                  Joyce Chua and
                  Kamil Kanclerz and
                  Karen Livescu and
                  Karl Krauth and
                  Karthik Gopalakrishnan and
                  Katerina Ignatyeva and
                  Katja Markert and
                  Kaustubh D. Dhole and
                  Kevin Gimpel and
                  Kevin Omondi and
                  Kory Mathewson and
                  Kristen Chiafullo and
                  Ksenia Shkaruta and
                  Kumar Shridhar and
                  Kyle McDonell and
                  Kyle Richardson and
                  Laria Reynolds and
                  Leo Gao and
                  Li Zhang and
                  Liam Dugan and
                  Lianhui Qin and
                  Lidia Contreras Ochando and
                  Louis{-}Philippe Morency and
                  Luca Moschella and
                  Lucas Lam and
                  Lucy Noble and
                  Ludwig Schmidt and
                  Luheng He and
                  Luis Oliveros Col{\'{o}}n and
                  Luke Metz and
                  L{\"{u}}tfi Kerem Senel and
                  Maarten Bosma and
                  Maarten Sap and
                  Maartje ter Hoeve and
                  Maheen Farooqi and
                  Manaal Faruqui and
                  Mantas Mazeika and
                  Marco Baturan and
                  Marco Marelli and
                  Marco Maru and
                  Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and
                  Marie Tolkiehn and
                  Mario Giulianelli and
                  Martha Lewis and
                  Martin Potthast and
                  Matthew L. Leavitt and
                  Matthias Hagen and
                  M{\'{a}}ty{\'{a}}s Schubert and
                  Medina Baitemirova and
                  Melody Arnaud and
                  Melvin McElrath and
                  Michael A. Yee and
                  Michael Cohen and
                  Michael Gu and
                  Michael I. Ivanitskiy and
                  Michael Starritt and
                  Michael Strube and
                  Michal Swedrowski and
                  Michele Bevilacqua and
                  Michihiro Yasunaga and
                  Mihir Kale and
                  Mike Cain and
                  Mimee Xu and
                  Mirac Suzgun and
                  Mitch Walker and
                  Mo Tiwari and
                  Mohit Bansal and
                  Moin Aminnaseri and
                  Mor Geva and
                  Mozhdeh Gheini and
                  Mukund Varma T. and
                  Nanyun Peng and
                  Nathan A. Chi and
                  Nayeon Lee and
                  Neta Gur{-}Ari Krakover and
                  Nicholas Cameron and
                  Nicholas Roberts and
                  Nick Doiron and
                  Nicole Martinez and
                  Nikita Nangia and
                  Niklas Deckers and
                  Niklas Muennighoff and
                  Nitish Shirish Keskar and
                  Niveditha Iyer and
                  Noah Constant and
                  Noah Fiedel and
                  Nuan Wen and
                  Oliver Zhang and
                  Omar Agha and
                  Omar Elbaghdadi and
                  Omer Levy and
                  Owain Evans and
                  Pablo Antonio Moreno Casares and
                  Parth Doshi and
                  Pascale Fung and
                  Paul Pu Liang and
                  Paul Vicol and
                  Pegah Alipoormolabashi and
                  Peiyuan Liao and
                  Percy Liang and
                  Peter Chang and
                  Peter Eckersley and
                  Phu Mon Htut and
                  Pinyu Hwang and
                  Piotr Milkowski and
                  Piyush Patil and
                  Pouya Pezeshkpour and
                  Priti Oli and
                  Qiaozhu Mei and
                  Qing Lyu and
                  Qinlang Chen and
                  Rabin Banjade and
                  Rachel Etta Rudolph and
                  Raefer Gabriel and
                  Rahel Habacker and
                  Ramon Risco and
                  Rapha{\"{e}}l Milli{\`{e}}re and
                  Rhythm Garg and
                  Richard Barnes and
                  Rif A. Saurous and
                  Riku Arakawa and
                  Robbe Raymaekers and
                  Robert Frank and
                  Rohan Sikand and
                  Roman Novak and
                  Roman Sitelew and
                  Ronan LeBras and
                  Rosanne Liu and
                  Rowan Jacobs and
                  Rui Zhang and
                  Ruslan Salakhutdinov and
                  Ryan Chi and
                  Ryan Lee and
                  Ryan Stovall and
                  Ryan Teehan and
                  Rylan Yang and
                  Sahib Singh and
                  Saif M. Mohammad and
                  Sajant Anand and
                  Sam Dillavou and
                  Sam Shleifer and
                  Sam Wiseman and
                  Samuel Gruetter and
                  Samuel R. Bowman and
                  Samuel S. Schoenholz and
                  Sanghyun Han and
                  Sanjeev Kwatra and
                  Sarah A. Rous and
                  Sarik Ghazarian and
                  Sayan Ghosh and
                  Sean Casey and
                  Sebastian Bischoff and
                  Sebastian Gehrmann and
                  Sebastian Schuster and
                  Sepideh Sadeghi and
                  Shadi Hamdan and
                  Sharon Zhou and
                  Shashank Srivastava and
                  Sherry Shi and
                  Shikhar Singh and
                  Shima Asaadi and
                  Shixiang Shane Gu and
                  Shubh Pachchigar and
                  Shubham Toshniwal and
                  Shyam Upadhyay and
                  Shyamolima (Shammie) Debnath and
                  Siamak Shakeri and
                  Simon Thormeyer and
                  Simone Melzi and
                  Siva Reddy and
                  Sneha Priscilla Makini and
                  Soo{-}Hwan Lee and
                  Spencer Torene and
                  Sriharsha Hatwar and
                  Stanislas Dehaene and
                  Stefan Divic and
                  Stefano Ermon and
                  Stella Biderman and
                  Stephanie Lin and
                  Stephen Prasad and
                  Steven T. Piantadosi and
                  Stuart M. Shieber and
                  Summer Misherghi and
                  Svetlana Kiritchenko and
                  Swaroop Mishra and
                  Tal Linzen and
                  Tal Schuster and
                  Tao Li and
                  Tao Yu and
                  Tariq Ali and
                  Tatsu Hashimoto and
                  Te{-}Lin Wu and
                  Th{\'{e}}o Desbordes and
                  Theodore Rothschild and
                  Thomas Phan and
                  Tianle Wang and
                  Tiberius Nkinyili and
                  Timo Schick and
                  Timofei Kornev and
                  Titus Tunduny and
                  Tobias Gerstenberg and
                  Trenton Chang and
                  Trishala Neeraj and
                  Tushar Khot and
                  Tyler Shultz and
                  Uri Shaham and
                  Vedant Misra and
                  Vera Demberg and
                  Victoria Nyamai and
                  Vikas Raunak and
                  Vinay V. Ramasesh and
                  Vinay Uday Prabhu and
                  Vishakh Padmakumar and
                  Vivek Srikumar and
                  William Fedus and
                  William Saunders and
                  William Zhang and
                  Wout Vossen and
                  Xiang Ren and
                  Xiaoyu Tong and
                  Xinran Zhao and
                  Xinyi Wu and
                  Xudong Shen and
                  Yadollah Yaghoobzadeh and
                  Yair Lakretz and
                  Yangqiu Song and
                  Yasaman Bahri and
                  Yejin Choi and
                  Yichi Yang and
                  Yiding Hao and
                  Yifu Chen and
                  Yonatan Belinkov and
                  Yu Hou and
                  Yufang Hou and
                  Yuntao Bai and
                  Zachary Seid and
                  Zhuoye Zhao and
                  Zijian Wang and
                  Zijie J. Wang and
                  Zirui Wang and
                  Ziyi Wu},
  title        = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities
                  of language models},
  journal      = {CoRR},
  volume       = {abs/2206.04615},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2206.04615},
  doi          = {10.48550/ARXIV.2206.04615},
  eprinttype    = {arXiv},
  eprint       = {2206.04615},
  timestamp    = {Mon, 05 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2206-04615.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-07808,
  author       = {Jack FitzGerald and
                  Shankar Ananthakrishnan and
                  Konstantine Arkoudas and
                  Davide Bernardi and
                  Abhishek Bhagia and
                  Claudio Delli Bovi and
                  Jin Cao and
                  Rakesh Chada and
                  Amit Chauhan and
                  Luoxin Chen and
                  Anurag Dwarakanath and
                  Satyam Dwivedi and
                  Turan Gojayev and
                  Karthik Gopalakrishnan and
                  Thomas Gueudr{\'{e}} and
                  Dilek Hakkani{-}Tur and
                  Wael Hamza and
                  Jonathan J. H{\"{u}}ser and
                  Kevin Martin Jose and
                  Haidar Khan and
                  Beiye Liu and
                  Jianhua Lu and
                  Alessandro Manzotti and
                  Pradeep Natarajan and
                  Karolina Owczarzak and
                  Gokmen Oz and
                  Enrico Palumbo and
                  Charith Peris and
                  Chandana Satya Prakash and
                  Stephen Rawls and
                  Andy Rosenbaum and
                  Anjali Shenoy and
                  Saleh Soltan and
                  Mukund Harakere Sridhar and
                  Liz Tan and
                  Fabian Triefenbach and
                  Pan Wei and
                  Haiyang Yu and
                  Shuai Zheng and
                  G{\"{o}}khan T{\"{u}}r and
                  Prem Natarajan},
  title        = {Alexa Teacher Model: Pretraining and Distilling Multi-Billion-Parameter
                  Encoders for Natural Language Understanding Systems},
  journal      = {CoRR},
  volume       = {abs/2206.07808},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2206.07808},
  doi          = {10.48550/ARXIV.2206.07808},
  eprinttype    = {arXiv},
  eprint       = {2206.07808},
  timestamp    = {Tue, 06 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2206-07808.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-08269,
  author       = {Ingvar M. Ziemann and
                  Stephen Tu},
  title        = {Learning with little mixing},
  journal      = {CoRR},
  volume       = {abs/2206.08269},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2206.08269},
  doi          = {10.48550/ARXIV.2206.08269},
  eprinttype    = {arXiv},
  eprint       = {2206.08269},
  timestamp    = {Sun, 03 Jul 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2206-08269.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-15378,
  author       = {Julien P{\'{e}}rolat and
                  Bart De Vylder and
                  Daniel Hennes and
                  Eugene Tarassov and
                  Florian Strub and
                  Vincent de Boer and
                  Paul Muller and
                  Jerome T. Connor and
                  Neil Burch and
                  Thomas W. Anthony and
                  Stephen McAleer and
                  Romuald Elie and
                  Sarah H. Cen and
                  Zhe Wang and
                  Audrunas Gruslys and
                  Aleksandra Malysheva and
                  Mina Khan and
                  Sherjil Ozair and
                  Finbarr Timbers and
                  Toby Pohlen and
                  Tom Eccles and
                  Mark Rowland and
                  Marc Lanctot and
                  Jean{-}Baptiste Lespiau and
                  Bilal Piot and
                  Shayegan Omidshafiei and
                  Edward Lockhart and
                  Laurent Sifre and
                  Nathalie Beauguerlange and
                  R{\'{e}}mi Munos and
                  David Silver and
                  Satinder Singh and
                  Demis Hassabis and
                  Karl Tuyls},
  title        = {Mastering the Game of Stratego with Model-Free Multiagent Reinforcement
                  Learning},
  journal      = {CoRR},
  volume       = {abs/2206.15378},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2206.15378},
  doi          = {10.48550/ARXIV.2206.15378},
  eprinttype    = {arXiv},
  eprint       = {2206.15378},
  timestamp    = {Wed, 02 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2206-15378.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2207-06541,
  author       = {Stephen McAleer and
                  John B. Lanier and
                  Kevin A. Wang and
                  Pierre Baldi and
                  Roy Fox and
                  Tuomas Sandholm},
  title        = {Self-Play {PSRO:} Toward Optimal Populations in Two-Player Zero-Sum
                  Games},
  journal      = {CoRR},
  volume       = {abs/2207.06541},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2207.06541},
  doi          = {10.48550/ARXIV.2207.06541},
  eprinttype    = {arXiv},
  eprint       = {2207.06541},
  timestamp    = {Tue, 19 Jul 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2207-06541.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-01448,
  author       = {Saleh Soltan and
                  Shankar Ananthakrishnan and
                  Jack FitzGerald and
                  Rahul Gupta and
                  Wael Hamza and
                  Haidar Khan and
                  Charith Peris and
                  Stephen Rawls and
                  Andy Rosenbaum and
                  Anna Rumshisky and
                  Chandana Satya Prakash and
                  Mukund Sridhar and
                  Fabian Triefenbach and
                  Apurv Verma and
                  G{\"{o}}khan T{\"{u}}r and
                  Prem Natarajan},
  title        = {AlexaTM 20B: Few-Shot Learning Using a Large-Scale Multilingual Seq2Seq
                  Model},
  journal      = {CoRR},
  volume       = {abs/2208.01448},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2208.01448},
  doi          = {10.48550/ARXIV.2208.01448},
  eprinttype    = {arXiv},
  eprint       = {2208.01448},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2208-01448.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-07965,
  author       = {Uchenna Daniel Ani and
                  Jeremy D. McK. Watson and
                  Nilufer Tuptuk and
                  Steve Hailes and
                  Madeline Carr and
                  Carsten Maple},
  title        = {Improving the Cybersecurity of Critical National Infrastructure using
                  Modelling and Simulation},
  journal      = {CoRR},
  volume       = {abs/2208.07965},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2208.07965},
  doi          = {10.48550/ARXIV.2208.07965},
  eprinttype    = {arXiv},
  eprint       = {2208.07965},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2208-07965.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2209-10475,
  author       = {Wen Ting Maria Tu and
                  Stephen Makonin},
  title        = {Designing PIDs for Reproducible Science Using Time-Series Data},
  journal      = {CoRR},
  volume       = {abs/2209.10475},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2209.10475},
  doi          = {10.48550/ARXIV.2209.10475},
  eprinttype    = {arXiv},
  eprint       = {2209.10475},
  timestamp    = {Wed, 28 Sep 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2209-10475.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2209-10780,
  author       = {Xuesu Xiao and
                  Tingnan Zhang and
                  Krzysztof Choromanski and
                  Tsang{-}Wei Edward Lee and
                  Anthony G. Francis and
                  Jake Varley and
                  Stephen Tu and
                  Sumeet Singh and
                  Peng Xu and
                  Fei Xia and
                  Sven Mikael Persson and
                  Dmitry Kalashnikov and
                  Leila Takayama and
                  Roy Frostig and
                  Jie Tan and
                  Carolina Parada and
                  Vikas Sindhwani},
  title        = {Learning Model Predictive Controllers with Real-Time Attention for
                  Real-World Navigation},
  journal      = {CoRR},
  volume       = {abs/2209.10780},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2209.10780},
  doi          = {10.48550/ARXIV.2209.10780},
  eprinttype    = {arXiv},
  eprint       = {2209.10780},
  timestamp    = {Tue, 12 Nov 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2209-10780.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-00956,
  author       = {Chanikarn Nikunram and
                  Wasin Meesena and
                  Stephen John Turner and
                  Sucha Supittayapornpong},
  title        = {Minimizing Age of Processed Information in Wireless Networks},
  journal      = {CoRR},
  volume       = {abs/2210.00956},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2210.00956},
  doi          = {10.48550/ARXIV.2210.00956},
  eprinttype    = {arXiv},
  eprint       = {2210.00956},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2210-00956.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-02205,
  author       = {Luke Marris and
                  Marc Lanctot and
                  Ian Gemp and
                  Shayegan Omidshafiei and
                  Stephen McAleer and
                  Jerome T. Connor and
                  Karl Tuyls and
                  Thore Graepel},
  title        = {Game Theoretic Rating in N-player general-sum games with Equilibria},
  journal      = {CoRR},
  volume       = {abs/2210.02205},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2210.02205},
  doi          = {10.48550/ARXIV.2210.02205},
  eprinttype    = {arXiv},
  eprint       = {2210.02205},
  timestamp    = {Fri, 07 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2210-02205.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-02343,
  author       = {David Brandfonbrener and
                  Stephen Tu and
                  Avi Singh and
                  Stefan Welker and
                  Chad Boodoo and
                  Nikolai Matni and
                  Jake Varley},
  title        = {Visual Backtracking Teleoperation: {A} Data Collection Protocol for
                  Offline Image-Based Reinforcement Learning},
  journal      = {CoRR},
  volume       = {abs/2210.02343},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2210.02343},
  doi          = {10.48550/ARXIV.2210.02343},
  eprinttype    = {arXiv},
  eprint       = {2210.02343},
  timestamp    = {Fri, 07 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2210-02343.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-00186,
  author       = {Thomas T. C. K. Zhang and
                  Katie Kang and
                  Bruce D. Lee and
                  Claire J. Tomlin and
                  Sergey Levine and
                  Stephen Tu and
                  Nikolai Matni},
  title        = {Multi-Task Imitation Learning for Linear Dynamical Systems},
  journal      = {CoRR},
  volume       = {abs/2212.00186},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2212.00186},
  doi          = {10.48550/ARXIV.2212.00186},
  eprinttype    = {arXiv},
  eprint       = {2212.00186},
  timestamp    = {Wed, 07 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2212-00186.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-00613,
  author       = {Ziyan Wang and
                  Giljoo Nam and
                  Tuur Stuyck and
                  Stephen Lombardi and
                  Chen Cao and
                  Jason M. Saragih and
                  Michael Zollh{\"{o}}fer and
                  Jessica K. Hodgins and
                  Christoph Lassner},
  title        = {NeuWigs: {A} Neural Dynamic Model for Volumetric Hair Capture and
                  Animation},
  journal      = {CoRR},
  volume       = {abs/2212.00613},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2212.00613},
  doi          = {10.48550/ARXIV.2212.00613},
  eprinttype    = {arXiv},
  eprint       = {2212.00613},
  timestamp    = {Thu, 08 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2212-00613.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-13138,
  author       = {Karan Singhal and
                  Shekoofeh Azizi and
                  Tao Tu and
                  S. Sara Mahdavi and
                  Jason Wei and
                  Hyung Won Chung and
                  Nathan Scales and
                  Ajay Kumar Tanwani and
                  Heather Cole{-}Lewis and
                  Stephen Pfohl and
                  Perry Payne and
                  Martin Seneviratne and
                  Paul Gamble and
                  Chris Kelly and
                  Nathaneal Sch{\"{a}}rli and
                  Aakanksha Chowdhery and
                  Philip Andrew Mansfield and
                  Blaise Ag{\"{u}}era y Arcas and
                  Dale R. Webster and
                  Gregory S. Corrado and
                  Yossi Matias and
                  Katherine Chou and
                  Juraj Gottweis and
                  Nenad Tomasev and
                  Yun Liu and
                  Alvin Rajkomar and
                  Joelle K. Barral and
                  Christopher Semturs and
                  Alan Karthikesalingam and
                  Vivek Natarajan},
  title        = {Large Language Models Encode Clinical Knowledge},
  journal      = {CoRR},
  volume       = {abs/2212.13138},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2212.13138},
  doi          = {10.48550/ARXIV.2212.13138},
  eprinttype    = {arXiv},
  eprint       = {2212.13138},
  timestamp    = {Wed, 06 Nov 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2212-13138.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-13289,
  author       = {M. I. Sitnov and
                  G. K. Stephens and
                  V. G. Merkin and
                  C.{-}P. Wang and
                  D. Turner and
                  K. Genestreti and
                  M. Argall and
                  T. Y. Chen and
                  A. Y. Ukhorskiy and
                  S. Wing and
                  Y.{-}H. Liu},
  title        = {Artificial Intelligence to Enhance Mission Science Output for In-situ
                  Observations: Dealing with the Sparse Data Challenge},
  journal      = {CoRR},
  volume       = {abs/2212.13289},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2212.13289},
  doi          = {10.48550/ARXIV.2212.13289},
  eprinttype    = {arXiv},
  eprint       = {2212.13289},
  timestamp    = {Mon, 02 Jan 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2212-13289.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bib/DoranALBTUBM21,
  author       = {Stephen Doran and
                  Muhammad Arif and
                  Simon Lam and
                  Abdulahad Bayraktar and
                  Hasan Turkez and
                  Mathias Uhlen and
                  Jan Boren and
                  Adil Mardinoglu},
  title        = {Multi-omics approaches for revealing the complexity of cardiovascular
                  disease},
  journal      = {Briefings Bioinform.},
  volume       = {22},
  number       = {5},
  year         = {2021},
  url          = {https://doi.org/10.1093/bib/bbab061},
  doi          = {10.1093/BIB/BBAB061},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/bib/DoranALBTUBM21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bib/LamDYATNBUM21,
  author       = {Simon Lam and
                  Stephen Doran and
                  Hatice Hilal Yuksel and
                  Ozlem Altay and
                  Hasan Turkez and
                  Jens Nielsen and
                  Jan Boren and
                  Mathias Uhlen and
                  Adil Mardinoglu},
  title        = {Addressing the heterogeneity in liver diseases using biological networks},
  journal      = {Briefings Bioinform.},
  volume       = {22},
  number       = {2},
  pages        = {1751--1766},
  year         = {2021},
  url          = {https://doi.org/10.1093/bib/bbaa002},
  doi          = {10.1093/BIB/BBAA002},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/bib/LamDYATNBUM21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/YangGLBMWWJO21,
  author       = {Jeremy J. Yang and
                  Dhouha Grissa and
                  Christophe G. Lambert and
                  Cristian Bologa and
                  Stephen L. Mathias and
                  Anna Waller and
                  David J. Wild and
                  Lars Juhl Jensen and
                  Tudor I. Oprea},
  title        = {{TIGA:} target illumination {GWAS} analytics},
  journal      = {Bioinform.},
  volume       = {37},
  number       = {21},
  pages        = {3865--3873},
  year         = {2021},
  url          = {https://doi.org/10.1093/bioinformatics/btab427},
  doi          = {10.1093/BIOINFORMATICS/BTAB427},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/bioinformatics/YangGLBMWWJO21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cce/GangadharanSTFC21,
  author       = {Nishanthi Gangadharan and
                  David Sewell and
                  Richard Turner and
                  Ray Field and
                  Matthew Cheeks and
                  Stephen G. Oliver and
                  Nigel K. H. Slater and
                  Duygu Dikicioglu},
  title        = {Data intelligence for process performance prediction in biologics
                  manufacturing},
  journal      = {Comput. Chem. Eng.},
  volume       = {146},
  pages        = {107226},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.compchemeng.2021.107226},
  doi          = {10.1016/J.COMPCHEMENG.2021.107226},
  timestamp    = {Tue, 02 Mar 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cce/GangadharanSTFC21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ci/YousefiSASCT21,
  author       = {Leila Yousefi and
                  Stephen Swift and
                  Mahir Arzoky and
                  Lucia Saachi and
                  Luca Chiovato and
                  Allan Tucker},
  title        = {Opening the black box: Personalizing type 2 diabetes patients based
                  on their latent phenotype and temporal associated complication rules},
  journal      = {Comput. Intell.},
  volume       = {37},
  number       = {4},
  pages        = {1460--1498},
  year         = {2021},
  url          = {https://doi.org/10.1111/coin.12313},
  doi          = {10.1111/COIN.12313},
  timestamp    = {Tue, 12 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ci/YousefiSASCT21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/FarnellRGZPHHMC21,
  author       = {Damian J. J. Farnell and
                  Stephen Richmond and
                  Jennifer Galloway and
                  Alexei I. Zhurov and
                  Pertti Pirttiniemi and
                  Tuomo H. Heikkinen and
                  Virpi Harila and
                  Harold S. Matthews and
                  Peter Claes},
  title        = {An exploration of adolescent facial shape changes with age via multilevel
                  partial least squares regression},
  journal      = {Comput. Methods Programs Biomed.},
  volume       = {200},
  pages        = {105935},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.cmpb.2021.105935},
  doi          = {10.1016/J.CMPB.2021.105935},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cmpb/FarnellRGZPHHMC21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/concurrency/MullerFABJRTR21,
  author       = {Juliane M{\"{u}}ller and
                  Boris Faybishenko and
                  Deborah A. Agarwal and
                  Stephen Bailey and
                  Chongya Jiang and
                  Youngryel Ryu and
                  Craig Tull and
                  Lavanya Ramakrishnan},
  title        = {Assessing data change in scientific datasets},
  journal      = {Concurr. Comput. Pract. Exp.},
  volume       = {33},
  number       = {16},
  year         = {2021},
  url          = {https://doi.org/10.1002/cpe.6245},
  doi          = {10.1002/CPE.6245},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/concurrency/MullerFABJRTR21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/AtwoliBBBGHHLMN21,
  author       = {Lukoye Atwoli and
                  Abdullah H. Baqui and
                  Thomas Benfield and
                  Raffaella Bosurgi and
                  Fiona Godlee and
                  Stephen Hancocks and
                  Richard Horton and
                  Laurie Laybourn{-}Langton and
                  Carlos Augusto Monteiro and
                  Ian Norman and
                  Kirsten Patrick and
                  Nigel Praities and
                  Marcel G. M. Olde Rikkert and
                  Eric J. Rubin and
                  Peush Sahni and
                  Richard Smith and
                  Nick Talley and
                  Sue Turale and
                  Dami{\'{a}}n V{\'{a}}zquez},
  title        = {Call for emergency action to limit global temperature increases, restore
                  biodiversity, and protect health},
  journal      = {J. Am. Medical Informatics Assoc.},
  volume       = {28},
  number       = {10},
  pages        = {2069--2071},
  year         = {2021},
  url          = {https://doi.org/10.1093/jamia/ocab178},
  doi          = {10.1093/JAMIA/OCAB178},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jamia/AtwoliBBBGHHLMN21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jimaging/EtxegaraiTTVKH21,
  author       = {Maddi Etxegarai and
                  Erika Tudisco and
                  Alessandro Tengattini and
                  Gioacchino Viggiani and
                  Nikolay Kardjilov and
                  Stephen A. Hall},
  title        = {Characterisation of Single-Phase Fluid-Flow Heterogeneity Due to Localised
                  Deformation in a Porous Rock Using Rapid Neutron Tomography},
  journal      = {J. Imaging},
  volume       = {7},
  number       = {12},
  pages        = {275},
  year         = {2021},
  url          = {https://doi.org/10.3390/jimaging7120275},
  doi          = {10.3390/JIMAGING7120275},
  timestamp    = {Sat, 08 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jimaging/EtxegaraiTTVKH21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmlr/TuckBB21,
  author       = {Jonathan Tuck and
                  Shane T. Barratt and
                  Stephen P. Boyd},
  title        = {A Distributed Method for Fitting Laplacian Regularized Stratified
                  Models},
  journal      = {J. Mach. Learn. Res.},
  volume       = {22},
  pages        = {60:1--60:37},
  year         = {2021},
  url          = {https://jmlr.org/papers/v22/19-345.html},
  timestamp    = {Wed, 11 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jmlr/TuckBB21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/CarbonDGUHMBCDH21,
  author       = {Seth Carbon and
                  Eric Douglass and
                  Benjamin M. Good and
                  Deepak R. Unni and
                  Nomi L. Harris and
                  Christopher J. Mungall and
                  Siddartha Basu and
                  Rex L. Chisholm and
                  Robert J. Dodson and
                  Eric Hartline and
                  Petra Fey and
                  Paul D. Thomas and
                  Laurent{-}Philippe Albou and
                  Dustin Ebert and
                  Michael J. Kesling and
                  Huaiyu Mi and
                  Anushya Muruganujan and
                  Xiaosong Huang and
                  Tremayne Mushayahama and
                  Sandra A. LaBonte and
                  Deborah A. Siegele and
                  Giulia Antonazzo and
                  Helen Attrill and
                  Nick H. Brown and
                  Phani V. Garapati and
                  Steven J. Marygold and
                  Vitor Trovisco and
                  Gilberto dos Santos and
                  Kathleen Falls and
                  Christopher J. Tabone and
                  Pinglei Zhou and
                  Joshua L. Goodman and
                  Victor B. Strelets and
                  Jim Thurmond and
                  Penelope Garmiri and
                  Rizwan Ishtiaq and
                  Milagros Rodr{\'{\i}}guez{-}L{\'{o}}pez and
                  Marcio Luis Acencio and
                  Martin Kuiper and
                  Astrid L{\ae}greid and
                  Colin Logie and
                  Ruth C. Lovering and
                  Barbara Kramarz and
                  Shirin C. C. Saverimuttu and
                  Sandra M. Pinheiro and
                  Heather Gunn and
                  Renzhi Su and
                  Katherine E. Thurlow and
                  Marcus C. Chibucos and
                  Michelle G. Giglio and
                  Suvarna Nadendla and
                  James B. Munro and
                  Rebecca C. Jackson and
                  Margaret J. Duesbury and
                  Noemi del{-}Toro and
                  Birgit H. M. Meldal and
                  Kalpana Paneerselvam and
                  Livia Perfetto and
                  Pablo Porras and
                  Sandra E. Orchard and
                  Anjali Shrivastava and
                  Hsin{-}Yu Chang and
                  Robert D. Finn and
                  Alex L. Mitchell and
                  Neil D. Rawlings and
                  Lorna J. Richardson and
                  Amaia Sangrador{-}Vegas and
                  Judith A. Blake and
                  Karen R. Christie and
                  Mary E. Dolan and
                  Harold J. Drabkin and
                  David P. Hill and
                  Li Ni and
                  Dmitry M. Sitnikov and
                  Midori A. Harris and
                  Stephen G. Oliver and
                  Kim Rutherford and
                  Valerie Wood and
                  Jaqueline Hayles and
                  J{\"{u}}rg B{\"{a}}hler and
                  Elizabeth R. Bolton and
                  Jeffrey DePons and
                  Melinda R. Dwinell and
                  G. Thomas Hayman and
                  Mary L. Kaldunski and
                  Anne E. Kwitek and
                  Stanley J. F. Laulederkind and
                  Cody Plasterer and
                  Marek Tutaj and
                  Mahima Vedi and
                  Shur{-}Jen Wang and
                  Peter D'Eustachio and
                  Lisa Matthews and
                  James P. Balhoff and
                  Suzi A. Aleksander and
                  Michael J. Alexander and
                  J. Michael Cherry and
                  Stacia R. Engel and
                  Felix Gondwe and
                  Kalpana Karra and
                  Stuart R. Miyasato and
                  Robert S. Nash and
                  Matt Simison and
                  Marek S. Skrzypek and
                  Shuai Weng and
                  Edith D. Wong and
                  Marc Feuermann and
                  Pascale Gaudet and
                  Anne Morgat and
                  Erica Bakker and
                  Tanya Z. Berardini and
                  Leonore Reiser and
                  Shabari Subramaniam and
                  Eva Huala and
                  Cecilia N. Arighi and
                  Andrea H. Auchincloss and
                  Kristian B. Axelsen and
                  Ghislaine Argoud{-}Puy and
                  Alex Bateman and
                  Marie{-}Claude Blatter and
                  Emmanuel Boutet and
                  Emily Bowler and
                  Lionel Breuza and
                  Alan J. Bridge and
                  Ramona Britto and
                  Hema Bye{-}A{-}Jee and
                  Cristina Casals{-}Casas and
                  Elisabeth Coudert and
                  Paul Denny and
                  Anne Estreicher and
                  Maria Livia Famiglietti and
                  George E. Georghiou and
                  Arnaud Gos and
                  Nadine Gruaz{-}Gumowski and
                  Emma Hatton{-}Ellis and
                  Chantal Hulo and
                  Alexandr Ignatchenko and
                  Florence Jungo and
                  Kati Laiho and
                  Philippe Le Mercier and
                  Damien Lieberherr and
                  Antonia Lock and
                  Yvonne Lussi and
                  Alistair MacDougall and
                  Michele Magrane and
                  Maria Jesus Martin and
                  Patrick Masson and
                  Darren A. Natale and
                  Nevila Hyka{-}Nouspikel and
                  Ivo Pedruzzi and
                  Lucille Pourcel and
                  Sylvain Poux and
                  Sangya Pundir and
                  Catherine Rivoire and
                  Elena Speretta and
                  Shyamala Sundaram and
                  Nidhi Tyagi and
                  Kate Warner and
                  Rossana Zaru and
                  Cathy H. Wu and
                  Alexander D. Diehl and
                  Juancarlos Chan and
                  Christian A. Grove and
                  Raymond Y. N. Lee and
                  Hans{-}Michael M{\"{u}}ller and
                  Daniela Raciti and
                  Kimberly Van Auken and
                  Paul W. Sternberg and
                  Matthew Berriman and
                  Michael Paulini and
                  Kevin L. Howe and
                  Sibyl Gao and
                  Adam Wright and
                  Lincoln Stein and
                  Douglas G. Howe and
                  Sabrina Toro and
                  Monte Westerfield and
                  Pankaj Jaiswal and
                  Laurel Cooper and
                  Justin Elser},
  title        = {The Gene Ontology resource: enriching a GOld mine},
  journal      = {Nucleic Acids Res.},
  volume       = {49},
  number       = {Database-Issue},
  pages        = {D325--D334},
  year         = {2021},
  url          = {https://doi.org/10.1093/nar/gkaa1113},
  doi          = {10.1093/NAR/GKAA1113},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/CarbonDGUHMBCDH21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/HoweAAAAAAABBBB21,
  author       = {Kevin L. Howe and
                  Premanand Achuthan and
                  James E. Allen and
                  Jamie Allen and
                  Jorge {\'{A}}lvarez{-}Jarreta and
                  M. Ridwan Amode and
                  Irina M. Armean and
                  Andrey G. Azov and
                  Ruth Bennett and
                  Jyothish Bhai and
                  Konstantinos Billis and
                  Sanjay Boddu and
                  Mehrnaz Charkhchi and
                  Carla A. Cummins and
                  Luca Da Rin Fioretto and
                  Claire Davidson and
                  Kamalkumar Jayantilal Dodiya and
                  Bilal El Houdaigui and
                  Reham Fatima and
                  Astrid Gall and
                  Carlos Garc{\'{\i}}a{-}Gir{\'{o}}n and
                  Tiago Grego and
                  Cristina Guijarro{-}Clarke and
                  Leanne Haggerty and
                  Anmol Hemrom and
                  Thibaut Hourlier and
                  Osagie G. Izuogu and
                  Thomas Juettemann and
                  Vinay Kaikala and
                  Mike P. Kay and
                  Ilias Lavidas and
                  Tuan Le and
                  Diana Lemos and
                  Jose Gonzalez Martinez and
                  Jos{\'{e}} Carlos Marug{\'{a}}n and
                  Thomas Maurel and
                  Aoife C. McMahon and
                  Shamika Mohanan and
                  Benjamin Moore and
                  Matthieu Muffato and
                  Denye N. Oheh and
                  Dimitrios Paraschas and
                  Anne Parker and
                  Andrew Parton and
                  Irina Prosovetskaia and
                  Manoj Pandian Sakthivel and
                  Ahamed Imran Abdul Salam and
                  Bianca M. Schmitt and
                  Helen Schuilenburg and
                  Dan Sheppard and
                  Emily Steed and
                  Michal Szpak and
                  Marek Szuba and
                  Kieron R. Taylor and
                  Anja Thormann and
                  Glen Threadgold and
                  Brandon Walts and
                  Andrea Winterbottom and
                  Marc Chakiachvili and
                  Ameya Chaubal and
                  Nishadi De Silva and
                  Bethany Flint and
                  Adam Frankish and
                  Sarah E. Hunt and
                  Garth IIsley and
                  Nick Langridge and
                  Jane E. Loveland and
                  Fergal J. Martin and
                  Jonathan M. Mudge and
                  Joannella Morales and
                  Emily Perry and
                  Magali Ruffier and
                  John G. Tate and
                  David Thybert and
                  Stephen J. Trevanion and
                  Fiona Cunningham and
                  Andrew D. Yates and
                  Daniel R. Zerbino and
                  Paul Flicek},
  title        = {Ensembl 2021},
  journal      = {Nucleic Acids Res.},
  volume       = {49},
  number       = {Database-Issue},
  pages        = {D884--D891},
  year         = {2021},
  url          = {https://doi.org/10.1093/nar/gkaa942},
  doi          = {10.1093/NAR/GKAA942},
  timestamp    = {Tue, 01 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/HoweAAAAAAABBBB21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/SheilsMKSNBJVKS21,
  author       = {Timothy Sheils and
                  Stephen L. Mathias and
                  Keith J. Kelleher and
                  Vishal B. Siramshetty and
                  Dac{-}Trung Nguyen and
                  Cristian Bologa and
                  Lars Juhl Jensen and
                  Dusica Vidovic and
                  Amar Koleti and
                  Stephan C. Sch{\"{u}}rer and
                  Anna Waller and
                  Jeremy J. Yang and
                  Jayme Holmes and
                  Giovanni Bocci and
                  Noel Southall and
                  Poorva Dharkar and
                  Ewy A. Math{\'{e}} and
                  Anton Simeonov and
                  Tudor I. Oprea},
  title        = {{TCRD} and Pharos 2021: mining the human proteome for disease biology},
  journal      = {Nucleic Acids Res.},
  volume       = {49},
  number       = {Database-Issue},
  pages        = {D1334--D1346},
  year         = {2021},
  url          = {https://doi.org/10.1093/nar/gkaa993},
  doi          = {10.1093/NAR/GKAA993},
  timestamp    = {Tue, 08 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/SheilsMKSNBJVKS21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HuiMZAABBBBBBBB21,
  author       = {Steve C. N. Hui and
                  Mark Mikkelsen and
                  Helge J. Z{\"{o}}llner and
                  Vishwadeep Ahluwalia and
                  Sarael Alcauter and
                  Laima Baltusis and
                  Deborah A. Barany and
                  Laura R. Barlow and
                  Robert Becker and
                  Jeffrey I. Berman and
                  Adam Berrington and
                  Pallab K. Bhattacharyya and
                  Jakob Udby Blicher and
                  Wolfgang Bogner and
                  Mark S. Brown and
                  Vince D. Calhoun and
                  Ryan Castillo and
                  Kim M. Cecil and
                  Richard A. E. Edden and
                  Yeo Bi Choi and
                  Winnie C. W. Chu and
                  William T. Clarke and
                  Alexander R. Craven and
                  Koen Cuypers and
                  Michael Dacko and
                  Camilo de la Fuente{-}Sandoval and
                  Patricia Desmond and
                  Aleksandra Domagalik and
                  Julien Dumont and
                  Niall W. Duncan and
                  Ulrike Dydak and
                  Katherine Dyke and
                  David A. Edmondson and
                  Gabriele Ende and
                  Lars Ersland and
                  C. John Evans and
                  Alan S. R. Fermin and
                  Antonio Ferretti and
                  Ariane Fillmer and
                  Tao Gong and
                  Ian Greenhouse and
                  James T. Grist and
                  Meng Gu and
                  Ashley D. Harris and
                  Katarzyna Hat and
                  Stefanie Heba and
                  Eva Heckova and
                  John P. Hegarty and
                  Kirstin{-}Friederike Heise and
                  Shiori Honda and
                  Aaron Jacobson and
                  Jacobus F. A. Jansen and
                  Christopher W. Jenkins and
                  Stephen J. Johnston and
                  Christoph Juchem and
                  Alayar Kangarlu and
                  Adam B. Kerr and
                  Karl Landheer and
                  Thomas Lange and
                  Phil Lee and
                  Swati Rane Levendovszky and
                  Catherine Limperopoulos and
                  Feng Liu and
                  William Lloyd and
                  David J. Lythgoe and
                  Maro G. Machizawa and
                  Erin L. MacMillan and
                  Richard J. Maddock and
                  Andrei V. Manzhurtsev and
                  Mar{\'{\i}}a L. Martinez{-}Gudino and
                  Jack J. Miller and
                  Heline Mirzakhanian and
                  Marta Moreno{-}Ortega and
                  Paul G. Mullins and
                  Shinichiro Nakajima and
                  Jamie Near and
                  Ralph Noeske and
                  Wibeke Nordh{\o}y and
                  Georg Oeltzschner and
                  Raul Osorio{-}Duran and
                  Mar{\'{\i}}a Concepci{\'{o}}n Garc{\'{\i}}a Otaduy and
                  Erick H. Pasaye and
                  Ronald Peeters and
                  Scott J. Peltier and
                  Ulrich Pilatus and
                  Nenad Polomac and
                  Eric C. Porges and
                  Subechhya Pradhan and
                  James Joseph Prisciandaro and
                  Nicolaas A. Puts and
                  Caroline D. Rae and
                  Francisco Reyes{-}Madrigal and
                  Timothy P. L. Roberts and
                  Caroline E. Robertson and
                  Jens T. Rosenberg and
                  Diana{-}Georgiana Rotaru and
                  Ruth L. O'Gorman Tuura and
                  Muhammad G. Saleh and
                  Kristian Sandberg and
                  Ryan Sangill and
                  Keith Schembri and
                  Anouk Schrantee and
                  Natalia A. Semenova and
                  Debra Singel and
                  Rouslan Sitnikov and
                  Jolinda Smith and
                  Yulu Song and
                  Craig E. L. Stark and
                  Diederick Stoffers and
                  Stephan P. Swinnen and
                  Rongwen Tain and
                  Costin Tanase and
                  Sofie Tapper and
                  Martin Tegenthoff and
                  Thomas Thiel and
                  Marc Thioux and
                  Peter Truong and
                  Pim van Dijk and
                  Nolan Vella and
                  Rishma Vidyasagar and
                  Andrej Vovk and
                  Guangbin Wang and
                  Lars T. Westlye and
                  Timothy K. Wilbur and
                  William R. Willoughby and
                  Martin Wilson and
                  Hans{-}J{\"{o}}rg Wittsack and
                  Adam J. Woods and
                  Yen{-}Chien Wu and
                  Junqian Xu and
                  Maria Yanez Lopez and
                  David Ka Wai Yeung and
                  Qun Zhao and
                  Xiaopeng Zhou and
                  Gasper Zupan},
  title        = {Frequency drift in {MR} spectroscopy at 3T},
  journal      = {NeuroImage},
  volume       = {241},
  pages        = {118430},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.neuroimage.2021.118430},
  doi          = {10.1016/J.NEUROIMAGE.2021.118430},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/neuroimage/HuiMZAABBBBBBBB21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/FehrKOGSGSBMMHK21,
  author       = {Jana Fehr and
                  Stefan Konigorski and
                  Stephen Olivier and
                  Resign Gunda and
                  Ashmika Surujdeen and
                  Dickman Gareta and
                  Theresa Smit and
                  Kathy Baisley and
                  Sashen Moodley and
                  Yumna Moosa and
                  Willem Hanekom and
                  Olivier Koole and
                  Thumbi Ndung'u and
                  Deenan Pillay and
                  Alison D. Grant and
                  Mark J. Siedner and
                  Christoph Lippert and
                  Emily B. Wong and
                  Anand Ramnanan and
                  Anele Mkhwanazi and
                  Antony Rapulana and
                  Anupa Singh and
                  Ashentha Govender and
                  Ayanda Zungu and
                  Boitsholo Mfolo and
                  Bongani Magwaza and
                  Bongumenzi Ndlovu and
                  Clive Mavimbela and
                  Costa Criticos and
                  Day Munatsi and
                  Dilip Kalyan and
                  Doctar Mlambo and
                  Fezeka Mfeka and
                  Freddy Mabetlela and
                  Gregory Ording{-}Jespersen and
                  Hannah Keal and
                  Hlengiwe Dlamini and
                  Hlengiwe Khathi and
                  Hlobisile Chonco and
                  Hlobisile Gumede and
                  Hlolisile Khumalo and
                  Hloniphile Ngubane and
                  Hollis Shen and
                  Hosea Kambonde and
                  Innocentia Mpofana and
                  Jabu Kwinda and
                  Jaco Dreyer and
                  Jade Cousins and
                  Jaikrishna Kalideen and
                  Janet Seeley and
                  Kandaseelan Chetty and
                  Kayleen Brien and
                  Kennedy Nyamande and
                  Kgaugelo Moropane and
                  Khabonina Malomane and
                  Khadija Khan and
                  Khanyisani Buthelezi and
                  Kimeshree Perumal and
                  Kobus Herbst and
                  Lindani Mthembu and
                  Logan Pillay and
                  Mandisi Dlamini and
                  Mandlakayise Zikhali and
                  Mbali Mbuyisa and
                  Mbuti Mofokeng and
                  Melusi Sibiya and
                  Mlungisi Dube and
                  Mosa Suleman and
                  Mpumelelo Steto and
                  Mzamo Buthelezi and
                  Nagavelli Padayachi and
                  Nceba Gqaleni and
                  Ngcebo Mhlongo and
                  Nokukhanya Ntshakala and
                  Nomathamsanqa Majozi and
                  Nombuyiselo Zondi and
                  Nomfundo Luthuli and
                  Nomfundo Ngema and
                  Nompilo Buthelezi and
                  Nonceba Mfeka and
                  Nondumiso Khuluse and
                  Nondumiso Mabaso and
                  Nondumiso Zitha and
                  Nonhlanhla Mfekayi and
                  Nonhlanhla Mzimela and
                  Nozipho Mbonambi and
                  Ntombiyenhlanhla Mkhwanazi and
                  Ntombiyenkosi Ntombela and
                  Pamela Ramkalawon and
                  Pfarelo Tshivase and
                  Phakamani Mkhwanazi and
                  Philippa Mathews and
                  Phumelele Mthethwa and
                  Phumla Ngcobo and
                  Ramesh Jackpersad and
                  Raynold Zondo and
                  Rochelle Singh and
                  Rose Myeni and
                  Sanah Bucibo and
                  Sandile Mthembu and
                  Sashin Harilall and
                  Senamile Makhari and
                  Seneme Mchunu and
                  Senzeni Mkhwanazi and
                  Sibahle Gumbi and
                  Siboniso Nene and
                  Sibusiso Mhlongo and
                  Sibusiso Mkhwanazi and
                  Sibusiso Nsibande and
                  Simphiwe Ntshangase and
                  Siphephelo Dlamini and
                  Sithembile Ngcobo and
                  Siyabonga Nsibande and
                  Siyabonga Nxumalo and
                  Sizwe Ndlela and
                  Skhumbuzo Mthombeni and
                  Smangaliso Zulu and
                  Sphiwe Clement Mthembu and
                  Sphiwe Ntuli and
                  Talente Ntimbane and
                  Thabile Zondi and
                  Thandeka Khoza and
                  Thengokwakhe Nkosi and
                  Thokozani Bhengu and
                  Thokozani Simelane and
                  Tshwaraganang Modise and
                  Tumi Madolo and
                  Velile Vellem and
                  Welcome Petros Mthembu and
                  Xolani Mkhize and
                  Zamashandu Mbatha and
                  Zinhle Buthelezi and
                  Zinhle Mthembu and
                  Zizile Sikhosana},
  title        = {Computer-aided interpretation of chest radiography reveals the spectrum
                  of tuberculosis in rural South Africa},
  journal      = {npj Digit. Medicine},
  volume       = {4},
  year         = {2021},
  url          = {https://doi.org/10.1038/s41746-021-00471-y},
  doi          = {10.1038/S41746-021-00471-Y},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/npjdm/FehrKOGSGSBMMHK21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/FehrKOGSGSBMMHK21a,
  author       = {Jana Fehr and
                  Stefan Konigorski and
                  Stephen Olivier and
                  Resign Gunda and
                  Ashmika Surujdeen and
                  Dickman Gareta and
                  Theresa Smit and
                  Kathy Baisley and
                  Sashen Moodley and
                  Yumna Moosa and
                  Willem Hanekom and
                  Olivier Koole and
                  Thumbi Ndung'u and
                  Deenan Pillay and
                  Alison D. Grant and
                  Mark J. Siedner and
                  Christoph Lippert and
                  Emily B. Wong and
                  Anand Ramnanan and
                  Anele Mkhwanazi and
                  Antony Rapulana and
                  Anupa Singh and
                  Ashentha Govender and
                  Ayanda Zungu and
                  Boitsholo Mfolo and
                  Bongani Magwaza and
                  Bongumenzi Ndlovu and
                  Clive Mavimbela and
                  Costa Criticos and
                  Day Munatsi and
                  Dilip Kalyan and
                  Doctar Mlambo and
                  Fezeka Mfeka and
                  Freddy Mabetlela and
                  Gregory Ording{-}Jespersen and
                  Hannah Keal and
                  Hlengiwe Dlamini and
                  Hlengiwe Khathi and
                  Hlobisile Chonco and
                  Hlobisile Gumede and
                  Hlolisile Khumalo and
                  Hloniphile Ngubane and
                  Hollis Shen and
                  Hosea Kambonde and
                  Innocentia Mpofana and
                  Jabu Kwinda and
                  Jaco Dreyer and
                  Jade Cousins and
                  Jaikrishna Kalideen and
                  Janet Seeley and
                  Kandaseelan Chetty and
                  Kayleen Brien and
                  Kennedy Nyamande and
                  Kgaugelo Moropane and
                  Khabonina Malomane and
                  Khadija Khan and
                  Khanyisani Buthelezi and
                  Kimeshree Perumal and
                  Kobus Herbst and
                  Lindani Mthembu and
                  Logan Pillay and
                  Mandisi Dlamini and
                  Mandlakayise Zikhali and
                  Mbali Mbuyisa and
                  Mbuti Mofokeng and
                  Melusi Sibiya and
                  Mlungisi Dube and
                  Mosa Suleman and
                  Mpumelelo Steto and
                  Mzamo Buthelezi and
                  Nagavelli Padayachi and
                  Nceba Gqaleni and
                  Ngcebo Mhlongo and
                  Nokukhanya Ntshakala and
                  Nomathamsanqa Majozi and
                  Nombuyiselo Zondi and
                  Nomfundo Luthuli and
                  Nomfundo Ngema and
                  Nompilo Buthelezi and
                  Nonceba Mfeka and
                  Nondumiso Khuluse and
                  Nondumiso Mabaso and
                  Nondumiso Zitha and
                  Nonhlanhla Mfekayi and
                  Nonhlanhla Mzimela and
                  Nozipho Mbonambi and
                  Ntombiyenhlanhla Mkhwanazi and
                  Ntombiyenkosi Ntombela and
                  Pamela Ramkalawon and
                  Pfarelo Tshivase and
                  Phakamani Mkhwanazi and
                  Philippa Mathews and
                  Phumelele Mthethwa and
                  Phumla Ngcobo and
                  Ramesh Jackpersad and
                  Raynold Zondo and
                  Rochelle Singh and
                  Rose Myeni and
                  Sanah Bucibo and
                  Sandile Mthembu and
                  Sashin Harilall and
                  Senamile Makhari and
                  Seneme Mchunu and
                  Senzeni Mkhwanazi and
                  Sibahle Gumbi and
                  Siboniso Nene and
                  Sibusiso Mhlongo and
                  Sibusiso Mkhwanazi and
                  Sibusiso Nsibande and
                  Simphiwe Ntshangase and
                  Siphephelo Dlamini and
                  Sithembile Ngcobo and
                  Siyabonga Nsibande and
                  Siyabonga Nxumalo and
                  Sizwe Ndlela and
                  Skhumbuzo Mthombeni and
                  Smangaliso Zulu and
                  Sphiwe Clement Mthembu and
                  Sphiwe Ntuli and
                  Talente Ntimbane and
                  Thabile Zondi and
                  Thandeka Khoza and
                  Thengokwakhe Nkosi and
                  Thokozani Bhengu and
                  Thokozani Simelane and
                  Tshwaraganang Modise and
                  Tumi Madolo and
                  Velile Vellem and
                  Welcome Petros Mthembu and
                  Xolani Mkhize and
                  Zamashandu Mbatha and
                  Zinhle Buthelezi and
                  Zinhle Mthembu and
                  Zizile Sikhosana},
  title        = {Publisher Correction: Computer-aided interpretation of chest radiography
                  reveals the spectrum of tuberculosis in rural South Africa},
  journal      = {npj Digit. Medicine},
  volume       = {4},
  year         = {2021},
  url          = {https://doi.org/10.1038/s41746-021-00485-6},
  doi          = {10.1038/S41746-021-00485-6},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/npjdm/FehrKOGSGSBMMHK21a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/TunaTDRZM21,
  author       = {Suha Tuna and
                  Beh{\c{c}}et Ugur T{\"{o}}reyin and
                  Metin Demiralp and
                  Jinchang Ren and
                  Huimin Zhao and
                  Stephen Marshall},
  title        = {Iterative Enhanced Multivariance Products Representation for Effective
                  Compression of Hyperspectral Images},
  journal      = {{IEEE} Trans. Geosci. Remote. Sens.},
  volume       = {59},
  number       = {11},
  pages        = {9569--9584},
  year         = {2021},
  url          = {https://doi.org/10.1109/TGRS.2020.3031016},
  doi          = {10.1109/TGRS.2020.3031016},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tgrs/TunaTDRZM21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkde/LiCLCG21,
  author       = {Dongsheng Li and
                  Chao Chen and
                  Tun Lu and
                  Stephen M. Chu and
                  Ning Gu},
  title        = {Mixture Matrix Approximation for Collaborative Filtering},
  journal      = {{IEEE} Trans. Knowl. Data Eng.},
  volume       = {33},
  number       = {6},
  pages        = {2640--2653},
  year         = {2021},
  url          = {https://doi.org/10.1109/TKDE.2019.2955100},
  doi          = {10.1109/TKDE.2019.2955100},
  timestamp    = {Tue, 01 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tkde/LiCLCG21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/adhs/RobeyLTM21,
  author       = {Alexander Robey and
                  Lars Lindemann and
                  Stephen Tu and
                  Nikolai Matni},
  editor       = {Rapha{\"{e}}l M. Jungers and
                  Necmiye Ozay and
                  Alessandro Abate},
  title        = {Learning Robust Hybrid Control Barrier Functions for Uncertain Systems},
  booktitle    = {7th {IFAC} Conference on Analysis and Design of Hybrid Systems, {ADHS}
                  2021, Brussels, Belgium, July 7-9, 2021},
  series       = {IFAC-PapersOnLine},
  volume       = {54},
  number       = {5},
  pages        = {1--6},
  publisher    = {Elsevier},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.ifacol.2021.08.465},
  doi          = {10.1016/J.IFACOL.2021.08.465},
  timestamp    = {Tue, 14 Sep 2021 14:28:35 +0200},
  biburl       = {https://dblp.org/rec/conf/adhs/RobeyLTM21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aime/GhoshalGST21,
  author       = {Bhargab Ghoshal and
                  Biraja Ghoshal and
                  Stephen Swift and
                  Allan Tucker},
  editor       = {Allan Tucker and
                  Pedro Henriques Abreu and
                  Jaime S. Cardoso and
                  Pedro Pereira Rodrigues and
                  David Ria{\~{n}}o},
  title        = {Uncertainty Estimation in SARS-CoV-2 B-Cell Epitope Prediction for
                  Vaccine Development},
  booktitle    = {Artificial Intelligence in Medicine - 19th International Conference
                  on Artificial Intelligence in Medicine, {AIME} 2021, Virtual Event,
                  June 15-18, 2021, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {12721},
  pages        = {361--366},
  publisher    = {Springer},
  year         = {2021},
  url          = {https://doi.org/10.1007/978-3-030-77211-6\_41},
  doi          = {10.1007/978-3-030-77211-6\_41},
  timestamp    = {Thu, 10 Jun 2021 07:59:32 +0200},
  biburl       = {https://dblp.org/rec/conf/aime/GhoshalGST21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aime/GhoshalST21,
  author       = {Biraja Ghoshal and
                  Stephen Swift and
                  Allan Tucker},
  editor       = {Allan Tucker and
                  Pedro Henriques Abreu and
                  Jaime S. Cardoso and
                  Pedro Pereira Rodrigues and
                  David Ria{\~{n}}o},
  title        = {Bayesian Deep Active Learning for Medical Image Analysis},
  booktitle    = {Artificial Intelligence in Medicine - 19th International Conference
                  on Artificial Intelligence in Medicine, {AIME} 2021, Virtual Event,
                  June 15-18, 2021, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {12721},
  pages        = {36--42},
  publisher    = {Springer},
  year         = {2021},
  url          = {https://doi.org/10.1007/978-3-030-77211-6\_4},
  doi          = {10.1007/978-3-030-77211-6\_4},
  timestamp    = {Wed, 09 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/aime/GhoshalST21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/OSullivanWWTMAC21,
  author       = {Dympna O'Sullivan and
                  William Van Woensel and
                  Szymon Wilk and
                  Samson W. Tu and
                  Wojtek Michalowski and
                  Samina Abidi and
                  Marc Carrier and
                  Ruth Edry and
                  Irit Hochberg and
                  Stephen P. Kingwell and
                  Alexandra Kogan and
                  Martin Michalowski and
                  Hugh O'Sullivan and
                  Mor Peleg},
  title        = {Towards a framework for comparing functionalities of multimorbidity
                  clinical decision support: {A} literature-based feature set and benchmark
                  cases},
  booktitle    = {{AMIA} 2021, American Medical Informatics Association Annual Symposium,
                  San Diego, CA, USA, October 30, 2021 - November 3, 2021},
  publisher    = {{AMIA}},
  year         = {2021},
  url          = {https://knowledge.amia.org/74229-amia-1.4622266/t003-1.4626466/t003-1.4626467/3576930-1.4626582/3572901-1.4626579},
  timestamp    = {Wed, 17 Apr 2024 11:46:53 +0200},
  biburl       = {https://dblp.org/rec/conf/amia/OSullivanWWTMAC21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asscc/MehtaTTTGG21,
  author       = {Nandish Mehta and
                  Stephen G. Tell and
                  Walker J. Turner and
                  Lamar Tatro and
                  Giant Goh and
                  C. Thomas Gray},
  title        = {A 77 MHz Relaxation Oscillator in 5nm FinFET with 3ns {TIE} over 10K
                  cycles and {\(\pm\)}0.3{\%} Thermal Stability using Frequency-Error
                  Feedback Loop},
  booktitle    = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2021, Busan,
                  Korea, Republic of, November 7-10, 2021},
  pages        = {1--3},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/A-SSCC53895.2021.9634712},
  doi          = {10.1109/A-SSCC53895.2021.9634712},
  timestamp    = {Tue, 21 Dec 2021 17:54:16 +0100},
  biburl       = {https://dblp.org/rec/conf/asscc/MehtaTTTGG21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/BoffiTS21,
  author       = {Nicholas M. Boffi and
                  Stephen Tu and
                  Jean{-}Jacques E. Slotine},
  title        = {Nonparametric Adaptive Control and Prediction: Theory and Randomized
                  Algorithms},
  booktitle    = {2021 60th {IEEE} Conference on Decision and Control (CDC), Austin,
                  TX, USA, December 14-17, 2021},
  pages        = {2935--2942},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/CDC45484.2021.9682907},
  doi          = {10.1109/CDC45484.2021.9682907},
  timestamp    = {Tue, 17 May 2022 15:53:17 +0200},
  biburl       = {https://dblp.org/rec/conf/cdc/BoffiTS21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csci/AllisonTK21,
  author       = {Mark Allison and
                  Stephen W. Turner and
                  Molly Kwasny},
  title        = {Assessing Cognitive Load for Junior Software Engineers: {A} Mixed-Method
                  Study},
  booktitle    = {International Conference on Computational Science and Computational
                  Intelligence, {CSCI} 2021, Las Vegas, NV, USA, December 15-17, 2021},
  pages        = {883--888},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/CSCI54926.2021.00206},
  doi          = {10.1109/CSCI54926.2021.00206},
  timestamp    = {Sat, 27 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/csci/AllisonTK21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/MaiDKTBGCBSK21,
  author       = {Dawei Mai and
                  Yann Donnelly and
                  Michael Peter Kennedy and
                  Stefano Tulisi and
                  James Breslin and
                  Patrick Griffin and
                  Michael Connor and
                  Stephen Brookes and
                  Brian Shelly and
                  Michael Keaveney},
  title        = {Experimental Verification of Wandering Spur Suppression Technique
                  in a 4.9 GHz Fractional-N Frequency Synthesizer},
  booktitle    = {47th {ESSCIRC} 2021 - European Solid State Circuits Conference, {ESSCIR}
                  2021, Grenoble, France, September 13-22, 2021},
  pages        = {439--442},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/ESSCIRC53450.2021.9567841},
  doi          = {10.1109/ESSCIRC53450.2021.9567841},
  timestamp    = {Thu, 28 Oct 2021 16:11:37 +0200},
  biburl       = {https://dblp.org/rec/conf/esscirc/MaiDKTBGCBSK21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/TurnerMU21,
  author       = {Adam Brian Turner and
                  Stephen McCombie and
                  Allon J. Uhlmann},
  title        = {Follow the money: Revealing risky nodes in a Ransomware-Bitcoin network},
  booktitle    = {54th Hawaii International Conference on System Sciences, {HICSS} 2021,
                  Kauai, Hawaii, USA, January 5, 2021},
  pages        = {1--13},
  publisher    = {ScholarSpace},
  year         = {2021},
  url          = {https://hdl.handle.net/10125/70801},
  timestamp    = {Wed, 04 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/hicss/TurnerMU21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ArslanDVARLALTA21,
  author       = {Ali Nadir Arslan and
                  Katarzyna Dabrowska{-}Zielinska and
                  Vesselin Vassilev and
                  Jos{\'{e}} Manuel {\'{A}}lvarez{-}Mart{\'{\i}}nez and
                  Kameliya Radeva and
                  Stanislaw Lewinski and
                  Iida Autio and
                  Hannakaisa Lindqvist and
                  Maria Tenkanen and
                  Tuula Aalto and
                  Markus T{\"{o}}rm{\"{a}} and
                  Lachezar Filchev and
                  Michal Krupinski and
                  Stephen Barry and
                  Tarja Tuomainen and
                  Premysl Stych and
                  Abad Chabbi},
  title        = {Developing Support for Monitoring and Reporting of {GHG} Emissions
                  and Removals from Land Use, Land Change and Forestry},
  booktitle    = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
                  2021, Brussels, Belgium, July 11-16, 2021},
  pages        = {6536--6539},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/IGARSS47720.2021.9553360},
  doi          = {10.1109/IGARSS47720.2021.9553360},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/igarss/ArslanDVARLALTA21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/AhmadiCST21,
  author       = {Amir Ali Ahmadi and
                  Abraar Chaudhry and
                  Vikas Sindhwani and
                  Stephen Tu},
  editor       = {Ali Jadbabaie and
                  John Lygeros and
                  George J. Pappas and
                  Pablo A. Parrilo and
                  Benjamin Recht and
                  Claire J. Tomlin and
                  Melanie N. Zeilinger},
  title        = {Safely Learning Dynamical Systems from Short Trajectories},
  booktitle    = {Proceedings of the 3rd Annual Conference on Learning for Dynamics
                  and Control, {L4DC} 2021, 7-8 June 2021, Virtual Event, Switzerland},
  series       = {Proceedings of Machine Learning Research},
  volume       = {144},
  pages        = {498--509},
  publisher    = {{PMLR}},
  year         = {2021},
  url          = {http://proceedings.mlr.press/v144/ahmadi21a.html},
  timestamp    = {Mon, 14 Jun 2021 08:02:30 +0200},
  biburl       = {https://dblp.org/rec/conf/l4dc/AhmadiCST21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/BoffiTS21,
  author       = {Nicholas M. Boffi and
                  Stephen Tu and
                  Jean{-}Jacques E. Slotine},
  editor       = {Ali Jadbabaie and
                  John Lygeros and
                  George J. Pappas and
                  Pablo A. Parrilo and
                  Benjamin Recht and
                  Claire J. Tomlin and
                  Melanie N. Zeilinger},
  title        = {Regret Bounds for Adaptive Nonlinear Control},
  booktitle    = {Proceedings of the 3rd Annual Conference on Learning for Dynamics
                  and Control, {L4DC} 2021, 7-8 June 2021, Virtual Event, Switzerland},
  series       = {Proceedings of Machine Learning Research},
  volume       = {144},
  pages        = {471--483},
  publisher    = {{PMLR}},
  year         = {2021},
  url          = {http://proceedings.mlr.press/v144/boffi21a.html},
  timestamp    = {Mon, 14 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/l4dc/BoffiTS21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miua/TuMCM21,
  author       = {Shihfan Jack Tu and
                  Jules Morel and
                  Minsi Chen and
                  Stephen J. Mellon},
  editor       = {Bartlomiej W. Papiez and
                  Mohammad Yaqub and
                  Jianbo Jiao and
                  Ana I. L. Namburete and
                  J. Alison Noble},
  title        = {Fast Automatic Bone Surface Segmentation in Ultrasound Images Without
                  Machine Learning},
  booktitle    = {Medical Image Understanding and Analysis - 25th Annual Conference,
                  {MIUA} 2021, Oxford, United Kingdom, July 12-14, 2021, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {12722},
  pages        = {250--264},
  publisher    = {Springer},
  year         = {2021},
  url          = {https://doi.org/10.1007/978-3-030-80432-9\_20},
  doi          = {10.1007/978-3-030-80432-9\_20},
  timestamp    = {Thu, 23 Jun 2022 19:58:26 +0200},
  biburl       = {https://dblp.org/rec/conf/miua/TuMCM21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/AnanthaVTLPC21,
  author       = {Raviteja Anantha and
                  Svitlana Vakulenko and
                  Zhucheng Tu and
                  Shayne Longpre and
                  Stephen Pulman and
                  Srinivas Chappidi},
  editor       = {Kristina Toutanova and
                  Anna Rumshisky and
                  Luke Zettlemoyer and
                  Dilek Hakkani{-}T{\"{u}}r and
                  Iz Beltagy and
                  Steven Bethard and
                  Ryan Cotterell and
                  Tanmoy Chakraborty and
                  Yichao Zhou},
  title        = {Open-Domain Question Answering Goes Conversational via Question Rewriting},
  booktitle    = {Proceedings of the 2021 Conference of the North American Chapter of
                  the Association for Computational Linguistics: Human Language Technologies,
                  {NAACL-HLT} 2021, Online, June 6-11, 2021},
  pages        = {520--534},
  publisher    = {Association for Computational Linguistics},
  year         = {2021},
  url          = {https://doi.org/10.18653/v1/2021.naacl-main.44},
  doi          = {10.18653/V1/2021.NAACL-MAIN.44},
  timestamp    = {Fri, 06 Aug 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/naacl/AnanthaVTLPC21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/works-ws/Al-SaadiABCCHHJ21,
  author       = {Aymen Al{-}Saadi and
                  Dong H. Ahn and
                  Yadu N. Babuji and
                  Kyle Chard and
                  James Corbett and
                  Mihael Hategan and
                  Stephen Herbein and
                  Shantenu Jha and
                  Daniel E. Laney and
                  Andr{\'{e}} Merzky and
                  Todd S. Munson and
                  Michael Salim and
                  Mikhail Titov and
                  Matteo Turilli and
                  Thomas D. Uram and
                  Justin M. Wozniak},
  title        = {ExaWorks: Workflows for Exascale},
  booktitle    = {2021 {IEEE} Workshop on Workflows in Support of Large-Scale Science
                  (WORKS), St. Louis, MO, USA, November 15, 2021},
  pages        = {50--57},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/WORKS54523.2021.00012},
  doi          = {10.1109/WORKS54523.2021.00012},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/works-ws/Al-SaadiABCCHHJ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/coin-ws/2020,
  editor       = {Andrea Aler Tubella and
                  Stephen Cranefield and
                  Christopher Frantz and
                  Felipe Meneguzzi and
                  Wamberto Vasconcelos},
  title        = {Coordination, Organizations, Institutions, Norms, and Ethics for Governance
                  of Multi-Agent Systems {XIII} - International Workshops {COIN} 2017
                  and {COINE} 2020, Sao Paulo, Brazil, May 8-9, 2017 and Virtual Event,
                  May 9, 2020, Revised Selected Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {12298},
  publisher    = {Springer},
  year         = {2021},
  url          = {https://doi.org/10.1007/978-3-030-72376-7},
  doi          = {10.1007/978-3-030-72376-7},
  isbn         = {978-3-030-72375-0},
  timestamp    = {Thu, 15 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/coin-ws/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2101-06492,
  author       = {Alexander Robey and
                  Lars Lindemann and
                  Stephen Tu and
                  Nikolai Matni},
  title        = {Learning Robust Hybrid Control Barrier Functions for Uncertain Systems},
  journal      = {CoRR},
  volume       = {abs/2101.06492},
  year         = {2021},
  url          = {https://arxiv.org/abs/2101.06492},
  eprinttype    = {arXiv},
  eprint       = {2101.06492},
  timestamp    = {Fri, 22 Jan 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2101-06492.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2101-12383,
  author       = {Jil Kl{\"{u}}nder and
                  Regina Hebig and
                  Paolo Tell and
                  Marco Kuhrmann and
                  Joyce Nakatumba{-}Nabende and
                  Rogardt Heldal and
                  Stephan Krusche and
                  Masud Fazal{-}Baqaie and
                  Michael Felderer and
                  Marcela Fabiana Genero Bocco and
                  Steffen K{\"{u}}pper and
                  Sherlock A. Licorish and
                  Gustavo L{\'{o}}pez and
                  Fergal McCaffery and
                  {\"{O}}zden {\"{O}}zcan Top and
                  Christian R. Prause and
                  Rafael Prikladnicki and
                  Eray T{\"{u}}z{\"{u}}n and
                  Dietmar Pfahl and
                  Kurt Schneider and
                  Stephen G. MacDonell},
  title        = {Catching up with Method and Process Practice: An Industry-Informed
                  Baseline for Researchers},
  journal      = {CoRR},
  volume       = {abs/2101.12383},
  year         = {2021},
  url          = {https://arxiv.org/abs/2101.12383},
  eprinttype    = {arXiv},
  eprint       = {2101.12383},
  timestamp    = {Tue, 02 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2101-12383.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-09161,
  author       = {Stephen Tu and
                  Alexander Robey and
                  Nikolai Matni},
  title        = {Closing the Closed-Loop Distribution Shift in Safe Imitation Learning},
  journal      = {CoRR},
  volume       = {abs/2102.09161},
  year         = {2021},
  url          = {https://arxiv.org/abs/2102.09161},
  eprinttype    = {arXiv},
  eprint       = {2102.09161},
  timestamp    = {Wed, 24 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2102-09161.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-09284,
  author       = {Ross Drummond and
                  Matthew C. Turner and
                  Stephen R. Duncan},
  title        = {Reduced-Order Neural Network Synthesis with Robustness Guarantees},
  journal      = {CoRR},
  volume       = {abs/2102.09284},
  year         = {2021},
  url          = {https://arxiv.org/abs/2102.09284},
  eprinttype    = {arXiv},
  eprint       = {2102.09284},
  timestamp    = {Wed, 24 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2102-09284.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-02561,
  author       = {Cher Bass and
                  Mariana da Silva and
                  Carole H. Sudre and
                  Logan Z. J. Williams and
                  Petru{-}Daniel Tudosiu and
                  Fidel Alfaro{-}Almagro and
                  Sean P. Fitzgibbon and
                  Matthew F. Glasser and
                  Stephen M. Smith and
                  Emma C. Robinson},
  title        = {ICAM-reg: Interpretable Classification and Regression with Feature
                  Attribution for Mapping Neurological Phenotypes in Individual Scans},
  journal      = {CoRR},
  volume       = {abs/2103.02561},
  year         = {2021},
  url          = {https://arxiv.org/abs/2103.02561},
  eprinttype    = {arXiv},
  eprint       = {2103.02561},
  timestamp    = {Mon, 22 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2103-02561.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-11214,
  author       = {Bhargab Ghoshal and
                  Biraja Ghoshal and
                  Stephen Swift and
                  Allan Tucker},
  title        = {Uncertainty Estimation in SARS-CoV-2 B-cell Epitope Prediction for
                  Vaccine Development},
  journal      = {CoRR},
  volume       = {abs/2103.11214},
  year         = {2021},
  url          = {https://arxiv.org/abs/2103.11214},
  eprinttype    = {arXiv},
  eprint       = {2103.11214},
  timestamp    = {Wed, 24 Mar 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2103-11214.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-03589,
  author       = {Nicholas M. Boffi and
                  Stephen Tu and
                  Jean{-}Jacques E. Slotine},
  title        = {Random features for adaptive nonlinear control and prediction},
  journal      = {CoRR},
  volume       = {abs/2106.03589},
  year         = {2021},
  url          = {https://arxiv.org/abs/2106.03589},
  eprinttype    = {arXiv},
  eprint       = {2106.03589},
  timestamp    = {Fri, 11 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2106-03589.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-01295,
  author       = {Stephen Chang and
                  Michael Ballantyne and
                  Milo Turner and
                  William J. Bowman},
  title        = {Dependent Type Systems as Macros},
  journal      = {CoRR},
  volume       = {abs/2107.01295},
  year         = {2021},
  url          = {https://arxiv.org/abs/2107.01295},
  eprinttype    = {arXiv},
  eprint       = {2107.01295},
  timestamp    = {Wed, 07 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2107-01295.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2108-08368,
  author       = {Abu Reyan Ahmed and
                  Md Asadullah Turja and
                  Faryad Darabi Sahneh and
                  Mithun Ghosh and
                  Keaton Hamm and
                  Stephen G. Kobourov},
  title        = {Computing Steiner Trees using Graph Neural Networks},
  journal      = {CoRR},
  volume       = {abs/2108.08368},
  year         = {2021},
  url          = {https://arxiv.org/abs/2108.08368},
  eprinttype    = {arXiv},
  eprint       = {2108.08368},
  timestamp    = {Mon, 23 Aug 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2108-08368.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2108-13521,
  author       = {Aymen Al{-}Saadi and
                  Dong H. Ahn and
                  Yadu N. Babuji and
                  Kyle Chard and
                  James Corbett and
                  Mihael Hategan and
                  Stephen Herbein and
                  Shantenu Jha and
                  Daniel E. Laney and
                  Andr{\'{e}} Merzky and
                  Todd S. Munson and
                  Michael Salim and
                  Mikhail Titov and
                  Matteo Turilli and
                  Justin M. Wozniak},
  title        = {ExaWorks: Workflows for Exascale},
  journal      = {CoRR},
  volume       = {abs/2108.13521},
  year         = {2021},
  url          = {https://arxiv.org/abs/2108.13521},
  eprinttype    = {arXiv},
  eprint       = {2108.13521},
  timestamp    = {Sun, 20 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2108-13521.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-11435,
  author       = {Marco Kuhrmann and
                  Paolo Tell and
                  Regina Hebig and
                  Jil Kl{\"{u}}nder and
                  J{\"{u}}rgen M{\"{u}}nch and
                  Oliver Linssen and
                  Dietmar Pfahl and
                  Michael Felderer and
                  Christian R. Prause and
                  Stephen G. MacDonell and
                  Joyce Nakatumba{-}Nabende and
                  David Raffo and
                  Sarah Beecham and
                  Eray T{\"{u}}z{\"{u}}n and
                  Gustavo L{\'{o}}pez and
                  Nicol{\'{a}}s Paez and
                  Diego Fontdevila and
                  Sherlock A. Licorish and
                  Steffen K{\"{u}}pper and
                  G{\"{u}}nther Ruhe and
                  Eric Knauss and
                  {\"{O}}zden {\"{O}}zcan{-}Top and
                  Paul M. Clarke and
                  Fergal McCaffery and
                  Marcela Genero and
                  Aurora Vizca{\'{\i}}no and
                  Mario Piattini and
                  Marcos Kalinowski and
                  Tayana Conte and
                  Rafael Prikladnicki and
                  Stephan Krusche and
                  Ahmet Coskun{\c{c}}ay and
                  Ezequiel Scott and
                  Fabio Calefato and
                  Svetlana Pimonova and
                  Rolf{-}Helge Pfeiffer and
                  Ulrik Pagh Schultz and
                  Rogardt Heldal and
                  Masud Fazal{-}Baqaie and
                  Craig Anslow and
                  Maleknaz Nayebi and
                  Kurt Schneider and
                  Stefan Sauer and
                  Dietmar Winkler and
                  Stefan Biffl and
                  Mar{\'{\i}}a Cecilia Bastarrica and
                  Ita Richardson},
  title        = {What Makes Agile Software Development Agile?},
  journal      = {CoRR},
  volume       = {abs/2109.11435},
  year         = {2021},
  url          = {https://arxiv.org/abs/2109.11435},
  eprinttype    = {arXiv},
  eprint       = {2109.11435},
  timestamp    = {Mon, 09 Jan 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2109-11435.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-11576,
  author       = {Tim Hsu and
                  Nathan Keilbart and
                  Stephen Weitzner and
                  James Chapman and
                  Penghao Xiao and
                  Tuan Anh Pham and
                  S. Roger Qiu and
                  Xiao Chen and
                  Brandon C. Wood},
  title        = {Efficient, Interpretable Atomistic Graph Neural Network Representation
                  for Angle-dependent Properties and its Application to Optical Spectroscopy
                  Prediction},
  journal      = {CoRR},
  volume       = {abs/2109.11576},
  year         = {2021},
  url          = {https://arxiv.org/abs/2109.11576},
  eprinttype    = {arXiv},
  eprint       = {2109.11576},
  timestamp    = {Fri, 29 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2109-11576.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-09971,
  author       = {Lars Lindemann and
                  Alexander Robey and
                  Lejun Jiang and
                  Stephen Tu and
                  Nikolai Matni},
  title        = {Learning Robust Output Control Barrier Functions from Safe Expert
                  Demonstrations},
  journal      = {CoRR},
  volume       = {abs/2111.09971},
  year         = {2021},
  url          = {https://arxiv.org/abs/2111.09971},
  eprinttype    = {arXiv},
  eprint       = {2111.09971},
  timestamp    = {Mon, 22 Nov 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2111-09971.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-06904,
  author       = {Ziyan Wang and
                  Giljoo Nam and
                  Tuur Stuyck and
                  Stephen Lombardi and
                  Michael Zollh{\"{o}}fer and
                  Jessica K. Hodgins and
                  Christoph Lassner},
  title        = {{HVH:} Learning a Hybrid Neural Volumetric Representation for Dynamic
                  Hair Performance Capture},
  journal      = {CoRR},
  volume       = {abs/2112.06904},
  year         = {2021},
  url          = {https://arxiv.org/abs/2112.06904},
  eprinttype    = {arXiv},
  eprint       = {2112.06904},
  timestamp    = {Fri, 21 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2112-06904.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-10690,
  author       = {Thomas T. C. K. Zhang and
                  Stephen Tu and
                  Nicholas M. Boffi and
                  Jean{-}Jacques E. Slotine and
                  Nikolai Matni},
  title        = {Adversarially Robust Stability Certificates can be Sample-Efficient},
  journal      = {CoRR},
  volume       = {abs/2112.10690},
  year         = {2021},
  url          = {https://arxiv.org/abs/2112.10690},
  eprinttype    = {arXiv},
  eprint       = {2112.10690},
  timestamp    = {Tue, 04 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2112-10690.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/FarnellRGZPHHMC20,
  author       = {Damian J. J. Farnell and
                  Stephen Richmond and
                  Jennifer Galloway and
                  Alexei I. Zhurov and
                  Pertti Pirttiniemi and
                  Tuomo H. Heikkinen and
                  Virpi Harila and
                  Harold S. Matthews and
                  Peter Claes},
  title        = {Multilevel principal components analysis of three-dimensional facial
                  growth in adolescents},
  journal      = {Comput. Methods Programs Biomed.},
  volume       = {188},
  pages        = {105272},
  year         = {2020},
  url          = {https://doi.org/10.1016/j.cmpb.2019.105272},
  doi          = {10.1016/J.CMPB.2019.105272},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cmpb/FarnellRGZPHHMC20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/complexity/ShangCKTFK20,
  author       = {Ke Shang and
                  Felix T. S. Chan and
                  Stephen Karungaru and
                  Kenji Terada and
                  Zuren Feng and
                  Liangjun Ke},
  title        = {Two-Stage Robust Optimization for the Orienteering Problem with Stochastic
                  Weights},
  journal      = {Complex.},
  volume       = {2020},
  pages        = {5649821:1--5649821:15},
  year         = {2020},
  url          = {https://doi.org/10.1155/2020/5649821},
  doi          = {10.1155/2020/5649821},
  timestamp    = {Tue, 15 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/complexity/ShangCKTFK20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fcomp/TurnerMU20,
  author       = {Adam Brian Turner and
                  Stephen McCombie and
                  Allon J. Uhlmann},
  title        = {Analysis Techniques for Illicit Bitcoin Transactions},
  journal      = {Frontiers Comput. Sci.},
  volume       = {2},
  pages        = {600596},
  year         = {2020},
  url          = {https://doi.org/10.3389/fcomp.2020.600596},
  doi          = {10.3389/FCOMP.2020.600596},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/fcomp/TurnerMU20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/focm/DeanMMRT20,
  author       = {Sarah Dean and
                  Horia Mania and
                  Nikolai Matni and
                  Benjamin Recht and
                  Stephen Tu},
  title        = {On the Sample Complexity of the Linear Quadratic Regulator},
  journal      = {Found. Comput. Math.},
  volume       = {20},
  number       = {4},
  pages        = {633--679},
  year         = {2020},
  url          = {https://doi.org/10.1007/s10208-019-09426-y},
  doi          = {10.1007/S10208-019-09426-Y},
  timestamp    = {Fri, 07 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/focm/DeanMMRT20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/itcon/LeJGC20,
  author       = {Tuyen Le and
                  H. David Jeong and
                  Stephen B. Gilbert and
                  Evgeny Chukharev{-}Hudilainen},
  title        = {Generating partial civil information model views using a semantic
                  information retrieval approach},
  journal      = {J. Inf. Technol. Constr.},
  volume       = {25},
  pages        = {41--54},
  year         = {2020},
  url          = {https://www.itcon.org/paper/2020/2},
  timestamp    = {Thu, 24 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/itcon/LeJGC20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/PellegriniTJWKS20,
  author       = {Andrea Pellegrini and
                  Ashok Kumar Tummala and
                  Jamshed Jalal and
                  Mark Werkheiser and
                  Anitha Kona and
                  Nigel Stephens and
                  Magnus Bruce and
                  Yasuo Ishii and
                  Joseph Pusdesris and
                  Abhishek Raja and
                  Chris Abernathy and
                  Jinson Koppanalil and
                  Tushar Ringe},
  title        = {The Arm Neoverse {N1} Platform: Building Blocks for the Next-Gen Cloud-to-Edge
                  Infrastructure SoC},
  journal      = {{IEEE} Micro},
  volume       = {40},
  number       = {2},
  pages        = {53--62},
  year         = {2020},
  url          = {https://doi.org/10.1109/MM.2020.2972222},
  doi          = {10.1109/MM.2020.2972222},
  timestamp    = {Thu, 09 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/micro/PellegriniTJWKS20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/YatesAAAAAAAABB20,
  author       = {Andrew D. Yates and
                  Premanand Achuthan and
                  Wasiu A. Akanni and
                  James E. Allen and
                  Jamie Allen and
                  Jorge {\'{A}}lvarez{-}Jarreta and
                  M. Ridwan Amode and
                  Irina M. Armean and
                  Andrey G. Azov and
                  Ruth Bennett and
                  Jyothish Bhai and
                  Konstantinos Billis and
                  Sanjay Boddu and
                  Jos{\'{e}} Carlos Marug{\'{a}}n and
                  Carla A. Cummins and
                  Claire Davidson and
                  Kamalkumar Jayantilal Dodiya and
                  Reham Fatima and
                  Astrid Gall and
                  Carlos Garc{\'{\i}}a{-}Gir{\'{o}}n and
                  Laurent Gil and
                  Tiago Grego and
                  Leanne Haggerty and
                  Erin Haskell and
                  Thibaut Hourlier and
                  Osagie G. Izuogu and
                  Sophie H. Janacek and
                  Thomas Juettemann and
                  Mike P. Kay and
                  Ilias Lavidas and
                  Tuan Le and
                  Diana Lemos and
                  Jose Gonzalez Martinez and
                  Thomas Maurel and
                  Mark D. McDowall and
                  Aoife McMahon and
                  Shamika Mohanan and
                  Benjamin Moore and
                  Michael Nuhn and
                  Denye N. Oheh and
                  Anne Parker and
                  Andrew Parton and
                  Mateus Patricio and
                  Manoj Pandian Sakthivel and
                  Ahamed Imran Abdul Salam and
                  Bianca M. Schmitt and
                  Helen Schuilenburg and
                  Dan Sheppard and
                  Mira Sycheva and
                  Marek Szuba and
                  Kieron R. Taylor and
                  Anja Thormann and
                  Glen Threadgold and
                  Alessandro Vullo and
                  Brandon Walts and
                  Andrea Winterbottom and
                  Amonida Zadissa and
                  Marc Chakiachvili and
                  Bethany Flint and
                  Adam Frankish and
                  Sarah E. Hunt and
                  Garth IIsley and
                  Myrto Kostadima and
                  Nick Langridge and
                  Jane E. Loveland and
                  Fergal J. Martin and
                  Joannella Morales and
                  Jonathan M. Mudge and
                  Matthieu Muffato and
                  Emily Perry and
                  Magali Ruffier and
                  Stephen J. Trevanion and
                  Fiona Cunningham and
                  Kevin L. Howe and
                  Daniel R. Zerbino and
                  Paul Flicek},
  title        = {Ensembl 2020},
  journal      = {Nucleic Acids Res.},
  volume       = {48},
  number       = {Database-Issue},
  pages        = {D682--D688},
  year         = {2020},
  url          = {https://doi.org/10.1093/nar/gkz966},
  doi          = {10.1093/NAR/GKZ966},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/nar/YatesAAAAAAAABB20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/CollinsBKZAFKLG20,
  author       = {Ryan L. Collins and
                  Harrison Brand and
                  Konrad J. Karczewski and
                  Xuefang Zhao and
                  Jessica Alf{\"{o}}ldi and
                  Laurent C. Francioli and
                  Amit V. Khera and
                  Chelsea Lowther and
                  Laura D. Gauthier and
                  Harold Wang and
                  Nicholas A. Watts and
                  Matthew Solomonson and
                  Alexander Baumann and
                  Ruchi Munshi and
                  Mark Walker and
                  Christopher W. Whelan and
                  Yongqing Huang and
                  Ted Brookings and
                  Ted Sharpe and
                  Matthew R. Stone and
                  Elise Valkanas and
                  Jack Fu and
                  Grace Tiao and
                  Kristen M. Laricchia and
                  Valent{\'{\i}}n Ruano{-}Rubio and
                  Christine Stevens and
                  Namrata Gupta and
                  Caroline Cusick and
                  Lauren Margolin and
                  Irina M. Armean and
                  Eric Banks and
                  Louis Bergelson and
                  Kristian Cibulskis and
                  Kristen M. Connolly and
                  Miguel Covarrubias and
                  Beryl B. Cummings and
                  Mark J. Daly and
                  Stacey Donnelly and
                  Yossi Farjoun and
                  Steven Ferriera and
                  Stacey Gabriel and
                  Jeff Gentry and
                  Thibault Jeandet and
                  Diane Kaplan and
                  Christopher Llanwarne and
                  Eric V. Minikel and
                  Benjamin M. Neale and
                  Sam Novod and
                  Anne H. O'Donnell{-}Luria and
                  Nikelle Petrillo and
                  Timothy Poterba and
                  David Roazen and
                  Andrea Saltzman and
                  Kaitlin E. Samocha and
                  Molly Schleicher and
                  Cotton Seed and
                  Jos{\'{e}} Soto and
                  Kathleen Tibbetts and
                  Charlotte Tolonen and
                  Christopher Vittal and
                  Gordon Wade and
                  Arcturus Wang and
                  Qingbo Wang and
                  James S. Ware and
                  Ben Weisburd and
                  Nicola Whiffin and
                  Carlos A. Aguilar Salinas and
                  Tariq Ahmad and
                  Christine M. Albert and
                  Diego Ardissino and
                  Gil Atzmon and
                  John Barnard and
                  Laurent Beaugerie and
                  Emelia J. Benjamin and
                  Michael Boehnke and
                  Lori L. Bonnycastle and
                  Erwin P. Bottinger and
                  Donald W. Bowden and
                  Matthew J. Bown and
                  John C. Chambers and
                  Juliana C. Chan and
                  Daniel Chasman and
                  Judy Cho and
                  Mina K. Chung and
                  Bruce Cohen and
                  Adolfo Correa and
                  Dana Dabelea and
                  Dawood Darbar and
                  Ravindranath Duggirala and
                  Jos{\'{e}}e Dupuis and
                  Patrick T. Ellinor and
                  Roberto Elosua and
                  Jeanette Erdmann and
                  T{\~{o}}nu Esko and
                  Martti F{\"{a}}rkkil{\"{a}} and
                  Jose Florez and
                  Andre Franke and
                  Gad Getz and
                  Benjamin Glaser and
                  Stephen J. Glatt and
                  David Goldstein and
                  Clicerio Gonzalez and
                  Leif Groop and
                  Christopher A. Haiman and
                  Craig Hanis and
                  Matthew Harms and
                  Mikko Hiltunen and
                  Matti M. Holi and
                  Christina M. Hultman and
                  Mikko Kallela and
                  Jaakko Kaprio and
                  Sekar Kathiresan and
                  Bong{-}Jo Kim and
                  Young Jin Kim and
                  George Kirov and
                  Jaspal Kooner and
                  Seppo Koskinen and
                  Harlan M. Krumholz and
                  Subra Kugathasan and
                  Soo Heon Kwak and
                  Markku Laakso and
                  Terho Lehtim{\"{a}}ki and
                  Ruth J. F. Loos and
                  Steven A. Lubitz and
                  Ronald C. W. Ma and
                  Daniel G. MacArthur and
                  Jaume Marrugat and
                  Kari M. Mattila and
                  Steven A. McCarroll and
                  Mark I. McCarthy and
                  Dermot McGovern and
                  Ruth McPherson and
                  James B. Meigs and
                  Olle Melander and
                  Andres Metspalu and
                  Peter M. Nilsson and
                  Michael C. O'Donovan and
                  Dost {\"{O}}ng{\"{u}}r and
                  Lorena Orozco and
                  Michael J. Owen and
                  Colin N. A. Palmer and
                  Aarno Palotie and
                  Kyong Soo Park and
                  Carlos Pato and
                  Ann E. Pulver and
                  Nazneen Rahman and
                  Anne M. Remes and
                  John D. Rioux and
                  Samuli Ripatti and
                  Dan M. Roden and
                  Danish Saleheen and
                  Veikko Salomaa and
                  Nilesh J. Samani and
                  Jeremiah Scharf and
                  Heribert Schunkert and
                  Moore B. Shoemaker and
                  Pamela Sklar and
                  Hilkka Soininen and
                  Harry Sokol and
                  Tim Spector and
                  Patrick F. Sullivan and
                  Jaana Suvisaari and
                  E. Shyong Tai and
                  Yik Ying Teo and
                  Tuomi Tiinamaija and
                  Ming Tsuang and
                  Dan Turner and
                  Teresa Tusie{-}Luna and
                  Erkki Vartiainen and
                  Hugh Watkins and
                  Rinse K. Weersma and
                  Maija Wessman and
                  James G. Wilson and
                  Ramnik J. Xavier and
                  Kent D. Taylor and
                  Henry J. Lin and
                  Stephen S. Rich and
                  Wendy S. Post and
                  Yii{-}Der Ida Chen and
                  Jerome I. Rotter and
                  Chad Nusbaum and
                  Anthony A. Philippakis and
                  Eric S. Lander and
                  Michael E. Talkowski},
  title        = {A structural variation reference for medical and population genetics},
  journal      = {Nat.},
  volume       = {581},
  number       = {7809},
  pages        = {444--451},
  year         = {2020},
  url          = {https://doi.org/10.1038/s41586-020-2287-8},
  doi          = {10.1038/S41586-020-2287-8},
  timestamp    = {Wed, 16 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nature/CollinsBKZAFKLG20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/TurroAMGGSASFTS20,
  author       = {Ernest Turro and
                  William J. Astle and
                  Karyn Megy and
                  Stefan Gr{\"{a}}f and
                  Daniel Greene and
                  Olga Shamardina and
                  Hana Lango Allen and
                  Alba Sanchis{-}Juan and
                  Mattia Frontini and
                  Chantal Thys and
                  Jonathan Stephens and
                  Rutendo Mapeta and
                  Oliver S. Burren and
                  Kate Downes and
                  Matthias Haimel and
                  Salih Tuna and
                  Sri V. V. Deevi and
                  Timothy J. Aitman and
                  David L. H. Bennett and
                  Paul Calleja and
                  Keren Carss and
                  Mark J. Caulfield and
                  Patrick F. Chinnery and
                  Peter H. Dixon and
                  Daniel P. Gale and
                  Roger James and
                  Ania Koziell and
                  Michael A. Laffan and
                  Adam P. Levine and
                  Eamonn R. Maher and
                  Hugh S. Markus and
                  Joannella Morales and
                  Nicholas W. Morrell and
                  Andrew D. Mumford and
                  Elizabeth Ormondroyd and
                  Stuart Rankin and
                  Augusto Rendon and
                  Sylvia Richardson and
                  Irene Roberts and
                  Noemi B. A. Roy and
                  Moin A. Saleem and
                  Kenneth G. C. Smith and
                  Hannah Stark and
                  Rhea Y. Y. Tan and
                  Andreas C. Themistocleous and
                  Adrian J. Thrasher and
                  Hugh Watkins and
                  Andrew R. Webster and
                  Martin R. Wilkins and
                  Catherine Williamson and
                  James Whitworth and
                  Sean Humphray and
                  David R. Bentley and
                  Stephen Abbs and
                  Lara Abulhoul and
                  Julian Adlard and
                  Munaza Ahmed and
                  Hana Alachkar and
                  David J. Allsup and
                  Jeff Almeida{-}King and
                  Philip Ancliff and
                  Richard Antrobus and
                  Ruth Armstrong and
                  Gavin Arno and
                  Sofie Ashford and
                  Anthony Attwood and
                  Paul Aurora and
                  Christian Babbs and
                  Chiara Bacchelli and
                  Tamam Bakchoul and
                  Siddharth Banka and
                  Tadbir Bariana and
                  Julian Barwell and
                  Joana Batista and
                  Helen E. Baxendale and
                  Phil L. Beales and
                  Agnieszka Bierzynska and
                  Tina Biss and
                  Maria A. K. Bitner{-}Glindzicz and
                  Graeme C. M. Black and
                  Marta Bleda and
                  Iulia Blesneac and
                  Detlef Bockenhauer and
                  Harm Bogaard and
                  Christian J. Bourne and
                  Sara Boyce and
                  John R. Bradley and
                  Eugene Bragin and
                  Gerome Breen and
                  Paul Brennan and
                  Carole Brewer and
                  Matthew Brown and
                  Andrew C. Browning and
                  Michael J. Browning and
                  Rachel J. Buchan and
                  Matthew S. Buckland and
                  Teofila Bueser and
                  Carmen Bugarin Diz and
                  John Burn and
                  Siobhan O. Burns and
                  Nigel Burrows and
                  Carolyn Campbell and
                  Gerald Carr{-}White and
                  Ruth Casey and
                  Jenny Chambers and
                  John Chambers and
                  Melanie M. Y. Chan and
                  Calvin Cheah and
                  Floria Cheng and
                  Manali Chitre and
                  Martin T. Christian and
                  Colin Church and
                  Jill Clayton{-}Smith and
                  Maureen Cleary and
                  Naomi Clements Brod and
                  Gerry Coghlan and
                  Elizabeth Colby and
                  Trevor R. P. Cole and
                  Janine Collins and
                  Peter W. Collins and
                  Camilla Colombo and
                  Cecilia J. Compton and
                  Robin Condliffe and
                  Stuart A. Cook and
                  H. Terence Cook and
                  Nichola Cooper and
                  Paul A. Corris and
                  Abigail Furnell and
                  Fiona Cunningham and
                  Nicola S. Curry and
                  Antony J. Cutler and
                  Matthew J. Daniels and
                  Mehul Dattani and
                  Louise C. Daugherty and
                  John Davis and
                  Anthony De Soyza and
                  Timothy Dent and
                  Charu Deshpande and
                  Eleanor F. Dewhurst and
                  Sofia Douzgou and
                  Anna M. Drazyk and
                  Elizabeth Drewe and
                  Daniel Duarte and
                  Tina Dutt and
                  J. David M. Edgar and
                  Karen Edwards and
                  William Egner and
                  Melanie N. Ekani and
                  Perry Elliott and
                  Wendy N. Erber and
                  Marie Erwood and
                  Maria C. Estiu and
                  Dafydd Gareth Evans and
                  Gillian Evans and
                  Tamara Everington and
                  M{\'{e}}lanie Eyries and
                  Hiva Fassihi and
                  Remi Favier and
                  Jack Findhammer and
                  Debra Fletcher and
                  Frances A. Flinter and
                  R. Andres Floto and
                  Tom Fowler and
                  James Fox and
                  Amy J. Frary and
                  Courtney E. French and
                  Kathleen Freson and
                  Henning Gall and
                  Vijeya Ganesan and
                  Michael Gattens and
                  Claire Geoghegan and
                  Terence S. A. Gerighty and
                  Ali G. Gharavi and
                  Stefano Ghio and
                  Hossein{-}Ardeschir Ghofrani and
                  J. Simon R. Gibbs and
                  Kate Gibson and
                  Kimberly C. Gilmour and
                  Barbara Girerd and
                  Nicholas S. Gleadall and
                  Sarah Goddard and
                  David B. Goldstein and
                  Keith Gomez and
                  Pavels Gordins and
                  David Gosal and
                  Jodie Graham and
                  Luigi Grassi and
                  Lynn Greenhalgh and
                  Andreas Greinacher and
                  Paolo Gresele and
                  Philip Griffiths and
                  Sofia Grigoriadou and
                  Russell J. Grocock and
                  Detelina Grozeva and
                  Mark Gurnell and
                  Scott Hackett and
                  Charaka Hadinnapola and
                  William M. Hague and
                  Rosie Hague and
                  Matthew Hall and
                  Helen L. Hanson and
                  Eshika Haque and
                  Kirsty Harkness and
                  Andrew R. Harper and
                  Claire L. Harris and
                  Daniel Hart and
                  Ahamad Hassan and
                  Grant Hayman and
                  Alex Henderson and
                  Archana Herwadkar and
                  Jonathan Hoffman and
                  Simon Holden and
                  Rita Horvath and
                  Henry Houlden and
                  Arjan C. Houweling and
                  Luke S. G. E. Howard and
                  Fengyuan Hu and
                  Gavin Hudson and
                  Joseph Hughes and
                  Aarnoud P. Huissoon and
                  Marc Humbert and
                  Sarah Hunter and
                  Matthew E. Hurles and
                  Melita Irving and
                  Louise Izatt and
                  Sally A. Johnson and
                  Stephen Jolles and
                  Jennifer Jolley and
                  Dragana Josifova and
                  Neringa Jurkute and
                  Tim Karten and
                  Johannes Karten and
                  Mary A. Kasanicki and
                  Hanadi Kazkaz and
                  Rashid Kazmi and
                  Peter Kelleher and
                  Anne M. Kelly and
                  Wilf Kelsall and
                  Carly Kempster and
                  David G. Kiely and
                  Nathalie Kingston and
                  Robert Klima and
                  Nils Koelling and
                  Myrto Kostadima and
                  Gabor Kovacs and
                  Roman Kreuzhuber and
                  Taco W. Kuijpers and
                  Ajith Kumar and
                  Dinakantha Kumararatne and
                  Manju A. Kurian and
                  Fiona Lalloo and
                  Michele Lambert and
                  Allan Lawrie and
                  D. Mark Layton and
                  Nick Lench and
                  Claire Lentaigne and
                  Tracy Lester and
                  Rachel Linger and
                  Hilary Longhurst and
                  Lorena E. Lorenzo and
                  Eleni Louka and
                  Paul A. Lyons and
                  Rajiv D. Machado and
                  Robert V. MacKenzie Ross and
                  Bella Madan and
                  Jesmeen Maimaris and
                  Samantha Malka and
                  Sarah Mangles and
                  Kevin J. Marchbank and
                  Stephen Marks and
                  Hanns{-}Ulrich Marschall and
                  Andrew G. Marshall and
                  Jennifer Martin and
                  Mary Mathias and
                  Emma Matthews and
                  Heather Maxwell and
                  Paul McAlinden and
                  Mark I. McCarthy and
                  Harriet McKinney and
                  Aoife McMahon and
                  Stuart Meacham and
                  Adam J. Mead and
                  Ignacio Medina Castello and
                  Sarju G. Mehta and
                  Michel Michaelides and
                  Carolyn Millar and
                  Shehla N. Mohammed and
                  Shahin Moledina and
                  David Montani and
                  Anthony T. Moore and
                  Monika Mozere and
                  Keith W. Muir and
                  Andrea H. Nemeth and
                  William G. Newman and
                  Michael Newnham and
                  Sadia Noorani and
                  Paquita Nurden and
                  Jennifer O'Sullivan and
                  Samya Obaji and
                  Chris Odhams and
                  Steven Okoli and
                  Andrea Olschewski and
                  Horst Olschewski and
                  Kai Ren Ong and
                  S. Helen Oram and
                  Willem H. Ouwehand and
                  Claire Palles and
                  Sofia Papadia and
                  Soo{-}Mi Park and
                  David Parry and
                  Smita Patel and
                  Joan Paterson and
                  Andrew Peacock and
                  Simon H. Pearce and
                  John Peden and
                  Kathelijne Peerlinck and
                  Christopher J. Penkett and
                  Joanna Pepke{-}Zaba and
                  Romina Petersen and
                  Clarissa Pilkington and
                  Kenneth E. S. Poole and
                  Radhika Prathalingam and
                  Bethan Psaila and
                  Angela Pyle and
                  Richard Quinton and
                  Shamima Rahman and
                  Anupama Rao and
                  F. Lucy Raymond and
                  Paula J. Rayner{-}Matthews and
                  Christine Rees and
                  Tara Renton and
                  Christopher J. Rhodes and
                  Andrew S. C. Rice and
                  Alex Richter and
                  Leema Robert and
                  Anthony Rogers and
                  Sarah J. Rose and
                  Robert Ross{-}Russell and
                  Catherine Roughley and
                  Deborah M. Ruddy and
                  Omid Sadeghi{-}Alavijeh and
                  Nilesh J. Samani and
                  Crina Samarghitean and
                  Ravishankar B. Sargur and
                  Robert N. Sarkany and
                  Simon Satchell and
                  Sinisa Savic and
                  John A. Sayer and
                  Genevieve Sayer and
                  Laura Scelsi and
                  Andrew M. Schaefer and
                  Sol Schulman and
                  Richard Scott and
                  Marie Scully and
                  Claire Searle and
                  Werner Seeger and
                  Arjune Sen and
                  W. A. Carrock Sewell and
                  Denis Seyres and
                  Neil Shah and
                  Susan E. Shapiro and
                  Adam C. Shaw and
                  Patrick J. Short and
                  Keith Sibson and
                  Lucy Side and
                  Ilenia Simeoni and
                  Michael A. Simpson and
                  Matthew C. Sims and
                  Suthesh Sivapalaratnam and
                  Damian Smedley and
                  Katherine R. Smith and
                  Katie Snape and
                  Nicole Soranzo and
                  Florent Soubrier and
                  Laura Southgate and
                  Olivera Spasic{-}Boskovic and
                  Simon Staines and
                  Emily Staples and
                  Charles A. Steward and
                  Kathleen E. Stirrups and
                  Alex Stuckey and
                  Jay Suntharalingam and
                  Emilia M. Swietlik and
                  Petros Syrris and
                  R. Campbell Tait and
                  Kate Talks and
                  Katie Tate and
                  John M. Taylor and
                  Jenny C. Taylor and
                  James E. Thaventhiran and
                  Ellen Thomas and
                  David Thomas and
                  Moira J. Thomas and
                  Patrick Thomas and
                  Kate Thomson and
                  Glen Threadgold and
                  Tobias Tilly and
                  Marc Tischkowitz and
                  Catherine Titterton and
                  John A. Todd and
                  Cheng{-}Hock Toh and
                  Bas Tolhuis and
                  Ian P. Tomlinson and
                  Mark Toshner and
                  Matthew Traylor and
                  Carmen Treacy and
                  Paul Treadaway and
                  Richard Trembath and
                  Wojciech Turek and
                  Philip Twiss and
                  Tom Vale and
                  Chris Van Geet and
                  Natalie van Zuydam and
                  Maarten Vandekuilen and
                  Anthony M. Vandersteen and
                  Marta Vazquez{-}Lopez and
                  Julie von Ziegenweidt and
                  Anton Vonk{-}Noordegraaf and
                  Annette Wagner and
                  Quinten Waisfisz and
                  Suellen M. Walker and
                  Neil Walker and
                  Klaudia Walter and
                  James S. Ware and
                  Christopher Watt and
                  Lucy Wedderburn and
                  Wei Wei and
                  Steven B. Welch and
                  Julie Wessels and
                  Sarah K. Westbury and
                  John{-}Paul Westwood and
                  John Wharton and
                  Deborah Whitehorn and
                  Andrew O. M. Wilkie and
                  Brian T. Wilson and
                  Edwin K. S. Wong and
                  Nicholas W. Wood and
                  Yvette Wood and
                  Christopher Geoffrey Woods and
                  Emma R. Woodward and
                  Stephen J. Wort and
                  Austen Worth and
                  Michael Wright and
                  Katherine Yates and
                  Patrick F. K. Yong and
                  Timothy Young and
                  Ping Yu and
                  Patrick Yu{-}Wai{-}Man and
                  Eliska Zlamalova},
  title        = {Whole-genome sequencing of patients with rare diseases in a national
                  health system},
  journal      = {Nat.},
  volume       = {583},
  number       = {7814},
  pages        = {96--102},
  year         = {2020},
  url          = {https://doi.org/10.1038/s41586-020-2434-2},
  doi          = {10.1038/S41586-020-2434-2},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nature/TurroAMGGSASFTS20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmpl/ChangBTB20,
  author       = {Stephen Chang and
                  Michael Ballantyne and
                  Milo Turner and
                  William J. Bowman},
  title        = {Dependent type systems as macros},
  journal      = {Proc. {ACM} Program. Lang.},
  volume       = {4},
  number       = {{POPL}},
  pages        = {3:1--3:29},
  year         = {2020},
  url          = {https://doi.org/10.1145/3371071},
  doi          = {10.1145/3371071},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pacmpl/ChangBTB20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/AngelTPMLM20,
  author       = {Yoseline Angel and
                  Darren Turner and
                  Stephen Parkes and
                  Yoann Malb{\'{e}}teau and
                  Arko Lucieer and
                  Matthew F. McCabe},
  title        = {Automated Georectification and Mosaicking of UAV-Based Hyperspectral
                  Imagery from Push-Broom Sensors},
  journal      = {Remote. Sens.},
  volume       = {12},
  number       = {1},
  pages        = {34},
  year         = {2020},
  url          = {https://doi.org/10.3390/rs12010034},
  doi          = {10.3390/RS12010034},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/remotesensing/AngelTPMLM20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/AragonJPMAAATLM20,
  author       = {Bruno Aragon and
                  Kasper Johansen and
                  Stephen Parkes and
                  Yoann Malb{\'{e}}teau and
                  Samer Al{-}Mashharawi and
                  Talal Al{-}Amoudi and
                  Cristhian F. Andrade and
                  Darren Turner and
                  Arko Lucieer and
                  Matthew F. McCabe},
  title        = {A Calibration Procedure for Field and UAV-Based Uncooled Thermal Infrared
                  Instruments},
  journal      = {Sensors},
  volume       = {20},
  number       = {11},
  pages        = {3316},
  year         = {2020},
  url          = {https://doi.org/10.3390/s20113316},
  doi          = {10.3390/S20113316},
  timestamp    = {Thu, 04 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sensors/AragonJPMAAATLM20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/BaniAABBBBBBBBC20,
  author       = {Lukas B{\"{a}}ni and
                  Andreas Alexopoulos and
                  Marina Artuso and
                  Felix Bachmair and
                  Marcin Bartosik and
                  Helge Beck and
                  Vincenzo Bellini and
                  Vladimir Belyaev and
                  Benjamin Bentele and
                  Alexandre Bes and
                  Jean{-}Marie Brom and
                  Gabriele Chiodini and
                  Dominik Chren and
                  Vladimir Cindro and
                  Gilles Claus and
                  Johann Collot and
                  John Cumalat and
                  S{\'{e}}bastien Curtoni and
                  Anne Dabrowski and
                  Raffaello D'Alessandro and
                  Denis Dauvergne and
                  Wim de Boer and
                  Christian Dorfer and
                  Marc D{\"{u}}nser and
                  Gerald Eigen and
                  Vladimir Eremin and
                  Jacopo Forneris and
                  Laurent Gallin{-}Martel and
                  Marie{-}Laure Gallin{-}Martel and
                  Kock Gan and
                  Martin Gastal and
                  Abderrahman Ghimouz and
                  Mathieu Goffe and
                  Joel Goldstein and
                  Alexander Golubev and
                  Andrej Gorisek and
                  Eugene Grigoriev and
                  J{\"{o}}rn Grosse{-}Knetter and
                  Aidan Grummer and
                  Bojan Hiti and
                  Dmitry Hits and
                  Martin Hoeferkamp and
                  J{\'{e}}r{\^{o}}me Hosselet and
                  Fabian H{\"{u}}gging and
                  Chris Hutson and
                  Jens Janssen and
                  Harris Kagan and
                  Keida Kanxheri and
                  Richard Kass and
                  Mladen Kis and
                  Gregor Kramberger and
                  Sergey Kuleshov and
                  Ana Lacoste and
                  Stefano Lagomarsino and
                  Alessandro Lo Giudice and
                  Ivan L{\'{o}}pez Paz and
                  Eric Lukosi and
                  Chaker Maazouzi and
                  Igor Mandic and
                  Sara Marcatili and
                  Alysia Marino and
                  C{\'{e}}dric Mathieu and
                  Mauro Menichelli and
                  Marko Mikuz and
                  Arianna Morozzi and
                  Francesco Moscatelli and
                  Joshua Moss and
                  Raymond Mountain and
                  Alexander Oh and
                  Paolo Olivero and
                  Daniele Passeri and
                  Heinz Pernegger and
                  Roberto Perrino and
                  Federico Picollo and
                  Michal Pomorski and
                  Renato Potenza and
                  Arnulf Quadt and
                  Fatah Rarbi and
                  Alessandro Re and
                  Michael Reichmann and
                  Shaun Roe and
                  Olivier Rossetto and
                  Diego Sanz Becerra and
                  Christian J. Schmidt and
                  Stephen Schnetzer and
                  Silvio Sciortino and
                  Andrea Scorzoni and
                  Sally Seidel and
                  Leonello Servoli and
                  Dale Smith and
                  Bruno Sopko and
                  Vit Sopko and
                  Stefania Spagnolo and
                  Stefan Spanier and
                  Kevin Stenson and
                  Robert Stone and
                  Bjarne Stugu and
                  Concetta Sutera and
                  Michael Tr{\"{a}}ger and
                  William Trischuk and
                  Marco Truccato and
                  Cristina Tuv{\`{e}} and
                  Jaap Velthuis and
                  Stephen Wagner and
                  Rainer Wallny and
                  Jianchun Wang and
                  Norbert Wermes and
                  Jayashani Wickramasinghe and
                  Mahfoud Yamouni and
                  Justas Zalieckas and
                  Marko Zavrtanik and
                  Kazuhiko Hara and
                  Yoichi Ikegami and
                  Osamu Jinnouchi and
                  Takashi Kohriki and
                  Shingo Mitsui and
                  Ryo Nagai and
                  Susumu Terada and
                  Yoshinobu Unno},
  title        = {A Study of the Radiation Tolerance of {CVD} Diamond to 70 MeV Protons,
                  Fast Neutrons and 200 MeV Pions},
  journal      = {Sensors},
  volume       = {20},
  number       = {22},
  pages        = {6648},
  year         = {2020},
  url          = {https://doi.org/10.3390/s20226648},
  doi          = {10.3390/S20226648},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sensors/BaniAABBBBBBBBC20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LiTNWBTY20,
  author       = {Menglong Li and
                  Russel N. Torah and
                  Helga Nunes{-}Matos and
                  Yang Wei and
                  Stephen P. Beeby and
                  John Tudor and
                  Kai Yang},
  title        = {Integration and Testing of a Three-Axis Accelerometer in a Woven E-Textile
                  Sleeve for Wearable Movement Monitoring},
  journal      = {Sensors},
  volume       = {20},
  number       = {18},
  pages        = {5033},
  year         = {2020},
  url          = {https://doi.org/10.3390/s20185033},
  doi          = {10.3390/S20185033},
  timestamp    = {Tue, 18 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sensors/LiTNWBTY20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/RahamanMLJMAASM20,
  author       = {Md Abdur Rahaman and
                  Daniel H. Mathalon and
                  Hyo Jong Lee and
                  Wenhao Jiang and
                  Bryon A. Mueller and
                  Ole A. Andreassen and
                  Ingrid Agartz and
                  Scott R. Sponheim and
                  Andrew R. Mayer and
                  Julia M. Stephen and
                  Rex E. Jung and
                  Jessica A. Turner and
                  Jos{\'{e}} M. Ca{\~{n}}ive and
                  Juan R. Bustillo and
                  Vince D. Calhoun and
                  Cota Navin Gupta and
                  Srinivas Rachakonda and
                  Jiayu Chen and
                  Jingyu Liu and
                  Theo G. M. van Erp and
                  Steven G. Potkin and
                  Judith M. Ford},
  title        = {N-BiC: {A} Method for Multi-Component and Symptom Biclustering of
                  Structural {MRI} Data: Application to Schizophrenia},
  journal      = {{IEEE} Trans. Biomed. Eng.},
  volume       = {67},
  number       = {1},
  pages        = {110--121},
  year         = {2020},
  url          = {https://doi.org/10.1109/TBME.2019.2908815},
  doi          = {10.1109/TBME.2019.2908815},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tbe/RahamanMLJMAASM20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcst/Narvaez-ArocheM20,
  author       = {Octavio Narvaez{-}Aroche and
                  Pierre{-}Jean Meyer and
                  Stephen Tu and
                  Andrew K. Packard and
                  Murat Arcak},
  title        = {Robust Control of the Sit-to-Stand Movement for a Powered Lower Limb
                  Orthosis},
  journal      = {{IEEE} Trans. Control. Syst. Technol.},
  volume       = {28},
  number       = {6},
  pages        = {2390--2403},
  year         = {2020},
  url          = {https://doi.org/10.1109/TCST.2019.2945908},
  doi          = {10.1109/TCST.2019.2945908},
  timestamp    = {Fri, 30 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcst/Narvaez-ArocheM20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/FuXLWBMAL20,
  author       = {Huazhu Fu and
                  Yanwu Xu and
                  Stephen Lin and
                  Damon Wing Kee Wong and
                  Mani Baskaran and
                  Meenakshi Mahesh and
                  Tin Aung and
                  Jiang Liu},
  title        = {Angle-Closure Detection in Anterior Segment {OCT} Based on Multilevel
                  Deep Network},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {50},
  number       = {7},
  pages        = {3358--3366},
  year         = {2020},
  url          = {https://doi.org/10.1109/TCYB.2019.2897162},
  doi          = {10.1109/TCYB.2019.2897162},
  timestamp    = {Thu, 19 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcyb/FuXLWBMAL20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/RocadenboschBFW20,
  author       = {Francesc Rocadenbosch and
                  Rub{\'{e}}n Barrag{\'{a}}n and
                  Stephen J. Frasier and
                  Joseph Waldinger and
                  David D. Turner and
                  Robin Tanamachi and
                  Daniel T. Dawson},
  title        = {Ceilometer-Based Rain-Rate Estimation: {A} Case-Study Comparison With
                  S-Band Radar and Disdrometer Retrievals in the Context of {VORTEX-SE}},
  journal      = {{IEEE} Trans. Geosci. Remote. Sens.},
  volume       = {58},
  number       = {12},
  pages        = {8268--8284},
  year         = {2020},
  url          = {https://doi.org/10.1109/TGRS.2020.2984458},
  doi          = {10.1109/TGRS.2020.2984458},
  timestamp    = {Thu, 27 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tgrs/RocadenboschBFW20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmbmc/McGuinessGTM20,
  author       = {Daniel Tun{\c{c}} McGuiness and
                  Stamatios Giannoukos and
                  Stephen Taylor and
                  Alan Marshall},
  title        = {Analysis of Multi-Chemical Transmission in the Macro-Scale},
  journal      = {{IEEE} Trans. Mol. Biol. Multi Scale Commun.},
  volume       = {6},
  number       = {2},
  pages        = {93--106},
  year         = {2020},
  url          = {https://doi.org/10.1109/TMBMC.2020.3012874},
  doi          = {10.1109/TMBMC.2020.3012874},
  timestamp    = {Thu, 16 Sep 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tmbmc/McGuinessGTM20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acis/Lam0020,
  author       = {Yuk Tung Tonnie Lam and
                  Peter Busch and
                  Stephen Smith},
  title        = {Australia's Embrace of a Cashless Society},
  booktitle    = {Australasian Conference on Information Systems, {ACIS} 2020, Wellington,
                  New Zealand, December 1-4, 2020},
  pages        = {70},
  year         = {2020},
  url          = {https://aisel.aisnet.org/acis2020/70},
  timestamp    = {Thu, 16 May 2024 17:06:12 +0200},
  biburl       = {https://dblp.org/rec/conf/acis/Lam0020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aicv2/AbdulrasoolT20,
  author       = {Fatema Abdulrasool and
                  Stephen Turnbull},
  editor       = {Aboul Ella Hassanien and
                  Ahmad Taher Azar and
                  Tarek Gaber and
                  Diego Oliva and
                  Mohamed Fahmy Tolba},
  title        = {The Role of {IT} Governance in Enhancing the Performance of Smart
                  Universities},
  booktitle    = {Proceedings of the International Conference on Artificial Intelligence
                  and Computer Vision, {AICV} 2020, Cairo, Egypt, 8-10 April, 2020},
  series       = {Advances in Intelligent Systems and Computing},
  volume       = {1153},
  pages        = {708--720},
  publisher    = {Springer},
  year         = {2020},
  url          = {https://doi.org/10.1007/978-3-030-44289-7\_66},
  doi          = {10.1007/978-3-030-44289-7\_66},
  timestamp    = {Wed, 25 Mar 2020 12:15:32 +0100},
  biburl       = {https://dblp.org/rec/conf/aicv2/AbdulrasoolT20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/RobeyHLZDTM20,
  author       = {Alexander Robey and
                  Haimin Hu and
                  Lars Lindemann and
                  Hanwen Zhang and
                  Dimos V. Dimarogonas and
                  Stephen Tu and
                  Nikolai Matni},
  title        = {Learning Control Barrier Functions from Expert Demonstrations},
  booktitle    = {59th {IEEE} Conference on Decision and Control, {CDC} 2020, Jeju Island,
                  South Korea, December 14-18, 2020},
  pages        = {3717--3724},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://doi.org/10.1109/CDC42340.2020.9303785},
  doi          = {10.1109/CDC42340.2020.9303785},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cdc/RobeyHLZDTM20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/corl/BoffiTMSS20,
  author       = {Nicholas M. Boffi and
                  Stephen Tu and
                  Nikolai Matni and
                  Jean{-}Jacques E. Slotine and
                  Vikas Sindhwani},
  editor       = {Jens Kober and
                  Fabio Ramos and
                  Claire J. Tomlin},
  title        = {Learning Stability Certificates from Data},
  booktitle    = {4th Conference on Robot Learning, CoRL 2020, 16-18 November 2020,
                  Virtual Event / Cambridge, MA, {USA}},
  series       = {Proceedings of Machine Learning Research},
  volume       = {155},
  pages        = {1341--1350},
  publisher    = {{PMLR}},
  year         = {2020},
  url          = {https://proceedings.mlr.press/v155/boffi21a.html},
  timestamp    = {Tue, 18 Oct 2022 08:35:37 +0200},
  biburl       = {https://dblp.org/rec/conf/corl/BoffiTMSS20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/corl/LindemannHRZDTM20,
  author       = {Lars Lindemann and
                  Haimin Hu and
                  Alexander Robey and
                  Hanwen Zhang and
                  Dimos V. Dimarogonas and
                  Stephen Tu and
                  Nikolai Matni},
  editor       = {Jens Kober and
                  Fabio Ramos and
                  Claire J. Tomlin},
  title        = {Learning Hybrid Control Barrier Functions from Data},
  booktitle    = {4th Conference on Robot Learning, CoRL 2020, 16-18 November 2020,
                  Virtual Event / Cambridge, MA, {USA}},
  series       = {Proceedings of Machine Learning Research},
  volume       = {155},
  pages        = {1351--1370},
  publisher    = {{PMLR}},
  year         = {2020},
  url          = {https://proceedings.mlr.press/v155/lindemann21a.html},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/corl/LindemannHRZDTM20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ease/CapiluppiAAACDM20,
  author       = {Andrea Capiluppi and
                  Nemitari Ajienka and
                  Nour Ali and
                  Mahir Arzoky and
                  Steve Counsell and
                  Giuseppe Destefanis and
                  Alina Dana Miron and
                  Bhaveet Nagaria and
                  Rumyana Neykova and
                  Martin J. Shepperd and
                  Stephen Swift and
                  Allan Tucker},
  editor       = {Jingyue Li and
                  Letizia Jaccheri and
                  Torgeir Dings{\o}yr and
                  Ruzanna Chitchyan},
  title        = {Using the Lexicon from Source Code to Determine Application Domain},
  booktitle    = {{EASE} '20: Evaluation and Assessment in Software Engineering, Trondheim,
                  Norway, April 15-17, 2020},
  pages        = {110--119},
  publisher    = {{ACM}},
  year         = {2020},
  url          = {https://doi.org/10.1145/3383219.3383231},
  doi          = {10.1145/3383219.3383231},
  timestamp    = {Wed, 16 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ease/CapiluppiAAACDM20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecai/BellaEDPTRG20,
  author       = {G{\'{a}}bor Bella and
                  Liz Elliot and
                  Subhashis Das and
                  Stephen Pavis and
                  Ettore Turra and
                  David Robertson and
                  Fausto Giunchiglia},
  editor       = {Giuseppe De Giacomo and
                  Alejandro Catal{\'{a}} and
                  Bistra Dilkina and
                  Michela Milano and
                  Sen{\'{e}}n Barro and
                  Alberto Bugar{\'{\i}}n and
                  J{\'{e}}r{\^{o}}me Lang},
  title        = {Cross-Border Medical Research Using Multi-Layered and Distributed
                  Knowledge},
  booktitle    = {{ECAI} 2020 - 24th European Conference on Artificial Intelligence,
                  29 August-8 September 2020, Santiago de Compostela, Spain, August
                  29 - September 8, 2020 - Including 10th Conference on Prestigious
                  Applications of Artificial Intelligence {(PAIS} 2020)},
  series       = {Frontiers in Artificial Intelligence and Applications},
  volume       = {325},
  pages        = {2956--2963},
  publisher    = {{IOS} Press},
  year         = {2020},
  url          = {https://doi.org/10.3233/FAIA200469},
  doi          = {10.3233/FAIA200469},
  timestamp    = {Thu, 12 Jan 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ecai/BellaEDPTRG20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/DoPTSCWETD20,
  author       = {Tu Mai Anh Do and
                  Lo{\"{\i}}c Pottier and
                  Stephen Thomas and
                  Rafael Ferreira da Silva and
                  Michel A. Cuendet and
                  Harel Weinstein and
                  Trilce Estrada and
                  Michela Taufer and
                  Ewa Deelman},
  editor       = {Valeria V. Krzhizhanovskaya and
                  G{\'{a}}bor Z{\'{a}}vodszky and
                  Michael Harold Lees and
                  Jack J. Dongarra and
                  Peter M. A. Sloot and
                  S{\'{e}}rgio Brissos and
                  Jo{\~{a}}o Teixeira},
  title        = {A Novel Metric to Evaluate In Situ Workflows},
  booktitle    = {Computational Science - {ICCS} 2020 - 20th International Conference,
                  Amsterdam, The Netherlands, June 3-5, 2020, Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {12137},
  pages        = {538--553},
  publisher    = {Springer},
  year         = {2020},
  url          = {https://doi.org/10.1007/978-3-030-50371-0\_40},
  doi          = {10.1007/978-3-030-50371-0\_40},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iccS/DoPTSCWETD20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/SongJTDN20,
  author       = {Xingyou Song and
                  Yiding Jiang and
                  Stephen Tu and
                  Yilun Du and
                  Behnam Neyshabur},
  title        = {Observational Overfitting in Reinforcement Learning},
  booktitle    = {8th International Conference on Learning Representations, {ICLR} 2020,
                  Addis Ababa, Ethiopia, April 26-30, 2020},
  publisher    = {OpenReview.net},
  year         = {2020},
  url          = {https://openreview.net/forum?id=HJli2hNKDH},
  timestamp    = {Thu, 07 May 2020 17:11:47 +0200},
  biburl       = {https://dblp.org/rec/conf/iclr/SongJTDN20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/MajumdarKMMT20,
  author       = {Somdeb Majumdar and
                  Shauharda Khadka and
                  Santiago Miret and
                  Stephen McAleer and
                  Kagan Tumer},
  title        = {Evolutionary Reinforcement Learning for Sample-Efficient Multiagent
                  Coordination},
  booktitle    = {Proceedings of the 37th International Conference on Machine Learning,
                  {ICML} 2020, 13-18 July 2020, Virtual Event},
  series       = {Proceedings of Machine Learning Research},
  volume       = {119},
  pages        = {6651--6660},
  publisher    = {{PMLR}},
  year         = {2020},
  url          = {http://proceedings.mlr.press/v119/majumdar20a.html},
  timestamp    = {Tue, 15 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icml/MajumdarKMMT20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/0001NOST20,
  author       = {Simon Foster and
                  Yakoub Nemouchi and
                  Colin O'Halloran and
                  Karen Stephenson and
                  Nick Tudor},
  editor       = {Kyungmin Bae and
                  Domenico Bianculli and
                  Stefania Gnesi and
                  Nico Plat},
  title        = {Formal Model-Based Assurance Cases in Isabelle/SACM: An Autonomous
                  Underwater Vehicle Case Study},
  booktitle    = {FormaliSE@ICSE 2020: 8th International Conference on Formal Methods
                  in Software Engineering, Seoul, Republic of Korea, July 13, 2020},
  pages        = {11--21},
  publisher    = {{ACM}},
  year         = {2020},
  url          = {https://doi.org/10.1145/3372020.3391559},
  doi          = {10.1145/3372020.3391559},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icse/0001NOST20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/0033NTKZGPST0G20,
  author       = {Xi Chen and
                  Nikola Nedovic and
                  Stephen G. Tell and
                  Sudhir S. Kudva and
                  Brian Zimmer and
                  Thomas H. Greer and
                  John W. Poulton and
                  Sanquan Song and
                  Walker J. Turner and
                  John M. Wilson and
                  C. Thomas Gray},
  title        = {6.6 Reference-Noise Compensation Scheme for Single-Ended Package-to-Package
                  Links},
  booktitle    = {2020 {IEEE} International Solid- State Circuits Conference, {ISSCC}
                  2020, San Francisco, CA, USA, February 16-20, 2020},
  pages        = {126--128},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://doi.org/10.1109/ISSCC19947.2020.9063140},
  doi          = {10.1109/ISSCC19947.2020.9063140},
  timestamp    = {Sat, 18 Apr 2020 17:41:44 +0200},
  biburl       = {https://dblp.org/rec/conf/isscc/0033NTKZGPST0G20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/BassSSTSR20,
  author       = {Cher Bass and
                  Mariana da Silva and
                  Carole H. Sudre and
                  Petru{-}Daniel Tudosiu and
                  Stephen M. Smith and
                  Emma C. Robinson},
  editor       = {Hugo Larochelle and
                  Marc'Aurelio Ranzato and
                  Raia Hadsell and
                  Maria{-}Florina Balcan and
                  Hsuan{-}Tien Lin},
  title        = {{ICAM:} Interpretable Classification via Disentangled Representations
                  and Feature Attribution Mapping},
  booktitle    = {Advances in Neural Information Processing Systems 33: Annual Conference
                  on Neural Information Processing Systems 2020, NeurIPS 2020, December
                  6-12, 2020, virtual},
  year         = {2020},
  url          = {https://proceedings.neurips.cc/paper/2020/hash/56f9f88906aebf4ad985aaec7fa01313-Abstract.html},
  timestamp    = {Mon, 22 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/nips/BassSSTSR20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/LedentsovSKLCTH30,
  author       = {Nikolay N. Ledentsov and
                  V. A. Shchukin and
                  Vladimir P. Kalosha and
                  Nikolay Ledentsov Jr. and
                  Lukasz Chorchos and
                  Jaroslaw P. Turkiewicz and
                  Urs Hecht and
                  Patrick Kurth and
                  Friedel Gerfers and
                  Justin Lavrencik and
                  Siddharth Varughese and
                  Stephen E. Ralph},
  title        = {Optical Interconnects using Single-Mode and Multi-Mode {VCSEL} and
                  Multi-Mode Fiber},
  booktitle    = {Optical Fiber Communications Conference and Exhibition, {OFC} 2020,
                  San Diego, CA, USA, March 8-12, 2020},
  pages        = {1--3},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://ieeexplore.ieee.org/document/9083589},
  timestamp    = {Tue, 11 Jun 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ofc/LedentsovSKLCTH30.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/plans/TurnerWEK20,
  author       = {Michael Turner and
                  Stephen Wimbush and
                  Christoph Enneking and
                  Andriy Konovaltsev},
  title        = {Spoofing Detection by Distortion of the Correlation Function},
  booktitle    = {{IEEE/ION} Position, Location and Navigation Symposium, {PLANS} 2020,
                  Portland, OR, USA, April 20-23, 2020},
  pages        = {566--574},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://doi.org/10.1109/PLANS46316.2020.9110173},
  doi          = {10.1109/PLANS46316.2020.9110173},
  timestamp    = {Tue, 16 Jun 2020 12:24:43 +0200},
  biburl       = {https://dblp.org/rec/conf/plans/TurnerWEK20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/hci/FrostDGTLB20,
  author       = {Dennis Frost and
                  Suzanne Dillon and
                  Stephen Grady and
                  Jeffrey Thurlow and
                  Tuck Wah Leong and
                  Jeanette Bell},
  editor       = {Rens Brankaert and
                  Gail Kenning},
  title        = {Approaches for Authentic Engagement: Younger Onset Dementia},
  booktitle    = {{HCI} and Design in the Context of Dementia},
  series       = {Human-Computer Interaction Series},
  pages        = {77--93},
  publisher    = {Springer},
  year         = {2020},
  url          = {https://doi.org/10.1007/978-3-030-32835-1\_6},
  doi          = {10.1007/978-3-030-32835-1\_6},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/series/hci/FrostDGTLB20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/miccai/2020asmus,
  editor       = {Yipeng Hu and
                  Roxane Licandro and
                  J. Alison Noble and
                  Jana Hutter and
                  Stephen R. Aylward and
                  Andrew Melbourne and
                  Esra Abaci Turk and
                  Jordina Torrents{-}Barrena},
  title        = {Medical Ultrasound, and Preterm, Perinatal and Paediatric Image Analysis
                  - First International Workshop, {ASMUS} 2020, and 5th International
                  Workshop, {PIPPI} 2020, Held in Conjunction with {MICCAI} 2020, Lima,
                  Peru, October 4-8, 2020, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {12437},
  publisher    = {Springer},
  year         = {2020},
  url          = {https://doi.org/10.1007/978-3-030-60334-2},
  doi          = {10.1007/978-3-030-60334-2},
  isbn         = {978-3-030-60333-5},
  timestamp    = {Tue, 06 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/miccai/2020asmus.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2001-10389,
  author       = {Jonathan Tuck and
                  Stephen P. Boyd},
  title        = {Eigen-Stratified Models},
  journal      = {CoRR},
  volume       = {abs/2001.10389},
  year         = {2020},
  url          = {https://arxiv.org/abs/2001.10389},
  eprinttype    = {arXiv},
  eprint       = {2001.10389},
  timestamp    = {Thu, 30 Jan 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2001-10389.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-03315,
  author       = {Alexander Robey and
                  Haimin Hu and
                  Lars Lindemann and
                  Hanwen Zhang and
                  Dimos V. Dimarogonas and
                  Stephen Tu and
                  Nikolai Matni},
  title        = {Learning Control Barrier Functions from Expert Demonstrations},
  journal      = {CoRR},
  volume       = {abs/2004.03315},
  year         = {2020},
  url          = {https://arxiv.org/abs/2004.03315},
  eprinttype    = {arXiv},
  eprint       = {2004.03315},
  timestamp    = {Wed, 08 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2004-03315.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-01752,
  author       = {Jonathan Tuck and
                  Stephen P. Boyd},
  title        = {Fitting Laplacian Regularized Stratified Gaussian Models},
  journal      = {CoRR},
  volume       = {abs/2005.01752},
  year         = {2020},
  url          = {https://arxiv.org/abs/2005.01752},
  eprinttype    = {arXiv},
  eprint       = {2005.01752},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2005-01752.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-13095,
  author       = {Nilufer Tuptuk and
                  Stephen Hailes},
  title        = {Identifying Vulnerabilities of Industrial Control Systems using Evolutionary
                  Multiobjective Optimisation},
  journal      = {CoRR},
  volume       = {abs/2005.13095},
  year         = {2020},
  url          = {https://arxiv.org/abs/2005.13095},
  eprinttype    = {arXiv},
  eprint       = {2005.13095},
  timestamp    = {Thu, 28 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2005-13095.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-08287,
  author       = {Cher Bass and
                  Mariana da Silva and
                  Carole H. Sudre and
                  Petru{-}Daniel Tudosiu and
                  Stephen M. Smith and
                  Emma C. Robinson},
  title        = {{ICAM:} Interpretable Classification via Disentangled Representations
                  and Feature Attribution Mapping},
  journal      = {CoRR},
  volume       = {abs/2006.08287},
  year         = {2020},
  url          = {https://arxiv.org/abs/2006.08287},
  eprinttype    = {arXiv},
  eprint       = {2006.08287},
  timestamp    = {Mon, 22 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2006-08287.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-05952,
  author       = {Nicholas M. Boffi and
                  Stephen Tu and
                  Nikolai Matni and
                  Jean{-}Jacques E. Slotine and
                  Vikas Sindhwani},
  title        = {Learning Stability Certificates from Data},
  journal      = {CoRR},
  volume       = {abs/2008.05952},
  year         = {2020},
  url          = {https://arxiv.org/abs/2008.05952},
  eprinttype    = {arXiv},
  eprint       = {2008.05952},
  timestamp    = {Mon, 17 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2008-05952.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-04898,
  author       = {Raviteja Anantha and
                  Svitlana Vakulenko and
                  Zhucheng Tu and
                  Shayne Longpre and
                  Stephen Pulman and
                  Srinivas Chappidi},
  title        = {Open-Domain Question Answering Goes Conversational via Question Rewriting},
  journal      = {CoRR},
  volume       = {abs/2010.04898},
  year         = {2020},
  url          = {https://arxiv.org/abs/2010.04898},
  eprinttype    = {arXiv},
  eprint       = {2010.04898},
  timestamp    = {Tue, 20 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2010-04898.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-04112,
  author       = {Lars Lindemann and
                  Haimin Hu and
                  Alexander Robey and
                  Hanwen Zhang and
                  Dimos V. Dimarogonas and
                  Stephen Tu and
                  Nikolai Matni},
  title        = {Learning Hybrid Control Barrier Functions from Data},
  journal      = {CoRR},
  volume       = {abs/2011.04112},
  year         = {2020},
  url          = {https://arxiv.org/abs/2011.04112},
  eprinttype    = {arXiv},
  eprint       = {2011.04112},
  timestamp    = {Thu, 12 Nov 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2011-04112.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-12257,
  author       = {Amir Ali Ahmadi and
                  Abraar Chaudhry and
                  Vikas Sindhwani and
                  Stephen Tu},
  title        = {Safely Learning Dynamical Systems from Short Trajectories},
  journal      = {CoRR},
  volume       = {abs/2011.12257},
  year         = {2020},
  url          = {https://arxiv.org/abs/2011.12257},
  eprinttype    = {arXiv},
  eprint       = {2011.12257},
  timestamp    = {Thu, 26 Nov 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2011-12257.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-13101,
  author       = {Nicholas M. Boffi and
                  Stephen Tu and
                  Jean{-}Jacques E. Slotine},
  title        = {Regret Bounds for Adaptive Nonlinear Control},
  journal      = {CoRR},
  volume       = {abs/2011.13101},
  year         = {2020},
  url          = {https://arxiv.org/abs/2011.13101},
  eprinttype    = {arXiv},
  eprint       = {2011.13101},
  timestamp    = {Tue, 01 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2011-13101.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/us/Tu19,
  author       = {Stephen Tu},
  title        = {Sample Complexity Bounds for the Linear Quadratic Regulator},
  school       = {University of California, Berkeley, {USA}},
  year         = {2019},
  url          = {https://www.escholarship.org/uc/item/4zw591fq},
  timestamp    = {Wed, 22 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/phd/us/Tu19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/McGuinessGMT19,
  author       = {Daniel Tunc McGuiness and
                  Stamatios Giannoukos and
                  Alan Marshall and
                  Stephen Taylor},
  title        = {Modulation Analysis in Macro-Molecular Communications},
  journal      = {{IEEE} Access},
  volume       = {7},
  pages        = {11049--11065},
  year         = {2019},
  url          = {https://doi.org/10.1109/ACCESS.2019.2892850},
  doi          = {10.1109/ACCESS.2019.2892850},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/McGuinessGMT19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cphysics/HawkesVPKCT19,
  author       = {James Nicholas Hawkes and
                  Guilherme Vaz and
                  Alexander B. Phillips and
                  Christiaan M. Klaij and
                  S. J. Cox and
                  Stephen R. Turnock},
  title        = {Chaotic multigrid methods for the solution of elliptic equations},
  journal      = {Comput. Phys. Commun.},
  volume       = {237},
  pages        = {26--36},
  year         = {2019},
  url          = {https://doi.org/10.1016/j.cpc.2018.10.031},
  doi          = {10.1016/J.CPC.2018.10.031},
  timestamp    = {Mon, 15 Mar 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cphysics/HawkesVPKCT19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/heuristics/JilaniTS19,
  author       = {Mohd Zairul Mazwan Bin Jilani and
                  Allan Tucker and
                  Stephen Swift},
  title        = {An application of generalised simulated annealing towards the simultaneous
                  modelling and clustering of glaucoma},
  journal      = {J. Heuristics},
  volume       = {25},
  number       = {6},
  pages        = {933--957},
  year         = {2019},
  url          = {https://doi.org/10.1007/s10732-019-09415-y},
  doi          = {10.1007/S10732-019-09415-Y},
  timestamp    = {Thu, 07 Nov 2019 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/heuristics/JilaniTS19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieeejas/TuckHB19,
  author       = {Jonathan Tuck and
                  David Hallac and
                  Stephen P. Boyd},
  title        = {Distributed majorization-minimization for Laplacian regularized problems},
  journal      = {{IEEE} {CAA} J. Autom. Sinica},
  volume       = {6},
  number       = {1},
  pages        = {45--52},
  year         = {2019},
  url          = {https://doi.org/10.1109/JAS.2019.1911321},
  doi          = {10.1109/JAS.2019.1911321},
  timestamp    = {Fri, 18 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ieeejas/TuckHB19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcphy/ZengTBW19,
  author       = {Fanhai Zeng and
                  Ian W. Turner and
                  Kevin Burrage and
                  Stephen J. Wright},
  title        = {A discrete least squares collocation method for two-dimensional nonlinear
                  time-dependent partial differential equations},
  journal      = {J. Comput. Phys.},
  volume       = {394},
  pages        = {177--199},
  year         = {2019},
  url          = {https://doi.org/10.1016/j.jcp.2019.05.044},
  doi          = {10.1016/J.JCP.2019.05.044},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jcphy/ZengTBW19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/SchillaiTRP19,
  author       = {Sophia M. Schillai and
                  Stephen R. Turnock and
                  Eric Rogers and
                  Alexander B. Phillips},
  title        = {Experimental analysis of low-altitude terrain following for hover-capable
                  flight-style autonomous underwater vehicles},
  journal      = {J. Field Robotics},
  volume       = {36},
  number       = {8},
  pages        = {1399--1421},
  year         = {2019},
  url          = {https://doi.org/10.1002/rob.21910},
  doi          = {10.1002/ROB.21910},
  timestamp    = {Tue, 26 Nov 2019 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jfr/SchillaiTRP19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jossw/Brummel-SmithBB19,
  author       = {Corey Brummel{-}Smith and
                  Greg Bryan and
                  Iryna Butsky and
                  Lauren Corlies and
                  Andrew Emerick and
                  John Forbes and
                  Yusuke Fujimoto and
                  Nathan J. Goldbaum and
                  Philipp Grete and
                  Cameron Hummels and
                  Ji{-}hoon Kim and
                  Daegene Koh and
                  Miao Li and
                  Yuan Li and
                  Xinyu Li and
                  Brian W. O'Shea and
                  Molly Peeples and
                  John Regan and
                  Munier Salem and
                  Wolfram Schmidt and
                  Christine Simpson and
                  Britton Smith and
                  Jason Tumlinson and
                  Matthew J. Turk and
                  John H. Wise and
                  Tom Abel and
                  James Bordner and
                  Renyue Cen and
                  David Collins and
                  Brian Crosby and
                  Philipp V. F. Edelmann and
                  Oliver Hahn and
                  Robert Harkness and
                  Elizabeth Harper{-}Clark and
                  Shuo Kong and
                  Alexei G. Kritsuk and
                  Michael Kuhlen and
                  James Larrue and
                  Eve Lee and
                  Greg Meece and
                  Michael L. Norman and
                  Jeffrey S. Oishi and
                  Pascal Paschos and
                  Carolyn Peruta and
                  Alex Razoumov and
                  Daniel R. Reynolds and
                  Devin Silvia and
                  Samuel W. Skillman and
                  Stephen Skory and
                  Geoffrey So and
                  Elizabeth J. Tasker and
                  Rick Wagner and
                  Peng Wang and
                  Hao Xu and
                  Fen Zhao},
  title        = {{ENZO:} An Adaptive Mesh Refinement Code for Astrophysics (Version
                  2.6)},
  journal      = {J. Open Source Softw.},
  volume       = {4},
  number       = {42},
  pages        = {1636},
  year         = {2019},
  url          = {https://doi.org/10.21105/joss.01636},
  doi          = {10.21105/JOSS.01636},
  timestamp    = {Thu, 31 Oct 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jossw/Brummel-SmithBB19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/PoultonWTZCKSTN19,
  author       = {John W. Poulton and
                  John M. Wilson and
                  Walker J. Turner and
                  Brian Zimmer and
                  Xi Chen and
                  Sudhir S. Kudva and
                  Sanquan Song and
                  Stephen G. Tell and
                  Nikola Nedovic and
                  Wenxu Zhao and
                  Sunil R. Sudhakaran and
                  C. Thomas Gray and
                  William J. Dally},
  title        = {A 1.17-pJ/b, 25-Gb/s/pin Ground-Referenced Single-Ended Serial Link
                  for Off- and On-Package Communication Using a Process- and Temperature-Adaptive
                  Voltage Regulator},
  journal      = {{IEEE} J. Solid State Circuits},
  volume       = {54},
  number       = {1},
  pages        = {43--54},
  year         = {2019},
  url          = {https://doi.org/10.1109/JSSC.2018.2875092},
  doi          = {10.1109/JSSC.2018.2875092},
  timestamp    = {Sun, 30 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jssc/PoultonWTZCKSTN19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/UrsuHBYMSNSO19,
  author       = {Oleg Ursu and
                  Jayme Holmes and
                  Cristian Bologa and
                  Jeremy J. Yang and
                  Stephen L. Mathias and
                  Vasileios Stathias and
                  Dac{-}Trung Nguyen and
                  Stephan C. Sch{\"{u}}rer and
                  Tudor I. Oprea},
  title        = {DrugCentral 2018: an update},
  journal      = {Nucleic Acids Res.},
  volume       = {47},
  number       = {Database-Issue},
  pages        = {D963--D970},
  year         = {2019},
  url          = {https://doi.org/10.1093/nar/gky963},
  doi          = {10.1093/NAR/GKY963},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/UrsuHBYMSNSO19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/ChitnisGGHSSDPT19,
  author       = {Tanuja Chitnis and
                  Bonnie I. Glanz and
                  Cindy Gonzalez and
                  Brian C. Healy and
                  Taylor J. Saraceno and
                  Neda Sattarnezhad and
                  Camilo Diaz{-}Cruz and
                  Mariann Polgar{-}Turcsanyi and
                  Subhash Tummala and
                  Rohit Bakshi and
                  Vikram Bajaj and
                  David Ben Shimol and
                  Nikhil Bikhchandani and
                  Alexander W. Blocker and
                  Joshua Burkart and
                  Raphael Cendrillon and
                  Michael P. Cusack and
                  Emre Demiralp and
                  Sarel Kobus Jooste and
                  Alaa Kharbouch and
                  Amy A. Lee and
                  Joseph Lehar and
                  Manway Liu and
                  Swaminathan Mahadevan and
                  Mark Murphy and
                  Linda C. Norton and
                  Tushar Anil Parlikar and
                  Anupam Pathak and
                  Ali Shoeb and
                  Erin Soderberg and
                  Philip Stephens and
                  Aaron H. Stoertz and
                  Florence Thng and
                  Kashyap R. Tumkur and
                  Hongsheng Wang and
                  Jane Rhodes and
                  Richard A. Rudick and
                  Richard M. Ransohoff and
                  Glenn A. Phillips and
                  Effie Bruzik and
                  William J. Marks and
                  Howard L. Weiner and
                  Thomas M. Snyder},
  title        = {Quantifying neurologic disease using biosensor measurements in-clinic
                  and in free-living settings in multiple sclerosis},
  journal      = {npj Digit. Medicine},
  volume       = {2},
  year         = {2019},
  url          = {https://doi.org/10.1038/s41746-019-0197-7},
  doi          = {10.1038/S41746-019-0197-7},
  timestamp    = {Mon, 28 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/npjdm/ChitnisGGHSSDPT19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/NetoPPTSBTFMO19,
  author       = {Elias Chaibub Neto and
                  Abhishek Pratap and
                  Thanneer M. Perumal and
                  Meghasyam Tummalacherla and
                  Phil Snyder and
                  Brian M. Bot and
                  Andrew D. Trister and
                  Stephen H. Friend and
                  Lara M. Mangravite and
                  Larsson Omberg},
  title        = {Detecting the impact of subject characteristics on machine learning-based
                  diagnostic applications},
  journal      = {npj Digit. Medicine},
  volume       = {2},
  year         = {2019},
  url          = {https://doi.org/10.1038/s41746-019-0178-x},
  doi          = {10.1038/S41746-019-0178-X},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/npjdm/NetoPPTSBTFMO19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/TurkPAJWFLHFCKN19,
  author       = {F. Joseph Turk and
                  Ramon Padull{\'{e}}s and
                  Chi O. Ao and
                  Manuel de la Torre Ju{\'{a}}rez and
                  Kuo{-}Nung Wang and
                  Garth W. Franklin and
                  Stephen T. Lowe and
                  Svetla M. Hristova{-}Veleva and
                  Eric J. Fetzer and
                  Estel Cardellach and
                  Yi{-}Hung Kuo and
                  J. David Neelin},
  title        = {Benefits of a Closely-Spaced Satellite Constellation of Atmospheric
                  Polarimetric Radio Occultation Measurements},
  journal      = {Remote. Sens.},
  volume       = {11},
  number       = {20},
  pages        = {2399},
  year         = {2019},
  url          = {https://doi.org/10.3390/rs11202399},
  doi          = {10.3390/RS11202399},
  timestamp    = {Wed, 15 Feb 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/remotesensing/TurkPAJWFLHFCKN19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/TurnerH19,
  author       = {Alexander P. Turner and
                  Stephen Hayes},
  title        = {The Classification of Minor Gait Alterations Using Wearable Sensors
                  and Deep Learning},
  journal      = {{IEEE} Trans. Biomed. Eng.},
  volume       = {66},
  number       = {11},
  pages        = {3136--3145},
  year         = {2019},
  url          = {https://doi.org/10.1109/TBME.2019.2900863},
  doi          = {10.1109/TBME.2019.2900863},
  timestamp    = {Mon, 26 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tbe/TurnerH19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmbmc/McGuinessGTM19,
  author       = {Daniel Tun{\c{c}} McGuiness and
                  Stamatios Giannoukos and
                  Stephen Taylor and
                  Alan Marshall},
  title        = {Experimental and Analytical Analysis of Macro-Scale Molecular Communications
                  Within Closed Boundaries},
  journal      = {{IEEE} Trans. Mol. Biol. Multi Scale Commun.},
  volume       = {5},
  number       = {1},
  pages        = {44--55},
  year         = {2019},
  url          = {https://doi.org/10.1109/TMBMC.2019.2955094},
  doi          = {10.1109/TMBMC.2019.2955094},
  timestamp    = {Tue, 08 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tmbmc/McGuinessGTM19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/NovotnyTTGDFL19,
  author       = {Johannes Novotny and
                  Joshua Tveite and
                  Morgan L. Turner and
                  Stephen M. Gatesy and
                  Fritz Drury and
                  Peter Falkingham and
                  David H. Laidlaw},
  title        = {Developing Virtual Reality Visualizations for Unsteady Flow Analysis
                  of Dinosaur Track Formation using Scientific Sketching},
  journal      = {{IEEE} Trans. Vis. Comput. Graph.},
  volume       = {25},
  number       = {5},
  pages        = {2145--2154},
  year         = {2019},
  url          = {https://doi.org/10.1109/TVCG.2019.2898796},
  doi          = {10.1109/TVCG.2019.2898796},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tvcg/NovotnyTTGDFL19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aied/Al-LuhaybiYSCT19,
  author       = {Mashael Al{-}Luhaybi and
                  Leila Yousefi and
                  Stephen Swift and
                  Steve Counsell and
                  Allan Tucker},
  editor       = {Seiji Isotani and
                  Eva Mill{\'{a}}n and
                  Amy Ogan and
                  Peter M. Hastings and
                  Bruce M. McLaren and
                  Rose Luckin},
  title        = {Predicting Academic Performance: {A} Bootstrapping Approach for Learning
                  Dynamic Bayesian Networks},
  booktitle    = {Artificial Intelligence in Education - 20th International Conference,
                  {AIED} 2019, Chicago, IL, USA, June 25-29, 2019, Proceedings, Part
                  {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {11625},
  pages        = {26--36},
  publisher    = {Springer},
  year         = {2019},
  url          = {https://doi.org/10.1007/978-3-030-23204-7\_3},
  doi          = {10.1007/978-3-030-23204-7\_3},
  timestamp    = {Mon, 15 Jun 2020 17:12:49 +0200},
  biburl       = {https://dblp.org/rec/conf/aied/Al-LuhaybiYSCT19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/DeanTMR19,
  author       = {Sarah Dean and
                  Stephen Tu and
                  Nikolai Matni and
                  Benjamin Recht},
  title        = {Safely Learning to Control the Constrained Linear Quadratic Regulator},
  booktitle    = {2019 American Control Conference, {ACC} 2019, Philadelphia, PA, USA,
                  July 10-12, 2019},
  pages        = {5582--5588},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.23919/ACC.2019.8814865},
  doi          = {10.23919/ACC.2019.8814865},
  timestamp    = {Sun, 08 Aug 2021 01:40:57 +0200},
  biburl       = {https://dblp.org/rec/conf/amcc/DeanTMR19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/DrummondTD19,
  author       = {Ross Drummond and
                  Matthew C. Turner and
                  Stephen R. Duncan},
  title        = {External Positivity of Linear Systems by Weak Majorisation},
  booktitle    = {2019 American Control Conference, {ACC} 2019, Philadelphia, PA, USA,
                  July 10-12, 2019},
  pages        = {5191--5196},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.23919/ACC.2019.8814408},
  doi          = {10.23919/ACC.2019.8814408},
  timestamp    = {Sun, 08 Aug 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/amcc/DrummondTD19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/TuBR19,
  author       = {Stephen Tu and
                  Ross Boczar and
                  Benjamin Recht},
  title        = {Minimax Lower Bounds for H{\(\infty\)}-Norm Estimation},
  booktitle    = {2019 American Control Conference, {ACC} 2019, Philadelphia, PA, USA,
                  July 10-12, 2019},
  pages        = {3538--3543},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.23919/ACC.2019.8814311},
  doi          = {10.23919/ACC.2019.8814311},
  timestamp    = {Sun, 08 Aug 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/amcc/TuBR19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/YousefiSASCT19,
  author       = {Leila Yousefi and
                  Stephen Swift and
                  Mahir Arzoky and
                  Lucia Sacchi and
                  Luca Chiovato and
                  Allan Tucker},
  title        = {Opening the Black Box: Exploring Temporal Pattern of Type 2 Diabetes
                  Complications in Patient Clustering Using Association Rules and Hidden
                  Variable Discovery},
  booktitle    = {32nd {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2019, Cordoba, Spain, June 5-7, 2019},
  pages        = {198--203},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.1109/CBMS.2019.00048},
  doi          = {10.1109/CBMS.2019.00048},
  timestamp    = {Fri, 27 Dec 2019 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/YousefiSASCT19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/MatniPRT19,
  author       = {Nikolai Matni and
                  Alexandre Prouti{\`{e}}re and
                  Anders Rantzer and
                  Stephen Tu},
  title        = {From self-tuning regulators to reinforcement learning and back again},
  booktitle    = {58th {IEEE} Conference on Decision and Control, {CDC} 2019, Nice,
                  France, December 11-13, 2019},
  pages        = {3724--3740},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.1109/CDC40024.2019.9029916},
  doi          = {10.1109/CDC40024.2019.9029916},
  timestamp    = {Fri, 04 Mar 2022 13:30:46 +0100},
  biburl       = {https://dblp.org/rec/conf/cdc/MatniPRT19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/MatniT19,
  author       = {Nikolai Matni and
                  Stephen Tu},
  title        = {A Tutorial on Concentration Bounds for System Identification},
  booktitle    = {58th {IEEE} Conference on Decision and Control, {CDC} 2019, Nice,
                  France, December 11-13, 2019},
  pages        = {3741--3749},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.1109/CDC40024.2019.9029621},
  doi          = {10.1109/CDC40024.2019.9029621},
  timestamp    = {Mon, 27 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cdc/MatniT19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/SongP0ZTTKNWGD19,
  author       = {Sanquan Song and
                  John Poulton and
                  Xi Chen and
                  Brian Zimmer and
                  Stephen G. Tell and
                  Walker J. Turner and
                  Sudhir S. Kudva and
                  Nikola Nedovic and
                  John M. Wilson and
                  C. Thomas Gray and
                  William J. Dally},
  title        = {A 2-to-20 GHz Multi-Phase Clock Generator with Phase Interpolators
                  Using Injection-Locked Oscillation Buffers for High-Speed IOs in 16nm
                  FinFET},
  booktitle    = {{IEEE} Custom Integrated Circuits Conference, {CICC} 2019, Austin,
                  TX, USA, April 14-17, 2019},
  pages        = {1--4},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.1109/CICC.2019.8780177},
  doi          = {10.1109/CICC.2019.8780177},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/cicc/SongP0ZTTKNWGD19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/colt/TuR19,
  author       = {Stephen Tu and
                  Benjamin Recht},
  editor       = {Alina Beygelzimer and
                  Daniel Hsu},
  title        = {The Gap Between Model-Based and Model-Free Methods on the Linear Quadratic
                  Regulator: An Asymptotic Viewpoint},
  booktitle    = {Conference on Learning Theory, {COLT} 2019, 25-28 June 2019, Phoenix,
                  AZ, {USA}},
  series       = {Proceedings of Machine Learning Research},
  volume       = {99},
  pages        = {3036--3083},
  publisher    = {{PMLR}},
  year         = {2019},
  url          = {http://proceedings.mlr.press/v99/tu19a.html},
  timestamp    = {Mon, 08 Jul 2019 16:13:41 +0200},
  biburl       = {https://dblp.org/rec/conf/colt/TuR19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eScience/TauferDTWDPSWCE19,
  author       = {Michela Taufer and
                  Ewa Deelman and
                  Stephen Thomas and
                  Michael R. Wyatt II and
                  Tu Mai Anh Do and
                  Lo{\"{\i}}c Pottier and
                  Rafael Ferreira da Silva and
                  Harel Weinstein and
                  Michel A. Cuendet and
                  Trilce Estrada},
  title        = {Characterizing In Situ and In Transit Analytics of Molecular Dynamics
                  Simulations for Next-Generation Supercomputers},
  booktitle    = {15th International Conference on eScience, eScience 2019, San Diego,
                  CA, USA, September 24-27, 2019},
  pages        = {188--198},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.1109/eScience.2019.00027},
  doi          = {10.1109/ESCIENCE.2019.00027},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/eScience/TauferDTWDPSWCE19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/BraunPTW19,
  author       = {G{\'{a}}bor Braun and
                  Sebastian Pokutta and
                  Dan Tu and
                  Stephen J. Wright},
  editor       = {Kamalika Chaudhuri and
                  Ruslan Salakhutdinov},
  title        = {Blended Conditonal Gradients},
  booktitle    = {Proceedings of the 36th International Conference on Machine Learning,
                  {ICML} 2019, 9-15 June 2019, Long Beach, California, {USA}},
  series       = {Proceedings of Machine Learning Research},
  volume       = {97},
  pages        = {735--743},
  publisher    = {{PMLR}},
  year         = {2019},
  url          = {http://proceedings.mlr.press/v97/braun19a.html},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icml/BraunPTW19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/KlunderHTKNHKFF19,
  author       = {Jil Kl{\"{u}}nder and
                  Regina Hebig and
                  Paolo Tell and
                  Marco Kuhrmann and
                  Joyce Nakatumba{-}Nabende and
                  Rogardt Heldal and
                  Stephan Krusche and
                  Masud Fazal{-}Baqaie and
                  Michael Felderer and
                  Marcela Fabiana Genero Bocco and
                  Steffen K{\"{u}}pper and
                  Sherlock A. Licorish and
                  Gustavo L{\'{o}}pez and
                  Fergal McCaffery and
                  {\"{O}}zden {\"{O}}zcan Top and
                  Christian R. Prause and
                  Rafael Prikladnicki and
                  Eray T{\"{u}}z{\"{u}}n and
                  Dietmar Pfahl and
                  Kurt Schneider and
                  Stephen G. MacDonell},
  editor       = {Helen Sharp and
                  Mike Whalen},
  title        = {Catching up with method and process practice: an industry-informed
                  baseline for researchers},
  booktitle    = {Proceedings of the 41st International Conference on Software Engineering:
                  Software Engineering in Practice, {ICSE} {(SEIP)} 2019, Montreal,
                  QC, Canada, May 25-31, 2019},
  pages        = {255--264},
  publisher    = {{IEEE} / {ACM}},
  year         = {2019},
  url          = {https://doi.org/10.1109/ICSE-SEIP.2019.00036},
  doi          = {10.1109/ICSE-SEIP.2019.00036},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icse/KlunderHTKNHKFF19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ideal/ShepperdGLACCDS19,
  author       = {Martin J. Shepperd and
                  Yuchen Guo and
                  Ning Li and
                  Mahir Arzoky and
                  Andrea Capiluppi and
                  Steve Counsell and
                  Giuseppe Destefanis and
                  Stephen Swift and
                  Allan Tucker and
                  Leila Yousefi},
  editor       = {Hujun Yin and
                  David Camacho and
                  Peter Ti{\~{n}}o and
                  Antonio J. Tall{\'{o}}n{-}Ballesteros and
                  Ronaldo Menezes and
                  Richard Allmendinger},
  title        = {The Prevalence of Errors in Machine Learning Experiments},
  booktitle    = {Intelligent Data Engineering and Automated Learning - {IDEAL} 2019
                  - 20th International Conference, Manchester, UK, November 14-16, 2019,
                  Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {11871},
  pages        = {102--109},
  publisher    = {Springer},
  year         = {2019},
  url          = {https://doi.org/10.1007/978-3-030-33607-3\_12},
  doi          = {10.1007/978-3-030-33607-3\_12},
  timestamp    = {Thu, 08 Oct 2020 17:51:06 +0200},
  biburl       = {https://dblp.org/rec/conf/ideal/ShepperdGLACCDS19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/KennedyDBTPCBSG19,
  author       = {Michael Peter Kennedy and
                  Yann Donnelly and
                  James Breslin and
                  Stefano Tulisi and
                  Sanganagouda Patil and
                  Ciaran Curtin and
                  Stephen Brookes and
                  Brian Shelly and
                  Patrick Griffin and
                  Michael Keaveney},
  title        = {4.48GHz 0.18{\(\mu\)}m SiGe BiCMOS Exact-Frequency Fractional-N Frequency
                  Synthesizer with Spurious-Tone Suppression Yielding a -80dBc In-Band
                  Fractional Spur},
  booktitle    = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2019,
                  San Francisco, CA, USA, February 17-21, 2019},
  pages        = {272--274},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.1109/ISSCC.2019.8662327},
  doi          = {10.1109/ISSCC.2019.8662327},
  timestamp    = {Wed, 16 Oct 2019 14:14:55 +0200},
  biburl       = {https://dblp.org/rec/conf/isscc/KennedyDBTPCBSG19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nanocom/McGuinessGTM19,
  author       = {Daniel Tun{\c{c}} McGuiness and
                  Stamatios Giannoukos and
                  Stephen Taylor and
                  Alan Marshall},
  title        = {Experimental Study of the Flush Dynamics of Macro-Scale Molecular
                  Communications},
  booktitle    = {Proceedings of the Sixth Annual {ACM} International Conference on
                  Nanoscale Computing and Communication, {NANOCOM} 2019, Dublin, Ireland,
                  September 25-27, 2019},
  pages        = {35:1--35:2},
  publisher    = {{ACM}},
  year         = {2019},
  url          = {https://doi.org/10.1145/3345312.3345489},
  doi          = {10.1145/3345312.3345489},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/nanocom/McGuinessGTM19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/KrauthTR19,
  author       = {Karl Krauth and
                  Stephen Tu and
                  Benjamin Recht},
  editor       = {Hanna M. Wallach and
                  Hugo Larochelle and
                  Alina Beygelzimer and
                  Florence d'Alch{\'{e}}{-}Buc and
                  Emily B. Fox and
                  Roman Garnett},
  title        = {Finite-time Analysis of Approximate Policy Iteration for the Linear
                  Quadratic Regulator},
  booktitle    = {Advances in Neural Information Processing Systems 32: Annual Conference
                  on Neural Information Processing Systems 2019, NeurIPS 2019, December
                  8-14, 2019, Vancouver, BC, Canada},
  pages        = {8512--8522},
  year         = {2019},
  url          = {https://proceedings.neurips.cc/paper/2019/hash/aaebdb8bb6b0e73f6c3c54a0ab0c6415-Abstract.html},
  timestamp    = {Mon, 16 May 2022 15:41:51 +0200},
  biburl       = {https://dblp.org/rec/conf/nips/KrauthTR19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ManiaTR19,
  author       = {Horia Mania and
                  Stephen Tu and
                  Benjamin Recht},
  editor       = {Hanna M. Wallach and
                  Hugo Larochelle and
                  Alina Beygelzimer and
                  Florence d'Alch{\'{e}}{-}Buc and
                  Emily B. Fox and
                  Roman Garnett},
  title        = {Certainty Equivalence is Efficient for Linear Quadratic Control},
  booktitle    = {Advances in Neural Information Processing Systems 32: Annual Conference
                  on Neural Information Processing Systems 2019, NeurIPS 2019, December
                  8-14, 2019, Vancouver, BC, Canada},
  pages        = {10154--10164},
  year         = {2019},
  url          = {https://proceedings.neurips.cc/paper/2019/hash/5dbc8390f17e019d300d5a162c3ce3bc-Abstract.html},
  timestamp    = {Thu, 21 Jan 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/nips/ManiaTR19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rfidta/TurkiZHBPYBH19,
  author       = {Badredin Turki and
                  M. Ali Ziai and
                  Aaron J. R. Hillier and
                  Kate Belsey and
                  Adam Parry and
                  Stephen G. Yeates and
                  John C. Batchelor and
                  Simon J. Holder},
  title        = {Chemical Vapor Detecting Passive {RFID} Tag},
  booktitle    = {{IEEE} International Conference on {RFID} Technology and Applications,
                  {RFID-TA} 2019, Pisa, Italy, September 25-27, 2019},
  pages        = {113--115},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.1109/RFID-TA.2019.8892161},
  doi          = {10.1109/RFID-TA.2019.8892161},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/rfidta/TurkiZHBPYBH19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sdm/LiCGLCG19,
  author       = {Dongsheng Li and
                  Chao Chen and
                  Zhilin Gong and
                  Tun Lu and
                  Stephen M. Chu and
                  Ning Gu},
  editor       = {Tanya Y. Berger{-}Wolf and
                  Nitesh V. Chawla},
  title        = {Collaborative Filtering with Noisy Ratings},
  booktitle    = {Proceedings of the 2019 {SIAM} International Conference on Data Mining,
                  {SDM} 2019, Calgary, Alberta, Canada, May 2-4, 2019},
  pages        = {747--755},
  publisher    = {{SIAM}},
  year         = {2019},
  url          = {https://doi.org/10.1137/1.9781611975673.84},
  doi          = {10.1137/1.9781611975673.84},
  timestamp    = {Sat, 21 Nov 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sdm/LiCGLCG19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1902-03585,
  author       = {Huazhu Fu and
                  Yanwu Xu and
                  Stephen Lin and
                  Damon Wing Kee Wong and
                  Mani Baskaran and
                  Meenakshi Mahesh and
                  Tin Aung and
                  Jiang Liu},
  title        = {Angle-Closure Detection in Anterior Segment {OCT} based on Multi-Level
                  Deep Network},
  journal      = {CoRR},
  volume       = {abs/1902.03585},
  year         = {2019},
  url          = {http://arxiv.org/abs/1902.03585},
  eprinttype    = {arXiv},
  eprint       = {1902.03585},
  timestamp    = {Thu, 19 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1902-03585.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1902-04820,
  author       = {Nicolas S. Holliman and
                  Manu Antony and
                  James Charlton and
                  Stephen Dowsland and
                  Philip James and
                  Mark Turner},
  title        = {Petascale Cloud Supercomputing for Terapixel Visualization of a Digital
                  Twin},
  journal      = {CoRR},
  volume       = {abs/1902.04820},
  year         = {2019},
  url          = {http://arxiv.org/abs/1902.04820},
  eprinttype    = {arXiv},
  eprint       = {1902.04820},
  timestamp    = {Thu, 20 May 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1902-04820.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1902-07826,
  author       = {Horia Mania and
                  Stephen Tu and
                  Benjamin Recht},
  title        = {Certainty Equivalent Control of {LQR} is Efficient},
  journal      = {CoRR},
  volume       = {abs/1902.07826},
  year         = {2019},
  url          = {http://arxiv.org/abs/1902.07826},
  eprinttype    = {arXiv},
  eprint       = {1902.07826},
  timestamp    = {Tue, 21 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1902-07826.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1903-11441,
  author       = {Daniel Ahlin and
                  Boris Bauermeister and
                  Jan Conrad and
                  Robert W. Gardner and
                  Luca Grandi and
                  Benedikt Riedel and
                  Evan Shockley and
                  Judith Stephen and
                  Ragnar Sundblad and
                  Suchandra Thapa and
                  Christopher D. Tunnell},
  title        = {The {XENON1T} Data Distribution and Processing Scheme},
  journal      = {CoRR},
  volume       = {abs/1903.11441},
  year         = {2019},
  url          = {http://arxiv.org/abs/1903.11441},
  eprinttype    = {arXiv},
  eprint       = {1903.11441},
  timestamp    = {Fri, 13 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1903-11441.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1904-12017,
  author       = {Jonathan Tuck and
                  Shane T. Barratt and
                  Stephen P. Boyd},
  title        = {A Distributed Method for Fitting Laplacian Regularized Stratified
                  Models},
  journal      = {CoRR},
  volume       = {abs/1904.12017},
  year         = {2019},
  url          = {http://arxiv.org/abs/1904.12017},
  eprinttype    = {arXiv},
  eprint       = {1904.12017},
  timestamp    = {Mon, 09 Sep 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1904-12017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1905-12842,
  author       = {Karl Krauth and
                  Stephen Tu and
                  Benjamin Recht},
  title        = {Finite-time Analysis of Approximate Policy Iteration for the Linear
                  Quadratic Regulator},
  journal      = {CoRR},
  volume       = {abs/1905.12842},
  year         = {2019},
  url          = {http://arxiv.org/abs/1905.12842},
  eprinttype    = {arXiv},
  eprint       = {1905.12842},
  timestamp    = {Mon, 03 Jun 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1905-12842.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1906-11392,
  author       = {Nikolai Matni and
                  Alexandre Prouti{\`{e}}re and
                  Anders Rantzer and
                  Stephen Tu},
  title        = {From self-tuning regulators to reinforcement learning and back again},
  journal      = {CoRR},
  volume       = {abs/1906.11392},
  year         = {2019},
  url          = {http://arxiv.org/abs/1906.11392},
  eprinttype    = {arXiv},
  eprint       = {1906.11392},
  timestamp    = {Mon, 01 Jul 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1906-11392.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1906-11395,
  author       = {Nikolai Matni and
                  Stephen Tu},
  title        = {A Tutorial on Concentration Bounds for System Identification},
  journal      = {CoRR},
  volume       = {abs/1906.11395},
  year         = {2019},
  url          = {http://arxiv.org/abs/1906.11395},
  eprinttype    = {arXiv},
  eprint       = {1906.11395},
  timestamp    = {Mon, 01 Jul 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1906-11395.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-04436,
  author       = {Martin J. Shepperd and
                  Yuchen Guo and
                  Ning Li and
                  Mahir Arzoky and
                  Andrea Capiluppi and
                  Steve Counsell and
                  Giuseppe Destefanis and
                  Stephen Swift and
                  Allan Tucker and
                  Leila Yousefi},
  title        = {The Prevalence of Errors in Machine Learning Experiments},
  journal      = {CoRR},
  volume       = {abs/1909.04436},
  year         = {2019},
  url          = {http://arxiv.org/abs/1909.04436},
  eprinttype    = {arXiv},
  eprint       = {1909.04436},
  timestamp    = {Thu, 01 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1909-04436.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-12474,
  author       = {Yossi Bokor and
                  Daniel Grixti{-}Cheng and
                  Markus Hegland and
                  Stephen G. Roberts and
                  Katharine Turner},
  title        = {Stratified Space Learning: Reconstructing Embedded Graphs},
  journal      = {CoRR},
  volume       = {abs/1909.12474},
  year         = {2019},
  url          = {http://arxiv.org/abs/1909.12474},
  eprinttype    = {arXiv},
  eprint       = {1909.12474},
  timestamp    = {Sat, 23 Jan 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1909-12474.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1911-07929,
  author       = {Jessica Velasco and
                  Cherry Pascion and
                  Jean Wilmar Alberio and
                  Jonathan Apuang and
                  John Stephen Cruz and
                  Mark Angelo Gomez and
                  Benjamin Molina Jr. and
                  Lyndon Tuala and
                  August Thio{-}ac and
                  Romeo Jorda Jr.},
  title        = {A Smartphone-Based Skin Disease Classification Using MobileNet {CNN}},
  journal      = {CoRR},
  volume       = {abs/1911.07929},
  year         = {2019},
  url          = {http://arxiv.org/abs/1911.07929},
  eprinttype    = {arXiv},
  eprint       = {1911.07929},
  timestamp    = {Mon, 02 Dec 2019 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1911-07929.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1912-02975,
  author       = {Xingyou Song and
                  Yiding Jiang and
                  Stephen Tu and
                  Yilun Du and
                  Behnam Neyshabur},
  title        = {Observational Overfitting in Reinforcement Learning},
  journal      = {CoRR},
  volume       = {abs/1912.02975},
  year         = {2019},
  url          = {http://arxiv.org/abs/1912.02975},
  eprinttype    = {arXiv},
  eprint       = {1912.02975},
  timestamp    = {Thu, 02 Jan 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1912-02975.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/McGuinessGMT18,
  author       = {Daniel Tunc McGuiness and
                  Stamatios Giannoukos and
                  Alan Marshall and
                  Stephen Taylor},
  title        = {Parameter Analysis in Macro-Scale Molecular Communications Using Advection-Diffusion},
  journal      = {{IEEE} Access},
  volume       = {6},
  pages        = {46706--46717},
  year         = {2018},
  url          = {https://doi.org/10.1109/ACCESS.2018.2866679},
  doi          = {10.1109/ACCESS.2018.2866679},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/McGuinessGMT18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/AmatoBCKKKLRO0T18,
  author       = {Christopher Amato and
                  Haitham Bou{-}Ammar and
                  Elizabeth F. Churchill and
                  Erez Karpas and
                  Takashi Kido and
                  Mike Kuniavsky and
                  William F. Lawless and
                  Francesca Rossi and
                  Frans A. Oliehoek and
                  Stephen Russell and
                  Keiki Takadama and
                  Siddharth Srivastava and
                  Karl Tuyls and
                  Philip van Allen and
                  Kristen Brent Venable and
                  Peter Vrancx and
                  Shiqi Zhang},
  title        = {Reports on the 2018 {AAAI} Spring Symposium Series},
  journal      = {{AI} Mag.},
  volume       = {39},
  number       = {4},
  pages        = {29--35},
  year         = {2018},
  url          = {https://doi.org/10.1609/aimag.v39i4.2824},
  doi          = {10.1609/AIMAG.V39I4.2824},
  timestamp    = {Tue, 23 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/aim/AmatoBCKKKLRO0T18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/LinHCTSPEEKOBMG18,
  author       = {Hui{-}Yi Lin and
                  Po{-}Yu Huang and
                  Dung{-}Tsa Chen and
                  Heng{-}Yuan Tung and
                  Thomas A. Sellers and
                  Julio M. Pow{-}Sang and
                  Rosalind A. Eeles and
                  Doug Easton and
                  Zsofia Kote{-}Jarai and
                  Ali Amin Al Olama and
                  Sara Benlloch and
                  Kenneth Muir and
                  Graham G. Giles and
                  Fredrik Wiklund and
                  Henrik Gronberg and
                  Christopher A. Haiman and
                  Johanna Schleutker and
                  B{\o}rge G. Nordestgaard and
                  Ruth C. Travis and
                  Freddie Hamdy and
                  David E. Neal and
                  Nora Pashayan and
                  Kay{-}Tee Khaw and
                  Janet L. Stanford and
                  William J. Blot and
                  Stephen N. Thibodeau and
                  Christiane Maier and
                  Adam S. Kibel and
                  Cezary Cybulski and
                  Lisa A. Cannon{-}Albright and
                  Hermann Brenner and
                  Radka Kaneva and
                  Jyotsna Batra and
                  Manuel R. Teixeira and
                  Hardev Pandha and
                  Yong{-}Jie Lu and
                  The PRACTICAL Consortium and
                  Jong Y. Park},
  title        = {AA9int: {SNP} interaction pattern search using non-hierarchical additive
                  model set},
  journal      = {Bioinform.},
  volume       = {34},
  number       = {24},
  pages        = {4141--4150},
  year         = {2018},
  url          = {https://doi.org/10.1093/bioinformatics/bty461},
  doi          = {10.1093/BIOINFORMATICS/BTY461},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/bioinformatics/LinHCTSPEEKOBMG18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cce/BankoleJBTZ18,
  author       = {Temitayo Bankole and
                  Dustin Jones and
                  Debangsu Bhattacharyya and
                  Richard Turton and
                  Stephen E. Zitney},
  title        = {Optimal scheduling and its Lyapunov stability for advanced load-following
                  energy plants with CO\({}_{\mbox{2}}\) capture},
  journal      = {Comput. Chem. Eng.},
  volume       = {109},
  pages        = {30--47},
  year         = {2018},
  url          = {https://doi.org/10.1016/j.compchemeng.2017.10.025},
  doi          = {10.1016/J.COMPCHEMENG.2017.10.025},
  timestamp    = {Mon, 18 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cce/BankoleJBTZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cgf/ZhaoCT18,
  author       = {Mingbi Zhao and
                  Wentong Cai and
                  Stephen John Turner},
  title        = {{CLUST:} Simulating Realistic Crowd Behaviour by Mining Pattern from
                  Crowd Videos},
  journal      = {Comput. Graph. Forum},
  volume       = {37},
  number       = {1},
  pages        = {184--201},
  year         = {2018},
  url          = {https://doi.org/10.1111/cgf.13259},
  doi          = {10.1111/CGF.13259},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cgf/ZhaoCT18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/data/MakoninWT18,
  author       = {Stephen Makonin and
                  Z. Jane Wang and
                  Chris Tumpach},
  title        = {{RAE:} The Rainforest Automation Energy Dataset for Smart Grid Meter
                  Data Analysis},
  journal      = {Data},
  volume       = {3},
  number       = {1},
  pages        = {8},
  year         = {2018},
  url          = {https://doi.org/10.3390/data3010008},
  doi          = {10.3390/DATA3010008},
  timestamp    = {Wed, 27 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/data/MakoninWT18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/icl/McGuinessGMT18,
  author       = {Daniel Tunc McGuiness and
                  Stamatios Giannoukos and
                  Alan Marshall and
                  Stephen Taylor},
  title        = {Experimental Results on the Open-Air Transmission of Macro-Molecular
                  Communication Using Membrane Inlet Mass Spectrometry},
  journal      = {{IEEE} Commun. Lett.},
  volume       = {22},
  number       = {12},
  pages        = {2567--2570},
  year         = {2018},
  url          = {https://doi.org/10.1109/LCOMM.2018.2875445},
  doi          = {10.1109/LCOMM.2018.2875445},
  timestamp    = {Thu, 20 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/icl/McGuinessGMT18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/ValentaBBDEFGGJ18,
  author       = {Annette L. Valenta and
                  Eta S. Berner and
                  Suzanne Austin Boren and
                  Gloria J. Deckard and
                  Christina Eldredge and
                  Douglas B. Fridsma and
                  Cynthia S. Gadd and
                  Yang Gong and
                  Todd R. Johnson and
                  Josette Jones and
                  E. LaVerne Manos and
                  Kirk T. Phillips and
                  Nancy K. Roderer and
                  Douglas Rosendale and
                  Anne M. Turner and
                  G{\"{u}}nter Tusch and
                  Jeffrey J. Williamson and
                  Stephen B. Johnson},
  title        = {{AMIA} Board White Paper: {AMIA} 2017 core competencies for applied
                  health informatics education at the master's degree level},
  journal      = {J. Am. Medical Informatics Assoc.},
  volume       = {25},
  number       = {12},
  pages        = {1657--1668},
  year         = {2018},
  url          = {https://doi.org/10.1093/jamia/ocy132},
  doi          = {10.1093/JAMIA/OCY132},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jamia/ValentaBBDEFGGJ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jeric/TurnerPE18,
  author       = {Scott Alexander Turner and
                  Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and
                  Stephen H. Edwards},
  title        = {Peer Review in {CS2:} Conceptual Learning and High-Level Thinking},
  journal      = {{ACM} Trans. Comput. Educ.},
  volume       = {18},
  number       = {3},
  pages        = {13:1--13:37},
  year         = {2018},
  url          = {https://doi.org/10.1145/3152715},
  doi          = {10.1145/3152715},
  timestamp    = {Fri, 06 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jeric/TurnerPE18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/TanakitkornWTP18,
  author       = {Kantapon Tanakitkorn and
                  Philip A. Wilson and
                  Stephen R. Turnock and
                  Alexander B. Phillips},
  title        = {Sliding mode heading control of an overactuated, hover-capable autonomous
                  underwater vehicle with experimental verification},
  journal      = {J. Field Robotics},
  volume       = {35},
  number       = {3},
  pages        = {396--415},
  year         = {2018},
  url          = {https://doi.org/10.1002/rob.21766},
  doi          = {10.1002/ROB.21766},
  timestamp    = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jfr/TanakitkornWTP18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jossw/Turner18,
  author       = {Stephen D. Turner},
  title        = {qqman: an {R} package for visualizing {GWAS} results using {Q-Q} and
                  manhattan plots},
  journal      = {J. Open Source Softw.},
  volume       = {3},
  number       = {25},
  pages        = {731},
  year         = {2018},
  url          = {https://doi.org/10.21105/joss.00731},
  doi          = {10.21105/JOSS.00731},
  timestamp    = {Tue, 16 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jossw/Turner18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neco/VerziRPQMVJA18,
  author       = {Stephen J. Verzi and
                  Fredrick H. Rothganger and
                  Ojas Parekh and
                  Tu{-}Thach Quach and
                  Nadine E. Miner and
                  Craig M. Vineyard and
                  Conrad D. James and
                  James B. Aimone},
  title        = {Computing with Spikes: The Advantage of Fine-Grained Timing},
  journal      = {Neural Comput.},
  volume       = {30},
  number       = {10},
  year         = {2018},
  url          = {https://doi.org/10.1162/neco\_a\_01113},
  doi          = {10.1162/NECO\_A\_01113},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/neco/VerziRPQMVJA18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/AllozaCCRWRMHTL18,
  author       = {Clara Alloza and
                  Simon R. Cox and
                  Manuel Blesa Cabez and
                  Paul Redmond and
                  Heather Whalley and
                  Stuart J. Ritchie and
                  Susana Mu{\~{n}}oz Maniega and
                  Maria del C. Vald{\'{e}}s Hern{\'{a}}ndez and
                  Elliot Tucker{-}Drob and
                  Stephen M. Lawrie and
                  Joanna M. Wardlaw and
                  Ian J. Deary and
                  Mark E. Bastin},
  title        = {Polygenic risk score for schizophrenia and structural brain connectivity
                  in older age: {A} longitudinal connectome and tractography study},
  journal      = {NeuroImage},
  volume       = {183},
  pages        = {884--896},
  year         = {2018},
  url          = {https://doi.org/10.1016/j.neuroimage.2018.08.075},
  doi          = {10.1016/J.NEUROIMAGE.2018.08.075},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/neuroimage/AllozaCCRWRMHTL18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/RobinsonGGCCMBW18,
  author       = {Emma C. Robinson and
                  Kara Garcia and
                  Matthew F. Glasser and
                  Zhengdao Chen and
                  Timothy S. Coalson and
                  Antonios Makropoulos and
                  Jelena Bozek and
                  Robert Wright and
                  Andreas Schuh and
                  Matthew A. Webster and
                  Jana Hutter and
                  Anthony Price and
                  Lucilio Cordero{-}Grande and
                  Emer J. Hughes and
                  Nora Tusor and
                  Philip V. Bayly and
                  David C. Van Essen and
                  Stephen M. Smith and
                  Daniel Rueckert},
  title        = {Multimodal surface matching with higher-order smoothness constraints},
  journal      = {NeuroImage},
  volume       = {167},
  pages        = {453--465},
  year         = {2018},
  url          = {https://doi.org/10.1016/j.neuroimage.2017.10.037},
  doi          = {10.1016/J.NEUROIMAGE.2017.10.037},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/neuroimage/RobinsonGGCCMBW18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/YangMFGHWTGBT18,
  author       = {Kai Yang and
                  Katie L. Meadmore and
                  Chris T. Freeman and
                  Neil J. Grabham and
                  Ann{-}Marie Hughes and
                  Yang Wei and
                  Russel N. Torah and
                  Monika Glanc{-}Gostkiewicz and
                  Steve P. Beeby and
                  John Tudor},
  title        = {Development of User-Friendly Wearable Electronic Textiles for Healthcare
                  Applications},
  journal      = {Sensors},
  volume       = {18},
  number       = {8},
  pages        = {2410},
  year         = {2018},
  url          = {https://doi.org/10.3390/s18082410},
  doi          = {10.3390/S18082410},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/sensors/YangMFGHWTGBT18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tci/EldalyAPKCDM18,
  author       = {Ahmed Karam Eldaly and
                  Yoann Altmann and
                  Antonios Perperidis and
                  Nikola Krstajic and
                  Tushar Choudhary and
                  Kevin Dhaliwal and
                  Steve McLaughlin},
  title        = {Deconvolution and Restoration of Optical Endomicroscopy Images},
  journal      = {{IEEE} Trans. Computational Imaging},
  volume       = {4},
  number       = {2},
  pages        = {194--205},
  year         = {2018},
  url          = {https://doi.org/10.1109/TCI.2018.2811939},
  doi          = {10.1109/TCI.2018.2811939},
  timestamp    = {Tue, 16 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tci/EldalyAPKCDM18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/TuSVEWHPPYWP18,
  author       = {Liyun Tu and
                  Martin Styner and
                  Jared Vicory and
                  Shireen Y. Elhabian and
                  Rui Wang and
                  Jun{-}Pyo Hong and
                  Beatriz Paniagua and
                  Juan{-}Carlos Prieto and
                  Dan Yang and
                  Ross T. Whitaker and
                  Stephen M. Pizer},
  title        = {Skeletal Shape Correspondence Through Entropy},
  journal      = {{IEEE} Trans. Medical Imaging},
  volume       = {37},
  number       = {1},
  pages        = {1--11},
  year         = {2018},
  url          = {https://doi.org/10.1109/TMI.2017.2755550},
  doi          = {10.1109/TMI.2017.2755550},
  timestamp    = {Thu, 06 Jun 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tmi/TuSVEWHPPYWP18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/TuBR18,
  author       = {Stephen Tu and
                  Ross Boczar and
                  Benjamin Recht},
  title        = {On the Approximation of Toeplitz Operators for Nonparametric H\({}_{\mbox{{\(\infty\)}}}\)-norm
                  Estimation},
  booktitle    = {2018 Annual American Control Conference, {ACC} 2018, Milwaukee, WI,
                  USA, June 27-29, 2018},
  pages        = {1867--1872},
  publisher    = {{IEEE}},
  year         = {2018},
  url          = {https://doi.org/10.23919/ACC.2018.8431846},
  doi          = {10.23919/ACC.2018.8431846},
  timestamp    = {Sun, 08 Aug 2021 01:40:57 +0200},
  biburl       = {https://dblp.org/rec/conf/amcc/TuBR18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atal/AlanLSPRWTR18,
  author       = {Alper Turan Alan and
                  Chang Liu and
                  Elliot Salisbury and
                  Stephen D. Prior and
                  Sarvapali D. Ramchurn and
                  Feng Wu and
                  Kerry Tatlock and
                  Gareth Rees},
  editor       = {Elisabeth Andr{\'{e}} and
                  Sven Koenig and
                  Mehdi Dastani and
                  Gita Sukthankar},
  title        = {Human-UAV Teaming in Dynamic and Uncertain Environments},
  booktitle    = {Proceedings of the 17th International Conference on Autonomous Agents
                  and MultiAgent Systems, {AAMAS} 2018, Stockholm, Sweden, July 10-15,
                  2018},
  pages        = {1791--1793},
  publisher    = {International Foundation for Autonomous Agents and Multiagent Systems
                  Richland, SC, {USA} / {ACM}},
  year         = {2018},
  url          = {http://dl.acm.org/citation.cfm?id=3237979},
  timestamp    = {Sat, 30 Sep 2023 09:34:53 +0200},
  biburl       = {https://dblp.org/rec/conf/atal/AlanLSPRWTR18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibm/YousefiSASCT18,
  author       = {Leila Yousefi and
                  Stephen Swift and
                  Mahir Arzoky and
                  Lucia Sacchi and
                  Luca Chiovato and
                  Allan Tucker},
  editor       = {Huiru Jane Zheng and
                  Zoraida Callejas and
                  David Griol and
                  Haiying Wang and
                  Xiaohua Hu and
                  Harald H. H. W. Schmidt and
                  Jan Baumbach and
                  Julie Dickerson and
                  Le Zhang},
  title        = {Opening the Black Box: Discovering and Explaining Hidden Variables
                  in Type 2 Diabetic Patient Modelling},
  booktitle    = {{IEEE} International Conference on Bioinformatics and Biomedicine,
                  {BIBM} 2018, Madrid, Spain, December 3-6, 2018},
  pages        = {1040--1044},
  publisher    = {{IEEE} Computer Society},
  year         = {2018},
  url          = {https://doi.ieeecomputersociety.org/10.1109/BIBM.2018.8621484},
  doi          = {10.1109/BIBM.2018.8621484},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/bibm/YousefiSASCT18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccece/CatafordGTB18,
  author       = {Andrew Cataford and
                  S. Andrew Gadsden and
                  Kevin Turpie and
                  Mohammad Biglarbegian},
  title        = {Air-LUSI: Estimation, Filtering, and {PID} Tracking Simulation},
  booktitle    = {2018 {IEEE} Canadian Conference on Electrical {\&} Computer Engineering,
                  {CCECE} 2018, Quebec, QC, Canada, May 13-16, 2018},
  pages        = {1--6},
  publisher    = {{IEEE}},
  year         = {2018},
  url          = {https://doi.org/10.1109/CCECE.2018.8447850},
  doi          = {10.1109/CCECE.2018.8447850},
  timestamp    = {Wed, 16 Oct 2019 14:14:49 +0200},
  biburl       = {https://dblp.org/rec/conf/ccece/CatafordGTB18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/TurnerP0CTFGZSN18,
  author       = {Walker J. Turner and
                  John W. Poulton and
                  John M. Wilson and
                  Xi Chen and
                  Stephen G. Tell and
                  Matthew Fojtik and
                  Thomas H. Greer and
                  Brian Zimmer and
                  Sanquan Song and
                  Nikola Nedovic and
                  Sudhir S. Kudva and
                  Sunil R. Sudhakaran and
                  Rizwan Bashirullah and
                  Wenxu Zhao and
                  William J. Dally and
                  C. Thomas Gray},
  title        = {Ground-referenced signaling for intra-chip and short-reach chip-to-chip
                  interconnects},
  booktitle    = {2018 {IEEE} Custom Integrated Circuits Conference, {CICC} 2018, San
                  Diego, CA, USA, April 8-11, 2018},
  pages        = {1--8},
  publisher    = {{IEEE}},
  year         = {2018},
  url          = {https://doi.org/10.1109/CICC.2018.8357077},
  doi          = {10.1109/CICC.2018.8357077},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/cicc/TurnerP0CTFGZSN18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/colt/SimchowitzMTJR18,
  author       = {Max Simchowitz and
                  Horia Mania and
                  Stephen Tu and
                  Michael I. Jordan and
                  Benjamin Recht},
  editor       = {S{\'{e}}bastien Bubeck and
                  Vianney Perchet and
                  Philippe Rigollet},
  title        = {Learning Without Mixing: Towards {A} Sharp Analysis of Linear System
                  Identification},
  booktitle    = {Conference On Learning Theory, {COLT} 2018, Stockholm, Sweden, 6-9
                  July 2018},
  series       = {Proceedings of Machine Learning Research},
  volume       = {75},
  pages        = {439--473},
  publisher    = {{PMLR}},
  year         = {2018},
  url          = {http://proceedings.mlr.press/v75/simchowitz18a.html},
  timestamp    = {Wed, 03 Apr 2019 18:17:23 +0200},
  biburl       = {https://dblp.org/rec/conf/colt/SimchowitzMTJR18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/CaoLLLTC18,
  author       = {Kris Cao and
                  Angeliki Lazaridou and
                  Marc Lanctot and
                  Joel Z. Leibo and
                  Karl Tuyls and
                  Stephen Clark},
  title        = {Emergent Communication through Negotiation},
  booktitle    = {6th International Conference on Learning Representations, {ICLR} 2018,
                  Vancouver, BC, Canada, April 30 - May 3, 2018, Conference Track Proceedings},
  publisher    = {OpenReview.net},
  year         = {2018},
  url          = {https://openreview.net/forum?id=Hk6WhagRW},
  timestamp    = {Thu, 25 Jul 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iclr/CaoLLLTC18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/LazaridouHTC18,
  author       = {Angeliki Lazaridou and
                  Karl Moritz Hermann and
                  Karl Tuyls and
                  Stephen Clark},
  title        = {Emergence of Linguistic Communication from Referential Games with
                  Symbolic and Pixel Input},
  booktitle    = {6th International Conference on Learning Representations, {ICLR} 2018,
                  Vancouver, BC, Canada, April 30 - May 3, 2018, Conference Track Proceedings},
  publisher    = {OpenReview.net},
  year         = {2018},
  url          = {https://openreview.net/forum?id=HJGv1Z-AW},
  timestamp    = {Thu, 04 Apr 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iclr/LazaridouHTC18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/TuR18,
  author       = {Stephen Tu and
                  Benjamin Recht},
  editor       = {Jennifer G. Dy and
                  Andreas Krause},
  title        = {Least-Squares Temporal Difference Learning for the Linear Quadratic
                  Regulator},
  booktitle    = {Proceedings of the 35th International Conference on Machine Learning,
                  {ICML} 2018, Stockholmsm{\"{a}}ssan, Stockholm, Sweden, July
                  10-15, 2018},
  series       = {Proceedings of Machine Learning Research},
  volume       = {80},
  pages        = {5012--5021},
  publisher    = {{PMLR}},
  year         = {2018},
  url          = {http://proceedings.mlr.press/v80/tu18a.html},
  timestamp    = {Wed, 03 Apr 2019 18:17:30 +0200},
  biburl       = {https://dblp.org/rec/conf/icml/TuR18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/TomaBRG18,
  author       = {Tudor Toma and
                  Kaustav Basu and
                  Wilder Rodrigues and
                  Stephen J. Galsworthy},
  title        = {A Deep Learning Based Method for Heat Pump Dryer User Classification},
  booktitle    = {{IECON} 2018 - 44th Annual Conference of the {IEEE} Industrial Electronics
                  Society, Washington, DC, USA, October 21-23, 2018},
  pages        = {3455--3460},
  publisher    = {{IEEE}},
  year         = {2018},
  url          = {https://doi.org/10.1109/IECON.2018.8591328},
  doi          = {10.1109/IECON.2018.8591328},
  timestamp    = {Sun, 25 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iecon/TomaBRG18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/intellisys/AyedASCT18,
  author       = {Samy Ayed and
                  Mahir Arzoky and
                  Stephen Swift and
                  Steve Counsell and
                  Allan Tucker},
  editor       = {Kohei Arai and
                  Supriya Kapoor and
                  Rahul Bhatia},
  title        = {An Exploratory Study of the Inputs for Ensemble Clustering Technique
                  as a Subset Selection Problem},
  booktitle    = {Intelligent Systems and Applications - Proceedings of the 2018 Intelligent
                  Systems Conference, IntelliSys 2018, London, UK, September 6-7, 2018,
                  Volume 1},
  series       = {Advances in Intelligent Systems and Computing},
  volume       = {868},
  pages        = {1041--1055},
  publisher    = {Springer},
  year         = {2018},
  url          = {https://doi.org/10.1007/978-3-030-01054-6\_72},
  doi          = {10.1007/978-3-030-01054-6\_72},
  timestamp    = {Mon, 18 Feb 2019 09:18:28 +0100},
  biburl       = {https://dblp.org/rec/conf/intellisys/AyedASCT18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/0002TPZCKSTNZSG18,
  author       = {John M. Wilson and
                  Walker J. Turner and
                  John W. Poulton and
                  Brian Zimmer and
                  Xi Chen and
                  Sudhir S. Kudva and
                  Sanquan Song and
                  Stephen G. Tell and
                  Nikola Nedovic and
                  Wenxu Zhao and
                  Sunil R. Sudhakaran and
                  C. Thomas Gray and
                  William J. Dally},
  title        = {A 1.17pJ/b 25Gb/s/pin ground-referenced single-ended serial link for
                  off- and on-package communication in 16nm {CMOS} using a process-
                  and temperature-adaptive voltage regulator},
  booktitle    = {2018 {IEEE} International Solid-State Circuits Conference, {ISSCC}
                  2018, San Francisco, CA, USA, February 11-15, 2018},
  pages        = {276--278},
  publisher    = {{IEEE}},
  year         = {2018},
  url          = {https://doi.org/10.1109/ISSCC.2018.8310291},
  doi          = {10.1109/ISSCC.2018.8310291},
  timestamp    = {Wed, 16 Oct 2019 14:14:55 +0200},
  biburl       = {https://dblp.org/rec/conf/isscc/0002TPZCKSTNZSG18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/FuXLWBMAL18,
  author       = {Huazhu Fu and
                  Yanwu Xu and
                  Stephen Lin and
                  Damon Wing Kee Wong and
                  Mani Baskaran and
                  Meenakshi Mahesh and
                  Tin Aung and
                  Jiang Liu},
  editor       = {Alejandro F. Frangi and
                  Julia A. Schnabel and
                  Christos Davatzikos and
                  Carlos Alberola{-}L{\'{o}}pez and
                  Gabor Fichtinger},
  title        = {Multi-context Deep Network for Angle-Closure Glaucoma Screening in
                  Anterior Segment {OCT}},
  booktitle    = {Medical Image Computing and Computer Assisted Intervention - {MICCAI}
                  2018 - 21st International Conference, Granada, Spain, September 16-20,
                  2018, Proceedings, Part {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {11071},
  pages        = {356--363},
  publisher    = {Springer},
  year         = {2018},
  url          = {https://doi.org/10.1007/978-3-030-00934-2\_40},
  doi          = {10.1007/978-3-030-00934-2\_40},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/miccai/FuXLWBMAL18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nanocom/McGuinessMTG18,
  author       = {Daniel Tunc McGuiness and
                  Alan Marshall and
                  Stephen Taylor and
                  Stamatios Giannoukos},
  editor       = {J{\'{o}}n Atli Benediktsson and
                  Falko Dressler},
  title        = {Asymmetrical inter-symbol interference in macro-scale molecular communications},
  booktitle    = {Proceedings of the 5th {ACM} International Conference on Nanoscale
                  Computing and Communication, {NANOCOM} 2018, Reykjavik, Iceland, September
                  05-07, 2018},
  pages        = {13:1--13:6},
  publisher    = {{ACM}},
  year         = {2018},
  url          = {https://doi.org/10.1145/3233188.3233194},
  doi          = {10.1145/3233188.3233194},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/nanocom/McGuinessMTG18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/DeanMMRT18,
  author       = {Sarah Dean and
                  Horia Mania and
                  Nikolai Matni and
                  Benjamin Recht and
                  Stephen Tu},
  editor       = {Samy Bengio and
                  Hanna M. Wallach and
                  Hugo Larochelle and
                  Kristen Grauman and
                  Nicol{\`{o}} Cesa{-}Bianchi and
                  Roman Garnett},
  title        = {Regret Bounds for Robust Adaptive Control of the Linear Quadratic
                  Regulator},
  booktitle    = {Advances in Neural Information Processing Systems 31: Annual Conference
                  on Neural Information Processing Systems 2018, NeurIPS 2018, December
                  3-8, 2018, Montr{\'{e}}al, Canada},
  pages        = {4192--4201},
  year         = {2018},
  url          = {https://proceedings.neurips.cc/paper/2018/hash/0ae3f79a30234b6c45a6f7d298ba1310-Abstract.html},
  timestamp    = {Mon, 16 May 2022 15:41:51 +0200},
  biburl       = {https://dblp.org/rec/conf/nips/DeanMMRT18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/LiCLGLSGC18,
  author       = {Dongsheng Li and
                  Chao Chen and
                  Qin Lv and
                  Hansu Gu and
                  Tun Lu and
                  Li Shang and
                  Ning Gu and
                  Stephen M. Chu},
  editor       = {Pierre{-}Antoine Champin and
                  Fabien Gandon and
                  Mounia Lalmas and
                  Panagiotis G. Ipeirotis},
  title        = {AdaError: An Adaptive Learning Rate Method for Matrix Approximation-based
                  Collaborative Filtering},
  booktitle    = {Proceedings of the 2018 World Wide Web Conference on World Wide Web,
                  {WWW} 2018, Lyon, France, April 23-27, 2018},
  pages        = {741--751},
  publisher    = {{ACM}},
  year         = {2018},
  url          = {https://doi.org/10.1145/3178876.3186155},
  doi          = {10.1145/3178876.3186155},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/www/LiCLGLSGC18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/xsede/Ananthakrishnan18,
  author       = {Rachana Ananthakrishnan and
                  Ben Blaiszik and
                  Kyle Chard and
                  Ryan Chard and
                  Brendan McCollam and
                  Jim Pruyne and
                  Stephen Rosen and
                  Steven Tuecke and
                  Ian T. Foster},
  editor       = {Sergiu Sanielevici},
  title        = {Globus Platform Services for Data Publication},
  booktitle    = {Proceedings of the Practice and Experience on Advanced Research Computing,
                  {PEARC} 2018, Pittsburgh, PA, USA, July 22-26, 2018},
  pages        = {14:1--14:7},
  publisher    = {{ACM}},
  year         = {2018},
  url          = {https://doi.org/10.1145/3219104.3219127},
  doi          = {10.1145/3219104.3219127},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/xsede/Ananthakrishnan18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/xsede/RiedelBBCPGGLRS18,
  author       = {Benedikt Riedel and
                  Boris Bauermeister and
                  Lincoln Bryant and
                  Jan Conrad and
                  Patrick de Perio and
                  Robert W. Gardner and
                  Luca Grandi and
                  Francesco Lombardi and
                  Alfio Rizzo and
                  Gabriella Sartorelli and
                  Marco Selvi and
                  Evan Shockley and
                  Judith Stephen and
                  Suchandra Thapa and
                  Christopher D. Tunnell},
  editor       = {Sergiu Sanielevici},
  title        = {Distributed Data and Job Management for the {XENON1T} Experiment},
  booktitle    = {Proceedings of the Practice and Experience on Advanced Research Computing,
                  {PEARC} 2018, Pittsburgh, PA, USA, July 22-26, 2018},
  pages        = {9:1--9:8},
  publisher    = {{ACM}},
  year         = {2018},
  url          = {https://doi.org/10.1145/3219104.3219155},
  doi          = {10.1145/3219104.3219155},
  timestamp    = {Fri, 13 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/xsede/RiedelBBCPGGLRS18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/isvc/2018,
  editor       = {George Bebis and
                  Richard Boyle and
                  Bahram Parvin and
                  Darko Koracin and
                  Matt Turek and
                  Srikumar Ramalingam and
                  Kai Xu and
                  Stephen Lin and
                  Bilal Alsallakh and
                  Jing Yang and
                  Eduardo Cuervo and
                  Jonathan Ventura},
  title        = {Advances in Visual Computing - 13th International Symposium, {ISVC}
                  2018, Las Vegas, NV, USA, November 19-21, 2018, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {11241},
  publisher    = {Springer},
  year         = {2018},
  url          = {https://doi.org/10.1007/978-3-030-03801-4},
  doi          = {10.1007/978-3-030-03801-4},
  isbn         = {978-3-030-03800-7},
  timestamp    = {Tue, 14 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/isvc/2018.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1802-08334,
  author       = {Max Simchowitz and
                  Horia Mania and
                  Stephen Tu and
                  Michael I. Jordan and
                  Benjamin Recht},
  title        = {Learning Without Mixing: Towards {A} Sharp Analysis of Linear System
                  Identification},
  journal      = {CoRR},
  volume       = {abs/1802.08334},
  year         = {2018},
  url          = {http://arxiv.org/abs/1802.08334},
  eprinttype    = {arXiv},
  eprint       = {1802.08334},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1802-08334.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1803-09166,
  author       = {Phil Weir and
                  Roland Ellerweg and
                  Stephen J. Payne and
                  Dominic Reuter and
                  Tuomas Alhonnoro and
                  Philip Voglreiter and
                  Panchatcharam Mariappan and
                  Mika Pollari and
                  Chang{-}Sub Park and
                  Peter Voigt and
                  Tim van Oostenbrugge and
                  Sebastian Fischer and
                  Peter Kalmar and
                  Jurgen J. F{\"{u}}tterer and
                  Philipp Stiegler and
                  Stephan Zangos and
                  Ronan Flanagan and
                  Michael Moche and
                  Marina Kolesnik},
  title        = {Go-Smart: Open-Ended, Web-Based Modelling of Minimally Invasive Cancer
                  Treatments via a Clinical Domain Approach},
  journal      = {CoRR},
  volume       = {abs/1803.09166},
  year         = {2018},
  url          = {http://arxiv.org/abs/1803.09166},
  eprinttype    = {arXiv},
  eprint       = {1803.09166},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1803-09166.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1804-03980,
  author       = {Kris Cao and
                  Angeliki Lazaridou and
                  Marc Lanctot and
                  Joel Z. Leibo and
                  Karl Tuyls and
                  Stephen Clark},
  title        = {Emergent Communication through Negotiation},
  journal      = {CoRR},
  volume       = {abs/1804.03980},
  year         = {2018},
  url          = {http://arxiv.org/abs/1804.03980},
  eprinttype    = {arXiv},
  eprint       = {1804.03980},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1804-03980.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1804-03984,
  author       = {Angeliki Lazaridou and
                  Karl Moritz Hermann and
                  Karl Tuyls and
                  Stephen Clark},
  title        = {Emergence of Linguistic Communication from Referential Games with
                  Symbolic and Pixel Input},
  journal      = {CoRR},
  volume       = {abs/1804.03984},
  year         = {2018},
  url          = {http://arxiv.org/abs/1804.03984},
  eprinttype    = {arXiv},
  eprint       = {1804.03984},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1804-03984.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1804-04878,
  author       = {Vikas Sindhwani and
                  Stephen Tu and
                  Mohi Khansari},
  title        = {Learning Contracting Vector Fields For Stable Imitation Learning},
  journal      = {CoRR},
  volume       = {abs/1804.04878},
  year         = {2018},
  url          = {http://arxiv.org/abs/1804.04878},
  eprinttype    = {arXiv},
  eprint       = {1804.04878},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1804-04878.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-07311,
  author       = {G{\'{a}}bor Braun and
                  Sebastian Pokutta and
                  Dan Tu and
                  Stephen J. Wright},
  title        = {Blended Conditional Gradients: the unconditioning of conditional gradients},
  journal      = {CoRR},
  volume       = {abs/1805.07311},
  year         = {2018},
  url          = {http://arxiv.org/abs/1805.07311},
  eprinttype    = {arXiv},
  eprint       = {1805.07311},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1805-07311.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-09388,
  author       = {Sarah Dean and
                  Horia Mania and
                  Nikolai Matni and
                  Benjamin Recht and
                  Stephen Tu},
  title        = {Regret Bounds for Robust Adaptive Control of the Linear Quadratic
                  Regulator},
  journal      = {CoRR},
  volume       = {abs/1805.09388},
  year         = {2018},
  url          = {http://arxiv.org/abs/1805.09388},
  eprinttype    = {arXiv},
  eprint       = {1805.09388},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1805-09388.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-03239,
  author       = {Huazhu Fu and
                  Yanwu Xu and
                  Stephen Lin and
                  Damon Wing Kee Wong and
                  Mani Baskaran and
                  Meenakshi Mahesh and
                  Tin Aung and
                  Jiang Liu},
  title        = {Multi-Context Deep Network for Angle-Closure Glaucoma Screening in
                  Anterior Segment {OCT}},
  journal      = {CoRR},
  volume       = {abs/1809.03239},
  year         = {2018},
  url          = {http://arxiv.org/abs/1809.03239},
  eprinttype    = {arXiv},
  eprint       = {1809.03239},
  timestamp    = {Thu, 19 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1809-03239.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-10121,
  author       = {Sarah Dean and
                  Stephen Tu and
                  Nikolai Matni and
                  Benjamin Recht},
  title        = {Safely Learning to Control the Constrained Linear Quadratic Regulator},
  journal      = {CoRR},
  volume       = {abs/1809.10121},
  year         = {2018},
  url          = {http://arxiv.org/abs/1809.10121},
  eprinttype    = {arXiv},
  eprint       = {1809.10121},
  timestamp    = {Fri, 05 Oct 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1809-10121.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-10855,
  author       = {Stephen Tu and
                  Ross Boczar and
                  Benjamin Recht},
  title        = {Minimax Lower Bounds for {\(\mathscr{H}\)}\({}_{\mbox{{\(\infty\)}}}\)-Norm
                  Estimation},
  journal      = {CoRR},
  volume       = {abs/1809.10855},
  year         = {2018},
  url          = {http://arxiv.org/abs/1809.10855},
  eprinttype    = {arXiv},
  eprint       = {1809.10855},
  timestamp    = {Fri, 05 Oct 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1809-10855.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-07011,
  author       = {Octavio Narvaez{-}Aroche and
                  Pierre{-}Jean Meyer and
                  Stephen Tu and
                  Andrew K. Packard and
                  Murat Arcak},
  title        = {Robust Control of the Sit-to-Stand Movement for a Powered Lower Limb
                  Orthosis},
  journal      = {CoRR},
  volume       = {abs/1811.07011},
  year         = {2018},
  url          = {http://arxiv.org/abs/1811.07011},
  eprinttype    = {arXiv},
  eprint       = {1811.07011},
  timestamp    = {Fri, 30 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1811-07011.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1812-03565,
  author       = {Stephen Tu and
                  Benjamin Recht},
  title        = {The Gap Between Model-Based and Model-Free Methods on the Linear Quadratic
                  Regulator: An Asymptotic Viewpoint},
  journal      = {CoRR},
  volume       = {abs/1812.03565},
  year         = {2018},
  url          = {http://arxiv.org/abs/1812.03565},
  eprinttype    = {arXiv},
  eprint       = {1812.03565},
  timestamp    = {Tue, 01 Jan 2019 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1812-03565.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aci/MalmasiSHGST17,
  author       = {Shervin Malmasi and
                  Nicolae L. Sandor and
                  Naoshi Hosomura and
                  Matt Goldberg and
                  Stephen Skentzos and
                  Alexander Turchin},
  title        = {Canary: An {NLP} Platform for Clinicians and Researchers},
  journal      = {Appl. Clin. Inform.},
  volume       = {08},
  number       = {02},
  pages        = {447--453},
  year         = {2017},
  url          = {https://doi.org/10.4338/aci-2017-01-ie-0018},
  doi          = {10.4338/ACI-2017-01-IE-0018},
  timestamp    = {Tue, 01 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/aci/MalmasiSHGST17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/CannonYMUMWSJSB17,
  author       = {Daniel Cannon and
                  Jeremy J. Yang and
                  Stephen L. Mathias and
                  Oleg Ursu and
                  Subramani Mani and
                  Anna Waller and
                  Stephan C. Sch{\"{u}}rer and
                  Lars Juhl Jensen and
                  Larry A. Sklar and
                  Cristian Bologa and
                  Tudor I. Oprea},
  title        = {{TIN-X:} target importance and novelty explorer},
  journal      = {Bioinform.},
  volume       = {33},
  number       = {16},
  pages        = {2601--2603},
  year         = {2017},
  url          = {https://doi.org/10.1093/bioinformatics/btx200},
  doi          = {10.1093/BIOINFORMATICS/BTX200},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/bioinformatics/CannonYMUMWSJSB17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biomedsem/LinMKTVFKNJGMUS17,
  author       = {Yu Lin and
                  Saurabh Mehta and
                  Hande K{\"{u}}{\c{c}}{\"{u}}k{-}McGinty and
                  John Paul Turner and
                  Dusica Vidovic and
                  Michele Forlin and
                  Amar Koleti and
                  Dac{-}Trung Nguyen and
                  Lars Juhl Jensen and
                  Rajarshi Guha and
                  Stephen L. Mathias and
                  Oleg Ursu and
                  Vasileios Stathias and
                  Jianbin Duan and
                  Nooshin Nabizadeh and
                  Caty Chung and
                  Christopher Mader and
                  Ubbo Visser and
                  Jeremy J. Yang and
                  Cristian Bologa and
                  Tudor I. Oprea and
                  Stephan C. Sch{\"{u}}rer},
  title        = {Drug target ontology to classify and integrate drug discovery data},
  journal      = {J. Biomed. Semant.},
  volume       = {8},
  number       = {1},
  pages        = {50:1--50:16},
  year         = {2017},
  url          = {https://doi.org/10.1186/s13326-017-0161-x},
  doi          = {10.1186/S13326-017-0161-X},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/biomedsem/LinMKTVFKNJGMUS17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcsb/AquinoHJLHCEHJS17,
  author       = {Patricia Aquino and
                  Brent Honda and
                  Suma Jaini and
                  Anna Lyubetskaya and
                  Krutika Hosur and
                  Joanna G. Chiu and
                  Iriny Ekladious and
                  Dongjian Hu and
                  Lin Jin and
                  Marianna K. Sayeg and
                  Arion Stettner and
                  Julia Wang and
                  Brandon G. Wong and
                  Winnie S. Wong and
                  Stephen L. Alexander and
                  Cong Ba and
                  Seth I. Bensussen and
                  David B. Bernstein and
                  Dana Braff and
                  Susie Cha and
                  Daniel I. Cheng and
                  Jang{-}Hwan Cho and
                  Kenny Chou and
                  James Chuang and
                  Daniel E. Gastler and
                  Daniel J. Grasso and
                  John S. Greifenberger and
                  Chen Guo and
                  Anna K. Hawes and
                  Divya V. Israni and
                  Saloni R. Jain and
                  Jessica Kim and
                  Junyu Lei and
                  Hao Li and
                  David Li and
                  Qian Li and
                  Christopher P. Mancuso and
                  Ning Mao and
                  Salwa F. Masud and
                  Cari L. Meisel and
                  Jing Mi and
                  Christine S. Nykyforchyn and
                  Minhee Park and
                  Hannah M. Peterson and
                  Alfred K. Ramirez and
                  Daniel S. Reynolds and
                  Nae Gyune Rim and
                  Jared C. Saffie and
                  Hang Su and
                  Wendell R. Su and
                  Yaqing Su and
                  Meng Sun and
                  Meghan M. Thommes and
                  Tao Tu and
                  Nitinun Varongchayakul and
                  Tyler E. Wagner and
                  Benjamin H. Weinberg and
                  Rouhui Yang and
                  Anastasia Yaroslavsky and
                  Christine Yoon and
                  Yanyu Zhao and
                  Alicia J. Zollinger and
                  Anne M. Stringer and
                  John W. Foster and
                  Joseph Wade and
                  Sahadaven Raman and
                  Natasha Broude and
                  Wilson W. Wong and
                  James E. Galagan},
  title        = {Coordinated regulation of acid resistance in Escherichia coli},
  journal      = {{BMC} Syst. Biol.},
  volume       = {11},
  number       = {1},
  pages        = {1:1--1:15},
  year         = {2017},
  url          = {https://doi.org/10.1186/s12918-016-0376-y},
  doi          = {10.1186/S12918-016-0376-Y},
  timestamp    = {Wed, 06 Nov 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/bmcsb/AquinoHJLHCEHJS17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/braininf/HighsmithWTSE17,
  author       = {Jonathan M. Highsmith and
                  Karl L. Wuensch and
                  Tuan Tran and
                  Alexandra J. Stephenson and
                  Daniel E. Everhart},
  title        = {It's not what you expect: feedback negativity is independent of reward
                  expectation and affective responsivity in a non-probabilistic task},
  journal      = {Brain Informatics},
  volume       = {4},
  number       = {1},
  pages        = {51--63},
  year         = {2017},
  url          = {https://doi.org/10.1007/s40708-016-0050-6},
  doi          = {10.1007/S40708-016-0050-6},
  timestamp    = {Wed, 13 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/braininf/HighsmithWTSE17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bspc/NapoliGWTO17,
  author       = {Alessandro Napoli and
                  Stephen M. Glassd and
                  Christian R. Ward and
                  Carole A. Tucker and
                  Iyad Obeid},
  title        = {Performance analysis of a generalized motion capture system using
                  microsoft kinect 2.0},
  journal      = {Biomed. Signal Process. Control.},
  volume       = {38},
  pages        = {265--280},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.bspc.2017.06.006},
  doi          = {10.1016/J.BSPC.2017.06.006},
  timestamp    = {Fri, 26 Mar 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/bspc/NapoliGWTO17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-wss/MrugalaTH17,
  author       = {Kinga Mrugala and
                  Nilufer Tuptuk and
                  Stephen Hailes},
  title        = {Evolving attackers against wireless sensor networks using genetic
                  programming},
  journal      = {{IET} Wirel. Sens. Syst.},
  volume       = {7},
  number       = {4},
  pages        = {113--122},
  year         = {2017},
  url          = {https://doi.org/10.1049/iet-wss.2016.0090},
  doi          = {10.1049/IET-WSS.2016.0090},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/iet-wss/MrugalaTH17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/NelsonOUBZHYMMT17,
  author       = {Stuart J. Nelson and
                  Tudor I. Oprea and
                  Oleg Ursu and
                  Cristian Bologa and
                  Amrapali Zaveri and
                  Jayme Holmes and
                  Jeremy J. Yang and
                  Stephen L. Mathias and
                  Subramani Mani and
                  Mark S. Tuttle and
                  Michel Dumontier},
  title        = {Formalizing drug indications on the road to therapeutic intent},
  journal      = {J. Am. Medical Informatics Assoc.},
  volume       = {24},
  number       = {6},
  pages        = {1169--1172},
  year         = {2017},
  url          = {https://doi.org/10.1093/jamia/ocx064},
  doi          = {10.1093/JAMIA/OCX064},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jamia/NelsonOUBZHYMMT17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/TunnecliffWGKM17,
  author       = {Jacqueline Tunnecliff and
                  John Weiner and
                  James E. Gaida and
                  Jennifer L. Keating and
                  Prue Morgan and
                  Dragan Ilic and
                  Lyn Clearihan and
                  David Davies and
                  Sivalal Sadasivan and
                  Patitapaban Mohanty and
                  Shankar Ganesh and
                  John Reynolds and
                  Stephen Maloney},
  title        = {Translating evidence to practice in the health professions: a randomized
                  trial of Twitter vs Facebook},
  journal      = {J. Am. Medical Informatics Assoc.},
  volume       = {24},
  number       = {2},
  pages        = {403--408},
  year         = {2017},
  url          = {https://doi.org/10.1093/jamia/ocw085},
  doi          = {10.1093/JAMIA/OCW085},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jamia/TunnecliffWGKM17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/WongBKGTW17,
  author       = {David Wong and
                  Timothy Bonnici and
                  Julia Knight and
                  Stephen Gerry and
                  James Turton and
                  Peter J. Watkinson},
  title        = {A ward-based time study of paper and electronic documentation for
                  recording vital sign observations},
  journal      = {J. Am. Medical Informatics Assoc.},
  volume       = {24},
  number       = {4},
  pages        = {717--721},
  year         = {2017},
  url          = {https://doi.org/10.1093/jamia/ocw186},
  doi          = {10.1093/JAMIA/OCW186},
  timestamp    = {Mon, 26 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jamia/WongBKGTW17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/ManiCOOMBUB17,
  author       = {Subramani Mani and
                  Daniel Cannon and
                  Robin Ohls and
                  Tudor I. Oprea and
                  Stephen L. Mathias and
                  Karri Ballard and
                  Oleg Ursu and
                  Cristian Bologa},
  title        = {Protein biomarker druggability profiling},
  journal      = {J. Biomed. Informatics},
  volume       = {66},
  pages        = {241--247},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.jbi.2017.01.014},
  doi          = {10.1016/J.JBI.2017.01.014},
  timestamp    = {Tue, 16 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jbi/ManiCOOMBUB17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/LonesACDJNTS17,
  author       = {Michael A. Lones and
                  Jane E. Alty and
                  Jeremy Cosgrove and
                  Philippa Duggan{-}Carter and
                  Stuart Jamieson and
                  Rebecca F. Naylor and
                  Andrew James Turner and
                  Stephen L. Smith},
  title        = {A New Evolutionary Algorithm-Based Home Monitoring Device for Parkinson's
                  Dyskinesia},
  journal      = {J. Medical Syst.},
  volume       = {41},
  number       = {11},
  pages        = {176:1--176:8},
  year         = {2017},
  url          = {https://doi.org/10.1007/s10916-017-0811-7},
  doi          = {10.1007/S10916-017-0811-7},
  timestamp    = {Tue, 12 Jul 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jms/LonesACDJNTS17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/NguyenMBBFGHHJK17,
  author       = {Dac{-}Trung Nguyen and
                  Stephen L. Mathias and
                  Cristian Bologa and
                  S{\o}ren Brunak and
                  Nicolas F. Fernandez and
                  Anna Gaulton and
                  Anne Hersey and
                  Jayme Holmes and
                  Lars Juhl Jensen and
                  Anneli Karlsson and
                  Guixia Liu and
                  Avi Ma'ayan and
                  Geetha Mandava and
                  Subramani Mani and
                  Saurabh Mehta and
                  John P. Overington and
                  Juhee Patel and
                  Andrew D. Rouillard and
                  Stephan C. Sch{\"{u}}rer and
                  Timothy Sheils and
                  Anton Simeonov and
                  Larry A. Sklar and
                  Noel Southall and
                  Oleg Ursu and
                  Dusica Vidovic and
                  Anna Waller and
                  Jeremy J. Yang and
                  Ajit Jadhav and
                  Tudor I. Oprea and
                  Rajarshi Guha},
  title        = {Pharos: Collating protein information to shed light on the druggable
                  genome},
  journal      = {Nucleic Acids Res.},
  volume       = {45},
  number       = {Database-Issue},
  pages        = {D995--D1002},
  year         = {2017},
  url          = {https://doi.org/10.1093/nar/gkw1072},
  doi          = {10.1093/NAR/GKW1072},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/NguyenMBBFGHHJK17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/UrsuHKBYMNO17,
  author       = {Oleg Ursu and
                  Jayme Holmes and
                  Jeffrey Knockel and
                  Cristian Bologa and
                  Jeremy J. Yang and
                  Stephen L. Mathias and
                  Stuart J. Nelson and
                  Tudor I. Oprea},
  title        = {DrugCentral: online drug compendium},
  journal      = {Nucleic Acids Res.},
  volume       = {45},
  number       = {Database-Issue},
  pages        = {D932--D939},
  year         = {2017},
  url          = {https://doi.org/10.1093/nar/gkw993},
  doi          = {10.1093/NAR/GKW993},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/UrsuHKBYMNO17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/LiKTDDCHZSSLGBM17,
  author       = {Xin Li and
                  Yungil Kim and
                  Emily K. Tsang and
                  Joe R. Davis and
                  Farhan N. Damani and
                  Colby Chiang and
                  Gaelen T. Hess and
                  Zachary Zappala and
                  Benjamin J. Strober and
                  Alexandra J. Scott and
                  Amy Li and
                  Andrea Ganna and
                  Michael C. Bassik and
                  Jason D. Merker and
                  Fran{\c{c}}ois Aguet and
                  Kristin G. Ardlie and
                  Beryl B. Cummings and
                  Ellen T. Gelfand and
                  Gad Getz and
                  Kane Hadley and
                  Robert E. Handsaker and
                  Katherine H. Huang and
                  Seva Kashin and
                  Konrad J. Karczewski and
                  Monkol Lek and
                  Xiao Li and
                  Daniel G. MacArthur and
                  Jared L. Nedzel and
                  Duyen T. Nguyen and
                  Michael S. Noble and
                  Ayellet V. Segr{\`{e}} and
                  Casandra A. Trowbridge and
                  Taru Tukiainen and
                  Nathan S. Abell and
                  Brunilda Balliu and
                  Ruth Barshir and
                  Omer Basha and
                  Alexis J. Battle and
                  Gireesh K. Bogu and
                  Andrew Brown and
                  Christopher D. Brown and
                  Stephane E. Castel and
                  Lin S. Chen and
                  Donald F. Conrad and
                  Nancy J. Cox and
                  Olivier Delaneau and
                  Emmanouil T. Dermitzakis and
                  Barbara E. Engelhardt and
                  Eleazar Eskin and
                  Pedro G. Ferreira and
                  Laure Fr{\'{e}}sard and
                  Eric R. Gamazon and
                  Diego Garrido{-}Mart{\'{\i}}n and
                  Ariel D. H. Gewirtz and
                  Genna Gliner and
                  Michael J. Gloudemans and
                  Roderic Guig{\'{o}} and
                  Ira M. Hall and
                  Buhm Han and
                  Yuan He and
                  Farhad Hormozdiari and
                  Cedric Howald and
                  Hae Kyung Im and
                  Brian Jo and
                  Eun Yong Kang and
                  Sarah Kim{-}Hellmuth and
                  Tuuli Lappalainen and
                  Gen Li and
                  Boxiang Liu and
                  Serghei Mangul and
                  Mark I. McCarthy and
                  Ian C. McDowell and
                  Pejman Mohammadi and
                  Jean Monlong and
                  Stephen B. Montgomery},
  title        = {The impact of rare variation on gene expression across tissues},
  journal      = {Nat.},
  volume       = {550},
  number       = {7675},
  pages        = {239--243},
  year         = {2017},
  url          = {https://doi.org/10.1038/nature24267},
  doi          = {10.1038/NATURE24267},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nature/LiKTDDCHZSSLGBM17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/AineBBCCGHHJLLM17,
  author       = {C. J. Aine and
                  Henry Jeremy Bockholt and
                  Juan R. Bustillo and
                  Jos{\'{e}} M. Ca{\~{n}}ive and
                  Arvind Caprihan and
                  Charles Gasparovic and
                  Faith M. Hanlon and
                  Jon M. Houck and
                  Rex E. Jung and
                  John Lauriello and
                  Jingyu Liu and
                  Andy R. Mayer and
                  Nora I. Perrone{-}Bizzozero and
                  Stefan Posse and
                  Julia M. Stephen and
                  Jessica A. Turner and
                  Vincent P. Clark and
                  Vince D. Calhoun},
  title        = {Multimodal Neuroimaging in Schizophrenia: Description and Dissemination},
  journal      = {Neuroinformatics},
  volume       = {15},
  number       = {4},
  pages        = {343--364},
  year         = {2017},
  url          = {https://doi.org/10.1007/s12021-017-9338-9},
  doi          = {10.1007/S12021-017-9338-9},
  timestamp    = {Wed, 07 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ni/AineBBCCGHHJLLM17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/softx/TudiscoACH17,
  author       = {Erika Tudisco and
                  Edward And{\`{o}} and
                  R{\'{e}}mi Cailletaud and
                  Stephen A. Hall},
  title        = {TomoWarp2: {A} local digital volume correlation code},
  journal      = {SoftwareX},
  volume       = {6},
  pages        = {267--270},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.softx.2017.10.002},
  doi          = {10.1016/J.SOFTX.2017.10.002},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/softx/TudiscoACH17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/FuXLZWLFBA17,
  author       = {Huazhu Fu and
                  Yanwu Xu and
                  Stephen Lin and
                  Xiaoqin Zhang and
                  Damon Wing Kee Wong and
                  Jiang Liu and
                  Alejandro F. Frangi and
                  Mani Baskaran and
                  Tin Aung},
  title        = {Segmentation and Quantification for Angle-Closure Glaucoma Assessment
                  in Anterior Segment {OCT}},
  journal      = {{IEEE} Trans. Medical Imaging},
  volume       = {36},
  number       = {9},
  pages        = {1930--1938},
  year         = {2017},
  url          = {https://doi.org/10.1109/TMI.2017.2703147},
  doi          = {10.1109/TMI.2017.2703147},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tmi/FuXLZWLFBA17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/LiCT17,
  author       = {Xiaosong Li and
                  Wentong Cai and
                  Stephen John Turner},
  title        = {Cloning Agent-Based Simulation},
  journal      = {{ACM} Trans. Model. Comput. Simul.},
  volume       = {27},
  number       = {2},
  pages        = {15},
  year         = {2017},
  url          = {https://doi.org/10.1145/3013529},
  doi          = {10.1145/3013529},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tomacs/LiCT17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/MalmasiHCBST17,
  author       = {Shervin Malmasi and
                  Naoshi Hosomura and
                  Lee{-}Shing Chang and
                  C. J. Brown and
                  Stephen Skentzos and
                  Alexander Turchin},
  title        = {Extracting Healthcare Quality Information from Unstructured Data},
  booktitle    = {{AMIA} 2017, American Medical Informatics Association Annual Symposium,
                  Washington, DC, USA, November 4-8, 2017},
  publisher    = {{AMIA}},
  year         = {2017},
  url          = {https://knowledge.amia.org/65881-amiab-1.4254737/t003-1.4258387/f003-1.4258388/2732186-1.4258608/2732196-1.4258605},
  timestamp    = {Wed, 17 Apr 2024 11:47:24 +0200},
  biburl       = {https://dblp.org/rec/conf/amia/MalmasiHCBST17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/MalmasiSHGST17,
  author       = {Shervin Malmasi and
                  Nicolae L. Sandor and
                  Naoshi Hosomura and
                  Matt Goldberg and
                  Stephen Skentzos and
                  Alexander Turchin},
  title        = {Canary: An Information Extraction Platform for Clinical Researchers},
  booktitle    = {{AMIA} 2017, American Medical Informatics Association Annual Symposium,
                  Washington, DC, USA, November 4-8, 2017},
  publisher    = {{AMIA}},
  year         = {2017},
  url          = {https://knowledge.amia.org/65881-amiab-1.4254737/t006-1.4257302/f006-1.4257303/2728680-1.4257334/2730400-1.4257331},
  timestamp    = {Wed, 17 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/amia/MalmasiSHGST17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/CounsellST17,
  author       = {Steve Counsell and
                  Stephen Swift and
                  Allan Tucker},
  editor       = {Panagiotis D. Bamidis and
                  Stathis Th. Konstantinidis and
                  Pedro Pereira Rodrigues},
  title        = {A Deconstructed Replication of a Time of Test Study Using the {AGIS}
                  Metric},
  booktitle    = {30th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2017, Thessaloniki, Greece, June 22-24, 2017},
  pages        = {103--104},
  publisher    = {{IEEE} Computer Society},
  year         = {2017},
  url          = {https://doi.org/10.1109/CBMS.2017.60},
  doi          = {10.1109/CBMS.2017.60},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/CounsellST17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eScience/SimpsonWHSDTH017,
  author       = {Mike Simpson and
                  Simon Woodman and
                  Hugo Hiden and
                  Sebastian Stein and
                  Stephen Dowsland and
                  Mark Turner and
                  Vicki L. Hanson and
                  Paul Watson},
  title        = {A Platform for the Analysis of Qualitative and Quantitative Data about
                  the Built Environment and Its Users},
  booktitle    = {13th {IEEE} International Conference on e-Science, e-Science 2017,
                  Auckland, New Zealand, October 24-27, 2017},
  pages        = {228--237},
  publisher    = {{IEEE} Computer Society},
  year         = {2017},
  url          = {https://doi.org/10.1109/eScience.2017.36},
  doi          = {10.1109/ESCIENCE.2017.36},
  timestamp    = {Tue, 15 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/eScience/SimpsonWHSDTH017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ei-sda/Holliman0DCP17,
  author       = {Nicolas S. Holliman and
                  Mark Turner and
                  Stephen Dowsland and
                  Richard Cloete and
                  Thomas Picton},
  editor       = {Andrew J. Woods and
                  Gregg E. Favalora and
                  Nicolas S. Holliman and
                  Takashi Kawai},
  title        = {Designing a Cloud-based 3D Visualization Engine for Smart Cities},
  booktitle    = {Stereoscopic Displays and Applications XXVIII, Burlingame, CA, USA,
                  January 29 - February 2, 2017},
  pages        = {173--178},
  publisher    = {Society for Imaging Science and Technology},
  year         = {2017},
  url          = {https://doi.org/10.2352/ISSN.2470-1173.2017.5.SDA-105},
  doi          = {10.2352/ISSN.2470-1173.2017.5.SDA-105},
  timestamp    = {Wed, 26 Jul 2023 17:17:16 +0200},
  biburl       = {https://dblp.org/rec/conf/ei-sda/Holliman0DCP17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/TuVWGJR17,
  author       = {Stephen Tu and
                  Shivaram Venkataraman and
                  Ashia C. Wilson and
                  Alex Gittens and
                  Michael I. Jordan and
                  Benjamin Recht},
  editor       = {Doina Precup and
                  Yee Whye Teh},
  title        = {Breaking Locality Accelerates Block Gauss-Seidel},
  booktitle    = {Proceedings of the 34th International Conference on Machine Learning,
                  {ICML} 2017, Sydney, NSW, Australia, 6-11 August 2017},
  series       = {Proceedings of Machine Learning Research},
  volume       = {70},
  pages        = {3482--3491},
  publisher    = {{PMLR}},
  year         = {2017},
  url          = {http://proceedings.mlr.press/v70/tu17a.html},
  timestamp    = {Wed, 29 May 2019 08:41:45 +0200},
  biburl       = {https://dblp.org/rec/conf/icml/TuVWGJR17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/MannucciLDYFMEA17,
  author       = {Anthony J. Mannucci and
                  Stephen T. Lowe and
                  Jeffrey Dickson and
                  Larry E. Young and
                  Garth W. Franklin and
                  Thomas K. Meehan and
                  Stephan Esterhuizen and
                  Chi O. Ao and
                  Panagiotis Vergados and
                  Clara C. Chew and
                  Son V. Kim and
                  Son V. Nghiem and
                  F. Joseph Turk and
                  Cinzia Zuffada and
                  Rashmi Shah and
                  Attila Komjathy},
  title        = {High-value remote sensing for the geosciences: Opportunistic use of
                  navigation satellite signals},
  booktitle    = {2017 {IEEE} International Geoscience and Remote Sensing Symposium,
                  {IGARSS} 2017, Fort Worth, TX, USA, July 23-28, 2017},
  pages        = {2686--2689},
  publisher    = {{IEEE}},
  year         = {2017},
  url          = {https://doi.org/10.1109/IGARSS.2017.8127549},
  doi          = {10.1109/IGARSS.2017.8127549},
  timestamp    = {Wed, 16 Oct 2019 14:14:53 +0200},
  biburl       = {https://dblp.org/rec/conf/igarss/MannucciLDYFMEA17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medinfo/GraySTWMTTGSHNM17,
  author       = {Kathleen Gray and
                  Remya Stephen and
                  Bronwyn Terrill and
                  Brenda Wilson and
                  Anna Middleton and
                  Rigan Tytherleigh and
                  Erin Turbitt and
                  Clara Gaff and
                  Jacqueline Savard and
                  Chriselle Hickerton and
                  Ainsley J. Newson and
                  Sylvia Metcalfe},
  editor       = {Adi V. Gundlapalli and
                  Marie{-}Christine Jaulent and
                  Dongsheng Zhao},
  title        = {Consumer Health Informatics Aspects of Direct-to-Consumer Personal
                  Genomic Testing},
  booktitle    = {{MEDINFO} 2017: Precision Healthcare through Informatics - Proceedings
                  of the 16th World Congress on Medical and Health Informatics, Hangzhou,
                  China, 21-25 August 2017},
  series       = {Studies in Health Technology and Informatics},
  volume       = {245},
  pages        = {89--93},
  publisher    = {{IOS} Press},
  year         = {2017},
  url          = {https://doi.org/10.3233/978-1-61499-830-3-89},
  doi          = {10.3233/978-1-61499-830-3-89},
  timestamp    = {Fri, 26 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/medinfo/GraySTWMTTGSHNM17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LiCLLGC17,
  author       = {Dongsheng Li and
                  Chao Chen and
                  Wei Liu and
                  Tun Lu and
                  Ning Gu and
                  Stephen M. Chu},
  editor       = {Isabelle Guyon and
                  Ulrike von Luxburg and
                  Samy Bengio and
                  Hanna M. Wallach and
                  Rob Fergus and
                  S. V. N. Vishwanathan and
                  Roman Garnett},
  title        = {Mixture-Rank Matrix Approximation for Collaborative Filtering},
  booktitle    = {Advances in Neural Information Processing Systems 30: Annual Conference
                  on Neural Information Processing Systems 2017, December 4-9, 2017,
                  Long Beach, CA, {USA}},
  pages        = {477--485},
  year         = {2017},
  url          = {https://proceedings.neurips.cc/paper/2017/hash/3dd48ab31d016ffcbf3314df2b3cb9ce-Abstract.html},
  timestamp    = {Thu, 21 Jan 2021 13:58:27 +0100},
  biburl       = {https://dblp.org/rec/conf/nips/LiCLLGC17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2017,
  editor       = {Tudor Jebelean and
                  Viorel Negru and
                  Dana Petcu and
                  Daniela Zaharie and
                  Tetsuo Ida and
                  Stephen M. Watt},
  title        = {19th International Symposium on Symbolic and Numeric Algorithms for
                  Scientific Computing, {SYNASC} 2017, Timisoara, Romania, September
                  21-24, 2017},
  publisher    = {{IEEE} Computer Society},
  year         = {2017},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8528958/proceeding},
  isbn         = {978-1-5386-2626-9},
  timestamp    = {Wed, 16 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/synasc/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/EldalyAPKCD017,
  author       = {Ahmed Karam Eldaly and
                  Yoann Altmann and
                  Antonios Perperidis and
                  Nikola Krstajic and
                  Tushar Choudhary and
                  Kevin Dhaliwal and
                  Stephen McLaughlin},
  title        = {Deconvolution and Restoration of Optical Endomicroscopy Images},
  journal      = {CoRR},
  volume       = {abs/1701.08107},
  year         = {2017},
  url          = {http://arxiv.org/abs/1701.08107},
  eprinttype    = {arXiv},
  eprint       = {1701.08107},
  timestamp    = {Fri, 25 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/EldalyAPKCD017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/MakoninWT17,
  author       = {Stephen Makonin and
                  Z. Jane Wang and
                  Chris Tumpach},
  title        = {{RAE:} The Rainforest Automation Energy Dataset for Smart Grid Meter
                  Data Analysis},
  journal      = {CoRR},
  volume       = {abs/1705.05767},
  year         = {2017},
  url          = {http://arxiv.org/abs/1705.05767},
  eprinttype    = {arXiv},
  eprint       = {1705.05767},
  timestamp    = {Wed, 27 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/MakoninWT17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/TuBPR17,
  author       = {Stephen Tu and
                  Ross Boczar and
                  Andrew K. Packard and
                  Benjamin Recht},
  title        = {Non-Asymptotic Analysis of Robust Control from Coarse-Grained Identification},
  journal      = {CoRR},
  volume       = {abs/1707.04791},
  year         = {2017},
  url          = {http://arxiv.org/abs/1707.04791},
  eprinttype    = {arXiv},
  eprint       = {1707.04791},
  timestamp    = {Fri, 30 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/TuBPR17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1709-10203,
  author       = {Stephen Tu and
                  Ross Boczar and
                  Benjamin Recht},
  title        = {On the Approximation of Toeplitz Operators for Nonparametric {\textdollar}{\textbackslash}mathcal\{H\}{\_}{\textbackslash}infty{\textdollar}-norm
                  Estimation},
  journal      = {CoRR},
  volume       = {abs/1709.10203},
  year         = {2017},
  url          = {http://arxiv.org/abs/1709.10203},
  eprinttype    = {arXiv},
  eprint       = {1709.10203},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1709-10203.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1710-01688,
  author       = {Sarah Dean and
                  Horia Mania and
                  Nikolai Matni and
                  Benjamin Recht and
                  Stephen Tu},
  title        = {On the Sample Complexity of the Linear Quadratic Regulator},
  journal      = {CoRR},
  volume       = {abs/1710.01688},
  year         = {2017},
  url          = {http://arxiv.org/abs/1710.01688},
  eprinttype    = {arXiv},
  eprint       = {1710.01688},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1710-01688.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1712-08642,
  author       = {Stephen Tu and
                  Benjamin Recht},
  title        = {Least-Squares Temporal Difference Learning for the Linear Quadratic
                  Regulator},
  journal      = {CoRR},
  volume       = {abs/1712.08642},
  year         = {2017},
  url          = {http://arxiv.org/abs/1712.08642},
  eprinttype    = {arXiv},
  eprint       = {1712.08642},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1712-08642.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc8209,
  author       = {Mark C. Reynolds and
                  Sean Turner and
                  Stephen T. Kent},
  title        = {A Profile for BGPsec Router Certificates, Certificate Revocation Lists,
                  and Certification Requests},
  journal      = {{RFC}},
  volume       = {8209},
  pages        = {1--15},
  year         = {2017},
  url          = {https://doi.org/10.17487/RFC8209},
  doi          = {10.17487/RFC8209},
  timestamp    = {Thu, 15 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/rfc/rfc8209.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/SuzukiKTTTQIYYT16,
  author       = {Yuta Suzuki and
                  Jonas Korlach and
                  Stephen W. Turner and
                  Tatsuya Tsukahara and
                  Junko Taniguchi and
                  Wei Qu and
                  Kazuki Ichikawa and
                  Jun Yoshimura and
                  Hideaki Yurino and
                  Yuji Takahashi and
                  Jun Mitsui and
                  Hiroyuki Ishiura and
                  Shoji Tsuji and
                  Hiroyuki Takeda and
                  Shinichi Morishita},
  title        = {AgIn: measuring the landscape of CpG methylation of individual repetitive
                  elements},
  journal      = {Bioinform.},
  volume       = {32},
  number       = {19},
  pages        = {2911--2919},
  year         = {2016},
  url          = {https://doi.org/10.1093/bioinformatics/btw360},
  doi          = {10.1093/BIOINFORMATICS/BTW360},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/bioinformatics/SuzukiKTTTQIYYT16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biomedsem/CheungKRSRSAGGA16,
  author       = {Kei{-}Hoi Cheung and
                  Shivakumar Keerthikumar and
                  Paola Roncaglia and
                  Sai Lakshmi Subramanian and
                  Matthew E. Roth and
                  Monisha Samuel and
                  Sushma Anand and
                  Lahiru Gangoda and
                  Stephen Gould and
                  Roger Alexander and
                  David Galas and
                  Mark B. Gerstein and
                  Andrew F. Hill and
                  Robert R. Kitchen and
                  Jan L{\"{o}}tvall and
                  Tushar Patel},
  title        = {Extending gene ontology in the context of extracellular {RNA} and
                  vesicle communication},
  journal      = {J. Biomed. Semant.},
  volume       = {7},
  pages        = {19},
  year         = {2016},
  url          = {https://doi.org/10.1186/s13326-016-0061-5},
  doi          = {10.1186/S13326-016-0061-5},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/biomedsem/CheungKRSRSAGGA16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biosystems/TurnerLTSJACT16,
  author       = {Alexander P. Turner and
                  Michael A. Lones and
                  Martin A. Trefzer and
                  Stephen L. Smith and
                  Stuart Jamieson and
                  Jane E. Alty and
                  Jeremy Cosgrove and
                  Andy M. Tyrrell},
  title        = {Using epigenetic networks for the analysis of movement associated
                  with levodopa therapy for Parkinson's disease},
  journal      = {Biosyst.},
  volume       = {146},
  pages        = {35--42},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.biosystems.2016.05.005},
  doi          = {10.1016/J.BIOSYSTEMS.2016.05.005},
  timestamp    = {Thu, 23 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/biosystems/TurnerLTSJACT16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cais/PetersMBHMSTVWD16,
  author       = {Christoph Peters and
                  Paul P. Maglio and
                  Ralph Badinelli and
                  Robert R. Harmon and
                  Roger S. Maull and
                  James C. Spohrer and
                  Tuure Tuunanen and
                  Stephen L. Vargo and
                  Jeffrey J. Welser and
                  Haluk Demirkan and
                  Terri L. Griffith and
                  Yassi Moghaddam},
  title        = {Emerging Digital Frontiers for Service Innovation},
  journal      = {Commun. Assoc. Inf. Syst.},
  volume       = {39},
  pages        = {8},
  year         = {2016},
  url          = {https://doi.org/10.17705/1cais.03908},
  doi          = {10.17705/1CAIS.03908},
  timestamp    = {Tue, 16 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cais/PetersMBHMSTVWD16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cce/PaulBTZ16,
  author       = {Prokash Paul and
                  Debangsu Bhattacharyya and
                  Richard Turton and
                  Stephen E. Zitney},
  title        = {Dynamic model-based sensor network design algorithm for system efficiency
                  maximization},
  journal      = {Comput. Chem. Eng.},
  volume       = {89},
  pages        = {27--40},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.compchemeng.2016.01.018},
  doi          = {10.1016/J.COMPCHEMENG.2016.01.018},
  timestamp    = {Mon, 18 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cce/PaulBTZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chb/WattsMTBSWBAMJ16,
  author       = {Christina M. Watts and
                  Patricia S. Moyer{-}Packenham and
                  Stephen I. Tucker and
                  Emma P. Bullock and
                  Jessica F. Shumway and
                  Arla Westenskow and
                  Jennifer Boyer{-}Thurgood and
                  Katie Anderson{-}Pence and
                  Salif Mahamane and
                  Kerry Jordan},
  title        = {An examination of children's learning progression shifts while using
                  touch screen virtual manipulative mathematics apps},
  journal      = {Comput. Hum. Behav.},
  volume       = {64},
  pages        = {814--828},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.chb.2016.07.029},
  doi          = {10.1016/J.CHB.2016.07.029},
  timestamp    = {Tue, 18 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/chb/WattsMTBSWBAMJ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/compsec/FlowerdayT16,
  author       = {Stephen V. Flowerday and
                  Tite Tuyikeze},
  title        = {Information security policy development and implementation: The what,
                  how and who},
  journal      = {Comput. Secur.},
  volume       = {61},
  pages        = {169--183},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.cose.2016.06.002},
  doi          = {10.1016/J.COSE.2016.06.002},
  timestamp    = {Mon, 28 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/compsec/FlowerdayT16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/concurrency/LiCT16,
  author       = {Xiaosong Li and
                  Wentong Cai and
                  Stephen John Turner},
  title        = {Supporting efficient execution of continuous space agent-based simulation
                  on {GPU}},
  journal      = {Concurr. Comput. Pract. Exp.},
  volume       = {28},
  number       = {12},
  pages        = {3313--3332},
  year         = {2016},
  url          = {https://doi.org/10.1002/cpe.3808},
  doi          = {10.1002/CPE.3808},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/concurrency/LiCT16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cviu/TuVEPPDWSP16,
  author       = {Liyun Tu and
                  Jared Vicory and
                  Shireen Y. Elhabian and
                  Beatriz Paniagua and
                  Juan{-}Carlos Prieto and
                  James N. Damon and
                  Ross T. Whitaker and
                  Martin Styner and
                  Stephen M. Pizer},
  title        = {Entropy-based correspondence improvement of interpolated skeletal
                  models},
  journal      = {Comput. Vis. Image Underst.},
  volume       = {151},
  pages        = {72--79},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.cviu.2015.11.002},
  doi          = {10.1016/J.CVIU.2015.11.002},
  timestamp    = {Thu, 06 Jun 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cviu/TuVEPPDWSP16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/BoothQCSCKLMST16,
  author       = {Eric G. Booth and
                  Jiangxiao Qiu and
                  Stephen R. Carpenter and
                  Jason Schatz and
                  Xi Chen and
                  Christopher J. Kucharik and
                  Steven P. Loheide II and
                  Melissa M. Motew and
                  Jenny M. Seifert and
                  Monica G. Turner},
  title        = {From qualitative to quantitative environmental scenarios: Translating
                  storylines into biophysical modeling inputs at the watershed scale},
  journal      = {Environ. Model. Softw.},
  volume       = {85},
  pages        = {80--97},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.envsoft.2016.08.008},
  doi          = {10.1016/J.ENVSOFT.2016.08.008},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/envsoft/BoothQCSCKLMST16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/FrancoHSNT16,
  author       = {Chiara Franco and
                  Leanne Appleby Hepburn and
                  David J. Smith and
                  Stephen Nimrod and
                  Allan Tucker},
  title        = {A Bayesian Belief Network to assess rate of changes in coral reef
                  ecosystems},
  journal      = {Environ. Model. Softw.},
  volume       = {80},
  pages        = {132--142},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.envsoft.2016.02.029},
  doi          = {10.1016/J.ENVSOFT.2016.02.029},
  timestamp    = {Wed, 19 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/envsoft/FrancoHSNT16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/ShakeriLTL16,
  author       = {Mojtaba Shakeri and
                  Malcolm Yoke Hean Low and
                  Stephen John Turner and
                  Eng Wah Lee},
  title        = {An efficient incremental evaluation function for optimizing truck
                  scheduling in a resource-constrained crossdock using metaheuristics},
  journal      = {Expert Syst. Appl.},
  volume       = {45},
  pages        = {172--184},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.eswa.2015.09.041},
  doi          = {10.1016/J.ESWA.2015.09.041},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/ShakeriLTL16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamsc/TuminaroPTSP16,
  author       = {Ray S. Tuminaro and
                  Mauro Perego and
                  Irina K. Tezaur and
                  Andrew G. Salinger and
                  Stephen F. Price},
  title        = {A Matrix Dependent/Algebraic Multigrid Approach for Extruded Meshes
                  with Applications to Ice Sheet Modeling},
  journal      = {{SIAM} J. Sci. Comput.},
  volume       = {38},
  number       = {5},
  year         = {2016},
  url          = {https://doi.org/10.1137/15M1040839},
  doi          = {10.1137/15M1040839},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/siamsc/TuminaroPTSP16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simpra/LiCTQG16,
  author       = {Zengxiang Li and
                  Wentong Cai and
                  Stephen John Turner and
                  Zheng Qin and
                  Rick Siow Mong Goh},
  title        = {Transparent three-phase Byzantine fault tolerance for parallel and
                  distributed simulations},
  journal      = {Simul. Model. Pract. Theory},
  volume       = {60},
  pages        = {90--107},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.simpat.2015.09.012},
  doi          = {10.1016/J.SIMPAT.2015.09.012},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/simpra/LiCTQG16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/synthese/OlenT16,
  author       = {Peter Olen and
                  Stephen P. Turner},
  title        = {Was Sellars an error theorist?},
  journal      = {Synth.},
  volume       = {193},
  number       = {7},
  pages        = {2053--2075},
  year         = {2016},
  url          = {https://doi.org/10.1007/s11229-015-0829-7},
  doi          = {10.1007/S11229-015-0829-7},
  timestamp    = {Thu, 09 Jul 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/synthese/OlenT16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/TullyC16,
  author       = {Stephen Tully and
                  Howie Choset},
  title        = {A Filtering Approach for Image-Guided Surgery With a Highly Articulated
                  Surgical Snake Robot},
  journal      = {{IEEE} Trans. Biomed. Eng.},
  volume       = {63},
  number       = {2},
  pages        = {392--402},
  year         = {2016},
  url          = {https://doi.org/10.1109/TBME.2015.2461531},
  doi          = {10.1109/TBME.2015.2461531},
  timestamp    = {Wed, 02 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tbe/TullyC16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkl/TuckerMWJ16,
  author       = {Stephen I. Tucker and
                  Patricia S. Moyer{-}Packenham and
                  Arla Westenskow and
                  Kerry Jordan},
  title        = {The Complexity of the Affordance-Ability Relationship When Second-Grade
                  Children Interact with Mathematics Virtual Manipulative Apps},
  journal      = {Technol. Knowl. Learn.},
  volume       = {21},
  number       = {3},
  pages        = {341--360},
  year         = {2016},
  url          = {https://doi.org/10.1007/s10758-016-9276-x},
  doi          = {10.1007/S10758-016-9276-X},
  timestamp    = {Tue, 10 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tkl/TuckerMWJ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ACMicec/TumibayLYS16,
  author       = {Gilbert M. Tumibay and
                  Fernand T. Layug and
                  Daisy S. Yap and
                  Mar Stephen M. Sembrano},
  editor       = {Toru Ishida and
                  Norman M. Sadeh and
                  Jae Kyu Lee and
                  Federico Casalegno and
                  Wooju Kim and
                  Sohyeong Kim and
                  Sung{-}Byung Yang},
  title        = {Increasing the value of farm products: connecting farmers and consumers
                  through an E-commerce system},
  booktitle    = {Proceedings of the 18th Annual International Conference on Electronic
                  Commerce - e-Commerce in Smart connected World, {ICEC} '16, Suwon,
                  Republic of Korea, August 17-19, 2016},
  pages        = {5:1--5:5},
  publisher    = {{ACM}},
  year         = {2016},
  url          = {https://doi.org/10.1145/2971603.2971608},
  doi          = {10.1145/2971603.2971608},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ACMicec/TumibayLYS16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/CounsellST16,
  author       = {Steve Counsell and
                  Stephen Swift and
                  Allan Tucker},
  title        = {The {AGIS} Metric and Time of Test: {A} Replication Study},
  booktitle    = {29th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2016, Belfast, {UK} and Dublin, Ireland, June 20-24, 2016},
  pages        = {269--270},
  publisher    = {{IEEE} Computer Society},
  year         = {2016},
  url          = {https://doi.org/10.1109/CBMS.2016.80},
  doi          = {10.1109/CBMS.2016.80},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/CounsellST16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/JilaniTS16,
  author       = {Mohd Zairul Mazwan Bin Jilani and
                  Allan Tucker and
                  Stephen Swift},
  title        = {Simultaneous Modelling and Clustering of Visual Field Data},
  booktitle    = {29th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2016, Belfast, {UK} and Dublin, Ireland, June 20-24, 2016},
  pages        = {213--218},
  publisher    = {{IEEE} Computer Society},
  year         = {2016},
  url          = {https://doi.org/10.1109/CBMS.2016.66},
  doi          = {10.1109/CBMS.2016.66},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/JilaniTS16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eScience/TueckeACLMRF16,
  author       = {Steven Tuecke and
                  Rachana Ananthakrishnan and
                  Kyle Chard and
                  Mattias Lidman and
                  Brendan McCollam and
                  Stephen Rosen and
                  Ian T. Foster},
  title        = {Globus auth: {A} research identity and access management platform},
  booktitle    = {12th {IEEE} International Conference on e-Science, e-Science 2016,
                  Baltimore, MD, USA, October 23-27, 2016},
  pages        = {203--212},
  publisher    = {{IEEE} Computer Society},
  year         = {2016},
  url          = {https://doi.org/10.1109/eScience.2016.7870901},
  doi          = {10.1109/ESCIENCE.2016.7870901},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/eScience/TueckeACLMRF16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/NapoliWGTO16,
  author       = {Alessandro Napoli and
                  Christian R. Ward and
                  Stephen M. Glassd and
                  Carole A. Tucker and
                  Iyad Obeid},
  title        = {Automated assessment of postural stability system},
  booktitle    = {38th Annual International Conference of the {IEEE} Engineering in
                  Medicine and Biology Society, {EMBC} 2016, Orlando, FL, USA, August
                  16-20, 2016},
  pages        = {6090--6093},
  publisher    = {{IEEE}},
  year         = {2016},
  url          = {https://doi.org/10.1109/EMBC.2016.7592118},
  doi          = {10.1109/EMBC.2016.7592118},
  timestamp    = {Fri, 26 Mar 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/embc/NapoliWGTO16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/MrugalaTH16,
  author       = {Kinga Mrugala and
                  Nilufer Tuptuk and
                  Stephen Hailes},
  editor       = {Tobias Friedrich and
                  Frank Neumann and
                  Andrew M. Sutton},
  title        = {Evolving Attackers against Wireless Sensor Networks},
  booktitle    = {Genetic and Evolutionary Computation Conference, {GECCO} 2016, Denver,
                  CO, USA, July 20-24, 2016, Companion Material Proceedings},
  pages        = {107--108},
  publisher    = {{ACM}},
  year         = {2016},
  url          = {https://doi.org/10.1145/2908961.2908974},
  doi          = {10.1145/2908961.2908974},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/gecco/MrugalaTH16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icbo/UtechtJBCORRAHB16,
  author       = {Joseph Utecht and
                  John Judkins and
                  Mathias Brochhausen and
                  Terra Colvin Jr. and
                  J. Neil Otte and
                  Nicholas Rogers and
                  Robert Rose and
                  Maria Alvi and
                  Amanda Hicks and
                  Jane Ball and
                  Stephen M. Bowman and
                  Robert T. Maxson and
                  Rosemary Nabaweesi and
                  Rohit Pradhan and
                  Nels D. Sanddal and
                  M. Eduard Tudoreanu and
                  Robert J. Winchell},
  editor       = {Pankaj Jaiswal and
                  Robert Hoehndorf and
                  Cecilia N. Arighi and
                  Austin Meier},
  title        = {{OOSTT:} a Resource for Analyzing the Organizational Structures of
                  Trauma Centers and Trauma Systems},
  booktitle    = {Proceedings of the Joint International Conference on Biological Ontology
                  and BioCreative, Corvallis, Oregon, United States, August 1-4, 2016},
  series       = {{CEUR} Workshop Proceedings},
  volume       = {1747},
  publisher    = {CEUR-WS.org},
  year         = {2016},
  url          = {https://ceur-ws.org/Vol-1747/IT504\_ICBO2016.pdf},
  timestamp    = {Fri, 10 Mar 2023 16:22:23 +0100},
  biburl       = {https://dblp.org/rec/conf/icbo/UtechtJBCORRAHB16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/TuBSSR16,
  author       = {Stephen Tu and
                  Ross Boczar and
                  Max Simchowitz and
                  Mahdi Soltanolkotabi and
                  Ben Recht},
  editor       = {Maria{-}Florina Balcan and
                  Kilian Q. Weinberger},
  title        = {Low-rank Solutions of Linear Matrix Equations via Procrustes Flow},
  booktitle    = {Proceedings of the 33nd International Conference on Machine Learning,
                  {ICML} 2016, New York City, NY, USA, June 19-24, 2016},
  series       = {{JMLR} Workshop and Conference Proceedings},
  volume       = {48},
  pages        = {964--973},
  publisher    = {JMLR.org},
  year         = {2016},
  url          = {http://proceedings.mlr.press/v48/tu16.html},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icml/TuBSSR16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/noms/TurnerU16,
  author       = {Stephen W. Turner and
                  Suleyman Uludag},
  editor       = {Sema Oktug and
                  Mehmet Ulema and
                  Cicek Cavdar and
                  Lisandro Zambenedetti Granville and
                  Carlos Raniery Paula dos Santos},
  title        = {Intelligent transportation as the key enabler of smart cities},
  booktitle    = {2016 {IEEE/IFIP} Network Operations and Management Symposium, {NOMS}
                  2016, Istanbul, Turkey, April 25-29, 2016},
  pages        = {1261--1264},
  publisher    = {{IEEE}},
  year         = {2016},
  url          = {https://doi.org/10.1109/NOMS.2016.7502999},
  doi          = {10.1109/NOMS.2016.7502999},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/noms/TurnerU16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/xpu/McCaldenTB16,
  author       = {Stephen McCalden and
                  Mark Tumilty and
                  David W. Bustard},
  editor       = {Helen Sharp and
                  Tracy Hall},
  title        = {Smoothing the Transition from Agile Software Development to Agile
                  Software Maintenance},
  booktitle    = {Agile Processes, in Software Engineering, and Extreme Programming
                  - 17th International Conference, {XP} 2016, Edinburgh, UK, May 24-27,
                  2016, Proceedings},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {251},
  pages        = {209--216},
  publisher    = {Springer},
  year         = {2016},
  url          = {https://doi.org/10.1007/978-3-319-33515-5\_18},
  doi          = {10.1007/978-3-319-33515-5\_18},
  timestamp    = {Tue, 26 Jun 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/xpu/McCaldenTB16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2016,
  editor       = {James H. Davenport and
                  Viorel Negru and
                  Tetsuo Ida and
                  Tudor Jebelean and
                  Dana Petcu and
                  Stephen M. Watt and
                  Daniela Zaharie},
  title        = {18th International Symposium on Symbolic and Numeric Algorithms for
                  Scientific Computing, {SYNASC} 2016, Timisoara, Romania, September
                  24-27, 2016},
  publisher    = {{IEEE}},
  year         = {2016},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7827704/proceeding},
  isbn         = {978-1-5090-5707-8},
  timestamp    = {Wed, 16 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/synasc/2016.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/PanLTPZJRRR16,
  author       = {Xinghao Pan and
                  Maximilian Lam and
                  Stephen Tu and
                  Dimitris S. Papailiopoulos and
                  Ce Zhang and
                  Michael I. Jordan and
                  Kannan Ramchandran and
                  Christopher R{\'{e}} and
                  Benjamin Recht},
  title        = {{CYCLADES:} Conflict-free Asynchronous Machine Learning},
  journal      = {CoRR},
  volume       = {abs/1605.09721},
  year         = {2016},
  url          = {http://arxiv.org/abs/1605.09721},
  eprinttype    = {arXiv},
  eprint       = {1605.09721},
  timestamp    = {Tue, 12 Jan 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/PanLTPZJRRR16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/TuRVR16,
  author       = {Stephen Tu and
                  Rebecca Roelofs and
                  Shivaram Venkataraman and
                  Benjamin Recht},
  title        = {Large Scale Kernel Learning using Block Coordinate Descent},
  journal      = {CoRR},
  volume       = {abs/1602.05310},
  year         = {2016},
  url          = {http://arxiv.org/abs/1602.05310},
  eprinttype    = {arXiv},
  eprint       = {1602.05310},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/TuRVR16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcsc/KusetogullariSL15,
  author       = {Huseyin Kusetogullari and
                  Md. Haidar Sharif and
                  Mark S. Leeson and
                  Turgay {\c{C}}elik},
  title        = {A Reduced Uncertainty-Based Hybrid Evolutionary Algorithm for Solving
                  Dynamic Shortest-Path Routing Problem},
  journal      = {J. Circuits Syst. Comput.},
  volume       = {24},
  number       = {5},
  pages        = {1550067:1--1550067:42},
  year         = {2015},
  url          = {https://doi.org/10.1142/S021812661550067X},
  doi          = {10.1142/S021812661550067X},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jcsc/KusetogullariSL15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocnet/ZhuPLMWPCTFWWE15,
  author       = {Jiannan Zhu and
                  Stephan Pachnicke and
                  Mirko Lawin and
                  Stephen Mayne and
                  Adrian Wonfor and
                  Richard V. Penty and
                  Rosie Cush and
                  Richard Turner and
                  Paul Firth and
                  Mike J. Wale and
                  Ian H. White and
                  J{\"{o}}rg{-}Peter Elbers},
  title        = {First Demonstration of a {WDM-PON} System Using Full C-band Tunable
                  {SFP+} Transceiver Modules [Invited]},
  journal      = {{JOCN}},
  volume       = {7},
  number       = {1},
  pages        = {A28--A36},
  year         = {2015},
  url          = {https://doi.org/10.1364/jocn.7.000a28},
  doi          = {10.1364/JOCN.7.000A28},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jocnet/ZhuPLMWPCTFWWE15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/WilsonFTGCYZ15,
  author       = {Carlene Wilson and
                  Ingrid H. K. Flight and
                  Deborah Turnbull and
                  Tess Gregory and
                  Stephen R. Cole and
                  Graeme P. Young and
                  Ian T. Zajac},
  title        = {A randomised controlled trial of personalised decision support delivered
                  via the internet for bowel cancer screening with a faecal occult blood
                  test: the effects of tailoring of messages according to social cognitive
                  variables on participation},
  journal      = {{BMC} Medical Informatics Decis. Mak.},
  volume       = {15},
  pages        = {25},
  year         = {2015},
  url          = {https://doi.org/10.1186/s12911-015-0147-5},
  doi          = {10.1186/S12911-015-0147-5},
  timestamp    = {Mon, 26 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/midm/WilsonFTGCYZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/ChiuYZMPNTR15,
  author       = {Tsu{-}Pei Chiu and
                  Lin Yang and
                  Tianyin Zhou and
                  Bradley J. Main and
                  Stephen C. J. Parker and
                  Sergey V. Nuzhdin and
                  Thomas D. Tullius and
                  Remo Rohs},
  title        = {GBshape: a genome browser database for {DNA} shape annotations},
  journal      = {Nucleic Acids Res.},
  volume       = {43},
  number       = {Database-Issue},
  pages        = {103--109},
  year         = {2015},
  url          = {https://doi.org/10.1093/nar/gku977},
  doi          = {10.1093/NAR/GKU977},
  timestamp    = {Sun, 17 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/ChiuYZMPNTR15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/EichnerCCMTSW15,
  author       = {Cornelius Eichner and
                  Stephen F. Cauley and
                  Julien Cohen{-}Adad and
                  Harald E. M{\"{o}}ller and
                  Robert Turner and
                  Kawin Setsompop and
                  Lawrence L. Wald},
  title        = {Real diffusion-weighted {MRI} enabling true signal averaging and increased
                  diffusion contrast},
  journal      = {NeuroImage},
  volume       = {122},
  pages        = {373--384},
  year         = {2015},
  url          = {https://doi.org/10.1016/j.neuroimage.2015.07.074},
  doi          = {10.1016/J.NEUROIMAGE.2015.07.074},
  timestamp    = {Wed, 19 May 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/neuroimage/EichnerCCMTSW15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spl/TuYVZPS15,
  author       = {Liyun Tu and
                  Dan Yang and
                  Jared Vicory and
                  Xiaohong Zhang and
                  Stephen M. Pizer and
                  Martin Andreas Styner},
  title        = {Fitting Skeletal Object Models Using Spherical Harmonics Based Template
                  Warping},
  journal      = {{IEEE} Signal Process. Lett.},
  volume       = {22},
  number       = {12},
  pages        = {2269--2273},
  year         = {2015},
  url          = {https://doi.org/10.1109/LSP.2015.2476366},
  doi          = {10.1109/LSP.2015.2476366},
  timestamp    = {Sat, 30 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/spl/TuYVZPS15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/te/ScottCLSTSG15,
  author       = {Michael James Scott and
                  Steve Counsell and
                  Stanislao Lauria and
                  Stephen Swift and
                  Allan Tucker and
                  Martin J. Shepperd and
                  Gheorghita Ghinea},
  title        = {Enhancing Practice and Achievement in Introductory Programming With
                  a Robot Olympics},
  journal      = {{IEEE} Trans. Educ.},
  volume       = {58},
  number       = {4},
  pages        = {249--254},
  year         = {2015},
  url          = {https://doi.org/10.1109/TE.2014.2382567},
  doi          = {10.1109/TE.2014.2382567},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/te/ScottCLSTSG15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/MenzeJBKFKBPSWL15,
  author       = {Bjoern H. Menze and
                  Andr{\'{a}}s Jakab and
                  Stefan Bauer and
                  Jayashree Kalpathy{-}Cramer and
                  Keyvan Farahani and
                  Justin S. Kirby and
                  Yuliya Burren and
                  Nicole Porz and
                  Johannes Slotboom and
                  Roland Wiest and
                  Levente Lanczi and
                  Elizabeth R. Gerstner and
                  Marc{-}Andr{\'{e}} Weber and
                  Tal Arbel and
                  Brian B. Avants and
                  Nicholas Ayache and
                  Patricia Buendia and
                  D. Louis Collins and
                  Nicolas Cordier and
                  Jason J. Corso and
                  Antonio Criminisi and
                  Tilak Das and
                  Herve Delingette and
                  {\c{C}}agatay Demiralp and
                  Christopher R. Durst and
                  Michel Dojat and
                  Senan Doyle and
                  Joana Festa and
                  Florence Forbes and
                  Ezequiel Geremia and
                  Ben Glocker and
                  Polina Golland and
                  Xiaotao Guo and
                  Andac Hamamci and
                  Khan M. Iftekharuddin and
                  Raj Jena and
                  Nigel M. John and
                  Ender Konukoglu and
                  Danial Lashkari and
                  Jos{\'{e}} Antonio Mariz and
                  Raphael Meier and
                  S{\'{e}}rgio Pereira and
                  Doina Precup and
                  Stephen J. Price and
                  Tammy Riklin Raviv and
                  Syed M. S. Reza and
                  Michael T. Ryan and
                  Duygu Sarikaya and
                  Lawrence H. Schwartz and
                  Hoo{-}Chang Shin and
                  Jamie Shotton and
                  Carlos A. Silva and
                  Nuno J. Sousa and
                  Nagesh K. Subbanna and
                  G{\'{a}}bor Sz{\'{e}}kely and
                  Thomas J. Taylor and
                  Owen M. Thomas and
                  Nicholas J. Tustison and
                  G{\"{o}}zde B. {\"{U}}nal and
                  Flor Vasseur and
                  Max Wintermark and
                  Dong Hye Ye and
                  Liang Zhao and
                  Binsheng Zhao and
                  Darko Zikic and
                  Marcel Prastawa and
                  Mauricio Reyes and
                  Koen Van Leemput},
  title        = {The Multimodal Brain Tumor Image Segmentation Benchmark {(BRATS)}},
  journal      = {{IEEE} Trans. Medical Imaging},
  volume       = {34},
  number       = {10},
  pages        = {1993--2024},
  year         = {2015},
  url          = {https://doi.org/10.1109/TMI.2014.2377694},
  doi          = {10.1109/TMI.2014.2377694},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tmi/MenzeJBKFKBPSWL15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tocs/PellauerPAAACFG15,
  author       = {Michael Pellauer and
                  Angshuman Parashar and
                  Michael Adler and
                  Bushra Ahsan and
                  Randy L. Allmon and
                  Neal Clayton Crago and
                  Kermin Fleming and
                  Mohit Gambhir and
                  Aamer Jaleel and
                  Tushar Krishna and
                  Daniel Lustig and
                  Stephen Maresh and
                  Vladimir Pavlov and
                  Rachid Rayess and
                  Antonia Zhai and
                  Joel S. Emer},
  title        = {Efficient Control and Communication Paradigms for Coarse-Grained Spatial
                  Architectures},
  journal      = {{ACM} Trans. Comput. Syst.},
  volume       = {33},
  number       = {3},
  pages        = {10:1--10:32},
  year         = {2015},
  url          = {https://doi.org/10.1145/2754930},
  doi          = {10.1145/2754930},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tocs/PellauerPAAACFG15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/LiCTLDG15,
  author       = {Zengxiang Li and
                  Wentong Cai and
                  Stephen John Turner and
                  Xiaorong Li and
                  Ta Nguyen Binh Duong and
                  Rick Siow Mong Goh},
  title        = {Adaptive Resource Provisioning Mechanism in VEEs for Improving Performance
                  of HLA-Based Simulations},
  journal      = {{ACM} Trans. Model. Comput. Simul.},
  volume       = {26},
  number       = {1},
  pages        = {1:1--1:25},
  year         = {2015},
  url          = {https://doi.org/10.1145/2717309},
  doi          = {10.1145/2717309},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tomacs/LiCTLDG15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tpds/TanTGTW15,
  author       = {Wen Jun Tan and
                  Wai Teng Tang and
                  Rick Siow Mong Goh and
                  Stephen John Turner and
                  Weng{-}Fai Wong},
  title        = {A Code Generation Framework for Targeting Optimized Library Calls
                  for Multiple Platforms},
  journal      = {{IEEE} Trans. Parallel Distributed Syst.},
  volume       = {26},
  number       = {7},
  pages        = {1789--1799},
  year         = {2015},
  url          = {https://doi.org/10.1109/TPDS.2014.2329494},
  doi          = {10.1109/TPDS.2014.2329494},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tpds/TanTGTW15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tpds/TangTGTW15,
  author       = {Wai Teng Tang and
                  Wen Jun Tan and
                  Rick Siow Mong Goh and
                  Stephen John Turner and
                  Weng{-}Fai Wong},
  title        = {A Family of Bit-Representation-Optimized Formats for Fast Sparse Matrix-Vector
                  Multiplication on the {GPU}},
  journal      = {{IEEE} Trans. Parallel Distributed Syst.},
  volume       = {26},
  number       = {9},
  pages        = {2373--2385},
  year         = {2015},
  url          = {https://doi.org/10.1109/TPDS.2014.2357437},
  doi          = {10.1109/TPDS.2014.2357437},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tpds/TangTGTW15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/adaEurope/PinhoMMT15,
  author       = {Lu{\'{\i}}s Miguel Pinho and
                  Brad Moore and
                  Stephen Michell and
                  S. Tucker Taft},
  editor       = {Juan Antonio de la Puente and
                  Tullio Vardanega},
  title        = {An Execution Model for Fine-Grained Parallelism in Ada},
  booktitle    = {Reliable Software Technologies - Ada-Europe 2015 - 20th Ada-Europe
                  International Conference on Reliable Software Technologies, Madrid
                  Spain, June 22-26, 2015, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {9111},
  pages        = {196--211},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-319-19584-1\_13},
  doi          = {10.1007/978-3-319-19584-1\_13},
  timestamp    = {Tue, 14 May 2019 10:00:50 +0200},
  biburl       = {https://dblp.org/rec/conf/adaEurope/PinhoMMT15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/ManiCOMUB15,
  author       = {Subramani Mani and
                  Daniel Cannon and
                  Tudor I. Oprea and
                  Stephen L. Mathias and
                  Oleg Ursu and
                  Cristian Bologa},
  title        = {Protein Drug Target Prioritization for Illumination},
  booktitle    = {{AMIA} 2015, American Medical Informatics Association Annual Symposium,
                  San Francisco, CA, USA, November 14-18, 2015},
  publisher    = {{AMIA}},
  year         = {2015},
  url          = {https://knowledge.amia.org/59310-amia-1.2741865/t001-1.2745946/f001-1.2745947/2247351-1.2746059/2248806-1.2746056},
  timestamp    = {Wed, 17 Apr 2024 11:47:40 +0200},
  biburl       = {https://dblp.org/rec/conf/amia/ManiCOMUB15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/SandorST15,
  author       = {Nicolae L. Sandor and
                  Stephen Skentzos and
                  Alexander Turchin},
  title        = {Canary - a Graphic User Interface to a Heuristic {NLP} Engine},
  booktitle    = {{AMIA} 2015, American Medical Informatics Association Annual Symposium,
                  San Francisco, CA, USA, November 14-18, 2015},
  publisher    = {{AMIA}},
  year         = {2015},
  url          = {https://knowledge.amia.org/59310-amia-1.2741865/t005-1.2744350/f005-1.2744351/2248348-1.2744622/2244203-1.2744619},
  timestamp    = {Wed, 17 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/amia/SandorST15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/TuluALOEP15,
  author       = {Bengisu Tulu and
                  Emmanuel Agu and
                  Stephenie C. Lemon and
                  Jessica Oleski and
                  Martinus Evans and
                  Sherry Pagoto},
  title        = {Smart Coach: {A} Problem-Solving Mobile App to Support Weight Loss
                  Management},
  booktitle    = {{AMIA} 2015, American Medical Informatics Association Annual Symposium,
                  San Francisco, CA, USA, November 14-18, 2015},
  publisher    = {{AMIA}},
  year         = {2015},
  url          = {https://knowledge.amia.org/59310-amia-1.2741865/t005-1.2744350/f005-1.2744351/2247766-1.2744472/2247987-1.2744469},
  timestamp    = {Wed, 17 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/amia/TuluALOEP15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/WarrenJBST15,
  author       = {Judith J. Warren and
                  Stephen B. Johnson and
                  Suzanne Austin Boren and
                  Stuart M. Speedie and
                  G{\"{u}}nter Tusch},
  title        = {Health Informatics Graduate Program Accreditation: {CAHIIM} Process
                  and Standards Update},
  booktitle    = {{AMIA} 2015, American Medical Informatics Association Annual Symposium,
                  San Francisco, CA, USA, November 14-18, 2015},
  publisher    = {{AMIA}},
  year         = {2015},
  url          = {https://knowledge.amia.org/59310-amia-1.2741865/t003-1.2745834/f003-1.2745835/2248640-1.2745842/2248831-1.2745839},
  timestamp    = {Wed, 17 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/amia/WarrenJBST15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/KonradBCTNDPW15,
  author       = {Artie Konrad and
                  Victoria Bellotti and
                  Nicole Crenshaw and
                  Simon Tucker and
                  Les Nelson and
                  Honglu Du and
                  Peter Pirolli and
                  Steve Whittaker},
  editor       = {Bo Begole and
                  Jinwoo Kim and
                  Kori Inkpen and
                  Woontack Woo},
  title        = {Finding the Adaptive Sweet Spot: Balancing Compliance and Achievement
                  in Automated Stress Reduction},
  booktitle    = {Proceedings of the 33rd Annual {ACM} Conference on Human Factors in
                  Computing Systems, {CHI} 2015, Seoul, Republic of Korea, April 18-23,
                  2015},
  pages        = {3829--3838},
  publisher    = {{ACM}},
  year         = {2015},
  url          = {https://doi.org/10.1145/2702123.2702512},
  doi          = {10.1145/2702123.2702512},
  timestamp    = {Mon, 11 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/chi/KonradBCTNDPW15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/WartelKGBSTQLMB15,
  author       = {Franck Wartel and
                  Leonidas Kosmidis and
                  Adriana Gogonel and
                  Andrea Baldovin and
                  Zo{\"{e}} R. Stephenson and
                  Benoit Triquet and
                  Eduardo Qui{\~{n}}ones and
                  Code Lo and
                  Enrico Mezzetti and
                  Ian Broster and
                  Jaume Abella and
                  Liliana Cucu{-}Grosjean and
                  Tullio Vardanega and
                  Francisco J. Cazorla},
  editor       = {Wolfgang Nebel and
                  David Atienza},
  title        = {Timing analysis of an avionics case study on complex hardware/software
                  platforms},
  booktitle    = {Proceedings of the 2015 Design, Automation {\&} Test in Europe
                  Conference {\&} Exhibition, {DATE} 2015, Grenoble, France, March
                  9-13, 2015},
  pages        = {397--402},
  publisher    = {{ACM}},
  year         = {2015},
  url          = {http://dl.acm.org/citation.cfm?id=2755843},
  timestamp    = {Mon, 09 Aug 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/date/WartelKGBSTQLMB15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/ZhaoCT15,
  author       = {Mingbi Zhao and
                  Wentong Cai and
                  Stephen John Turner},
  title        = {Evaluation of Crowd Models in Low Density Scenarios Using Real-World
                  Crowd Data},
  booktitle    = {19th {IEEE/ACM} International Symposium on Distributed Simulation
                  and Real Time Applications, {DS-RT} 2015, Chengdu, China, October
                  14-16, 2015},
  pages        = {1--9},
  publisher    = {{IEEE} Computer Society},
  year         = {2015},
  url          = {https://doi.org/10.1109/DS-RT.2015.25},
  doi          = {10.1109/DS-RT.2015.25},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dsrt/ZhaoCT15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eScience/WoodmanHTDW15,
  author       = {Simon Woodman and
                  Hugo Hiden and
                  Mark Turner and
                  Stephen Dowsland and
                  Paul Watson},
  title        = {Monitoring of Upper Limb Rehabilitation and Recovery after Stroke:
                  An Architecture for a Cloud-Based Therapy Platform},
  booktitle    = {11th {IEEE} International Conference on e-Science, e-Science 2015,
                  Munich, Germany, August 31 - September 4, 2015},
  pages        = {381--390},
  publisher    = {{IEEE} Computer Society},
  year         = {2015},
  url          = {https://doi.org/10.1109/eScience.2015.29},
  doi          = {10.1109/ESCIENCE.2015.29},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/eScience/WoodmanHTDW15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoc/EllisPTSMKIPFGL15,
  author       = {Andrew D. Ellis and
                  Ian D. Phillips and
                  Mingming Tan and
                  Marc F. C. Stephens and
                  Mary E. McCarthy and
                  M. A. Z. Al Kahteeb and
                  Md. Asif Iqbal and
                  Andreas Perentos and
                  Simon Fabbri and
                  Vladimir Gordienko and
                  Domani{\c{c}} Lavery and
                  Gabriele Liga and
                  M. G. Saavedra and
                  Robert Maher and
                  Stelios Sygletos and
                  Paul Harper and
                  Nick J. Doran and
                  Polina Bayvel and
                  Sergey K. Turitsyn},
  title        = {Enhanced superchannel transmission using phase conjugation},
  booktitle    = {European Conference on Optical Communication, {ECOC} 2015, Valencia,
                  Spain, September 27 - October 1, 2015},
  pages        = {1--3},
  publisher    = {{IEEE}},
  year         = {2015},
  url          = {https://doi.org/10.1109/ECOC.2015.7341993},
  doi          = {10.1109/ECOC.2015.7341993},
  timestamp    = {Mon, 02 Oct 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ecoc/EllisPTSMKIPFGL15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/TurnerASF15,
  author       = {Stephen W. Turner and
                  Mark Allison and
                  Zahid A. Syed and
                  Michael Farmer},
  title        = {Towards a flipped cyber classroom to facilitate active learning strategies},
  booktitle    = {2015 {IEEE} Frontiers in Education Conference, {FIE} 2015, El Paso,
                  TX, USA, October 21-24, 2015},
  pages        = {1--4},
  publisher    = {{IEEE} Computer Society},
  year         = {2015},
  url          = {https://doi.org/10.1109/FIE.2015.7344136},
  doi          = {10.1109/FIE.2015.7344136},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/fie/TurnerASF15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/TezaurTPSP15,
  author       = {Irina K. Tezaur and
                  Raymond S. Tuminaro and
                  Mauro Perego and
                  Andrew G. Salinger and
                  Stephen F. Price},
  editor       = {Slawomir Koziel and
                  Leifur {\TH}. Leifsson and
                  Michael Lees and
                  Valeria V. Krzhizhanovskaya and
                  Jack J. Dongarra and
                  Peter M. A. Sloot},
  title        = {On the Scalability of the Albany/FELIX first-order Stokes Approximation
                  ice Sheet Solver for Large-Scale Simulations of the Greenland and
                  Antarctic ice Sheets},
  booktitle    = {Proceedings of the International Conference on Computational Science,
                  {ICCS} 2015, Computational Science at the Gates of Nature, Reykjav{\'{\i}}k,
                  Iceland, 1-3 June, 2015, 2014},
  series       = {Procedia Computer Science},
  volume       = {51},
  pages        = {2026--2035},
  publisher    = {Elsevier},
  year         = {2015},
  url          = {https://doi.org/10.1016/j.procs.2015.05.467},
  doi          = {10.1016/J.PROCS.2015.05.467},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iccS/TezaurTPSP15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/memsys/JogKKPBCKKD15,
  author       = {Adwait Jog and
                  Onur Kayiran and
                  Tuba Kesten and
                  Ashutosh Pattnaik and
                  Evgeny Bolotin and
                  Niladrish Chatterjee and
                  Stephen W. Keckler and
                  Mahmut T. Kandemir and
                  Chita R. Das},
  editor       = {Bruce L. Jacob},
  title        = {Anatomy of {GPU} Memory System for Multi-Application Execution},
  booktitle    = {Proceedings of the 2015 International Symposium on Memory Systems,
                  {MEMSYS} 2015, Washington DC, DC, USA, October 5-8, 2015},
  pages        = {223--234},
  publisher    = {{ACM}},
  year         = {2015},
  url          = {https://doi.org/10.1145/2818950.2818979},
  doi          = {10.1145/2818950.2818979},
  timestamp    = {Fri, 13 Nov 2020 09:24:44 +0100},
  biburl       = {https://dblp.org/rec/conf/memsys/JogKKPBCKKD15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/PaniaguaZOAGNE15,
  author       = {Beatriz Paniagua and
                  Dzenan Zukic and
                  Ricardo Ortiz and
                  Stephen R. Aylward and
                  Brent Golden and
                  Tung Nguyen and
                  Andinet Enquobahrie},
  editor       = {Cristian A. Linte and
                  Ziv Yaniv and
                  Pascal Fallavollita},
  title        = {Ultrasound-Guided Navigation System for Orthognathic Surgery},
  booktitle    = {Augmented Environments for Computer-Assisted Interventions - 10th
                  International Workshop, {AE-CAI} 2015 Held in Conjunction with {MICCAI}
                  2015, Munich, Germany, October 9, 2015, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {9365},
  pages        = {1--10},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-319-24601-7\_1},
  doi          = {10.1007/978-3-319-24601-7\_1},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/miccai/PaniaguaZOAGNE15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miip/TuSVPPYP15,
  author       = {Liyun Tu and
                  Martin Styner and
                  Jared Vicory and
                  Beatriz Paniagua and
                  Juan{-}Carlos Prieto and
                  Dan Yang and
                  Stephen M. Pizer},
  editor       = {S{\'{e}}bastien Ourselin and
                  Martin Andreas Styner},
  title        = {Skeletal shape correspondence via entropy minimization},
  booktitle    = {Medical Imaging 2015: Image Processing, Orlando, Florida, USA, February
                  24-26, 2015},
  series       = {{SPIE} Proceedings},
  volume       = {9413},
  pages        = {94130U},
  publisher    = {{SPIE}},
  year         = {2015},
  url          = {https://doi.org/10.1117/12.2081245},
  doi          = {10.1117/12.2081245},
  timestamp    = {Thu, 06 Jun 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/miip/TuSVPPYP15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ndss/BostPTG15,
  author       = {Raphael Bost and
                  Raluca Ada Popa and
                  Stephen Tu and
                  Shafi Goldwasser},
  title        = {Machine Learning Classification over Encrypted Data},
  booktitle    = {22nd Annual Network and Distributed System Security Symposium, {NDSS}
                  2015, San Diego, California, USA, February 8-11, 2015},
  publisher    = {The Internet Society},
  year         = {2015},
  url          = {https://www.ndss-symposium.org/ndss2015/machine-learning-classification-over-encrypted-data},
  timestamp    = {Mon, 01 Feb 2021 08:42:14 +0100},
  biburl       = {https://dblp.org/rec/conf/ndss/BostPTG15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/PachnickeMQSSZW15,
  author       = {Stephan Pachnicke and
                  Stephen Mayne and
                  B. Quemeneur and
                  D. Sayles and
                  H. Schwuchow and
                  Jiannan Zhu and
                  Adrian Wonfor and
                  P. Marx and
                  Mirko Lawin and
                  M. Fellhofer and
                  Richard Turner and
                  P. Neuber and
                  M. Dietrich and
                  Mike J. Wale and
                  Richard V. Penty and
                  Ian H. White and
                  J{\"{o}}rg{-}Peter Elbers},
  title        = {Field demonstration of a tunable {WDM-PON} system with novel {SFP+}
                  modules and centralized wavelength control},
  booktitle    = {Optical Fiber Communications Conference and Exhibition, {OFC} 2015,
                  Los Angeles, CA, USA, March 22-26, 2015},
  pages        = {1--3},
  publisher    = {{IEEE}},
  year         = {2015},
  url          = {https://doi.org/10.1364/OFC.2015.M2A.6},
  doi          = {10.1364/OFC.2015.M2A.6},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ofc/PachnickeMQSSZW15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/LiCT15,
  author       = {Xiaosong Li and
                  Wentong Cai and
                  Stephen John Turner},
  editor       = {Simon J. E. Taylor and
                  Navonil Mustafee and
                  Young{-}Jun Son},
  title        = {Cloning Agent-based Simulation on {GPU}},
  booktitle    = {Proceedings of the 3rd {ACM} Conference on SIGSIM-Principles of Advanced
                  Discrete Simulation, London, United Kingdom, June 10 - 12, 2015},
  pages        = {173--182},
  publisher    = {{ACM}},
  year         = {2015},
  url          = {https://doi.org/10.1145/2769458.2769470},
  doi          = {10.1145/2769458.2769470},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/LiCT15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/percom/TuptukH15,
  author       = {Nilufer Tuptuk and
                  Stephen Hailes},
  title        = {Covert channel attacks in pervasive computing},
  booktitle    = {2015 {IEEE} International Conference on Pervasive Computing and Communications,
                  PerCom 2015, St. Louis, MO, USA, 23-27 March, 2015},
  pages        = {236--242},
  publisher    = {{IEEE} Computer Society},
  year         = {2015},
  url          = {https://doi.org/10.1109/PERCOM.2015.7146534},
  doi          = {10.1109/PERCOM.2015.7146534},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/percom/TuptukH15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rtss/PinhoMMT15,
  author       = {Lu{\'{\i}}s Miguel Pinho and
                  Brad Moore and
                  Stephen Michell and
                  S. Tucker Taft},
  title        = {Real-Time Support in the Proposal for Fine-Grained Parallelism in
                  Ada},
  booktitle    = {2015 {IEEE} Real-Time Systems Symposium, {RTSS} 2015, San Antonio,
                  Texas, USA, December 1-4, 2015},
  pages        = {374},
  publisher    = {{IEEE} Computer Society},
  year         = {2015},
  url          = {https://doi.org/10.1109/RTSS.2015.43},
  doi          = {10.1109/RTSS.2015.43},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/rtss/PinhoMMT15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/15/TuckerLCS15,
  author       = {Allan Tucker and
                  Yuanxi Li and
                  Stefano Ceccon and
                  Stephen Swift},
  editor       = {Arjen Hommersom and
                  Peter J. F. Lucas},
  title        = {Trajectories Through the Disease Process: Cross Sectional and Longitudinal
                  Studies},
  booktitle    = {Foundations of Biomedical Knowledge Representation - Methods and Applications},
  series       = {Lecture Notes in Computer Science},
  volume       = {9521},
  pages        = {189--205},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-319-28007-3\_12},
  doi          = {10.1007/978-3-319-28007-3\_12},
  timestamp    = {Sat, 30 Sep 2023 09:32:43 +0200},
  biburl       = {https://dblp.org/rec/books/sp/15/TuckerLCS15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2015,
  editor       = {Laura Kov{\'{a}}cs and
                  Viorel Negru and
                  Tetsuo Ida and
                  Tudor Jebelean and
                  Dana Petcu and
                  Stephen M. Watt and
                  Daniela Zaharie},
  title        = {17th International Symposium on Symbolic and Numeric Algorithms for
                  Scientific Computing, {SYNASC} 2015, Timisoara, Romania, September
                  21-24, 2015},
  publisher    = {{IEEE} Computer Society},
  year         = {2015},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7425657/proceeding},
  isbn         = {978-1-5090-0461-4},
  timestamp    = {Wed, 16 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/synasc/2015.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/WeirREAPVMFPPSV15,
  author       = {Phil Weir and
                  Dominic Reuter and
                  Roland Ellerweg and
                  Tuomas Alhonnoro and
                  Mika Pollari and
                  Philip Voglreiter and
                  Panchatcharam Mariappan and
                  Ronan Flanagan and
                  Chang{-}Sub Park and
                  Stephen J. Payne and
                  Elmar Staerk and
                  Peter Voigt and
                  Michael Moche and
                  Marina Kolesnik},
  title        = {Go-Smart: Web-based Computational Modeling of Minimally Invasive Cancer
                  Treatments},
  journal      = {CoRR},
  volume       = {abs/1511.03418},
  year         = {2015},
  url          = {http://arxiv.org/abs/1511.03418},
  eprinttype    = {arXiv},
  eprint       = {1511.03418},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/WeirREAPVMFPPSV15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/artmed/SacchiTCGS14,
  author       = {Lucia Sacchi and
                  Allan Tucker and
                  Steve Counsell and
                  David Garway{-}Heath and
                  Stephen Swift},
  title        = {Improving predictive models of glaucoma severity by incorporating
                  quality indicators},
  journal      = {Artif. Intell. Medicine},
  volume       = {60},
  number       = {2},
  pages        = {103--112},
  year         = {2014},
  url          = {https://doi.org/10.1016/j.artmed.2013.12.002},
  doi          = {10.1016/J.ARTMED.2013.12.002},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/artmed/SacchiTCGS14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cce/JonesBTZ14,
  author       = {Dustin Jones and
                  Debangsu Bhattacharyya and
                  Richard Turton and
                  Stephen E. Zitney},
  title        = {Plant-wide control system design: Primary controlled variable selection},
  journal      = {Comput. Chem. Eng.},
  volume       = {71},
  pages        = {220--234},
  year         = {2014},
  url          = {https://doi.org/10.1016/j.compchemeng.2014.08.004},
  doi          = {10.1016/J.COMPCHEMENG.2014.08.004},
  timestamp    = {Mon, 18 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cce/JonesBTZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cce/JonesBTZ14a,
  author       = {Dustin Jones and
                  Debangsu Bhattacharyya and
                  Richard Turton and
                  Stephen E. Zitney},
  title        = {Plant-wide control system design: Secondary controlled variable selection},
  journal      = {Comput. Chem. Eng.},
  volume       = {71},
  pages        = {253--262},
  year         = {2014},
  url          = {https://doi.org/10.1016/j.compchemeng.2014.08.007},
  doi          = {10.1016/J.COMPCHEMENG.2014.08.007},
  timestamp    = {Mon, 18 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cce/JonesBTZ14a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dhq/SturmT14,
  author       = {Sean Sturm and
                  Stephen Francis Turner},
  title        = {Digital Caricature},
  journal      = {Digit. Humanit. Q.},
  volume       = {8},
  number       = {3},
  year         = {2014},
  url          = {http://www.digitalhumanities.org/dhq/vol/8/3/000182/000182.html},
  timestamp    = {Wed, 12 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/dhq/SturmT14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejc/StephensTZ14,
  author       = {D. Christopher Stephens and
                  Thomas W. Tucker and
                  Xiaoya Zha},
  title        = {Representativity of Cayley maps},
  journal      = {Eur. J. Comb.},
  volume       = {39},
  pages        = {207--222},
  year         = {2014},
  url          = {https://doi.org/10.1016/j.ejc.2013.12.006},
  doi          = {10.1016/J.EJC.2013.12.006},
  timestamp    = {Fri, 12 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ejc/StephensTZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-wss/MatikoBT14,
  author       = {Joseph W. Matiko and
                  Stephen P. Beeby and
                  John Tudor},
  title        = {Real time emotion detection within a wireless sensor network and its
                  impact on power consumption},
  journal      = {{IET} Wirel. Sens. Syst.},
  volume       = {4},
  number       = {4},
  pages        = {183--190},
  year         = {2014},
  url          = {https://doi.org/10.1049/iet-wss.2014.0056},
  doi          = {10.1049/IET-WSS.2014.0056},
  timestamp    = {Fri, 18 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/iet-wss/MatikoBT14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijitpm/IskinDNB14,
  author       = {Ibrahim Iskin and
                  Tugrul U. Daim and
                  Stephen Noble and
                  Angie Baltz},
  title        = {Approaching {IT} Automation Decisions using Analytic Hierarchy Process
                  {(AHP)}},
  journal      = {Int. J. Inf. Technol. Proj. Manag.},
  volume       = {5},
  number       = {1},
  pages        = {77--89},
  year         = {2014},
  url          = {https://doi.org/10.4018/ijitpm.2014010107},
  doi          = {10.4018/IJITPM.2014010107},
  timestamp    = {Thu, 01 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijitpm/IskinDNB14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jos/AydtCT14,
  author       = {Heiko Aydt and
                  Wentong Cai and
                  Stephen John Turner},
  title        = {Dynamic specialization for symbiotic simulation-based operational
                  decision support using the evolutionary computing modelling language
                  {(ECML)}},
  journal      = {J. Simulation},
  volume       = {8},
  number       = {2},
  pages        = {105--114},
  year         = {2014},
  url          = {https://doi.org/10.1057/jos.2013.15},
  doi          = {10.1057/JOS.2013.15},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jos/AydtCT14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/KecklerT14,
  author       = {Stephen W. Keckler and
                  Dean M. Tullsen},
  title        = {2014 International Symposium on Computer Architecture Influential
                  Paper Award; 2014 Maurice Wilkes Award Given to Ravi Rajwar},
  journal      = {{IEEE} Micro},
  volume       = {34},
  number       = {6},
  pages        = {95--97},
  year         = {2014},
  url          = {https://doi.org/10.1109/MM.2014.91},
  doi          = {10.1109/MM.2014.91},
  timestamp    = {Sat, 20 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/micro/KecklerT14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WangSZWHCSGB14,
  author       = {Yanli Wang and
                  Tugba O. Suzek and
                  Jian Zhang and
                  Jiyao Wang and
                  Siqian He and
                  Tiejun Cheng and
                  Benjamin A. Shoemaker and
                  Asta Gindulyte and
                  Stephen H. Bryant},
  title        = {PubChem BioAssay: 2014 update},
  journal      = {Nucleic Acids Res.},
  volume       = {42},
  number       = {Database-Issue},
  pages        = {1075--1082},
  year         = {2014},
  url          = {https://doi.org/10.1093/nar/gkt978},
  doi          = {10.1093/NAR/GKT978},
  timestamp    = {Sun, 17 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/WangSZWHCSGB14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/HoJLALISMTAPGKR14,
  author       = {Joshua Wing Kei Ho and
                  Youngsook L. Jung and
                  Tao Liu and
                  Burak Han Alver and
                  Soohyun Lee and
                  Kohta Ikegami and
                  Kyung{-}Ah Sohn and
                  Aki Minoda and
                  Michael Y. Tolstorukov and
                  Alex Appert and
                  Stephen C. J. Parker and
                  Tingting Gu and
                  Anshul Kundaje and
                  Nicole C. Riddle and
                  Eric Bishop and
                  Thea A. Egelhofer and
                  Sheng'en Shawn Hu and
                  Artyom A. Alekseyenko and
                  Andreas Rechtsteiner and
                  Dalal Asker and
                  Jason A. Belsky and
                  Sarah K. Bowman and
                  Q. Brent Chen and
                  Ron A.{-}J. Chen and
                  Daniel S. Day and
                  Yan Dong and
                  Andrea C. Dose and
                  Xikun Duan and
                  Charles B. Epstein and
                  Sevinc Ercan and
                  Elise A. Feingold and
                  Francesco Ferrari and
                  Jacob M. Garrigues and
                  Nils Gehlenborg and
                  Peter J. Good and
                  Psalm Haseley and
                  Daniel He and
                  Moritz Herrmann and
                  Michael M. Hoffman and
                  Tess E. Jeffers and
                  Peter V. Kharchenko and
                  Paulina Kolasinska{-}Zwierz and
                  Chitra V. Kotwaliwale and
                  Nischay Kumar and
                  Sasha A. Langley and
                  Erica Larschan and
                  Isabel Latorre and
                  Maxwell W. Libbrecht and
                  Xueqiu Lin and
                  Richard Park and
                  Michael J. Pazin and
                  Hoang N. Pham and
                  Annette Plachetka and
                  Bo Qin and
                  Yuri B. Schwartz and
                  Noam Shoresh and
                  Przemyslaw Stempor and
                  Anne Vielle and
                  Chengyang Wang and
                  Christina M. Whittle and
                  Huiling Xue and
                  Robert E. Kingston and
                  Ju Han Kim and
                  Bradley E. Bernstein and
                  Abby F. Dernburg and
                  Vincenzo Pirrotta and
                  Mitzi I. Kuroda and
                  William S. Noble and
                  Thomas D. Tullius and
                  Manolis Kellis and
                  David M. MacAlpine and
                  Susan Strome and
                  Sarah C. R. Elgin and
                  Xiaole Shirley Liu and
                  Jason D. Lieb and
                  Julie Ahringer and
                  Gary H. Karpen and
                  Peter J. Park},
  title        = {Comparative analysis of metazoan chromatin organization Open},
  journal      = {Nat.},
  volume       = {512},
  number       = {7515},
  pages        = {449--452},
  year         = {2014},
  url          = {https://doi.org/10.1038/nature13415},
  doi          = {10.1038/NATURE13415},
  timestamp    = {Tue, 12 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nature/HoJLALISMTAPGKR14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simpra/LiCT14,
  author       = {Zengxiang Li and
                  Wentong Cai and
                  Stephen John Turner},
  title        = {Un-identical federate replication structure for improving performance
                  of HLA-based simulations},
  journal      = {Simul. Model. Pract. Theory},
  volume       = {48},
  pages        = {112--128},
  year         = {2014},
  url          = {https://doi.org/10.1016/j.simpat.2014.06.016},
  doi          = {10.1016/J.SIMPAT.2014.06.016},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/simpra/LiCT14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tec/LonesFTCSST14,
  author       = {Michael A. Lones and
                  Luis A. Fuente and
                  Alexander P. Turner and
                  Leo S. D. Caves and
                  Susan Stepney and
                  Stephen L. Smith and
                  Andy M. Tyrrell},
  title        = {Artificial Biochemical Networks: Evolving Dynamical Systems to Control
                  Dynamical Systems},
  journal      = {{IEEE} Trans. Evol. Comput.},
  volume       = {18},
  number       = {2},
  pages        = {145--166},
  year         = {2014},
  url          = {https://doi.org/10.1109/TEVC.2013.2243732},
  doi          = {10.1109/TEVC.2013.2243732},
  timestamp    = {Thu, 23 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tec/LonesFTCSST14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cgames/AlskheliwiJLPS14,
  author       = {Turki Alskheliwi and
                  Carol Jim and
                  Khalid Lateef and
                  Stephen Penn and
                  Ahmed Salem},
  title        = {Applying game theory rules to enhance decision support systems in
                  credit and financial applications},
  booktitle    = {Computer Games: AI, Animation, Mobile, Multimedia, Educational and
                  Serious Games, {CGAMES} 2014, Louisville, KY, USA, July 28-30, 2014},
  pages        = {1--10},
  publisher    = {{IEEE} Computer Society},
  year         = {2014},
  url          = {https://doi.org/10.1109/CGames.2014.6934138},
  doi          = {10.1109/CGAMES.2014.6934138},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cgames/AlskheliwiJLPS14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/TurnbullZSHWSMJ14,
  author       = {Douglas R. Turnbull and
                  Justin A. Zupnick and
                  Kristofer B. Stensland and
                  Andrew R. Horwitz and
                  Alexander J. Wolf and
                  Alexander E. Spirgel and
                  Stephen P. Meyerhofer and
                  Thorsten Joachims},
  editor       = {Matt Jones and
                  Philippe A. Palanque and
                  Albrecht Schmidt and
                  Tovi Grossman},
  title        = {Using personalized radio to enhance local music discovery},
  booktitle    = {{CHI} Conference on Human Factors in Computing Systems, CHI'14, Toronto,
                  ON, Canada - April 26 - May 01, 2014, Extended Abstracts},
  pages        = {2023--2028},
  publisher    = {{ACM}},
  year         = {2014},
  url          = {https://doi.org/10.1145/2559206.2581246},
  doi          = {10.1145/2559206.2581246},
  timestamp    = {Mon, 08 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/chi/TurnbullZSHWSMJ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/LiCT14,
  author       = {Xiaosong Li and
                  Wentong Cai and
                  Stephen John Turner},
  title        = {Efficient Neighbor Searching for Agent-Based Simulation on {GPU}},
  booktitle    = {18th {IEEE/ACM} International Symposium on Distributed Simulation
                  and Real Time Applications, {DS-RT} 2014, Toulouse, France, October
                  1-3, 2014},
  pages        = {87--96},
  publisher    = {{IEEE} Computer Society},
  year         = {2014},
  url          = {https://doi.org/10.1109/DS-RT.2014.19},
  doi          = {10.1109/DS-RT.2014.19},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dsrt/LiCT14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoc/SygletosMFSSPGS14,
  author       = {Stelios Sygletos and
                  Mary E. McCarthy and
                  Simon Fabbri and
                  Mariia Sorokina and
                  Marc F. C. Stephens and
                  Ian D. Phillips and
                  Elias G. Giacoumidis and
                  Naoise Mac Suibhne and
                  Paul Harper and
                  Nick J. Doran and
                  Sergei K. Turitsyn and
                  Andrew D. Ellis},
  title        = {Multichannel regeneration of dual quadrature signals},
  booktitle    = {The European Conference on Optical Communication, {ECOC} 2014, Cannes,
                  France, September 21-25, 2014},
  pages        = {1--3},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://doi.org/10.1109/ECOC.2014.6964110},
  doi          = {10.1109/ECOC.2014.6964110},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ecoc/SygletosMFSSPGS14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/LonesADTJS14,
  author       = {Michael A. Lones and
                  Jane E. Alty and
                  Philippa Duggan{-}Carter and
                  Andrew James Turner and
                  D. R. Stuart Jamieson and
                  Stephen L. Smith},
  editor       = {Dirk V. Arnold and
                  Enrique Alba},
  title        = {Classification and characterisation of movement patterns during levodopa
                  therapy for parkinson's disease},
  booktitle    = {Genetic and Evolutionary Computation Conference, {GECCO} '14, Vancouver,
                  BC, Canada, July 12-16, 2014, Companion Material Proceedings},
  pages        = {1321--1328},
  publisher    = {{ACM}},
  year         = {2014},
  url          = {https://doi.org/10.1145/2598394.2609852},
  doi          = {10.1145/2598394.2609852},
  timestamp    = {Wed, 13 Jul 2022 16:15:15 +0200},
  biburl       = {https://dblp.org/rec/conf/gecco/LonesADTJS14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/haisa/TuyikezeF14,
  author       = {Tite Tuyikeze and
                  Stephen Flowerday},
  editor       = {Nathan L. Clarke and
                  Steven Furnell},
  title        = {Information Security Policy Development and Implementation: {A} Content
                  Analysis Approach},
  booktitle    = {Eighth International Symposium on Human Aspects of Information Security
                  {\&} Assurance, {HAISA} 2014 ,Plymouth, UK, July 8-9, 2014. Proceedings},
  pages        = {11--20},
  publisher    = {University of Plymouth},
  year         = {2014},
  url          = {http://www.cscan.org/openaccess/?paperid=233},
  timestamp    = {Tue, 06 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/haisa/TuyikezeF14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/MatikoBT14,
  author       = {Joseph W. Matiko and
                  Stephen P. Beeby and
                  John Tudor},
  title        = {Fuzzy logic based emotion classification},
  booktitle    = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
                  {ICASSP} 2014, Florence, Italy, May 4-9, 2014},
  pages        = {4389--4393},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://doi.org/10.1109/ICASSP.2014.6854431},
  doi          = {10.1109/ICASSP.2014.6854431},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/MatikoBT14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ida/CounsellTSFP14,
  author       = {Steve Counsell and
                  Allan Tucker and
                  Stephen Swift and
                  Guy Fitzgerald and
                  Jason Peters},
  editor       = {Hendrik Blockeel and
                  Matthijs van Leeuwen and
                  Veronica Vinciotti},
  title        = {Comparing Pre-defined Software Engineering Metrics with Free-Text
                  for the Prediction of Code 'Ripples'},
  booktitle    = {Advances in Intelligent Data Analysis {XIII} - 13th International
                  Symposium, {IDA} 2014, Leuven, Belgium, October 30 - November 1, 2014.
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {8819},
  pages        = {61--71},
  publisher    = {Springer},
  year         = {2014},
  url          = {https://doi.org/10.1007/978-3-319-12571-8\_6},
  doi          = {10.1007/978-3-319-12571-8\_6},
  timestamp    = {Mon, 03 Jan 2022 22:18:10 +0100},
  biburl       = {https://dblp.org/rec/conf/ida/CounsellTSFP14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/KainzVSWMKPKSAHSFBMOPPRSMKSP14,
  author       = {Bernhard Kainz and
                  Philip Voglreiter and
                  Michael Sereinigg and
                  Iris Wiederstein{-}Grasser and
                  Ursula Mayrhauser and
                  Sonja Kostenbauer and
                  Mika Pollari and
                  Rostislav Khlebnikov and
                  Matthias Seise and
                  Tuomas Alhonnoro and
                  Yrj{\"{o}} H{\"{a}}me and
                  Daniel Seider and
                  Ronan Flanagan and
                  Claire Bost and
                  Judith Muehl and
                  David O'Neill and
                  Tingying Peng and
                  Stephen J. Payne and
                  Daniel Rueckert and
                  Dieter Schmalstieg and
                  Michael Moche and
                  Marina Kolesnik and
                  Philipp Stiegler and
                  Rupert H. Portugaller},
  title        = {High-resolution contrast enhanced multi-phase hepatic Computed Tomography
                  data fromaporcine Radio-Frequency Ablation study},
  booktitle    = {{IEEE} 11th International Symposium on Biomedical Imaging, {ISBI}
                  2014, April 29 - May 2, 2014, Beijing, Chin, Beijing, China},
  pages        = {81--84},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://doi.org/10.1109/ISBI.2014.6867814},
  doi          = {10.1109/ISBI.2014.6867814},
  timestamp    = {Wed, 04 Oct 2023 17:01:25 +0200},
  biburl       = {https://dblp.org/rec/conf/isbi/KainzVSWMKPKSAHSFBMOPPRSMKSP14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/issre/TurkayMGC14,
  author       = {Cagatay Turkay and
                  Stephen Mason and
                  Ilir Gashi and
                  Bojan Cukic},
  title        = {Supporting Decision-Making for Biometric System Deployment through
                  Visual Analysis},
  booktitle    = {25th {IEEE} International Symposium on Software Reliability Engineering
                  Workshops, {ISSRE} Workshops, Naples, Italy, November 3-6, 2014},
  pages        = {347--352},
  publisher    = {{IEEE} Computer Society},
  year         = {2014},
  url          = {https://doi.org/10.1109/ISSREW.2014.78},
  doi          = {10.1109/ISSREW.2014.78},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/issre/TurkayMGC14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jcdl/RoseT14,
  author       = {Stephen Rose and
                  Sandra Tuppen},
  editor       = {Ben Fields and
                  Kevin R. Page},
  title        = {Prospects for a Big Data History of Music},
  booktitle    = {Proceedings of the 1st International Workshop on Digital Libraries
                  for Musicology, DLfM@JCDL 2014, London, United Kingdom, September
                  12, 2014},
  pages        = {1--3},
  publisher    = {{ACM}},
  year         = {2014},
  url          = {https://doi.org/10.1145/2660168.2660177},
  doi          = {10.1145/2660168.2660177},
  timestamp    = {Tue, 06 Nov 2018 16:59:02 +0100},
  biburl       = {https://dblp.org/rec/conf/jcdl/RoseT14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/LeKMGPSTDET14,
  author       = {Son T. Le and
                  Thavamaran Kanesan and
                  Mary E. McCarthy and
                  Elias G. Giacoumidis and
                  Ian D. Phillips and
                  Marc F. C. Stephens and
                  Mingming Tan and
                  Nick J. Doran and
                  Andrew D. Ellis and
                  S. K. Turitsyn},
  title        = {Experimental demonstration of data-dependent pilot-aided phase noise
                  estimation for {CO-OFDM}},
  booktitle    = {Optical Fiber Communications Conference and Exhibition, {OFC} 2014,
                  San Francisco, CA, USA, March 9-13, 2014},
  pages        = {1--3},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://doi.org/10.1364/OFC.2014.Tu3G.4},
  doi          = {10.1364/OFC.2014.TU3G.4},
  timestamp    = {Fri, 14 Apr 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ofc/LeKMGPSTDET14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/PhillipsTSMGSRF14,
  author       = {Ian D. Phillips and
                  Mingming Tan and
                  Marc F. C. Stephens and
                  Mary E. McCarthy and
                  Elias G. Giacoumidis and
                  Stelios Sygletos and
                  Pawel Rosa and
                  Simon Fabbri and
                  Son Thai Le and
                  Thavamaran Kanesan and
                  Sergey K. Turitsyn and
                  Nick J. Doran and
                  Paul Harper and
                  Andrew D. Ellis},
  title        = {Exceeding the nonlinear-shannon limit using raman laser based amplification
                  and optical phase conjugation},
  booktitle    = {Optical Fiber Communications Conference and Exhibition, {OFC} 2014,
                  San Francisco, CA, USA, March 9-13, 2014},
  pages        = {1--3},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://doi.org/10.1364/OFC.2014.M3C.1},
  doi          = {10.1364/OFC.2014.M3C.1},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ofc/PhillipsTSMGSRF14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/osdi/ZhengTKL14,
  author       = {Wenting Zheng and
                  Stephen Tu and
                  Eddie Kohler and
                  Barbara Liskov},
  editor       = {Jason Flinn and
                  Hank Levy},
  title        = {Fast Databases with Fast Durability and Recovery Through Multicore
                  Parallelism},
  booktitle    = {11th {USENIX} Symposium on Operating Systems Design and Implementation,
                  {OSDI} '14, Broomfield, CO, USA, October 6-8, 2014},
  pages        = {465--477},
  publisher    = {{USENIX} Association},
  year         = {2014},
  url          = {https://www.usenix.org/conference/osdi14/technical-sessions/presentation/zheng\_wenting},
  timestamp    = {Tue, 02 Feb 2021 08:05:58 +0100},
  biburl       = {https://dblp.org/rec/conf/osdi/ZhengTKL14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rss/SananTBSC14,
  author       = {Siddharth Sanan and
                  Stephen Tully and
                  Andrea Bajo and
                  Nabil Simaan and
                  Howie Choset},
  editor       = {Dieter Fox and
                  Lydia E. Kavraki and
                  Hanna Kurniawati},
  title        = {Simultaneous Compliance and Registration Estimation for Robotic Surgery},
  booktitle    = {Robotics: Science and Systems X, University of California, Berkeley,
                  USA, July 12-16, 2014},
  year         = {2014},
  url          = {http://www.roboticsproceedings.org/rss10/p51.html},
  doi          = {10.15607/RSS.2014.X.051},
  timestamp    = {Fri, 29 Jan 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/rss/SananTBSC14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigada/TaftMPM14,
  author       = {S. Tucker Taft and
                  Brad Moore and
                  Lu{\'{\i}}s Miguel Pinho and
                  Stephen Michell},
  editor       = {Michael B. Feldman and
                  S. Tucker Taft},
  title        = {Safe parallel programming in ada with language extensions},
  booktitle    = {Proceedings of the 2014 {ACM} SIGAda annual conference on High integrity
                  language technology, {HILT} 2014, Portland, Oregon, USA, October 18-21,
                  2014},
  pages        = {87--96},
  publisher    = {{ACM}},
  year         = {2014},
  url          = {https://doi.org/10.1145/2663171.2663181},
  doi          = {10.1145/2663171.2663181},
  timestamp    = {Fri, 02 Jun 2023 17:16:28 +0200},
  biburl       = {https://dblp.org/rec/conf/sigada/TaftMPM14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uist/RetelnyRTLPRDVB14,
  author       = {Daniela Retelny and
                  S{\'{e}}bastien Robaszkiewicz and
                  Alexandra To and
                  Walter S. Lasecki and
                  Jay Patel and
                  Negar Rahmati and
                  Tulsee Doshi and
                  Melissa A. Valentine and
                  Michael S. Bernstein},
  editor       = {Hrvoje Benko and
                  Mira Dontcheva and
                  Daniel Wigdor},
  title        = {Expert crowdsourcing with flash teams},
  booktitle    = {The 27th Annual {ACM} Symposium on User Interface Software and Technology,
                  {UIST} '14, Honolulu, HI, USA, October 5-8, 2014},
  pages        = {75--85},
  publisher    = {{ACM}},
  year         = {2014},
  url          = {https://doi.org/10.1145/2642918.2647409},
  doi          = {10.1145/2642918.2647409},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/uist/RetelnyRTLPRDVB14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/asiasim/2014,
  editor       = {Satoshi Tanaka and
                  Kyoko Hasegawa and
                  Rui Xu and
                  Naohisa Sakamoto and
                  Stephen John Turner},
  title        = {AsiaSim 2014 - 14th International Conference on Systems Simulation,
                  Kitakyushu, Japan, October 26-30, 2014. Proceedings},
  series       = {Communications in Computer and Information Science},
  volume       = {474},
  publisher    = {Springer},
  year         = {2014},
  url          = {https://doi.org/10.1007/978-3-662-45289-9},
  doi          = {10.1007/978-3-662-45289-9},
  isbn         = {978-3-662-45288-2},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/asiasim/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2014,
  editor       = {Franz Winkler and
                  Viorel Negru and
                  Tetsuo Ida and
                  Tudor Jebelean and
                  Dana Petcu and
                  Stephen M. Watt and
                  Daniela Zaharie},
  title        = {16th International Symposium on Symbolic and Numeric Algorithms for
                  Scientific Computing, {SYNASC} 2014, Timisoara, Romania, September
                  22-25, 2014},
  publisher    = {{IEEE} Computer Society},
  year         = {2014},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7031476/proceeding},
  isbn         = {978-1-4799-8447-3},
  timestamp    = {Wed, 16 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/synasc/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/BostPTG14,
  author       = {Raphael Bost and
                  Raluca Ada Popa and
                  Stephen Tu and
                  Shafi Goldwasser},
  title        = {Machine Learning Classification over Encrypted Data},
  journal      = {{IACR} Cryptol. ePrint Arch.},
  pages        = {331},
  year         = {2014},
  url          = {http://eprint.iacr.org/2014/331},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/iacr/BostPTG14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biodb/MathiasHYZBUO13,
  author       = {Stephen L. Mathias and
                  Jarrett Hines{-}Kay and
                  Jeremy J. Yang and
                  Gergely Zahor{\'{a}}nszky{-}K{\"{o}}halmi and
                  Cristian Bologa and
                  Oleg Ursu and
                  Tudor I. Oprea},
  title        = {The {CARLSBAD} Database: {A} Confederated Database of Chemical Bioactivities},
  journal      = {Database J. Biol. Databases Curation},
  volume       = {2013},
  year         = {2013},
  url          = {https://doi.org/10.1093/database/bat044},
  doi          = {10.1093/DATABASE/BAT044},
  timestamp    = {Thu, 13 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/biodb/MathiasHYZBUO13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cgf/JeongSHLTFHNYLP13,
  author       = {Won{-}Ki Jeong and
                  Jens Schneider and
                  Axel Hansen and
                  Manhee Lee and
                  Stephen G. Turney and
                  Beverly E. Faulkner{-}Jones and
                  Jonathan L. Hecht and
                  R. Najarian and
                  Eric Yee and
                  Jeff W. Lichtman and
                  Hanspeter Pfister},
  title        = {A Collaborative Digital Pathology System for Multi-Touch Mobile and
                  Desktop Computing Platforms},
  journal      = {Comput. Graph. Forum},
  volume       = {32},
  number       = {6},
  pages        = {227--242},
  year         = {2013},
  url          = {https://doi.org/10.1111/cgf.12137},
  doi          = {10.1111/CGF.12137},
  timestamp    = {Thu, 11 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cgf/JeongSHLTFHNYLP13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/NorthCSCET13,
  author       = {Frederick North and
                  Sarah J. Crane and
                  Robert J. Stroebel and
                  Stephen S. Cha and
                  Eric S. Edell and
                  Sidna M. Tulledge{-}Scheitel},
  title        = {Research and applications: Patient-generated secure messages and eVisits
                  on a patient portal: are patients at risk?},
  journal      = {J. Am. Medical Informatics Assoc.},
  volume       = {20},
  number       = {6},
  pages        = {1143--1149},
  year         = {2013},
  url          = {https://doi.org/10.1136/amiajnl-2012-001208},
  doi          = {10.1136/AMIAJNL-2012-001208},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jamia/NorthCSCET13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/LiST13,
  author       = {Yuanxi Li and
                  Stephen Swift and
                  Allan Tucker},
  title        = {Modelling and analysing the dynamics of disease progression from cross-sectional
                  studies},
  journal      = {J. Biomed. Informatics},
  volume       = {46},
  number       = {2},
  pages        = {266--274},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.jbi.2012.11.003},
  doi          = {10.1016/J.JBI.2012.11.003},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jbi/LiST13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jphonetics/GengTSMHRWPBCDD13,
  author       = {Christian Geng and
                  Alice Turk and
                  James M. Scobbie and
                  Cedric Macmartin and
                  Philip Hoole and
                  Korin Richmond and
                  Alan Wrench and
                  Marianne Pouplier and
                  Ellen Gurman Bard and
                  Ziggy Campbell and
                  Catherine Dickie and
                  Eddie Dubourg and
                  William J. Hardcastle and
                  Evia Kainada and
                  Simon King and
                  Robin J. Lickley and
                  Satsuki Nakai and
                  Steve Renals and
                  Kevin White and
                  Ronny Wiegand},
  title        = {Recording speech articulation in dialogue: Evaluating a synchronized
                  double electromagnetic articulography setup},
  journal      = {J. Phonetics},
  volume       = {41},
  number       = {6},
  pages        = {421--431},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.wocn.2013.07.002},
  doi          = {10.1016/J.WOCN.2013.07.002},
  timestamp    = {Mon, 29 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jphonetics/GengTSMHRWPBCDD13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mansci/BaliBD13,
  author       = {Turan G. Bali and
                  Stephen J. Brown and
                  K. Ozgur Demirtas},
  title        = {Do Hedge Funds Outperform Stocks and Bonds?},
  journal      = {Manag. Sci.},
  volume       = {59},
  number       = {8},
  pages        = {1887--1903},
  year         = {2013},
  url          = {https://doi.org/10.1287/mnsc.1120.1689},
  doi          = {10.1287/MNSC.1120.1689},
  timestamp    = {Tue, 30 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/mansci/BaliBD13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BarchBHPSCGCDFNBHFBPSJSE13,
  author       = {Deanna M. Barch and
                  Gregory C. Burgess and
                  Michael P. Harms and
                  Steven E. Petersen and
                  Bradley L. Schlaggar and
                  Maurizio Corbetta and
                  Matthew F. Glasser and
                  Sandra W. Curtiss and
                  Sachin Dixit and
                  Cindy Feldt and
                  Dan Nolan and
                  Edward Bryant and
                  Tucker Hartley and
                  Owen Footer and
                  James M. Bjork and
                  Russell A. Poldrack and
                  Steve M. Smith and
                  Heidi Johansen{-}Berg and
                  Abraham Z. Snyder and
                  David C. Van Essen},
  title        = {Function in the human connectome: Task-fMRI and individual differences
                  in behavior},
  journal      = {NeuroImage},
  volume       = {80},
  pages        = {169--189},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.neuroimage.2013.05.033},
  doi          = {10.1016/J.NEUROIMAGE.2013.05.033},
  timestamp    = {Mon, 22 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/neuroimage/BarchBHPSCGCDFNBHFBPSJSE13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pvldb/DeBrabantPTSZ13,
  author       = {Justin A. DeBrabant and
                  Andrew Pavlo and
                  Stephen Tu and
                  Michael Stonebraker and
                  Stanley B. Zdonik},
  title        = {Anti-Caching: {A} New Approach to Database Management System Architecture},
  journal      = {Proc. {VLDB} Endow.},
  volume       = {6},
  number       = {14},
  pages        = {1942--1953},
  year         = {2013},
  url          = {http://www.vldb.org/pvldb/vol6/p1942-debrabant.pdf},
  doi          = {10.14778/2556549.2556575},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pvldb/DeBrabantPTSZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pvldb/TuKMZ13,
  author       = {Stephen Tu and
                  M. Frans Kaashoek and
                  Samuel Madden and
                  Nickolai Zeldovich},
  title        = {Processing Analytical Queries over Encrypted Data},
  journal      = {Proc. {VLDB} Endow.},
  volume       = {6},
  number       = {5},
  pages        = {289--300},
  year         = {2013},
  url          = {http://www.vldb.org/pvldb/vol6/p289-tu.pdf},
  doi          = {10.14778/2535573.2488336},
  timestamp    = {Wed, 09 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pvldb/TuKMZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/GuoGLTND13,
  author       = {Liang Guo and
                  Gareth S. Guvanasen and
                  Xi Liu and
                  Christopher Tuthill and
                  T. Richard Nichols and
                  Stephen P. DeWeerth},
  title        = {A PDMS-Based Integrated Stretchable Microelectrode Array (isMEA) for
                  Neural and Muscular Surface Interfacing},
  journal      = {{IEEE} Trans. Biomed. Circuits Syst.},
  volume       = {7},
  number       = {1},
  pages        = {1--10},
  year         = {2013},
  url          = {https://doi.org/10.1109/TBCAS.2012.2192932},
  doi          = {10.1109/TBCAS.2012.2192932},
  timestamp    = {Wed, 17 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tbcas/GuoGLTND13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/JonesBTZ13,
  author       = {Dustin Jones and
                  Debangsu Bhattacharyya and
                  Richard Turton and
                  Stephen E. Zitney},
  title        = {Optimal selection of primary controlled variables for an acid gas
                  removal unit as part of an {IGCC} plant with {CO2} capture},
  booktitle    = {American Control Conference, {ACC} 2013, Washington, DC, USA, June
                  17-19, 2013},
  pages        = {5035--5040},
  publisher    = {{IEEE}},
  year         = {2013},
  url          = {https://doi.org/10.1109/ACC.2013.6580620},
  doi          = {10.1109/ACC.2013.6580620},
  timestamp    = {Sun, 08 Aug 2021 01:40:56 +0200},
  biburl       = {https://dblp.org/rec/conf/amcc/JonesBTZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/PaulBTZ13,
  author       = {Prokash Paul and
                  Debangsu Bhattacharyya and
                  Richard Turton and
                  Stephen E. Zitney},
  title        = {Adaptive Kalman filter for estimation of environmental performance
                  variables in an acid gas removal process},
  booktitle    = {American Control Conference, {ACC} 2013, Washington, DC, USA, June
                  17-19, 2013},
  pages        = {2717--2721},
  publisher    = {{IEEE}},
  year         = {2013},
  url          = {https://doi.org/10.1109/ACC.2013.6580245},
  doi          = {10.1109/ACC.2013.6580245},
  timestamp    = {Sun, 08 Aug 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/amcc/PaulBTZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/MartinsTMRFLFSDG13,
  author       = {Susana B. Martins and
                  Samson W. Tu and
                  Richard Martinello and
                  Michael Rubin and
                  Philip Foulis and
                  Stephen Luther and
                  Tyler Forbush and
                  Matthew Scotch and
                  Brad Doebbelling and
                  Mary K. Goldstein},
  title        = {Creating a {MRSA} Ontology to Support Categorization of {MRSA} Infections},
  booktitle    = {{AMIA} 2013, American Medical Informatics Association Annual Symposium,
                  Washington, DC, USA, November 16-20, 2013},
  publisher    = {{AMIA}},
  year         = {2013},
  url          = {https://knowledge.amia.org/amia-55142-a2013e-1.580047/t-06-1.582200/f-006-1.582201/a-333-1.582989/a-335-1.582983},
  timestamp    = {Wed, 17 Apr 2024 11:47:55 +0200},
  biburl       = {https://dblp.org/rec/conf/amia/MartinsTMRFLFSDG13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/JinTLZH13,
  author       = {Jiangming Jin and
                  Stephen John Turner and
                  Bu{-}Sung Lee and
                  Jianlong Zhong and
                  Bingsheng He},
  title        = {Simulation of Information Propagation over Complex Networks: Performance
                  Studies on Multi-GPU},
  booktitle    = {17th {IEEE/ACM} International Symposium on Distributed Simulation
                  and Real Time Applications, {DS-RT} 2013, Delft, The Netherlands,
                  October 30 - November 1, 2013},
  pages        = {179--188},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://doi.org/10.1109/DS-RT.2013.27},
  doi          = {10.1109/DS-RT.2013.27},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dsrt/JinTLZH13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/ZhaoTC13,
  author       = {Mingbi Zhao and
                  Stephen John Turner and
                  Wentong Cai},
  title        = {A Data-Driven Crowd Simulation Model Based on Clustering and Classification},
  booktitle    = {17th {IEEE/ACM} International Symposium on Distributed Simulation
                  and Real Time Applications, {DS-RT} 2013, Delft, The Netherlands,
                  October 30 - November 1, 2013},
  pages        = {125--134},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://doi.org/10.1109/DS-RT.2013.21},
  doi          = {10.1109/DS-RT.2013.21},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dsrt/ZhaoTC13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/AnsaloniKZBBT13,
  author       = {Danilo Ansaloni and
                  Stephen Kell and
                  Yudi Zheng and
                  Lubom{\'{\i}}r Bulej and
                  Walter Binder and
                  Petr Tuma},
  editor       = {Giuseppe Castagna},
  title        = {Enabling Modularity and Re-use in Dynamic Program Analysis Tools for
                  the Java Virtual Machine},
  booktitle    = {{ECOOP} 2013 - Object-Oriented Programming - 27th European Conference,
                  Montpellier, France, July 1-5, 2013. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {7920},
  pages        = {352--377},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-642-39038-8\_15},
  doi          = {10.1007/978-3-642-39038-8\_15},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ecoop/AnsaloniKZBBT13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/MatikoBT13,
  author       = {Joseph W. Matiko and
                  Stephen P. Beeby and
                  John Tudor},
  title        = {Real time eye blink noise removal from {EEG} signals using morphological
                  component analysis},
  booktitle    = {35th Annual International Conference of the {IEEE} Engineering in
                  Medicine and Biology Society, {EMBC} 2013, Osaka, Japan, July 3-7,
                  2013},
  pages        = {13--16},
  publisher    = {{IEEE}},
  year         = {2013},
  url          = {https://doi.org/10.1109/EMBC.2013.6609425},
  doi          = {10.1109/EMBC.2013.6609425},
  timestamp    = {Wed, 16 Oct 2019 14:14:50 +0200},
  biburl       = {https://dblp.org/rec/conf/embc/MatikoBT13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/enase/KamalakarED13,
  author       = {Sunil Kamalakar and
                  Stephen H. Edwards and
                  Tung M. Dao},
  editor       = {Leszek A. Maciaszek and
                  Joaquim Filipe},
  title        = {Automatically Generating Tests from Natural Language Descriptions
                  of Software Behavior},
  booktitle    = {{ENASE} 2013 - Proceedings of the 8th International Conference on
                  Evaluation of Novel Approaches to Software Engineering, Angers, France,
                  4-6 July, 2013},
  pages        = {238--245},
  publisher    = {SciTePress},
  year         = {2013},
  url          = {https://doi.org/10.5220/0004566002380245},
  doi          = {10.5220/0004566002380245},
  timestamp    = {Fri, 19 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/enase/KamalakarED13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/TurnerU13,
  author       = {Stephen W. Turner and
                  Suleyman Uludag},
  editor       = {Randa L. Shehab and
                  James J. Sluss and
                  Deborah Anne Trytten},
  title        = {Student perceptions of cheating in online and traditional classes},
  booktitle    = {{IEEE} Frontiers in Education Conference, {FIE} 2013, Oklahoma City,
                  Oklahoma, USA, October 23-26, 2013},
  pages        = {1131--1137},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://doi.org/10.1109/FIE.2013.6685007},
  doi          = {10.1109/FIE.2013.6685007},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/fie/TurnerU13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gpce/MarekKZBBTASS13,
  author       = {Luk{\'{a}}s Marek and
                  Stephen Kell and
                  Yudi Zheng and
                  Lubom{\'{\i}}r Bulej and
                  Walter Binder and
                  Petr Tuma and
                  Danilo Ansaloni and
                  Aibek Sarimbekov and
                  Andreas Sewe},
  editor       = {Jaakko J{\"{a}}rvi and
                  Christian K{\"{a}}stner},
  title        = {ShadowVM: robust and comprehensive dynamic program analysis for the
                  java platform},
  booktitle    = {Generative Programming: Concepts and Experiences, GPCE'13, Indianapolis,
                  IN, {USA} - October 27 - 28, 2013},
  pages        = {105--114},
  publisher    = {{ACM}},
  year         = {2013},
  url          = {https://doi.org/10.1145/2517208.2517219},
  doi          = {10.1145/2517208.2517219},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/gpce/MarekKZBBTASS13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hotcloud/LeeLPTBSS13,
  author       = {Jeongkeun Lee and
                  Myungjin Lee and
                  Lucian Popa and
                  Yoshio Turner and
                  Sujata Banerjee and
                  Puneet Sharma and
                  Bryan Stephenson},
  editor       = {Dilma Da Silva and
                  George Porter},
  title        = {CloudMirror: Application-Aware Bandwidth Reservations in the Cloud},
  booktitle    = {5th {USENIX} Workshop on Hot Topics in Cloud Computing, HotCloud'13,
                  San Jose, CA, USA, June 25-26, 2013},
  publisher    = {{USENIX} Association},
  year         = {2013},
  url          = {https://www.usenix.org/conference/hotcloud13/workshop-program/presentations/lee},
  timestamp    = {Tue, 09 Feb 2021 08:31:36 +0100},
  biburl       = {https://dblp.org/rec/conf/hotcloud/LeeLPTBSS13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icaisc/KeithW13,
  author       = {Tureiti Keith and
                  Stephen John Weddell},
  editor       = {Leszek Rutkowski and
                  Marcin Korytkowski and
                  Rafal Scherer and
                  Ryszard Tadeusiewicz and
                  Lotfi A. Zadeh and
                  Jacek M. Zurada},
  title        = {The Echo State Network on the Graphics Processing Unit},
  booktitle    = {Artificial Intelligence and Soft Computing - 12th International Conference,
                  {ICAISC} 2013, Zakopane, Poland, June 9-13, 2013, Proceedings, Part
                  {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {7894},
  pages        = {96--107},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-642-38658-9\_9},
  doi          = {10.1007/978-3-642-38658-9\_9},
  timestamp    = {Wed, 13 Jan 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icaisc/KeithW13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/CharlesAJCTD13,
  author       = {Adam Charles and
                  Ali Ahmed and
                  Aditya Joshi and
                  Stephen Conover and
                  Christopher K. Turnes and
                  Mark A. Davenport},
  title        = {Cleaning up toxic waste: Removing nefarious contributions to recommendation
                  systems},
  booktitle    = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
                  {ICASSP} 2013, Vancouver, BC, Canada, May 26-31, 2013},
  pages        = {6571--6575},
  publisher    = {{IEEE}},
  year         = {2013},
  url          = {https://doi.org/10.1109/ICASSP.2013.6638932},
  doi          = {10.1109/ICASSP.2013.6638932},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/CharlesAJCTD13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccabs/KinserLTRB13,
  author       = {Jason M. Kinser and
                  Stephen J. Lockett and
                  Thomas Turbyville and
                  Karlyne M. Reilly and
                  John Beutler},
  title        = {Comparing analysis engines for generated micro-patterned, actin images},
  booktitle    = {{IEEE} 3rd International Conference on Computational Advances in Bio
                  and Medical Sciences, {ICCABS} 2013, New Orleans, LA, USA, June 12-14,
                  2013},
  pages        = {1--5},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://doi.org/10.1109/ICCABS.2013.6629198},
  doi          = {10.1109/ICCABS.2013.6629198},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccabs/KinserLTRB13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/TullyKC13,
  author       = {Stephen Tully and
                  George Kantor and
                  Howie Choset},
  title        = {Monocular feature-based periodic motion estimation for surgical guidance},
  booktitle    = {2013 {IEEE} International Conference on Robotics and Automation, Karlsruhe,
                  Germany, May 6-10, 2013},
  pages        = {4403--4408},
  publisher    = {{IEEE}},
  year         = {2013},
  url          = {https://doi.org/10.1109/ICRA.2013.6631201},
  doi          = {10.1109/ICRA.2013.6631201},
  timestamp    = {Wed, 16 Oct 2019 14:14:51 +0200},
  biburl       = {https://dblp.org/rec/conf/icra/TullyKC13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ida/PavlidisSTC13,
  author       = {Stelios Pavlidis and
                  Stephen Swift and
                  Allan Tucker and
                  Steve Counsell},
  editor       = {Allan Tucker and
                  Frank H{\"{o}}ppner and
                  Arno Siebes and
                  Stephen Swift},
  title        = {The Modelling of Glaucoma Progression through the Use of Cellular
                  Automata},
  booktitle    = {Advances in Intelligent Data Analysis {XII} - 12th International Symposium,
                  {IDA} 2013, London, UK, October 17-19, 2013. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {8207},
  pages        = {322--332},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-642-41398-8\_28},
  doi          = {10.1007/978-3-642-41398-8\_28},
  timestamp    = {Tue, 14 May 2019 10:00:49 +0200},
  biburl       = {https://dblp.org/rec/conf/ida/PavlidisSTC13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/indin/StephensonAV13,
  author       = {Zo{\"{e}} R. Stephenson and
                  Jaume Abella and
                  Tullio Vardanega},
  title        = {Supporting industrial use of probabilistic timing analysis with explicit
                  argumentation},
  booktitle    = {11th {IEEE} International Conference on Industrial Informatics, {INDIN}
                  2013, Bochum, Germany, July 29-31, 2013},
  pages        = {734--740},
  publisher    = {{IEEE}},
  year         = {2013},
  url          = {https://doi.org/10.1109/INDIN.2013.6622975},
  doi          = {10.1109/INDIN.2013.6622975},
  timestamp    = {Tue, 18 May 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/indin/StephensonAV13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/TangTKWKGTW13,
  author       = {Wai Teng Tang and
                  Wen Jun Tan and
                  Ratna Krishnamoorthy and
                  Yi Wen Wong and
                  Shyh{-}Hao Kuo and
                  Rick Siow Mong Goh and
                  Stephen John Turner and
                  Weng{-}Fai Wong},
  title        = {Optimizing and Auto-Tuning Iterative Stencil Loops for GPUs with the
                  In-Plane Method},
  booktitle    = {27th {IEEE} International Symposium on Parallel and Distributed Processing,
                  {IPDPS} 2013, Cambridge, MA, USA, May 20-24, 2013},
  pages        = {452--462},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://doi.org/10.1109/IPDPS.2013.79},
  doi          = {10.1109/IPDPS.2013.79},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ipps/TangTKWKGTW13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/LiCT13,
  author       = {Xiaosong Li and
                  Wentong Cai and
                  Stephen John Turner},
  editor       = {Margaret L. Loper and
                  Gabriel A. Wainer},
  title        = {{GPU} accelerated three-stage execution model for event-parallel simulation},
  booktitle    = {{SIGSIM} Principles of Advanced Discrete Simulation, {SIGSIM-PADS}
                  '13, Montreal, QC, Canada, May 19-22, 2013},
  pages        = {57--66},
  publisher    = {{ACM}},
  year         = {2013},
  url          = {https://doi.org/10.1145/2486092.2486100},
  doi          = {10.1145/2486092.2486100},
  timestamp    = {Wed, 10 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/LiCT13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/LiLDCT13,
  author       = {Zengxiang Li and
                  Xiaorong Li and
                  Ta Nguyen Binh Duong and
                  Wentong Cai and
                  Stephen John Turner},
  editor       = {Margaret L. Loper and
                  Gabriel A. Wainer},
  title        = {Accelerating optimistic HLA-based simulations in virtual execution
                  environments},
  booktitle    = {{SIGSIM} Principles of Advanced Discrete Simulation, {SIGSIM-PADS}
                  '13, Montreal, QC, Canada, May 19-22, 2013},
  pages        = {211--220},
  publisher    = {{ACM}},
  year         = {2013},
  url          = {https://doi.org/10.1145/2486092.2486119},
  doi          = {10.1145/2486092.2486119},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/LiLDCT13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/TangTRWCKGTW13,
  author       = {Wai Teng Tang and
                  Wen Jun Tan and
                  Rajarshi Ray and
                  Yi Wen Wong and
                  Weiguang Chen and
                  Shyh{-}Hao Kuo and
                  Rick Siow Mong Goh and
                  Stephen John Turner and
                  Weng{-}Fai Wong},
  editor       = {William Gropp and
                  Satoshi Matsuoka},
  title        = {Accelerating sparse matrix-vector multiplication on GPUs using bit-representation-optimized
                  schemes},
  booktitle    = {International Conference for High Performance Computing, Networking,
                  Storage and Analysis, SC'13, Denver, CO, {USA} - November 17 - 21,
                  2013},
  pages        = {26:1--26:12},
  publisher    = {{ACM}},
  year         = {2013},
  url          = {https://doi.org/10.1145/2503210.2503234},
  doi          = {10.1145/2503210.2503234},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sc/TangTRWCKGTW13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sosp/TuZKLM13,
  author       = {Stephen Tu and
                  Wenting Zheng and
                  Eddie Kohler and
                  Barbara Liskov and
                  Samuel Madden},
  editor       = {Michael Kaminsky and
                  Mike Dahlin},
  title        = {Speedy transactions in multicore in-memory databases},
  booktitle    = {{ACM} {SIGOPS} 24th Symposium on Operating Systems Principles, {SOSP}
                  '13, Farmington, PA, USA, November 3-6, 2013},
  pages        = {18--32},
  publisher    = {{ACM}},
  year         = {2013},
  url          = {https://doi.org/10.1145/2517349.2522713},
  doi          = {10.1145/2517349.2522713},
  timestamp    = {Wed, 09 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sosp/TuZKLM13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/supercomputer/PattersonPHMTCMB13,
  author       = {Michael K. Patterson and
                  Stephen W. Poole and
                  Chung{-}Hsing Hsu and
                  Don E. Maxwell and
                  William Tschudi and
                  Henry Coles and
                  David J. Martinez and
                  Natalie J. Bates},
  editor       = {Julian M. Kunkel and
                  Thomas Ludwig and
                  Hans Werner Meuer},
  title        = {TUE, a New Energy-Efficiency Metric Applied at ORNL's Jaguar},
  booktitle    = {Supercomputing - 28th International Supercomputing Conference, {ISC}
                  2013, Leipzig, Germany, June 16-20, 2013. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {7905},
  pages        = {372--382},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-642-38750-0\_28},
  doi          = {10.1007/978-3-642-38750-0\_28},
  timestamp    = {Tue, 14 May 2019 10:00:40 +0200},
  biburl       = {https://dblp.org/rec/conf/supercomputer/PattersonPHMTCMB13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/JinTLZH13,
  author       = {Jiangming Jin and
                  Stephen John Turner and
                  Bu{-}Sung Lee and
                  Jianlong Zhong and
                  Bingsheng He},
  title        = {Simulation studies of viral advertisement diffusion on multi-GPU},
  booktitle    = {Winter Simulations Conference: Simulation Making Decisions in a Complex
                  World, {WSC} 2013, Washington, DC, USA, December 8-11, 2013},
  pages        = {1592--1603},
  publisher    = {{IEEE}},
  year         = {2013},
  url          = {https://doi.org/10.1109/WSC.2013.6721542},
  doi          = {10.1109/WSC.2013.6721542},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/JinTLZH13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:conf/dagstuhl/BroersenCEGGLPTTTS13,
  author       = {Jan M. Broersen and
                  Stephen Cranefield and
                  Yehia Elrakaiby and
                  Dov M. Gabbay and
                  Davide Grossi and
                  Emiliano Lorini and
                  Xavier Parent and
                  Leendert W. N. van der Torre and
                  Luca Tummolini and
                  Paolo Turrini and
                  Fran{\c{c}}ois Schwarzentruber},
  editor       = {Giulia Andrighetto and
                  Guido Governatori and
                  Pablo Noriega and
                  Leendert W. N. van der Torre},
  title        = {Normative Reasoning and Consequence},
  booktitle    = {Normative Multi-Agent Systems},
  series       = {Dagstuhl Follow-Ups},
  volume       = {4},
  pages        = {33--70},
  publisher    = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
  year         = {2013},
  url          = {https://doi.org/10.4230/DFU.Vol4.12111.33},
  doi          = {10.4230/DFU.VOL4.12111.33},
  timestamp    = {Mon, 27 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dagstuhl/BroersenCEGGLPTTTS13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/asiasim/2013,
  editor       = {Gary S. H. Tan and
                  Gee Kin Yeo and
                  Stephen John Turner and
                  Yong Meng Teo},
  title        = {AsiaSim 2013 - 13th International Conference on Systems Simulation,
                  Singapore, November 6-8, 2013. Proceedings},
  series       = {Communications in Computer and Information Science},
  volume       = {402},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-642-45037-2},
  doi          = {10.1007/978-3-642-45037-2},
  isbn         = {978-3-642-45036-5},
  timestamp    = {Fri, 26 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/asiasim/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ida/2013,
  editor       = {Allan Tucker and
                  Frank H{\"{o}}ppner and
                  Arno Siebes and
                  Stephen Swift},
  title        = {Advances in Intelligent Data Analysis {XII} - 12th International Symposium,
                  {IDA} 2013, London, UK, October 17-19, 2013. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {8207},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-642-41398-8},
  doi          = {10.1007/978-3-642-41398-8},
  isbn         = {978-3-642-41397-1},
  timestamp    = {Tue, 14 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ida/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2013,
  editor       = {Nikolaj S. Bj{\o}rner and
                  Viorel Negru and
                  Tetsuo Ida and
                  Tudor Jebelean and
                  Dana Petcu and
                  Stephen M. Watt and
                  Daniela Zaharie},
  title        = {15th International Symposium on Symbolic and Numeric Algorithms for
                  Scientific Computing, {SYNASC} 2013, Timisoara, Romania, September
                  23-26, 2013},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6820820/proceeding},
  isbn         = {978-1-4799-3035-7},
  timestamp    = {Thu, 14 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/synasc/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc6916,
  author       = {Roque Gagliano and
                  Stephen T. Kent and
                  Sean Turner},
  title        = {Algorithm Agility Procedure for the Resource Public Key Infrastructure
                  {(RPKI)}},
  journal      = {{RFC}},
  volume       = {6916},
  pages        = {1--20},
  year         = {2013},
  url          = {https://doi.org/10.17487/RFC6916},
  doi          = {10.17487/RFC6916},
  timestamp    = {Tue, 14 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rfc/rfc6916.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc7093,
  author       = {Sean Turner and
                  Stephen T. Kent and
                  James Manger},
  title        = {Additional Methods for Generating Key Identifiers Values},
  journal      = {{RFC}},
  volume       = {7093},
  pages        = {1--5},
  year         = {2013},
  url          = {https://doi.org/10.17487/RFC7093},
  doi          = {10.17487/RFC7093},
  timestamp    = {Tue, 14 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rfc/rfc7093.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/basesearch/Sachs12,
  author       = {Stephen Sachs},
  title        = {Multigrid Methods applied to Fluid-Structure Interaction},
  school       = {{TU} Darmstadt, Germany},
  year         = {2012},
  url          = {http://tuprints.ulb.tu-darmstadt.de/2917/},
  timestamp    = {Wed, 20 Mar 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/phd/basesearch/Sachs12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/artmed/ZhuGTRD12,
  author       = {Vivienne J. Zhu and
                  Shaun J. Grannis and
                  Wanzhu Tu and
                  Marc B. Rosenman and
                  Stephen M. Downs},
  title        = {Evaluation of a clinical decision support algorithm for patient-specific
                  childhood immunization},
  journal      = {Artif. Intell. Medicine},
  volume       = {56},
  number       = {1},
  pages        = {51--57},
  year         = {2012},
  url          = {https://doi.org/10.1016/j.artmed.2012.04.004},
  doi          = {10.1016/J.ARTMED.2012.04.004},
  timestamp    = {Sun, 25 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/artmed/ZhuGTRD12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmig/WongSTWMA12,
  author       = {Kelvin Kian Loong Wong and
                  Zhonghua Sun and
                  Jiyuan Tu and
                  Stephen G. Worthley and
                  Jagannath Mazumdar and
                  Derek Abbott},
  title        = {Medical image diagnostics based on computer-aided flow analysis using
                  magnetic resonance images},
  journal      = {Comput. Medical Imaging Graph.},
  volume       = {36},
  number       = {7},
  pages        = {527--541},
  year         = {2012},
  url          = {https://doi.org/10.1016/j.compmedimag.2012.04.003},
  doi          = {10.1016/J.COMPMEDIMAG.2012.04.003},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cmig/WongSTWMA12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/ShakeriLTL12,
  author       = {Mojtaba Shakeri and
                  Malcolm Yoke Hean Low and
                  Stephen John Turner and
                  Eng Wah Lee},
  title        = {A robust two-phase heuristic algorithm for the truck scheduling problem
                  in a resource-constrained crossdock},
  journal      = {Comput. Oper. Res.},
  volume       = {39},
  number       = {11},
  pages        = {2564--2577},
  year         = {2012},
  url          = {https://doi.org/10.1016/j.cor.2012.01.002},
  doi          = {10.1016/J.COR.2012.01.002},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cor/ShakeriLTL12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esticas/YooTNLBSWGREC12,
  author       = {Juhwan Yoo and
                  Christopher K. Turnes and
                  Eric B. Nakamura and
                  Chi K. Le and
                  Stephen Becker and
                  Emilio A. Sovero and
                  Michael B. Wakin and
                  Michael C. Grant and
                  Justin K. Romberg and
                  Azita Emami{-}Neyestanak and
                  Emmanuel J. Cand{\`{e}}s},
  title        = {A Compressed Sensing Parameter Extraction Platform for Radar Pulse
                  Signal Acquisition},
  journal      = {{IEEE} J. Emerg. Sel. Topics Circuits Syst.},
  volume       = {2},
  number       = {3},
  pages        = {626--638},
  year         = {2012},
  url          = {https://doi.org/10.1109/JETCAS.2012.2214634},
  doi          = {10.1109/JETCAS.2012.2214634},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/esticas/YooTNLBSWGREC12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijrr/TullyKC12,
  author       = {Stephen Tully and
                  George Kantor and
                  Howie Choset},
  title        = {A unified Bayesian framework for global localization and {SLAM} in
                  hybrid metric/topological maps},
  journal      = {Int. J. Robotics Res.},
  volume       = {31},
  number       = {3},
  pages        = {271--288},
  year         = {2012},
  url          = {https://doi.org/10.1177/0278364911433617},
  doi          = {10.1177/0278364911433617},
  timestamp    = {Thu, 17 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijrr/TullyKC12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jot/ArzokySTC12,
  author       = {Mahir Arzoky and
                  Stephen Swift and
                  Allan Tucker and
                  James Cain},
  title        = {A Seeded Search for the Modularisation of Sequential Software Versions},
  journal      = {J. Object Technol.},
  volume       = {11},
  number       = {2},
  pages        = {6: 1--27},
  year         = {2012},
  url          = {https://doi.org/10.5381/jot.2012.11.2.a6},
  doi          = {10.5381/JOT.2012.11.2.A6},
  timestamp    = {Wed, 17 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jot/ArzokySTC12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WangXSZWZHKDSBGB12,
  author       = {Yanli Wang and
                  Jewen Xiao and
                  Tugba O. Suzek and
                  Jian Zhang and
                  Jiyao Wang and
                  Zhigang Zhou and
                  Lianyi Han and
                  Karen Karapetyan and
                  Svetlana Dracheva and
                  Benjamin A. Shoemaker and
                  Evan Bolton and
                  Asta Gindulyte and
                  Stephen H. Bryant},
  title        = {PubChem's BioAssay Database},
  journal      = {Nucleic Acids Res.},
  volume       = {40},
  number       = {Database-Issue},
  pages        = {400--412},
  year         = {2012},
  url          = {https://doi.org/10.1093/nar/gkr1132},
  doi          = {10.1093/NAR/GKR1132},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/nar/WangXSZWZHKDSBGB12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/LiGFZCYLDJZHZML12,
  author       = {Kaiming Li and
                  Lei Guo and
                  Carlos Faraco and
                  Dajiang Zhu and
                  Hanbo Chen and
                  Yixuan Yuan and
                  Jinglei Lv and
                  Fan Deng and
                  Xi Jiang and
                  Tuo Zhang and
                  Xintao Hu and
                  Degang Zhang and
                  L. Stephen Miller and
                  Tianming Liu},
  title        = {Visual analytics of brain networks},
  journal      = {NeuroImage},
  volume       = {61},
  number       = {1},
  pages        = {82--97},
  year         = {2012},
  url          = {https://doi.org/10.1016/j.neuroimage.2012.02.075},
  doi          = {10.1016/J.NEUROIMAGE.2012.02.075},
  timestamp    = {Thu, 07 Mar 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/neuroimage/LiGFZCYLDJZHZML12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/TurnerLW12,
  author       = {Darren Turner and
                  Arko Lucieer and
                  Christopher S. Watson},
  title        = {An Automated Technique for Generating Georectified Mosaics from Ultra-High
                  Resolution Unmanned Aerial Vehicle {(UAV)} Imagery, Based on Structure
                  from Motion (SfM) Point Clouds},
  journal      = {Remote. Sens.},
  volume       = {4},
  number       = {5},
  pages        = {1392--1410},
  year         = {2012},
  url          = {https://doi.org/10.3390/rs4051392},
  doi          = {10.3390/RS4051392},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/remotesensing/TurnerLW12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/WallaceLWT12,
  author       = {Luke Wallace and
                  Arko Lucieer and
                  Christopher S. Watson and
                  Darren Turner},
  title        = {Development of a UAV-LiDAR System with Application to Forest Inventory},
  journal      = {Remote. Sens.},
  volume       = {4},
  number       = {6},
  pages        = {1519--1543},
  year         = {2012},
  url          = {https://doi.org/10.3390/rs4061519},
  doi          = {10.3390/RS4061519},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/remotesensing/WallaceLWT12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamam/ShipmanT12,
  author       = {Stephen P. Shipman and
                  Hairui Tu},
  title        = {Total Resonant Transmission and Reflection by Periodic Structures},
  journal      = {{SIAM} J. Appl. Math.},
  volume       = {72},
  number       = {1},
  pages        = {216--239},
  year         = {2012},
  url          = {https://doi.org/10.1137/110834196},
  doi          = {10.1137/110834196},
  timestamp    = {Mon, 26 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/siamam/ShipmanT12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/TaylorTSM12,
  author       = {Simon J. E. Taylor and
                  Stephen John Turner and
                  Steffen Stra{\ss}burger and
                  Navonil Mustafee},
  title        = {Bridging the gap: {A} standards-based approach to {OR/MS} distributed
                  simulation},
  journal      = {{ACM} Trans. Model. Comput. Simul.},
  volume       = {22},
  number       = {4},
  pages        = {18:1--18:23},
  year         = {2012},
  url          = {https://doi.org/10.1145/2379810.2379811},
  doi          = {10.1145/2379810.2379811},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tomacs/TaylorTSM12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wc/BaykasKCKKPRSS12,
  author       = {Tuncer Baykas and
                  Mika Kasslin and
                  Mark Cummings and
                  Hyunduk Kang and
                  Joe Kwak and
                  Richard Paine and
                  Alex Reznik and
                  Rashid A. Saeed and
                  Stephen J. Shellhammer},
  title        = {Developing a standard for {TV} white space coexistence: technical
                  challenges and solution approaches},
  journal      = {{IEEE} Wirel. Commun.},
  volume       = {19},
  number       = {1},
  pages        = {10--22},
  year         = {2012},
  url          = {https://doi.org/10.1109/MWC.2012.6155872},
  doi          = {10.1109/MWC.2012.6155872},
  timestamp    = {Fri, 09 Apr 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/wc/BaykasKCKKPRSS12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asiasim/TanTA12,
  author       = {Wen Jun Tan and
                  Stephen John Turner and
                  Heiko Aydt},
  editor       = {Tianyuan Xiao and
                  Lin Zhang and
                  Minrui Fei},
  title        = {A Comparison of Multi-objective Evolutionary Algorithms for Simulation-Based
                  Optimization},
  booktitle    = {AsiaSim 2012 - Asia Simulation Conference 2012, Shanghai, China, October
                  27-30, 2012. Proceedings, Part {III}},
  series       = {Communications in Computer and Information Science},
  volume       = {325},
  pages        = {60--72},
  publisher    = {Springer},
  year         = {2012},
  url          = {https://doi.org/10.1007/978-3-642-34387-2\_8},
  doi          = {10.1007/978-3-642-34387-2\_8},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/asiasim/TanTA12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/europar/WongDTTDGKTW12,
  author       = {Yi Wen Wong and
                  Tomasz Dubrownik and
                  Wai Teng Tang and
                  Wen Jun Tan and
                  Rubing Duan and
                  Rick Siow Mong Goh and
                  Shyh{-}Hao Kuo and
                  Stephen John Turner and
                  Weng{-}Fai Wong},
  editor       = {Christos Kaklamanis and
                  Theodore S. Papatheodorou and
                  Paul G. Spirakis},
  title        = {Tulipse: {A} Visualization Framework for User-Guided Parallelization},
  booktitle    = {Euro-Par 2012 Parallel Processing - 18th International Conference,
                  Euro-Par 2012, Rhodes Island, Greece, August 27-31, 2012. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {7484},
  pages        = {4--15},
  publisher    = {Springer},
  year         = {2012},
  url          = {https://doi.org/10.1007/978-3-642-32820-6\_3},
  doi          = {10.1007/978-3-642-32820-6\_3},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/europar/WongDTTDGKTW12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ewgdss/TurnerW12,
  author       = {Simon Turner and
                  Stephen Wilmott},
  editor       = {Jorge E. Hern{\'{a}}ndez and
                  Shaofeng Liu and
                  Boris Delibasic and
                  Pascale Zarat{\'{e}} and
                  F{\'{a}}tima C. C. Dargam and
                  Rita A. Ribeiro},
  title        = {Decision Analysis in Magnox Limited: Developments in Techniques and
                  Stakeholder Engagement Processes},
  booktitle    = {Decision Support Systems {II} - Recent Developments Applied to {DSS}
                  Network Environments - Euro Working Group Workshop, {EWG-DSS} 2012,
                  Liverpool, UK, April 12-13, 2012, and Vilnius, Lithuania, July 8-11,
                  2012, Revised Selected and Extended Papers},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {164},
  pages        = {115--125},
  publisher    = {Springer},
  year         = {2012},
  url          = {https://doi.org/10.1007/978-3-642-41077-2\_9},
  doi          = {10.1007/978-3-642-41077-2\_9},
  timestamp    = {Wed, 20 Sep 2023 13:32:42 +0200},
  biburl       = {https://dblp.org/rec/conf/ewgdss/TurnerW12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/UludagKGTK12,
  author       = {Suleyman Uludag and
                  Murat Karakus and
                  Evrim Guler and
                  Stephen W. Turner and
                  Afelete Kita},
  editor       = {Richard J. LeBlanc and
                  Ann E. K. Sobel},
  title        = {Assessment of a frugal, virtual and green computing lab infrastructure
                  of the future},
  booktitle    = {{IEEE} Frontiers in Education Conference, {FIE} 2012, Seattle, WA,
                  USA, October 3-6, 2012},
  pages        = {1--6},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://doi.org/10.1109/FIE.2012.6462470},
  doi          = {10.1109/FIE.2012.6462470},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/fie/UludagKGTK12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpads/RajaseharanTTTKGW12,
  author       = {Chandrasehar Rajaseharan and
                  Wen Jun Tan and
                  Wai Teng Tang and
                  Stephen John Turner and
                  Shyh{-}Hao Kuo and
                  Rick Siow Mong Goh and
                  Weng{-}Fai Wong},
  title        = {Automatic Refactoring of Legacy Fortran Code to the Array Slicing
                  Notation},
  booktitle    = {18th {IEEE} International Conference on Parallel and Distributed Systems,
                  {ICPADS} 2012, Singapore, December 17-19, 2012},
  pages        = {698--699},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://doi.org/10.1109/ICPADS.2012.101},
  doi          = {10.1109/ICPADS.2012.101},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icpads/RajaseharanTTTKGW12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/DeganiTZC12,
  author       = {Amir Degani and
                  Stephen Tully and
                  Brett Zubiate and
                  Howie Choset},
  title        = {Over-tube apparatus for increasing the capabilities of an articulated
                  robotic probe},
  booktitle    = {{IEEE} International Conference on Robotics and Automation, {ICRA}
                  2012, 14-18 May, 2012, St. Paul, Minnesota, {USA}},
  pages        = {3533--3534},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://doi.org/10.1109/ICRA.2012.6224668},
  doi          = {10.1109/ICRA.2012.6224668},
  timestamp    = {Wed, 16 Oct 2019 14:14:51 +0200},
  biburl       = {https://dblp.org/rec/conf/icra/DeganiTZC12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/GongTKC12,
  author       = {Chaohui Gong and
                  Stephen Tully and
                  George Kantor and
                  Howie Choset},
  title        = {Multi-agent deterministic graph mapping via robot rendezvous},
  booktitle    = {{IEEE} International Conference on Robotics and Automation, {ICRA}
                  2012, 14-18 May, 2012, St. Paul, Minnesota, {USA}},
  pages        = {1278--1283},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://doi.org/10.1109/ICRA.2012.6225274},
  doi          = {10.1109/ICRA.2012.6225274},
  timestamp    = {Mon, 22 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icra/GongTKC12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/TullyBKCS12,
  author       = {Stephen Tully and
                  Andrea Bajo and
                  George Kantor and
                  Howie Choset and
                  Nabil Simaan},
  title        = {Constrained filtering with contact detection data for the localization
                  and registration of continuum robots in flexible environments},
  booktitle    = {{IEEE} International Conference on Robotics and Automation, {ICRA}
                  2012, 14-18 May, 2012, St. Paul, Minnesota, {USA}},
  pages        = {3388--3394},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://doi.org/10.1109/ICRA.2012.6225080},
  doi          = {10.1109/ICRA.2012.6225080},
  timestamp    = {Mon, 22 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icra/TullyBKCS12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ithet/GulerUKT12,
  author       = {Evrim Guler and
                  Suleyman Uludag and
                  Murat Karakus and
                  Stephen W. Turner},
  title        = {Virtualized lab infrastructure on a budget for various computing and
                  engineering courses},
  booktitle    = {2012 International Conference on Information Technology Based Higher
                  Education and Training, {ITHET} 2012, Istanbul, Turkey, June 21-23,
                  2012},
  pages        = {1--7},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://doi.org/10.1109/ITHET.2012.6246028},
  doi          = {10.1109/ITHET.2012.6246028},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ithet/GulerUKT12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ithet/KarakusUGTU12,
  author       = {Murat Karakus and
                  Suleyman Uludag and
                  Evrim Guler and
                  Stephen W. Turner and
                  Ahmet Ugur},
  title        = {Teaching computing and programming fundamentals via App Inventor for
                  Android},
  booktitle    = {2012 International Conference on Information Technology Based Higher
                  Education and Training, {ITHET} 2012, Istanbul, Turkey, June 21-23,
                  2012},
  pages        = {1--8},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://doi.org/10.1109/ITHET.2012.6246020},
  doi          = {10.1109/ITHET.2012.6246020},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ithet/KarakusUGTU12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/XuLLXCAW12,
  author       = {Yanwu Xu and
                  Jiang Liu and
                  Stephen Lin and
                  Dong Xu and
                  Carol Yim{-}lui Cheung and
                  Tin Aung and
                  Tien Yin Wong},
  editor       = {Nicholas Ayache and
                  Herv{\'{e}} Delingette and
                  Polina Golland and
                  Kensaku Mori},
  title        = {Efficient Optic Cup Detection from Intra-image Learning with Retinal
                  Structure Priors},
  booktitle    = {Medical Image Computing and Computer-Assisted Intervention - {MICCAI}
                  2012 - 15th International Conference, Nice, France, October 1-5, 2012,
                  Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {7510},
  pages        = {58--65},
  publisher    = {Springer},
  year         = {2012},
  url          = {https://doi.org/10.1007/978-3-642-33415-3\_8},
  doi          = {10.1007/978-3-642-33415-3\_8},
  timestamp    = {Mon, 01 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/miccai/XuLLXCAW12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/ZhaoPYQWGOPMET12,
  author       = {Haiping Zhao and
                  Iain Proctor and
                  Minghui Yang and
                  Xin Qi and
                  Mark Williams and
                  Qi Gao and
                  Guilherme Ottoni and
                  Andrew Paroski and
                  Scott MacVicar and
                  Jason Evans and
                  Stephen Tu},
  editor       = {Gary T. Leavens and
                  Matthew B. Dwyer},
  title        = {The HipHop compiler for {PHP}},
  booktitle    = {Proceedings of the 27th Annual {ACM} {SIGPLAN} Conference on Object-Oriented
                  Programming, Systems, Languages, and Applications, {OOPSLA} 2012,
                  part of {SPLASH} 2012, Tucson, AZ, USA, October 21-25, 2012},
  pages        = {575--586},
  publisher    = {{ACM}},
  year         = {2012},
  url          = {https://doi.org/10.1145/2384616.2384658},
  doi          = {10.1145/2384616.2384658},
  timestamp    = {Sat, 21 Oct 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/oopsla/ZhaoPYQWGOPMET12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/LiTCT12,
  author       = {Zengxiang Li and
                  Xueyan Tang and
                  Wentong Cai and
                  Stephen John Turner},
  title        = {Fair and Efficient Dead Reckoning-Based Update Dissemination for Distributed
                  Virtual Environments},
  booktitle    = {26th {ACM/IEEE/SCS} Workshop on Principles of Advanced and Distributed
                  Simulation, {PADS} 2012, Zhangjiajie, China, July 15-19, 2012},
  pages        = {13--22},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://doi.org/10.1109/PADS.2012.18},
  doi          = {10.1109/PADS.2012.18},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/LiTCT12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tpcg/LongshawTF12,
  author       = {Stephen M. Longshaw and
                  Martin J. Turner and
                  Emma Finch},
  editor       = {Hamish A. Carr and
                  Silvester Czanner},
  title        = {Visualizing a Spherical Geological Discrete Element Model of Fault
                  Evolution},
  booktitle    = {Theory and Practice of Computer Graphics, Rutherford, United Kingdom,
                  2012. Proceedings},
  pages        = {77--84},
  publisher    = {Eurographics Association},
  year         = {2012},
  url          = {https://doi.org/10.2312/LocalChapterEvents/TPCG/TPCG12/077-084},
  doi          = {10.2312/LOCALCHAPTEREVENTS/TPCG/TPCG12/077-084},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/tpcg/LongshawTF12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:journals/procedia/JinTLZH12,
  author       = {Jiangming Jin and
                  Stephen John Turner and
                  Bu{-}Sung Lee and
                  Jianlong Zhong and
                  Bingsheng He},
  editor       = {Hesham H. Ali and
                  Yong Shi and
                  Deepak Khazanchi and
                  Michael Lees and
                  G. Dick van Albada and
                  Jack J. Dongarra and
                  Peter M. A. Sloot},
  title        = {{HPC} Simulations of Information Propagation Over Social Networks},
  booktitle    = {Proceedings of the International Conference on Computational Science,
                  {ICCS} 2012, Omaha, Nebraska, USA, 4-6 June, 2012},
  series       = {Procedia Computer Science},
  volume       = {9},
  pages        = {292--301},
  publisher    = {Elsevier},
  year         = {2012},
  url          = {https://doi.org/10.1016/j.procs.2012.04.031},
  doi          = {10.1016/J.PROCS.2012.04.031},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/procedia/JinTLZH12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2012,
  editor       = {Andrei Voronkov and
                  Viorel Negru and
                  Tetsuo Ida and
                  Tudor Jebelean and
                  Dana Petcu and
                  Stephen M. Watt and
                  Daniela Zaharie},
  title        = {14th International Symposium on Symbolic and Numeric Algorithms for
                  Scientific Computing, {SYNASC} 2012, Timisoara, Romania, September
                  26-29, 2012},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6480928/proceeding},
  isbn         = {978-1-4673-5026-6},
  timestamp    = {Wed, 16 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/synasc/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dsp/DavisHTB11,
  author       = {Linda M. Davis and
                  Stephen V. Hanly and
                  Paul Tune and
                  Sibi Raj Bhaskaran},
  title        = {Channel estimation and user selection in the {MIMO} broadcast channel},
  journal      = {Digit. Signal Process.},
  volume       = {21},
  number       = {5},
  pages        = {608--618},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.dsp.2011.01.003},
  doi          = {10.1016/J.DSP.2011.01.003},
  timestamp    = {Thu, 20 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/dsp/DavisHTB11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijrr/SmithTBR11,
  author       = {Stephen L. Smith and
                  Jana Tumova and
                  Calin Belta and
                  Daniela Rus},
  title        = {Optimal path planning for surveillance with temporal-logic constraints},
  journal      = {Int. J. Robotics Res.},
  volume       = {30},
  number       = {14},
  pages        = {1695--1708},
  year         = {2011},
  url          = {https://doi.org/10.1177/0278364911417911},
  doi          = {10.1177/0278364911417911},
  timestamp    = {Thu, 17 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijrr/SmithTBR11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocn/LairdFETRMGBSF11,
  author       = {Angela R. Laird and
                  P. Mickle Fox and
                  Simon B. Eickhoff and
                  Jessica A. Turner and
                  Kimberly L. Ray and
                  David Reese McKay and
                  David C. Glahn and
                  Christian F. Beckmann and
                  Stephen M. Smith and
                  Peter T. Fox},
  title        = {Behavioral Interpretations of Intrinsic Connectivity Networks},
  journal      = {J. Cogn. Neurosci.},
  volume       = {23},
  number       = {12},
  pages        = {4022--4037},
  year         = {2011},
  url          = {https://doi.org/10.1162/jocn\_a\_00077},
  doi          = {10.1162/JOCN\_A\_00077},
  timestamp    = {Mon, 22 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jocn/LairdFETRMGBSF11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/MillerSDJSBJCEVJATJM11,
  author       = {Karla L. Miller and
                  Charlotte J. Stagg and
                  Gwena{\"{e}}lle Douaud and
                  Sa{\^{a}}d Jbabdi and
                  Stephen M. Smith and
                  Timothy Edward John Behrens and
                  Mark Jenkinson and
                  Steven A. Chance and
                  Margaret M. Esiri and
                  Natalie L. Voets and
                  Ned Jenkinson and
                  Tipu Z. Aziz and
                  Martin R. Turner and
                  Heidi Johansen{-}Berg and
                  Jennifer A. McNab},
  title        = {Diffusion imaging of whole, post-mortem human brains on a clinical
                  {MRI} scanner},
  journal      = {NeuroImage},
  volume       = {57},
  number       = {1},
  pages        = {167--181},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.neuroimage.2011.03.070},
  doi          = {10.1016/J.NEUROIMAGE.2011.03.070},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/neuroimage/MillerSDJSBJCEVJATJM11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/WilliamsTDWMBHLSHAKLTGVCF11,
  author       = {Tim D. Williams and
                  Nil Turan and
                  Amer M. Diab and
                  Huifeng Wu and
                  Carolynn Mackenzie and
                  Katie L. Bartie and
                  Olga Hrydziuszko and
                  Brett P. Lyons and
                  Grant D. Stentiford and
                  John M. Herbert and
                  Joseph K. Abraham and
                  Ioanna Katsiadaki and
                  Michael J. Leaver and
                  John B. Taggart and
                  Stephen G. George and
                  Mark R. Viant and
                  Kevin J. Chipman and
                  Francesco Falciani},
  title        = {Towards a System Level Understanding of Non-Model Organisms Sampled
                  from the Environment: {A} Network Biology Approach},
  journal      = {PLoS Comput. Biol.},
  volume       = {7},
  number       = {8},
  year         = {2011},
  url          = {https://doi.org/10.1371/journal.pcbi.1002126},
  doi          = {10.1371/JOURNAL.PCBI.1002126},
  timestamp    = {Thu, 10 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ploscb/WilliamsTDWMBHLSHAKLTGVCF11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/presence/SmithCDCBPCTBBGHMWC11,
  author       = {Cameron G. Smith and
                  Nigel T. Crook and
                  Simon Dobnik and
                  Daniel Charlton and
                  Johan Boye and
                  Stephen G. Pulman and
                  Ra{\'{u}}l Santos de la C{\'{a}}mara and
                  Markku Turunen and
                  David Benyon and
                  Jay Bradley and
                  Bj{\"{o}}rn Gamb{\"{a}}ck and
                  Preben Hansen and
                  Oli H. Mival and
                  Nick Webb and
                  Marc Cavazza},
  title        = {Interaction Strategies for an Affective Conversational Agent},
  journal      = {Presence Teleoperators Virtual Environ.},
  volume       = {20},
  number       = {5},
  pages        = {395--411},
  year         = {2011},
  url          = {https://doi.org/10.1162/PRES\_a\_00063},
  doi          = {10.1162/PRES\_A\_00063},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/presence/SmithCDCBPCTBBGHMWC11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamma/GustafsonP11,
  author       = {Stephen Gustafson and
                  Tuoc Van Phan},
  title        = {Stable Directions for Degenerate Excited States of Nonlinear Schr{\"{o}}dinger
                  Equations},
  journal      = {{SIAM} J. Math. Anal.},
  volume       = {43},
  number       = {4},
  pages        = {1716--1758},
  year         = {2011},
  url          = {https://doi.org/10.1137/10079210X},
  doi          = {10.1137/10079210X},
  timestamp    = {Fri, 03 Jul 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/siamma/GustafsonP11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamsc/TuminaroBCDEFJKKKLMMSW11,
  author       = {Ray Tuminaro and
                  Michele Benzi and
                  Xiao{-}Chuan Cai and
                  Iain Duff and
                  Howard C. Elman and
                  Roland Freund and
                  Kirk E. Jordan and
                  Tim Kelley and
                  David E. Keyes and
                  Misha Elena Kilmer and
                  Sven Leyffer and
                  Tom Manteuffel and
                  Steve F. McCormick and
                  David J. Silvester and
                  Homer F. Walker},
  title        = {Special Section: 2010 Copper Mountain Conference},
  journal      = {{SIAM} J. Sci. Comput.},
  volume       = {33},
  number       = {5},
  pages        = {2685},
  year         = {2011},
  url          = {https://doi.org/10.1137/SJOCE3000033000005002685000001},
  doi          = {10.1137/SJOCE3000033000005002685000001},
  timestamp    = {Mon, 26 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/siamsc/TuminaroBCDEFJKKKLMMSW11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tec/AydtTCLOA11,
  author       = {Heiko Aydt and
                  Stephen John Turner and
                  Wentong Cai and
                  Malcolm Yoke Hean Low and
                  Yew{-}Soon Ong and
                  Rassul Ayani},
  title        = {Toward an Evolutionary Computing Modeling Language},
  journal      = {{IEEE} Trans. Evol. Comput.},
  volume       = {15},
  number       = {2},
  pages        = {230--247},
  year         = {2011},
  url          = {https://doi.org/10.1109/TEVC.2010.2081368},
  doi          = {10.1109/TEVC.2010.2081368},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tec/AydtTCLOA11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/PanTCL11,
  author       = {Ke Pan and
                  Stephen John Turner and
                  Wentong Cai and
                  Zengxiang Li},
  title        = {A dynamic sort-based {DDM} matching algorithm for {HLA} applications},
  journal      = {{ACM} Trans. Model. Comput. Simul.},
  volume       = {21},
  number       = {3},
  pages        = {17:1--17:17},
  year         = {2011},
  url          = {https://doi.org/10.1145/1921598.1921601},
  doi          = {10.1145/1921598.1921601},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tomacs/PanTCL11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/TulpuleYWR11,
  author       = {Pinak Tulpule and
                  Stephen Yurkovich and
                  J. Wang and
                  Giorgio Rizzoni},
  title        = {Hybrid large scale system model for a {DC} microgrid},
  booktitle    = {American Control Conference, {ACC} 2011, San Francisco, CA, USA, June
                  29 - July 1, 2011},
  pages        = {3899--3904},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/ACC.2011.5990841},
  doi          = {10.1109/ACC.2011.5990841},
  timestamp    = {Sun, 08 Oct 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/amcc/TulpuleYWR11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/Turner11,
  author       = {Stephen John Turner},
  editor       = {David J. Roberts and
                  J. Mark Pullen and
                  Georgios Theodoropoulos and
                  Nick J. Avis},
  title        = {Symbiotic Simulation and Its Application to Complex Adaptive Systems},
  booktitle    = {15th {IEEE/ACM} International Symposium on Distributed Simulation
                  and Real Time Applications, {DS-RT} 2011, Salford, United Kingdom,
                  September 4-7, 2011},
  pages        = {3},
  publisher    = {{IEEE} Computer Society},
  year         = {2011},
  url          = {https://doi.org/10.1109/DS-RT.2011.36},
  doi          = {10.1109/DS-RT.2011.36},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dsrt/Turner11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/SakellariouCGTKC11,
  author       = {Sophia Sakellariou and
                  Vassilis Charissis and
                  Stephen Grant and
                  Janice Turner and
                  Dianne Kelly and
                  Chistodoulos Christomanos},
  editor       = {Randall Shumaker},
  title        = {Virtual Reality as Knowledge Enhancement Tool for Musculoskeletal
                  Pathology},
  booktitle    = {Virtual and Mixed Reality - Systems and Applications - International
                  Conference, Virtual and Mixed Reality 2011, Held as Part of {HCI}
                  International 2011, Orlando, FL, USA, July 9-14, 2011, Proceedings,
                  Part {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {6774},
  pages        = {54--63},
  publisher    = {Springer},
  year         = {2011},
  url          = {https://doi.org/10.1007/978-3-642-22024-1\_7},
  doi          = {10.1007/978-3-642-22024-1\_7},
  timestamp    = {Sun, 25 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/hci/SakellariouCGTKC11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icbo/MungallABCCCCDEEGKILMMTTTTWH11,
  author       = {Chris Mungall and
                  David Anderson and
                  Anita E. Bandrowski and
                  Brian A. Canada and
                  Andrew Chatr{-}aryamontri and
                  Keith C. Cheng and
                  P. Michael Conn and
                  Kara Dolinski and
                  Mark H. Ellisman and
                  Janan T. Eppig and
                  Jeffrey S. Grethe and
                  Joseph W. Kemnitz and
                  Shawn Iadonato and
                  Stephen D. Larson and
                  Charles Magness and
                  Maryann E. Martone and
                  Mike Tyers and
                  Carlo Torniai and
                  Olga G. Troyanskaya and
                  Judith Turner and
                  Monte Westerfield and
                  Melissa A. Haendel},
  editor       = {Olivier Bodenreider and
                  Maryann E. Martone and
                  Alan Ruttenberg},
  title        = {An Ontology-Based Approach to Linking Model Organisms and Resources
                  to Human Diseases},
  booktitle    = {Proceedings of the 2nd International Conference on Biomedical Ontology,
                  Buffalo, NY, USA, July 26-30, 2011},
  series       = {{CEUR} Workshop Proceedings},
  volume       = {833},
  publisher    = {CEUR-WS.org},
  year         = {2011},
  url          = {https://ceur-ws.org/Vol-833/paper43.pdf},
  timestamp    = {Fri, 10 Mar 2023 16:22:24 +0100},
  biburl       = {https://dblp.org/rec/conf/icbo/MungallABCCCCDEEGKILMMTTTTWH11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/TaoTKC11,
  author       = {Tong Tao and
                  Stephen Tully and
                  George Kantor and
                  Howie Choset},
  title        = {Incremental construction of the saturated-GVG for multi-hypothesis
                  topological {SLAM}},
  booktitle    = {{IEEE} International Conference on Robotics and Automation, {ICRA}
                  2011, Shanghai, China, 9-13 May 2011},
  pages        = {3072--3077},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/ICRA.2011.5980524},
  doi          = {10.1109/ICRA.2011.5980524},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icra/TaoTKC11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icst/ArzokySTC11,
  author       = {Mahir Arzoky and
                  Stephen Swift and
                  Allan Tucker and
                  James Cain},
  title        = {Munch: An Efficient Modularisation Strategy to Assess the Degree of
                  Refactoring on Sequential Source Code Checkings},
  booktitle    = {Fourth {IEEE} International Conference on Software Testing, Verification
                  and Validation, {ICST} 2012, Berlin, Germany, 21-25 March, 2011, Workshop
                  Proceedings},
  pages        = {422--429},
  publisher    = {{IEEE} Computer Society},
  year         = {2011},
  url          = {https://doi.org/10.1109/ICSTW.2011.87},
  doi          = {10.1109/ICSTW.2011.87},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icst/ArzokySTC11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/FuTKC11,
  author       = {Yu Fu and
                  Stephen Tully and
                  George Kantor and
                  Howie Choset},
  title        = {Monte Carlo Localization using 3D texture maps},
  booktitle    = {2011 {IEEE/RSJ} International Conference on Intelligent Robots and
                  Systems, {IROS} 2011, San Francisco, CA, USA, September 25-30, 2011},
  pages        = {482--487},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/IROS.2011.6094843},
  doi          = {10.1109/IROS.2011.6094843},
  timestamp    = {Wed, 16 Oct 2019 14:14:51 +0200},
  biburl       = {https://dblp.org/rec/conf/iros/FuTKC11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/TullyKC11,
  author       = {Stephen Tully and
                  George Kantor and
                  Howie Choset},
  title        = {Inequality constrained Kalman filtering for the localization and registration
                  of a surgical robot},
  booktitle    = {2011 {IEEE/RSJ} International Conference on Intelligent Robots and
                  Systems, {IROS} 2011, San Francisco, CA, USA, September 25-30, 2011},
  pages        = {5147--5152},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/IROS.2011.6094750},
  doi          = {10.1109/IROS.2011.6094750},
  timestamp    = {Mon, 22 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iros/TullyKC11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/TullyKZC11,
  author       = {Stephen Tully and
                  George Kantor and
                  Marco A. Zenati and
                  Howie Choset},
  title        = {Shape estimation for image-guided surgery with a highly articulated
                  snake robot},
  booktitle    = {2011 {IEEE/RSJ} International Conference on Intelligent Robots and
                  Systems, {IROS} 2011, San Francisco, CA, USA, September 25-30, 2011},
  pages        = {1353--1358},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/IROS.2011.6094751},
  doi          = {10.1109/IROS.2011.6094751},
  timestamp    = {Mon, 22 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iros/TullyKZC11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isqed/TuanLKT11,
  author       = {Tim Tuan and
                  Austin Lesea and
                  Chris Kingsley and
                  Steven Trimberger},
  title        = {Analysis of within-die process variation in 65nm FPGAs},
  booktitle    = {Proceedings of the 12th International Symposium on Quality Electronic
                  Design, {ISQED} 2011, Santa Clara, California, USA, 14-16 March 2011},
  pages        = {716--720},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/ISQED.2011.5770808},
  doi          = {10.1109/ISQED.2011.5770808},
  timestamp    = {Wed, 16 Oct 2019 14:14:55 +0200},
  biburl       = {https://dblp.org/rec/conf/isqed/TuanLKT11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mhci/BrewsterJMNRST11,
  author       = {Stephen A. Brewster and
                  Matt Jones and
                  Roderick Murray{-}Smith and
                  Amit Anil Nanavati and
                  Nitendra Rajput and
                  Albrecht Schmidt and
                  Markku Turunen},
  editor       = {Markus Bylund and
                  Oskar Juhlin and
                  Ylva Fernaeus},
  title        = {We need to talk: rediscovering audio for universal access},
  booktitle    = {Proceedings of the 13th Conference on Human-Computer Interaction with
                  Mobile Devices and Services, Mobile {HCI} 2011, Stockholm, Sweden,
                  August 30 - September 2, 2011},
  pages        = {715--716},
  publisher    = {{ACM}},
  year         = {2011},
  url          = {https://doi.org/10.1145/2037373.2037494},
  doi          = {10.1145/2037373.2037494},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/mhci/BrewsterJMNRST11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/GongLCWYZGM11,
  author       = {Zhaojin Gong and
                  Jianfeng Lu and
                  Jia Chen and
                  Yaping Wang and
                  Yixuan Yuan and
                  Tuo Zhang and
                  Lei Guo and
                  L. Stephen Miller},
  editor       = {Tianming Liu and
                  Dinggang Shen and
                  Luis Ib{\'{a}}{\~{n}}ez and
                  Xiaodong Tao},
  title        = {Ventricle Shape Analysis for Centenarians, Elderly Subjects, {MCI}
                  and {AD} Patients},
  booktitle    = {Multimodal Brain Image Analysis, First International Workshop, {MBIA}
                  2011, Held in Conjunction with {MICCAI} 2011, Toronto, Canada, September
                  18, 2011. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {7012},
  pages        = {84--92},
  publisher    = {Springer},
  year         = {2011},
  url          = {https://doi.org/10.1007/978-3-642-24446-9\_11},
  doi          = {10.1007/978-3-642-24446-9\_11},
  timestamp    = {Mon, 19 Feb 2024 14:24:13 +0100},
  biburl       = {https://dblp.org/rec/conf/miccai/GongLCWYZGM11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/XuXLLCCAW11,
  author       = {Yanwu Xu and
                  Dong Xu and
                  Stephen Lin and
                  Jiang Liu and
                  Jun Cheng and
                  Carol Yim{-}lui Cheung and
                  Tin Aung and
                  Tien Yin Wong},
  editor       = {Gabor Fichtinger and
                  Anne L. Martel and
                  Terry M. Peters},
  title        = {Sliding Window and Regression Based Cup Detection in Digital Fundus
                  Images for Glaucoma Diagnosis},
  booktitle    = {Medical Image Computing and Computer-Assisted Intervention - {MICCAI}
                  2011 - 14th International Conference, Toronto, Canada, September 18-22,
                  2011, Proceedings, Part {III}},
  series       = {Lecture Notes in Computer Science},
  volume       = {6893},
  pages        = {1--8},
  publisher    = {Springer},
  year         = {2011},
  url          = {https://doi.org/10.1007/978-3-642-23626-6\_1},
  doi          = {10.1007/978-3-642-23626-6\_1},
  timestamp    = {Mon, 01 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/miccai/XuXLLCCAW11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/psb/TurnerB11,
  author       = {Stephen D. Turner and
                  William S. Bush},
  editor       = {Russ B. Altman and
                  A. Keith Dunker and
                  Lawrence Hunter and
                  Tiffany Murray and
                  Teri E. Klein},
  title        = {Multivariate Analysis of Regulatory Snps: Empowering Personal Genomics
                  by Considering Cis-Epistasis and Heterogeneity},
  booktitle    = {Biocomputing 2011: Proceedings of the Pacific Symposium, Kohala Coast,
                  Hawaii, USA, 3-7 January 2011},
  pages        = {276--287},
  publisher    = {World Scientific Publishing},
  year         = {2011},
  url          = {http://psb.stanford.edu/psb-online/proceedings/psb11/turner.pdf},
  timestamp    = {Thu, 12 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/psb/TurnerB11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rivp/BasharatTSBLAP11,
  author       = {Arslan Basharat and
                  Wes Turner and
                  Gillian Stephens and
                  Benjamin Badillo and
                  Rick Lumpkin and
                  Patrick Andre and
                  Amitha Perera},
  editor       = {Nasser Kehtarnavaz and
                  Matthias F. Carlsohn},
  title        = {Tracking flow of leukocytes in blood for drug analysis},
  booktitle    = {Real-Time Image and Video Processing 2011, San Francisco Airport,
                  CA, USA, January 24-25, 2011},
  series       = {{SPIE} Proceedings},
  volume       = {7871},
  pages        = {78710N},
  publisher    = {{SPIE}},
  year         = {2011},
  url          = {https://doi.org/10.1117/12.872509},
  doi          = {10.1117/12.872509},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/rivp/BasharatTSBLAP11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/TurnerPEC11,
  author       = {Scott A. Turner and
                  Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and
                  Stephen H. Edwards and
                  Joseph Chase},
  editor       = {Thomas J. Cortina and
                  Ellen Lowenfeld Walker and
                  Laurie A. Smith King and
                  David R. Musicant},
  title        = {Student attitudes and motivation for peer review in {CS2}},
  booktitle    = {Proceedings of the 42nd {ACM} technical symposium on Computer science
                  education, {SIGCSE} 2011, Dallas, TX, USA, March 9-12, 2011},
  pages        = {347--352},
  publisher    = {{ACM}},
  year         = {2011},
  url          = {https://doi.org/10.1145/1953163.1953268},
  doi          = {10.1145/1953163.1953268},
  timestamp    = {Wed, 10 Mar 2021 13:17:16 +0100},
  biburl       = {https://dblp.org/rec/conf/sigcse/TurnerPEC11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigite/UludagKT11,
  author       = {Suleyman Uludag and
                  Murat Karakus and
                  Stephen W. Turner},
  editor       = {Bryan S. Goda and
                  Edward Sobiesk and
                  Randy W. Connolly},
  title        = {Implementing {IT0/CS0} with scratch, app inventor forandroid, and
                  lego mindstorms},
  booktitle    = {SIGITE' 11 {ACM} Special Interest Group for Information Technology
                  Education Conference, West Point, NY, USA, October 20-22, 2011},
  pages        = {183--190},
  publisher    = {{ACM}},
  year         = {2011},
  url          = {https://doi.org/10.1145/2047594.2047645},
  doi          = {10.1145/2047594.2047645},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sigite/UludagKT11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/AydtTCG11,
  author       = {Heiko Aydt and
                  Stephen John Turner and
                  Wentong Cai and
                  Boon{-}Ping Gan},
  editor       = {S. Jain and
                  Roy R. Creasey Jr. and
                  Jan Himmelspach and
                  K. Preston White and
                  Michael C. Fu},
  title        = {Symbiotic simulation for optimisation of tool operations in semiconductor
                  manufacturing},
  booktitle    = {Winter Simulation Conference 2011, WSC'11, Phoenix, AZ, USA, December
                  11-14, 2011},
  pages        = {2093--2104},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/WSC.2011.6147922},
  doi          = {10.1109/WSC.2011.6147922},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/AydtTCG11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TaylorGMTKFKS11,
  author       = {Simon J. E. Taylor and
                  Mohammadmersad Ghorbani and
                  Navonil Mustafee and
                  Stephen John Turner and
                  Tam{\'{a}}s Kiss and
                  Daniel Farkas and
                  Shane Kite and
                  Steffen Stra{\ss}burger},
  editor       = {S. Jain and
                  Roy R. Creasey Jr. and
                  Jan Himmelspach and
                  K. Preston White and
                  Michael C. Fu},
  title        = {Distributed computing and modeling {\&} simulation: speeding up
                  simulations and creating large models},
  booktitle    = {Winter Simulation Conference 2011, WSC'11, Phoenix, AZ, USA, December
                  11-14, 2011},
  pages        = {161--175},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/WSC.2011.6147748},
  doi          = {10.1109/WSC.2011.6147748},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/TaylorGMTKFKS11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2011,
  editor       = {Dongming Wang and
                  Viorel Negru and
                  Tetsuo Ida and
                  Tudor Jebelean and
                  Dana Petcu and
                  Stephen M. Watt and
                  Daniela Zaharie},
  title        = {13th International Symposium on Symbolic and Numeric Algorithms for
                  Scientific Computing, {SYNASC} 2011, Timisoara, Romania, September
                  26-29, 2011},
  publisher    = {{IEEE} Computer Society},
  year         = {2011},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6168887/proceeding},
  isbn         = {978-1-4673-0207-4},
  timestamp    = {Tue, 19 Nov 2019 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/synasc/2011.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biodatamining/TurnerDR10,
  author       = {Stephen D. Turner and
                  Scott M. Dudek and
                  Marylyn D. Ritchie},
  title        = {{ATHENA:} {A} knowledge-based hybrid backpropagation-grammatical evolution
                  neural network algorithm for discovering epistasis among quantitative
                  trait Loci},
  journal      = {BioData Min.},
  volume       = {3},
  pages        = {5},
  year         = {2010},
  url          = {https://doi.org/10.1186/1756-0381-3-5},
  doi          = {10.1186/1756-0381-3-5},
  timestamp    = {Wed, 01 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/biodatamining/TurnerDR10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ese/KitchenhamBTNLPB10,
  author       = {Barbara A. Kitchenham and
                  Pearl Brereton and
                  Mark Turner and
                  Mahmood Niazi and
                  Stephen G. Linkman and
                  Rialette Pretorius and
                  David Budgen},
  title        = {Refining the systematic literature review process - two participant-observer
                  case studies},
  journal      = {Empir. Softw. Eng.},
  volume       = {15},
  number       = {6},
  pages        = {618--653},
  year         = {2010},
  url          = {https://doi.org/10.1007/s10664-010-9134-8},
  doi          = {10.1007/S10664-010-9134-8},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ese/KitchenhamBTNLPB10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/imm/SchmalzelBRMTFF10,
  author       = {John L. Schmalzel and
                  Andrew Bracey and
                  Stephen Rawls and
                  Jon Morris and
                  Mark Turowski and
                  Richard Franzl and
                  Fernando Figueroa},
  title        = {Smart sensor demonstration payload},
  journal      = {{IEEE} Instrum. Meas. Mag.},
  volume       = {13},
  number       = {5},
  pages        = {8--15},
  year         = {2010},
  url          = {https://doi.org/10.1109/MIM.2010.5585068},
  doi          = {10.1109/MIM.2010.5585068},
  timestamp    = {Sat, 19 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/imm/SchmalzelBRMTFF10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/infsof/KitchenhamPBBTNL10,
  author       = {Barbara A. Kitchenham and
                  Rialette Pretorius and
                  David Budgen and
                  Pearl Brereton and
                  Mark Turner and
                  Mahmood Niazi and
                  Stephen G. Linkman},
  title        = {Systematic literature reviews in software engineering - {A} tertiary
                  study},
  journal      = {Inf. Softw. Technol.},
  volume       = {52},
  number       = {8},
  pages        = {792--805},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.infsof.2010.03.006},
  doi          = {10.1016/J.INFSOF.2010.03.006},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/infsof/KitchenhamPBBTNL10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcphy/LemieuxTSTTHA10,
  author       = {Jean{-}Fran{\c{c}}ois Lemieux and
                  L. Bruno Tremblay and
                  Jan Sedl{\'{a}}cek and
                  Paul F. Tupper and
                  Stephen Thomas and
                  David Huard and
                  Jean{-}Pierre Auclair},
  title        = {Improving the numerical convergence of viscous-plastic sea ice models
                  with the Jacobian-free Newton-Krylov method},
  journal      = {J. Comput. Phys.},
  volume       = {229},
  number       = {8},
  pages        = {2840--2852},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.jcp.2009.12.011},
  doi          = {10.1016/J.JCP.2009.12.011},
  timestamp    = {Wed, 19 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jcphy/LemieuxTSTTHA10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/ChenTCTXL10,
  author       = {Dan Chen and
                  Stephen John Turner and
                  Wentong Cai and
                  Georgios K. Theodoropoulos and
                  Muzhou Xiong and
                  Michael Lees},
  title        = {Synchronization in federation community networks},
  journal      = {J. Parallel Distributed Comput.},
  volume       = {70},
  number       = {2},
  pages        = {144--159},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.jpdc.2009.10.006},
  doi          = {10.1016/J.JPDC.2009.10.006},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jpdc/ChenTCTXL10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lht/MutulaK10,
  author       = {Stephen Mutula and
                  Tumelo Kalaote},
  title        = {Open source software deployment in the public sector: a review of
                  Botswana and South Africa},
  journal      = {Libr. Hi Tech},
  volume       = {28},
  number       = {1},
  pages        = {63--80},
  year         = {2010},
  url          = {https://doi.org/10.1108/07378831011026698},
  doi          = {10.1108/07378831011026698},
  timestamp    = {Mon, 28 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/lht/MutulaK10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/WilsonFZTYCG10,
  author       = {Carlene Wilson and
                  Ingrid H. K. Flight and
                  Ian Zajac and
                  Deborah Turnbull and
                  Graeme P. Young and
                  Stephen R. Cole and
                  Tess Gregory},
  title        = {Protocol for population testing of an Internet-based Personalised
                  Decision Support system for colorectal cancer screening},
  journal      = {{BMC} Medical Informatics Decis. Mak.},
  volume       = {10},
  pages        = {50},
  year         = {2010},
  url          = {https://doi.org/10.1186/1472-6947-10-50},
  doi          = {10.1186/1472-6947-10-50},
  timestamp    = {Mon, 26 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/midm/WilsonFZTYCG10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/GrilloTLMLBGHPPP10,
  author       = {Giorgio Grillo and
                  Antonio Turi and
                  Flavio Licciulli and
                  Flavio Mignone and
                  Sabino Liuni and
                  Sandro Banfi and
                  Vincenzo Alessandro Gennarino and
                  David Stephen Horner and
                  Giulio Pavesi and
                  Ernesto Picardi and
                  Graziano Pesole},
  title        = {UTRdb and UTRsite {(RELEASE} 2010): a collection of sequences and
                  regulatory motifs of the untranslated regions of eukaryotic mRNAs},
  journal      = {Nucleic Acids Res.},
  volume       = {38},
  number       = {Database-Issue},
  pages        = {75--80},
  year         = {2010},
  url          = {https://doi.org/10.1093/nar/gkp902},
  doi          = {10.1093/NAR/GKP902},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/GrilloTLMLBGHPPP10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WangBDKSSWXZB10,
  author       = {Yanli Wang and
                  Evan Bolton and
                  Svetlana Dracheva and
                  Karen Karapetyan and
                  Benjamin A. Shoemaker and
                  Tugba O. Suzek and
                  Jiyao Wang and
                  Jewen Xiao and
                  Jian Zhang and
                  Stephen H. Bryant},
  title        = {An overview of the PubChem BioAssay resource},
  journal      = {Nucleic Acids Res.},
  volume       = {38},
  number       = {Database-Issue},
  pages        = {255--266},
  year         = {2010},
  url          = {https://doi.org/10.1093/nar/gkp965},
  doi          = {10.1093/NAR/GKP965},
  timestamp    = {Thu, 23 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/WangBDKSSWXZB10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigops/BarrBDGHNTZ10,
  author       = {Kenneth C. Barr and
                  Prashanth P. Bungale and
                  Stephen Deasy and
                  Viktor Gyuris and
                  Perry Hung and
                  Craig Newell and
                  Harvey Tuch and
                  Bruno Zoppis},
  title        = {The VMware mobile virtualization platform: is that a hypervisor in
                  your pocket?},
  journal      = {{ACM} {SIGOPS} Oper. Syst. Rev.},
  volume       = {44},
  number       = {4},
  pages        = {124--135},
  year         = {2010},
  url          = {https://doi.org/10.1145/1899928.1899945},
  doi          = {10.1145/1899928.1899945},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sigops/BarrBDGHNTZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/JeongSTFMWRLP10,
  author       = {Won{-}Ki Jeong and
                  Jens Schneider and
                  Stephen G. Turney and
                  Beverly E. Faulkner{-}Jones and
                  Dominik Meyer and
                  R{\"{u}}diger Westermann and
                  R. Clay Reid and
                  Jeff Lichtman and
                  Hanspeter Pfister},
  title        = {Interactive Histology of Large-Scale Biomedical Image Stacks},
  journal      = {{IEEE} Trans. Vis. Comput. Graph.},
  volume       = {16},
  number       = {6},
  pages        = {1386--1395},
  year         = {2010},
  url          = {https://doi.org/10.1109/TVCG.2010.168},
  doi          = {10.1109/TVCG.2010.168},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tvcg/JeongSTFMWRLP10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/TullyKC10,
  author       = {Stephen Tully and
                  George Kantor and
                  Howie Choset},
  editor       = {Maria Fox and
                  David Poole},
  title        = {A Single-Step Maximum {A} Posteriori Update for Bearing-Only {SLAM}},
  booktitle    = {Proceedings of the Twenty-Fourth {AAAI} Conference on Artificial Intelligence,
                  {AAAI} 2010, Atlanta, Georgia, USA, July 11-15, 2010},
  pages        = {1252--1257},
  publisher    = {{AAAI} Press},
  year         = {2010},
  url          = {https://doi.org/10.1609/aaai.v24i1.7736},
  doi          = {10.1609/AAAI.V24I1.7736},
  timestamp    = {Mon, 04 Sep 2023 16:23:45 +0200},
  biburl       = {https://dblp.org/rec/conf/aaai/TullyKC10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibe/NguyenFACL10,
  author       = {Tung T. Nguyen and
                  Panagiota T. Foteinou and
                  Ioannis P. Androulakis and
                  Steve E. Calvano and
                  Stephen F. Lowry},
  title        = {Dynamic Complexity of the Temporal Transcriptional Regulation Program
                  in Human Endotoxemia},
  booktitle    = {10th {IEEE} International Conference on Bioinformatics and Bioengineering,
                  {BIBE} 2010, Philadelphia, Pennsylvania, USA, May 31-June 3 2010},
  pages        = {112--117},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/BIBE.2010.27},
  doi          = {10.1109/BIBE.2010.27},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/bibe/NguyenFACL10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cloud/ArmbrustLTFFP10,
  author       = {Michael Armbrust and
                  Nick Lanham and
                  Stephen Tu and
                  Armando Fox and
                  Michael J. Franklin and
                  David A. Patterson},
  editor       = {Joseph M. Hellerstein and
                  Surajit Chaudhuri and
                  Mendel Rosenblum},
  title        = {The case for {PIQL:} a performance insightful query language},
  booktitle    = {Proceedings of the 1st {ACM} Symposium on Cloud Computing, SoCC 2010,
                  Indianapolis, Indiana, USA, June 10-11, 2010},
  pages        = {131--136},
  publisher    = {{ACM}},
  year         = {2010},
  url          = {https://doi.org/10.1145/1807128.1807149},
  doi          = {10.1145/1807128.1807149},
  timestamp    = {Thu, 13 Apr 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cloud/ArmbrustLTFFP10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cscw/TuckerBRW10,
  author       = {Simon Tucker and
                  Ofer Bergman and
                  Anand Ramamoorthy and
                  Steve Whittaker},
  editor       = {Kori Inkpen and
                  Carl Gutwin and
                  John C. Tang},
  title        = {Catchup: a useful application of time-travel in meetings},
  booktitle    = {Proceedings of the 2010 {ACM} Conference on Computer Supported Cooperative
                  Work, {CSCW} 2010, Savannah, Georgia, USA, February 6-10, 2010},
  pages        = {99--102},
  publisher    = {{ACM}},
  year         = {2010},
  url          = {https://doi.org/10.1145/1718918.1718937},
  doi          = {10.1145/1718918.1718937},
  timestamp    = {Mon, 11 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cscw/TuckerBRW10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/LiCTP10,
  author       = {Zengxiang Li and
                  Wentong Cai and
                  Stephen John Turner and
                  Ke Pan},
  editor       = {Stephen John Turner and
                  David J. Roberts},
  title        = {A Three-Phases Byzantine Fault Tolerance Mechanism for HLA-Based Simulation},
  booktitle    = {{DS-RT} '10 Proceedings of the 2010 {IEEE/ACM} 14th International
                  Symposium on Distributed Simulation and Real Time Applications, Fairfax,
                  Virginia, USA, 17-20 October 2010},
  pages        = {149--158},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/DS-RT.2010.24},
  doi          = {10.1109/DS-RT.2010.24},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dsrt/LiCTP10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/TurnerDR10,
  author       = {Stephen D. Turner and
                  Scott M. Dudek and
                  Marylyn D. Ritchie},
  editor       = {Clara Pizzuti and
                  Marylyn D. Ritchie and
                  Mario Giacobini},
  title        = {Grammatical Evolution of Neural Networks for Discovering Epistasis
                  among Quantitative Trait Loci},
  booktitle    = {Evolutionary Computation, Machine Learning and Data Mining in Bioinformatics,
                  8th European Conference, EvoBIO 2010, Istanbul, Turkey, April 7-9,
                  2010. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {6023},
  pages        = {86--97},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-12211-8\_8},
  doi          = {10.1007/978-3-642-12211-8\_8},
  timestamp    = {Tue, 14 May 2019 10:00:37 +0200},
  biburl       = {https://dblp.org/rec/conf/evoW/TurnerDR10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/HolzingerBDTTR10,
  author       = {Emily Rose Holzinger and
                  Carrie C. Buchanan and
                  Scott M. Dudek and
                  Eric Torstenson and
                  Stephen D. Turner and
                  Marylyn D. Ritchie},
  editor       = {Martin Pelikan and
                  J{\"{u}}rgen Branke},
  title        = {Initialization parameter sweep in {ATHENA:} optimizing neural networks
                  for detecting gene-gene interactions in the presence of small main
                  effects},
  booktitle    = {Genetic and Evolutionary Computation Conference, {GECCO} 2010, Proceedings,
                  Portland, Oregon, USA, July 7-11, 2010},
  pages        = {203--210},
  publisher    = {{ACM}},
  year         = {2010},
  url          = {https://doi.org/10.1145/1830483.1830519},
  doi          = {10.1145/1830483.1830519},
  timestamp    = {Sat, 30 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/gecco/HolzingerBDTTR10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/grid/JinTLKGH10,
  author       = {Jiangming Jin and
                  Stephen John Turner and
                  Bu{-}Sung Lee and
                  Shyh{-}Hao Kuo and
                  Rick Siow Mong Goh and
                  Terence Hung},
  title        = {Performance modeling for runtime kernel adaptation: {A} case study
                  on infectious disease simulation},
  booktitle    = {Proceedings of the 2010 11th {IEEE/ACM} International Conference on
                  Grid Computing, Brussels, Belgium, October 25-29, 2010},
  pages        = {349--358},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/GRID.2010.5698009},
  doi          = {10.1109/GRID.2010.5698009},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/grid/JinTLKGH10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icann/HuntSSADSBBT10,
  author       = {Stephen P. Hunt and
                  Yi Sun and
                  Alexander V. Shafarenko and
                  Rod Adams and
                  Neil Davey and
                  Brendan Slater and
                  Ranjeet S. Bhamber and
                  Sonia K. Boscolo and
                  Sergei K. Turitsyn},
  editor       = {Konstantinos I. Diamantaras and
                  Wlodek Duch and
                  Lazaros S. Iliadis},
  title        = {Correcting Errors in Optical Data Transmission Using Neural Networks},
  booktitle    = {Artificial Neural Networks - {ICANN} 2010, 20th International Conference,
                  Thessaloniki, Greece, September 15-18, 2010, Proceedings, Part {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {6353},
  pages        = {448--457},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-15822-3\_55},
  doi          = {10.1007/978-3-642-15822-3\_55},
  timestamp    = {Sun, 25 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icann/HuntSSADSBBT10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/DavisHTB10,
  author       = {Linda M. Davis and
                  Stephen V. Hanly and
                  Paul Tune and
                  Sibi Raj Bhaskaran},
  title        = {Multi-Antenna Downlink Broadcast Using Compressed-Sensed Medium Access},
  booktitle    = {Proceedings of {IEEE} International Conference on Communications,
                  {ICC} 2010, Cape Town, South Africa, 23-27 May 2010},
  pages        = {1--5},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICC.2010.5501819},
  doi          = {10.1109/ICC.2010.5501819},
  timestamp    = {Wed, 16 Oct 2019 14:14:50 +0200},
  biburl       = {https://dblp.org/rec/conf/icc/DavisHTB10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmi/LiGFZDZJZCHML10,
  author       = {Kaiming Li and
                  Lei Guo and
                  Carlos Faraco and
                  Dajiang Zhu and
                  Fan Deng and
                  Tuo Zhang and
                  Xi Jiang and
                  Degang Zhang and
                  Hanbo Chen and
                  Xintao Hu and
                  L. Stephen Miller and
                  Tianming Liu},
  editor       = {Wen Gao and
                  Chin{-}Hui Lee and
                  Jie Yang and
                  Xilin Chen and
                  Maxine Esk{\'{e}}nazi and
                  Zhengyou Zhang},
  title        = {Human-centered attention models for video summarization},
  booktitle    = {Proceedings of the 12th International Conference on Multimodal Interfaces
                  / 7. International Workshop on Machine Learning for Multimodal Interaction,
                  {ICMI-MLMI} 2010, Beijing, China, November 8-12, 2010},
  pages        = {27:1--27:8},
  publisher    = {{ACM}},
  year         = {2010},
  url          = {https://doi.org/10.1145/1891903.1891938},
  doi          = {10.1145/1891903.1891938},
  timestamp    = {Thu, 07 Mar 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icmi/LiGFZDZJZCHML10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/incdm/TuckerSCKDLT10,
  author       = {Allan Tucker and
                  Stephen Swift and
                  Steve Counsell and
                  Simon Kent and
                  John Dickie and
                  Kenwin Liu and
                  Robert Turner},
  editor       = {Petra Perner},
  title        = {Data Mining the Millennium Seedbank at Kew},
  booktitle    = {Advances in Data Mining. 10th Industrial Conference, {ICDM} 2010,
                  Berlin, Germany, July 2010, Workshop Proceedings},
  pages        = {85--94},
  publisher    = {ibai Publishing},
  year         = {2010},
  timestamp    = {Tue, 22 Feb 2022 10:29:42 +0100},
  biburl       = {https://dblp.org/rec/conf/incdm/TuckerSCKDLT10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/PanCTZT10,
  author       = {Ke Pan and
                  Wentong Cai and
                  Xueyan Tang and
                  Suiping Zhou and
                  Stephen John Turner},
  title        = {A hybrid Interest Management mechanism for peer-to-peer Networked
                  Virtual Environments},
  booktitle    = {24th {IEEE} International Symposium on Parallel and Distributed Processing,
                  {IPDPS} 2010, Atlanta, Georgia, USA, 19-23 April 2010 - Conference
                  Proceedings},
  pages        = {1--12},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/IPDPS.2010.5470364},
  doi          = {10.1109/IPDPS.2010.5470364},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ipps/PanCTZT10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/SmithTBR10,
  author       = {Stephen L. Smith and
                  Jana Tumova and
                  Calin Belta and
                  Daniela Rus},
  title        = {Optimal path planning under temporal logic constraints},
  booktitle    = {2010 {IEEE/RSJ} International Conference on Intelligent Robots and
                  Systems, October 18-22, 2010, Taipei, Taiwan},
  pages        = {3288--3293},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/IROS.2010.5650896},
  doi          = {10.1109/IROS.2010.5650896},
  timestamp    = {Wed, 16 Oct 2019 14:14:51 +0200},
  biburl       = {https://dblp.org/rec/conf/iros/SmithTBR10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iva/SmithCBCDPCPCT10,
  author       = {Cameron G. Smith and
                  Nigel T. Crook and
                  Johan Boye and
                  Daniel Charlton and
                  Simon Dobnik and
                  David Pizzi and
                  Marc Cavazza and
                  Stephen G. Pulman and
                  Ra{\'{u}}l Santos de la C{\'{a}}mara and
                  Markku Turunen},
  editor       = {Jan M. Allbeck and
                  Norman I. Badler and
                  Timothy W. Bickmore and
                  Catherine Pelachaud and
                  Alla Safonova},
  title        = {Interaction Strategies for an Affective Conversational Agent},
  booktitle    = {Intelligent Virtual Agents, 10th International Conference, {IVA} 2010,
                  Philadelphia, PA, USA, September 20-22, 2010. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {6356},
  pages        = {301--314},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-15892-6\_31},
  doi          = {10.1007/978-3-642-15892-6\_31},
  timestamp    = {Fri, 09 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iva/SmithCBCDPCPCT10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/HuDLZCJLZFZMHHXMGL10,
  author       = {Xintao Hu and
                  Fan Deng and
                  Kaiming Li and
                  Tuo Zhang and
                  Hanbo Chen and
                  Xi Jiang and
                  Jinglei Lv and
                  Dajiang Zhu and
                  Carlos Faraco and
                  Degang Zhang and
                  Arsham Mesbah and
                  Junwei Han and
                  Xian{-}Sheng Hua and
                  Li Xie and
                  L. Stephen Miller and
                  Lei Guo and
                  Tianming Liu},
  editor       = {Alberto Del Bimbo and
                  Shih{-}Fu Chang and
                  Arnold W. M. Smeulders},
  title        = {Bridging low-level features and high-level semantics via fMRI brain
                  imaging for video classification},
  booktitle    = {Proceedings of the 18th International Conference on Multimedia 2010,
                  Firenze, Italy, October 25-29, 2010},
  pages        = {451--460},
  publisher    = {{ACM}},
  year         = {2010},
  url          = {https://doi.org/10.1145/1873951.1874016},
  doi          = {10.1145/1873951.1874016},
  timestamp    = {Thu, 07 Mar 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/mm/HuDLZCJLZFZMHHXMGL10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LiGFZDZJZCHML10,
  author       = {Kaiming Li and
                  Lei Guo and
                  Carlos Faraco and
                  Dajiang Zhu and
                  Fan Deng and
                  Tuo Zhang and
                  Xi Jiang and
                  Degang Zhang and
                  Hanbo Chen and
                  Xintao Hu and
                  L. Stephen Miller and
                  Tianming Liu},
  editor       = {John D. Lafferty and
                  Christopher K. I. Williams and
                  John Shawe{-}Taylor and
                  Richard S. Zemel and
                  Aron Culotta},
  title        = {Individualized {ROI} Optimization via Maximization of Group-wise Consistency
                  of Structural and Functional Profiles},
  booktitle    = {Advances in Neural Information Processing Systems 23: 24th Annual
                  Conference on Neural Information Processing Systems 2010. Proceedings
                  of a meeting held 6-9 December 2010, Vancouver, British Columbia,
                  Canada},
  pages        = {1369--1377},
  publisher    = {Curran Associates, Inc.},
  year         = {2010},
  url          = {https://proceedings.neurips.cc/paper/2010/hash/ccb1d45fb76f7c5a0bf619f979c6cf36-Abstract.html},
  timestamp    = {Thu, 07 Mar 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/nips/LiGFZDZJZCHML10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/LiCTP10,
  author       = {Zengxiang Li and
                  Wentong Cai and
                  Stephen John Turner and
                  Ke Pan},
  editor       = {George F. Riley and
                  Richard M. Fujimoto and
                  Rob Simmonds and
                  Francesco Quaglia},
  title        = {Federate Fault Tolerance in HLA-Based Simulation},
  booktitle    = {24th {ACM/IEEE/SCS} Workshop on Principles of Advanced and Distributed
                  Simulation, {PADS} 2010, Atlanta, Georgia, USA, May 17-19, 2010},
  pages        = {3--12},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/PADS.2010.5471663},
  doi          = {10.1109/PADS.2010.5471663},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/LiCTP10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/persuasive/CavazzaSCCBPMPCT10,
  author       = {Marc Cavazza and
                  Cameron G. Smith and
                  Daniel Charlton and
                  Nigel T. Crook and
                  Johan Boye and
                  Stephen G. Pulman and
                  Karo Moilanen and
                  David Pizzi and
                  Ra{\'{u}}l Santos de la C{\'{a}}mara and
                  Markku Turunen},
  editor       = {Thomas Ploug and
                  Per F. V. Hasle and
                  Harri Oinas{-}Kukkonen},
  title        = {Persuasive Dialogue Based on a Narrative Theory: An {ECA} Implementation},
  booktitle    = {Persuasive Technology, 5th International Conference, {PERSUASIVE}
                  2010, Copenhagen, Denmark, June 7-10, 2010. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {6137},
  pages        = {250--261},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-13226-1\_25},
  doi          = {10.1007/978-3-642-13226-1\_25},
  timestamp    = {Fri, 09 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/persuasive/CavazzaSCCBPMPCT10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ppsn/TurnerDR10,
  author       = {Stephen D. Turner and
                  Scott M. Dudek and
                  Marylyn D. Ritchie},
  editor       = {Robert Schaefer and
                  Carlos Cotta and
                  Joanna Kolodziej and
                  G{\"{u}}nter Rudolph},
  title        = {Incorporating Domain Knowledge into Evolutionary Computing for Discovering
                  Gene-Gene Interaction},
  booktitle    = {Parallel Problem Solving from Nature - {PPSN} XI, 11th International
                  Conference, Krak{\'{o}}w, Poland, September 11-15, 2010, Proceedings,
                  Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {6238},
  pages        = {394--403},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-15844-5\_40},
  doi          = {10.1007/978-3-642-15844-5\_40},
  timestamp    = {Wed, 25 Sep 2019 18:08:28 +0200},
  biburl       = {https://dblp.org/rec/conf/ppsn/TurnerDR10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/TurnerPEC10,
  author       = {Scott A. Turner and
                  Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and
                  Stephen H. Edwards and
                  Joseph Chase},
  editor       = {Gary Lewandowski and
                  Steven A. Wolfman and
                  Thomas J. Cortina and
                  Ellen Lowenfeld Walker},
  title        = {Peer review in {CS2:} conceptual learning},
  booktitle    = {Proceedings of the 41st {ACM} technical symposium on Computer science
                  education, {SIGCSE} 2010, Milwaukee, Wisconsin, USA, March 10-13,
                  2010},
  pages        = {331--335},
  publisher    = {{ACM}},
  year         = {2010},
  url          = {https://doi.org/10.1145/1734263.1734379},
  doi          = {10.1145/1734263.1734379},
  timestamp    = {Wed, 10 Mar 2021 13:17:16 +0100},
  biburl       = {https://dblp.org/rec/conf/sigcse/TurnerPEC10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmod/ArmbrustTFFPLTT10,
  author       = {Michael Armbrust and
                  Stephen Tu and
                  Armando Fox and
                  Michael J. Franklin and
                  David A. Patterson and
                  Nick Lanham and
                  Beth Trushkowsky and
                  Jesse Trutna},
  editor       = {Ahmed K. Elmagarmid and
                  Divyakant Agrawal},
  title        = {{PIQL:} a performance insightful query language},
  booktitle    = {Proceedings of the {ACM} {SIGMOD} International Conference on Management
                  of Data, {SIGMOD} 2010, Indianapolis, Indiana, USA, June 6-10, 2010},
  pages        = {1207--1210},
  publisher    = {{ACM}},
  year         = {2010},
  url          = {https://doi.org/10.1145/1807167.1807320},
  doi          = {10.1145/1807167.1807320},
  timestamp    = {Thu, 13 Apr 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sigmod/ArmbrustTFFPLTT10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/springsim/LiCTP10,
  author       = {Zengxiang Li and
                  Wentong Cai and
                  Stephen John Turner and
                  Ke Pan},
  editor       = {Robert M. McGraw and
                  Eric S. Imsand and
                  Michael J. Chinni},
  title        = {A replication structure for efficient and fault-tolerant parallel
                  and distributed simulations},
  booktitle    = {Proceedings of the 2010 Spring Simulation Multiconference, SpringSim
                  2010, Orlando, Florida, USA, April 11-15, 2010},
  pages        = {151},
  publisher    = {{SCS/ACM}},
  year         = {2010},
  url          = {https://doi.org/10.1145/1878537.1878695},
  doi          = {10.1145/1878537.1878695},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/springsim/LiCTP10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TaylorMKWTS10,
  author       = {Simon J. E. Taylor and
                  Navonil Mustafee and
                  Shane Kite and
                  Chris Wood and
                  Stephen John Turner and
                  Steffen Stra{\ss}burger},
  title        = {Improving simulation through advanced computing techniques: Grid computing
                  and simulation interoperability},
  booktitle    = {Proceedings of the 2010 Winter Simulation Conference, {WSC} 2010,
                  Baltimore, Maryland, USA, 5-8 December 2010},
  pages        = {216--230},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/WSC.2010.5679162},
  doi          = {10.1109/WSC.2010.5679162},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/TaylorMKWTS10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:journals/procedia/ShahandTCH10,
  author       = {Shayan Shahand and
                  Stephen John Turner and
                  Wentong Cai and
                  Maryam Khademi Hedayat},
  editor       = {Peter M. A. Sloot and
                  G. Dick van Albada and
                  Jack J. Dongarra},
  title        = {DynaSched: a dynamic Web service scheduling and deployment framework
                  for data-intensive Grid workflows},
  booktitle    = {Proceedings of the International Conference on Computational Science,
                  {ICCS} 2010, University of Amsterdam, The Netherlands, May 31 - June
                  2, 2010},
  series       = {Procedia Computer Science},
  volume       = {1},
  number       = {1},
  pages        = {593--602},
  publisher    = {Elsevier},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.procs.2010.04.063},
  doi          = {10.1016/J.PROCS.2010.04.063},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/procedia/ShahandTCH10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/dsrt/2010,
  editor       = {Stephen John Turner and
                  David J. Roberts},
  title        = {{DS-RT} '10 Proceedings of the 2010 {IEEE/ACM} 14th International
                  Symposium on Distributed Simulation and Real Time Applications, Fairfax,
                  Virginia, USA, 17-20 October 2010},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/5634610/proceeding},
  isbn         = {978-0-7695-4251-5},
  timestamp    = {Wed, 16 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dsrt/2010.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2010,
  editor       = {Tetsuo Ida and
                  Viorel Negru and
                  Tudor Jebelean and
                  Dana Petcu and
                  Stephen M. Watt and
                  Daniela Zaharie},
  title        = {12th International Symposium on Symbolic and Numeric Algorithms for
                  Scientific Computing, {SYNASC} 2010, Timisoara, Romania, 23-26 September
                  2010},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/5714592/proceeding},
  isbn         = {978-0-7695-4324-6},
  timestamp    = {Wed, 16 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/synasc/2010.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1007-2212,
  author       = {Stephen L. Smith and
                  Jana Tumova and
                  Calin Belta and
                  Daniela Rus},
  title        = {Optimal Path Planning under Temporal Logic Constraints},
  journal      = {CoRR},
  volume       = {abs/1007.2212},
  year         = {2010},
  url          = {http://arxiv.org/abs/1007.2212},
  eprinttype    = {arXiv},
  eprint       = {1007.2212},
  timestamp    = {Mon, 28 Jan 2019 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1007-2212.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ercim/OSullivanD10,
  author       = {Stephen O'Sullivan and
                  Turlough Downes},
  title        = {Massively Parallel Simulations of Star-Forming Gas Clouds},
  journal      = {{ERCIM} News},
  volume       = {2010},
  number       = {81},
  year         = {2010},
  url          = {http://ercim-news.ercim.eu/en81/special/massively-parallel-simulations-of-star-forming-gas-clouds},
  timestamp    = {Wed, 22 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ercim/OSullivanD10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc5755,
  author       = {Stephen Farrell and
                  Russ Housley and
                  Sean Turner},
  title        = {An Internet Attribute Certificate Profile for Authorization},
  journal      = {{RFC}},
  volume       = {5755},
  pages        = {1--50},
  year         = {2010},
  url          = {https://doi.org/10.17487/RFC5755},
  doi          = {10.17487/RFC5755},
  timestamp    = {Tue, 14 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rfc/rfc5755.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc5990,
  author       = {Randall J. Atkinson and
                  Burt Kaliski and
                  John G. Brainard and
                  Sean Turner},
  title        = {Use of the {RSA-KEM} Key Transport Algorithm in the Cryptographic
                  Message Syntax {(CMS)}},
  journal      = {{RFC}},
  volume       = {5990},
  pages        = {1--27},
  year         = {2010},
  url          = {https://doi.org/10.17487/RFC5990},
  doi          = {10.17487/RFC5990},
  timestamp    = {Tue, 14 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rfc/rfc5990.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/ChaiSBTAK09,
  author       = {High{-}Seng Chai and
                  Hugues Sicotte and
                  Kent R. Bailey and
                  Stephen T. Turner and
                  Yan W. Asmann and
                  Jean{-}Pierre A. Kocher},
  title        = {{GLOSSI:} a method to assess the association of genetic loci-sets
                  with complex diseases},
  journal      = {{BMC} Bioinform.},
  volume       = {10},
  year         = {2009},
  url          = {https://doi.org/10.1186/1471-2105-10-102},
  doi          = {10.1186/1471-2105-10-102},
  timestamp    = {Sun, 15 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/bmcbi/ChaiSBTAK09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/JamesonTAKRSGSOWKP09,
  author       = {Daniel Jameson and
                  David A. Turner and
                  John Ankers and
                  Stephnie Kennedy and
                  Sheila Ryan and
                  Neil Swainston and
                  Tony Griffiths and
                  David G. Spiller and
                  Stephen G. Oliver and
                  Michael R. H. White and
                  Douglas B. Kell and
                  Norman W. Paton},
  title        = {Information management for high content live cell imaging},
  journal      = {{BMC} Bioinform.},
  volume       = {10},
  year         = {2009},
  url          = {https://doi.org/10.1186/1471-2105-10-226},
  doi          = {10.1186/1471-2105-10-226},
  timestamp    = {Sun, 15 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/bmcbi/JamesonTAKRSGSOWKP09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csda/SunJTBK09,
  author       = {Yan V. Sun and
                  Douglas M. Jacobsen and
                  Stephen T. Turner and
                  Eric Boerwinkle and
                  Sharon L. R. Kardia},
  title        = {Fast implementation of a scan statistic for identifying chromosomal
                  patterns of genome wide association studies},
  journal      = {Comput. Stat. Data Anal.},
  volume       = {53},
  number       = {5},
  pages        = {1794--1801},
  year         = {2009},
  url          = {https://doi.org/10.1016/j.csda.2008.04.013},
  doi          = {10.1016/J.CSDA.2008.04.013},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/csda/SunJTBK09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/infsof/KitchenhamBBTBL09,
  author       = {Barbara A. Kitchenham and
                  Pearl Brereton and
                  David Budgen and
                  Mark Turner and
                  John Bailey and
                  Stephen G. Linkman},
  title        = {Systematic literature reviews in software engineering - {A} systematic
                  literature review},
  journal      = {Inf. Softw. Technol.},
  volume       = {51},
  number       = {1},
  pages        = {7--15},
  year         = {2009},
  url          = {https://doi.org/10.1016/j.infsof.2008.09.009},
  doi          = {10.1016/J.INFSOF.2008.09.009},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/infsof/KitchenhamBBTBL09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WangXSZWB09,
  author       = {Yanli Wang and
                  Jewen Xiao and
                  Tugba O. Suzek and
                  Jian Zhang and
                  Jiyao Wang and
                  Stephen H. Bryant},
  title        = {PubChem: a public information system for analyzing bioactivities of
                  small molecules},
  journal      = {Nucleic Acids Res.},
  volume       = {37},
  number       = {Web-Server-Issue},
  pages        = {623--633},
  year         = {2009},
  url          = {https://doi.org/10.1093/nar/gkp456},
  doi          = {10.1093/NAR/GKP456},
  timestamp    = {Sun, 17 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/WangXSZWB09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/YuPZW09,
  author       = {Donggang Yu and
                  Tuan D. Pham and
                  Xiaobo Zhou and
                  Stephen T. C. Wong},
  title        = {Recognition and analysis of cell nuclear phases for high-content screening
                  based on morphological features},
  journal      = {Pattern Recognit.},
  volume       = {42},
  number       = {4},
  pages        = {498--508},
  year         = {2009},
  url          = {https://doi.org/10.1016/j.patcog.2008.08.003},
  doi          = {10.1016/J.PATCOG.2008.08.003},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/YuPZW09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/PanTCL09,
  author       = {Ke Pan and
                  Stephen John Turner and
                  Wentong Cai and
                  Zengxiang Li},
  title        = {A Hybrid {HLA} Time Management Algorithm Based on Both Conditional
                  and Unconditional Information},
  journal      = {Simul.},
  volume       = {85},
  number       = {9},
  pages        = {559--573},
  year         = {2009},
  url          = {https://doi.org/10.1177/0037549709106328},
  doi          = {10.1177/0037549709106328},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/simulation/PanTCL09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/WangWHLL09,
  author       = {Tunde Wang and
                  Dong Wang and
                  Paul J. Hurst and
                  Bernard C. Levy and
                  Stephen H. Lewis},
  title        = {A Level-Crossing Analog-to-Digital Converter With Triangular Dither},
  journal      = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
  volume       = {56-I},
  number       = {9},
  pages        = {2089--2099},
  year         = {2009},
  url          = {https://doi.org/10.1109/TCSI.2008.2011586},
  doi          = {10.1109/TCSI.2008.2011586},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcas/WangWHLL09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aswec/ChartersBTKBL09,
  author       = {Stuart M. Charters and
                  David Budgen and
                  Mark Turner and
                  Barbara A. Kitchenham and
                  Pearl Brereton and
                  Stephen G. Linkman},
  title        = {Objectivity in Research: Challenges from the Evidence-Based Paradigm},
  booktitle    = {20th Australian Software Engineering Conference {(ASWEC} 2009), 14-17
                  April 2009, Gold Cost, Australia},
  pages        = {73--80},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/ASWEC.2009.25},
  doi          = {10.1109/ASWEC.2009.25},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/aswec/ChartersBTKBL09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bliss/YanciPA09,
  author       = {Asier Goikoetxea Yanci and
                  Stephen Pickles and
                  Tughrul Arslan},
  editor       = {Adrian Stoica and
                  Tughrul Arslan and
                  Ahmet T. Erdogan and
                  Tetsuya Higuchi and
                  Ahmed Bouridane and
                  Ahmed O. El{-}Rayis},
  title        = {Characterization of a Voltage Glitch Attack Detector for Secure Devices},
  booktitle    = {2009 Symposium on Bio-inspired Learning and Intelligent Systems for
                  Security, {BLISS} 2009, Edingburgh, United Kingdom, August 20-21 2009},
  pages        = {91--96},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/BLISS.2009.18},
  doi          = {10.1109/BLISS.2009.18},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/bliss/YanciPA09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/BergmanTBCW09,
  author       = {Ofer Bergman and
                  Simon Tucker and
                  Ruth Beyth{-}Marom and
                  Edward Cutrell and
                  Steve Whittaker},
  editor       = {Dan R. Olsen Jr. and
                  Richard B. Arthur and
                  Ken Hinckley and
                  Meredith Ringel Morris and
                  Scott E. Hudson and
                  Saul Greenberg},
  title        = {It's not that important: demoting personal information of low subjective
                  importance using GrayArea},
  booktitle    = {Proceedings of the 27th International Conference on Human Factors
                  in Computing Systems, {CHI} 2009, Boston, MA, USA, April 4-9, 2009},
  pages        = {269--278},
  publisher    = {{ACM}},
  year         = {2009},
  url          = {https://doi.org/10.1145/1518701.1518745},
  doi          = {10.1145/1518701.1518745},
  timestamp    = {Sun, 04 Aug 2024 19:38:26 +0200},
  biburl       = {https://dblp.org/rec/conf/chi/BergmanTBCW09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/det/ValenteNNT09,
  author       = {Anna Valente and
                  Aydin Nassehi and
                  Stephen T. Newman and
                  Tullio Tolio},
  editor       = {George Q. Huang and
                  Kai{-}Ling Mak and
                  Paul G. Maropoulos},
  title        = {A {STEP} Compliant Knowledge Based Schema for the Manufacture of Composites
                  in the Aerospace Industry},
  booktitle    = {Proceedings of the 6th CIRP-Sponsored International Conference on
                  Digital Enterprise Technology, {DET} 2009, Hong Kong, China, December
                  14.16, 2009},
  series       = {Advances in Intelligent and Soft Computing},
  volume       = {66},
  pages        = {1509--1525},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-10430-5\_114},
  doi          = {10.1007/978-3-642-10430-5\_114},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/det/ValenteNNT09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/FanchaoTA09,
  author       = {Zeng Fanchao and
                  Stephen John Turner and
                  Heiko Aydt},
  editor       = {Stephen John Turner and
                  David J. Roberts and
                  Wentong Cai and
                  Abdulmotaleb El{-}Saddik},
  title        = {Symbiotic Simulation Control in Supply Chain of Lubricant Additive
                  Industry},
  booktitle    = {13th {IEEE/ACM} International Symposium on Distributed Simulation
                  and Real Time Applications, Singapore, 25-28 October 2009},
  pages        = {165--172},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/DS-RT.2009.17},
  doi          = {10.1109/DS-RT.2009.17},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dsrt/FanchaoTA09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/PanTCL09,
  author       = {Ke Pan and
                  Stephen John Turner and
                  Wentong Cai and
                  Zengxiang Li},
  editor       = {Stephen John Turner and
                  David J. Roberts and
                  Wentong Cai and
                  Abdulmotaleb El{-}Saddik},
  title        = {Multi-user Gaming on the Grid Using a Service Oriented {HLA} {RTI}},
  booktitle    = {13th {IEEE/ACM} International Symposium on Distributed Simulation
                  and Real Time Applications, Singapore, 25-28 October 2009},
  pages        = {48--56},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/DS-RT.2009.39},
  doi          = {10.1109/DS-RT.2009.39},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dsrt/PanTCL09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eann/HuntSSADSBBT09,
  author       = {Stephen P. Hunt and
                  Yi Sun and
                  Alexander V. Shafarenko and
                  Rod Adams and
                  Neil Davey and
                  Brendan Slater and
                  Ranjeet S. Bhamber and
                  Sonia K. Boscolo and
                  Sergei K. Turitsyn},
  editor       = {Dominic Palmer{-}Brown and
                  Chrisina Draganova and
                  Elias Pimenidis and
                  Haris Mouratidis},
  title        = {Adaptive Electrical Signal Post-processing with Varying Representations
                  in Optical Communication Systems},
  booktitle    = {Engineering Applications of Neural Networks - 11th International Conference,
                  {EANN} 2009, London, UK, August 27-29, 2009. Proceedings},
  series       = {Communications in Computer and Information Science},
  volume       = {43},
  pages        = {235--245},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-03969-0\_22},
  doi          = {10.1007/978-3-642-03969-0\_22},
  timestamp    = {Sun, 25 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/eann/HuntSSADSBBT09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esem/KitchenhamBTNLPB09,
  author       = {Barbara A. Kitchenham and
                  Pearl Brereton and
                  Mark Turner and
                  Mahmood Niazi and
                  Stephen G. Linkman and
                  Rialette Pretorius and
                  David Budgen},
  title        = {The impact of limited search procedures for systematic literature
                  reviews {A} participant-observer case study},
  booktitle    = {Proceedings of the Third International Symposium on Empirical Software
                  Engineering and Measurement, {ESEM} 2009, October 15-16, 2009, Lake
                  Buena Vista, Florida, {USA}},
  pages        = {336--345},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/ESEM.2009.5314238},
  doi          = {10.1109/ESEM.2009.5314238},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/esem/KitchenhamBTNLPB09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/TurnerRB09,
  author       = {Stephen D. Turner and
                  Marylyn D. Ritchie and
                  William S. Bush},
  editor       = {Clara Pizzuti and
                  Marylyn D. Ritchie and
                  Mario Giacobini},
  title        = {Conquering the Needle-in-a-Haystack: How Correlated Input Variables
                  Beneficially Alter the Fitness Landscape for Neural Networks},
  booktitle    = {Evolutionary Computation, Machine Learning and Data Mining in Bioinformatics,
                  7th European Conference, EvoBIO 2009, T{\"{u}}bingen, Germany,
                  April 15-17, 2009, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5483},
  pages        = {80--91},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-01184-9\_8},
  doi          = {10.1007/978-3-642-01184-9\_8},
  timestamp    = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/evoW/TurnerRB09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fsr/TullyKC09,
  author       = {Stephen Tully and
                  George Kantor and
                  Howie Choset},
  editor       = {Andrew Howard and
                  Karl Iagnemma and
                  Alonzo Kelly},
  title        = {Leap-Frog Path Design for Multi-Robot Cooperative Localization},
  booktitle    = {Field and Service Robotics, Results of the 7th International Conference,
                  {FSR} 2009, Cambridge, Massachusetts, USA, 14-16 July 2009},
  series       = {Springer Tracts in Advanced Robotics},
  volume       = {62},
  pages        = {307--317},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-13408-1\_28},
  doi          = {10.1007/978-3-642-13408-1\_28},
  timestamp    = {Mon, 22 May 2017 17:10:59 +0200},
  biburl       = {https://dblp.org/rec/conf/fsr/TullyKC09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ida/CainCST09,
  author       = {James Cain and
                  Steve Counsell and
                  Stephen Swift and
                  Allan Tucker},
  editor       = {Niall M. Adams and
                  C{\'{e}}line Robardet and
                  Arno Siebes and
                  Jean{-}Fran{\c{c}}ois Boulicaut},
  title        = {An Application of Intelligent Data Analysis Techniques to a Large
                  Software Engineering Dataset},
  booktitle    = {Advances in Intelligent Data Analysis VIII, 8th International Symposium
                  on Intelligent Data Analysis, {IDA} 2009, Lyon, France, August 31
                  - September 2, 2009. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5772},
  pages        = {261--272},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-03915-7\_23},
  doi          = {10.1007/978-3-642-03915-7\_23},
  timestamp    = {Tue, 14 May 2019 10:00:49 +0200},
  biburl       = {https://dblp.org/rec/conf/ida/CainCST09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/WrigleyTBW09,
  author       = {Stuart N. Wrigley and
                  Simon Tucker and
                  Guy J. Brown and
                  Steve Whittaker},
  title        = {Audio spatialisation strategies for multitasking during teleconferences},
  booktitle    = {10th Annual Conference of the International Speech Communication Association,
                  {INTERSPEECH} 2009, Brighton, United Kingdom, September 6-10, 2009},
  pages        = {2935--2938},
  publisher    = {{ISCA}},
  year         = {2009},
  url          = {https://doi.org/10.21437/Interspeech.2009-743},
  doi          = {10.21437/INTERSPEECH.2009-743},
  timestamp    = {Tue, 11 Jun 2024 16:45:43 +0200},
  biburl       = {https://dblp.org/rec/conf/interspeech/WrigleyTBW09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/TullyKCW09,
  author       = {Stephen Tully and
                  George Kantor and
                  Howie Choset and
                  Felix Werner},
  title        = {A multi-hypothesis topological {SLAM} approach for loop closing on
                  edge-ordered graphs},
  booktitle    = {2009 {IEEE/RSJ} International Conference on Intelligent Robots and
                  Systems, October 11-15, 2009, St. Louis, MO, {USA}},
  pages        = {4943--4948},
  publisher    = {{IEEE}},
  year         = {2009},
  url          = {https://doi.org/10.1109/IROS.2009.5354255},
  doi          = {10.1109/IROS.2009.5354255},
  timestamp    = {Wed, 16 Oct 2019 14:14:51 +0200},
  biburl       = {https://dblp.org/rec/conf/iros/TullyKCW09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/WernerMSCTK09,
  author       = {Felix Werner and
                  Fr{\'{e}}d{\'{e}}ric Maire and
                  Joaquin Sitte and
                  Howie Choset and
                  Stephen Tully and
                  George Kantor},
  title        = {Topological {SLAM} using neighbourhood information of places},
  booktitle    = {2009 {IEEE/RSJ} International Conference on Intelligent Robots and
                  Systems, October 11-15, 2009, St. Louis, MO, {USA}},
  pages        = {4937--4942},
  publisher    = {{IEEE}},
  year         = {2009},
  url          = {https://doi.org/10.1109/IROS.2009.5354748},
  doi          = {10.1109/IROS.2009.5354748},
  timestamp    = {Mon, 22 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iros/WernerMSCTK09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isit/TuneBH09,
  author       = {Paul Tune and
                  Sibi Raj Bhaskaran and
                  Stephen V. Hanly},
  title        = {Number of measurements in sparse signal recovery},
  booktitle    = {{IEEE} International Symposium on Information Theory, {ISIT} 2009,
                  June 28 - July 3, 2009, Seoul, Korea, Proceedings},
  pages        = {16--20},
  publisher    = {{IEEE}},
  year         = {2009},
  url          = {https://doi.org/10.1109/ISIT.2009.5205809},
  doi          = {10.1109/ISIT.2009.5205809},
  timestamp    = {Wed, 16 Oct 2019 14:14:48 +0200},
  biburl       = {https://dblp.org/rec/conf/isit/TuneBH09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispa/HedayatCTS09,
  author       = {Maryam Khademi Hedayat and
                  Wentong Cai and
                  Stephen John Turner and
                  Shayan Shahand},
  title        = {Distributed Execution of Workflow Using Parallel Partitioning},
  booktitle    = {{IEEE} International Symposium on Parallel and Distributed Processing
                  with Applications, {ISPA} 2009, Chengdu, Sichuan, China, 10-12 August
                  2009},
  pages        = {106--112},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/ISPA.2009.96},
  doi          = {10.1109/ISPA.2009.96},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ispa/HedayatCTS09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itw/BhaskaranDGHT09,
  author       = {Sibi Raj Bhaskaran and
                  Linda M. Davis and
                  Alex J. Grant and
                  Stephen V. Hanly and
                  Paul Tune},
  editor       = {Bruce E. Hajek and
                  Leandros Tassiulas and
                  Venkat Anantharam and
                  Ioannis Kontoyiannis},
  title        = {Downlink scheduling using compressed sensing},
  booktitle    = {2009 {IEEE} Information Theory Workshop, {ITW} 2009, Volos, Greece,
                  June 10-12, 2009},
  pages        = {201--205},
  publisher    = {{IEEE}},
  year         = {2009},
  url          = {https://doi.org/10.1109/ITWNIT.2009.5158571},
  doi          = {10.1109/ITWNIT.2009.5158571},
  timestamp    = {Mon, 09 Aug 2021 14:54:02 +0200},
  biburl       = {https://dblp.org/rec/conf/itw/BhaskaranDGHT09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iui/TuckerW09,
  author       = {Simon Tucker and
                  Steve Whittaker},
  editor       = {Cristina Conati and
                  Mathias Bauer and
                  Nuria Oliver and
                  Daniel S. Weld},
  title        = {Have a say over what you see: evaluating interactive compression techniques},
  booktitle    = {Proceedings of the 14th International Conference on Intelligent User
                  Interfaces, {IUI} 2009, Sanibel Island, Florida, USA, February 8-11,
                  2009},
  pages        = {37--46},
  publisher    = {{ACM}},
  year         = {2009},
  url          = {https://doi.org/10.1145/1502650.1502659},
  doi          = {10.1145/1502650.1502659},
  timestamp    = {Mon, 11 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iui/TuckerW09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/AydtTCLA09,
  author       = {Heiko Aydt and
                  Stephen John Turner and
                  Wentong Cai and
                  Malcolm Yoke Hean Low and
                  Rassul Ayani},
  title        = {Symbiotic Simulation Model Validation for Radiation Detection Applications},
  booktitle    = {23rd International Workshop on Principles of Advanced and Distributed
                  Simulation, {PADS} 2009, Lake Placid, New York, USA, June 22-25, 2009},
  pages        = {11--18},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/PADS.2009.20},
  doi          = {10.1109/PADS.2009.20},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/AydtTCLA09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/RodgerHLQNTLCDS09,
  author       = {Susan H. Rodger and
                  Jenna Hayes and
                  Gaetjens Lezin and
                  Henry Qin and
                  Deborah Nelson and
                  Ruth Tucker and
                  Mercedes Lopez and
                  Stephen Cooper and
                  Wanda P. Dann and
                  Don Slater},
  editor       = {Sue Fitzgerald and
                  Mark Guzdial and
                  Gary Lewandowski and
                  Steven A. Wolfman},
  title        = {Engaging middle school teachers and students with alice in a diverse
                  set of subjects},
  booktitle    = {Proceedings of the 40th {SIGCSE} Technical Symposium on Computer Science
                  Education, {SIGCSE} 2009, Chattanooga, TN, USA, March 4-7, 2009},
  pages        = {271--275},
  publisher    = {{ACM}},
  year         = {2009},
  url          = {https://doi.org/10.1145/1508865.1508967},
  doi          = {10.1145/1508865.1508967},
  timestamp    = {Thu, 10 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sigcse/RodgerHLQNTLCDS09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/PalazziSFLAABBC09,
  author       = {Maria Palazzi and
                  Norah Zuniga Shaw and
                  William Forsythe and
                  Matthew R. Lewis and
                  Beth Albright and
                  Michael Andereck and
                  Sucheta Bhatawadekar and
                  Hyowon Ban and
                  Andrew Calhoun and
                  Jane Drozd and
                  Joshua Fry and
                  Melissa S. Quintanilha and
                  Anna Reed and
                  Benjamin Schroeder and
                  Lily Skove and
                  Ashley Thorndike and
                  Mary Twohig and
                  Ola Ahlqvist and
                  Peter Chan and
                  Noel Cressie and
                  Stephen Turk and
                  Jill Johnson and
                  Christopher Roman and
                  Elizabeth Waterhouse and
                  Scott DeLahunta and
                  Patrick Haggard and
                  Alva No{\"{e}}},
  editor       = {Jacquelyn Martino},
  title        = {Synchronous Objects for One Flat Thing, reproduced},
  booktitle    = {International Conference on Computer Graphics and Interactive Techniques,
                  {SIGGRAPH} 2009, New Orleans, Louisiana, USA, August 3-7, 2009, Art
                  Gallery},
  pages        = {37:1},
  publisher    = {{ACM}},
  year         = {2009},
  url          = {https://doi.org/10.1145/1667265.1667306},
  doi          = {10.1145/1667265.1667306},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/siggraph/PalazziSFLAABBC09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tpcg/LongshawTFG09,
  author       = {Stephen M. Longshaw and
                  Martin J. Turner and
                  Emma Finch and
                  Robert Gawthorpe},
  editor       = {Wen Tang and
                  John P. Collomosse},
  title        = {Discrete Element Modelling Using a Parallelised Physics Engine},
  booktitle    = {{EG} {UK} Theory and Practice of Computer Graphics, Cardiff University,,
                  United Kingdom, 2009. Proceedings},
  pages        = {207--214},
  publisher    = {Eurographics Association},
  year         = {2009},
  url          = {https://doi.org/10.2312/LocalChapterEvents/TPCG/TPCG09/207-214},
  doi          = {10.2312/LOCALCHAPTEREVENTS/TPCG/TPCG09/207-214},
  timestamp    = {Sun, 25 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/tpcg/LongshawTFG09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/AydtTCL09,
  author       = {Heiko Aydt and
                  Stephen John Turner and
                  Wentong Cai and
                  Malcolm Yoke Hean Low},
  editor       = {Ann Dunkin and
                  Ricki G. Ingalls and
                  Enver Y{\"{u}}cesan and
                  Manuel D. Rossetti and
                  Ray Hill and
                  Bj{\"{o}}rn Johansson},
  title        = {Research Issues in Symbiotic Simulation},
  booktitle    = {Proceedings of the 2009 Winter Simulation Conference, {WSC} 2009,
                  Hilton Austin Hotel, Austin, TX, USA, December 13-16, 2009},
  pages        = {1213--1222},
  publisher    = {{IEEE}},
  year         = {2009},
  url          = {https://doi.org/10.1109/WSC.2009.5429419},
  doi          = {10.1109/WSC.2009.5429419},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/AydtTCL09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/PanTCL09,
  author       = {Ke Pan and
                  Stephen John Turner and
                  Wentong Cai and
                  Zengxiang Li},
  editor       = {Ann Dunkin and
                  Ricki G. Ingalls and
                  Enver Y{\"{u}}cesan and
                  Manuel D. Rossetti and
                  Ray Hill and
                  Bj{\"{o}}rn Johansson},
  title        = {Implementation of Data Distribution Management Services in a Service
                  Oriented {HLA} {RTI}},
  booktitle    = {Proceedings of the 2009 Winter Simulation Conference, {WSC} 2009,
                  Hilton Austin Hotel, Austin, TX, USA, December 13-16, 2009},
  pages        = {1027--1038},
  publisher    = {{IEEE}},
  year         = {2009},
  url          = {https://doi.org/10.1109/WSC.2009.5429557},
  doi          = {10.1109/WSC.2009.5429557},
  timestamp    = {Thu, 10 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/PanTCL09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TaylorMTPS09,
  author       = {Simon J. E. Taylor and
                  Navonil Mustafee and
                  Stephen John Turner and
                  Ke Pan and
                  Steffen Stra{\ss}burger},
  editor       = {Ann Dunkin and
                  Ricki G. Ingalls and
                  Enver Y{\"{u}}cesan and
                  Manuel D. Rossetti and
                  Ray Hill and
                  Bj{\"{o}}rn Johansson},
  title        = {Commercial-Off-The-Shelf Simulation Package Interoperability: Issues
                  and Futures},
  booktitle    = {Proceedings of the 2009 Winter Simulation Conference, {WSC} 2009,
                  Hilton Austin Hotel, Austin, TX, USA, December 13-16, 2009},
  pages        = {203--215},
  publisher    = {{IEEE}},
  year         = {2009},
  url          = {https://doi.org/10.1109/WSC.2009.5429326},
  doi          = {10.1109/WSC.2009.5429326},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/TaylorMTPS09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/tf/09/TurnerCLA09,
  author       = {Stephen John Turner and
                  Wentong Cai and
                  Malcolm Yoke Hean Low and
                  Heiko Aydt},
  editor       = {Adelinde M. Uhrmacher and
                  Danny Weyns},
  title        = {An Agent-Based Generic Framework for Symbiotic Simulation Systems},
  booktitle    = {Multi-Agent Systems - Simulation and Applications},
  series       = {Computational Analysis, Synthesis, and Design of Dynamic Systems},
  pages        = {357--387},
  publisher    = {{CRC} Press / Taylor {\&} Francis},
  year         = {2009},
  url          = {https://doi.org/10.1201/9781420070248.ch12},
  doi          = {10.1201/9781420070248.CH12},
  timestamp    = {Wed, 07 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/books/tf/09/TurnerCLA09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/dsrt/2009,
  editor       = {Stephen John Turner and
                  David J. Roberts and
                  Wentong Cai and
                  Abdulmotaleb El{-}Saddik},
  title        = {13th {IEEE/ACM} International Symposium on Distributed Simulation
                  and Real Time Applications, Singapore, 25-28 October 2009},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/5361739/proceeding},
  isbn         = {978-0-7695-3868-6},
  timestamp    = {Wed, 10 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dsrt/2009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/synasc/2009,
  editor       = {Stephen M. Watt and
                  Viorel Negru and
                  Tetsuo Ida and
                  Tudor Jebelean and
                  Dana Petcu and
                  Daniela Zaharie},
  title        = {11th International Symposium on Symbolic and Numeric Algorithms for
                  Scientific Computing, {SYNASC} 2009, Timisoara, Romania, September
                  26-29, 2009},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/5459479/proceeding},
  isbn         = {978-1-4244-5910-0},
  timestamp    = {Wed, 16 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/synasc/2009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0904-4525,
  author       = {Paul Tune and
                  Sibiraj Bhaskaran Pillai and
                  Stephen V. Hanly},
  title        = {Number of Measurements in Sparse Signal Recovery},
  journal      = {CoRR},
  volume       = {abs/0904.4525},
  year         = {2009},
  url          = {http://arxiv.org/abs/0904.4525},
  eprinttype    = {arXiv},
  eprint       = {0904.4525},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-0904-4525.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csda/FridleyTCRBB08,
  author       = {Brooke L. Fridley and
                  Stephen T. Turner and
                  Arlene B. Chapman and
                  Andrei S. Rodin and
                  Eric Boerwinkle and
                  Kent R. Bailey},
  title        = {Reproducibility of genotypes as measured by the affymetrix GeneChip\({}^{\mbox{{\textregistered}}}\)
                  100K Human Mapping Array set},
  journal      = {Comput. Stat. Data Anal.},
  volume       = {52},
  number       = {12},
  pages        = {5367--5374},
  year         = {2008},
  url          = {https://doi.org/10.1016/j.csda.2008.05.020},
  doi          = {10.1016/J.CSDA.2008.05.020},
  timestamp    = {Tue, 18 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/csda/FridleyTCRBB08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ese/BudgenKCTBL08,
  author       = {David Budgen and
                  Barbara A. Kitchenham and
                  Stuart M. Charters and
                  Mark Turner and
                  Pearl Brereton and
                  Stephen G. Linkman},
  title        = {Presenting software engineering results using structured abstracts:
                  a randomised experiment},
  journal      = {Empir. Softw. Eng.},
  volume       = {13},
  number       = {4},
  pages        = {435--468},
  year         = {2008},
  url          = {https://doi.org/10.1007/s10664-008-9075-7},
  doi          = {10.1007/S10664-008-9075-7},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ese/BudgenKCTBL08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/ChenTTCMZ08,
  author       = {Dan Chen and
                  Georgios K. Theodoropoulos and
                  Stephen John Turner and
                  Wentong Cai and
                  Rob Minson and
                  Yi Zhang},
  title        = {Large scale agent-based simulation on the grid},
  journal      = {Future Gener. Comput. Syst.},
  volume       = {24},
  number       = {7},
  pages        = {658--671},
  year         = {2008},
  url          = {https://doi.org/10.1016/j.future.2008.01.004},
  doi          = {10.1016/J.FUTURE.2008.01.004},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/fgcs/ChenTTCMZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/ChenTCX08,
  author       = {Dan Chen and
                  Stephen John Turner and
                  Wentong Cai and
                  Muzhou Xiong},
  title        = {A decoupled federate architecture for high level architecture-based
                  distributed simulation},
  journal      = {J. Parallel Distributed Comput.},
  volume       = {68},
  number       = {11},
  pages        = {1487--1503},
  year         = {2008},
  url          = {https://doi.org/10.1016/j.jpdc.2008.07.010},
  doi          = {10.1016/J.JPDC.2008.07.010},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jpdc/ChenTCX08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/BugAGGFLLRSTM08,
  author       = {William J. Bug and
                  Giorgio A. Ascoli and
                  Jeffrey S. Grethe and
                  Amarnath Gupta and
                  Christine Fennema{-}Notestine and
                  Angela R. Laird and
                  Stephen D. Larson and
                  Daniel L. Rubin and
                  Gordon M. Shepherd and
                  Jessica A. Turner and
                  Maryann E. Martone},
  title        = {The {NIFSTD} and BIRNLex Vocabularies: Building Comprehensive Ontologies
                  for Neuroscience},
  journal      = {Neuroinformatics},
  volume       = {6},
  number       = {3},
  pages        = {175--194},
  year         = {2008},
  url          = {https://doi.org/10.1007/s12021-008-9032-z},
  doi          = {10.1007/S12021-008-9032-Z},
  timestamp    = {Sat, 19 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ni/BugAGGFLLRSTM08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/puc/WhittakerTSL08,
  author       = {Steve Whittaker and
                  Simon Tucker and
                  Kumutha Swampillai and
                  Rachel Laban},
  title        = {Design and evaluation of systems to support interaction capture and
                  retrieval},
  journal      = {Pers. Ubiquitous Comput.},
  volume       = {12},
  number       = {3},
  pages        = {197--221},
  year         = {2008},
  url          = {https://doi.org/10.1007/s00779-007-0146-3},
  doi          = {10.1007/S00779-007-0146-3},
  timestamp    = {Mon, 11 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/puc/WhittakerTSL08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigplan/AllenBBBFFHKKLLLPRRSTW08,
  author       = {Eric Allen and
                  Mark W. Bailey and
                  Rastislav Bod{\'{\i}}k and
                  Kim B. Bruce and
                  Kathleen Fisher and
                  Stephen N. Freund and
                  Robert Harper and
                  Chandra Krintz and
                  Shriram Krishnamurthi and
                  James R. Larus and
                  Doug Lea and
                  Gary T. Leavens and
                  Lori L. Pollock and
                  Stuart Reges and
                  Martin C. Rinard and
                  Mark A. Sheldon and
                  Franklyn A. Turbak and
                  Mitchell Wand},
  title        = {{SIGPLAN} programming language curriculum workshop: Discussion Summaries
                  and recommendations},
  journal      = {{ACM} {SIGPLAN} Notices},
  volume       = {43},
  number       = {11},
  pages        = {6--29},
  year         = {2008},
  url          = {https://doi.org/10.1145/1480828.1480831},
  doi          = {10.1145/1480828.1480831},
  timestamp    = {Tue, 26 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sigplan/AllenBBBFFHKKLLLPRRSTW08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/ChenTC08,
  author       = {Dan Chen and
                  Stephen John Turner and
                  Wentong Cai},
  title        = {Towards Fault-tolerant HLA-based Distributed Simulations},
  journal      = {Simul.},
  volume       = {84},
  number       = {10-11},
  pages        = {493--509},
  year         = {2008},
  url          = {https://doi.org/10.1177/0037549708095518},
  doi          = {10.1177/0037549708095518},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/simulation/ChenTC08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/TuckerW08,
  author       = {Simon Tucker and
                  Steve Whittaker},
  title        = {Temporal Compression Of Speech: An Evaluation},
  journal      = {{IEEE} Trans. Speech Audio Process.},
  volume       = {16},
  number       = {4},
  pages        = {790--796},
  year         = {2008},
  url          = {https://doi.org/10.1109/TASL.2008.916527},
  doi          = {10.1109/TASL.2008.916527},
  timestamp    = {Mon, 28 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/taslp/TuckerW08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/PhamWZBBHABHLW08,
  author       = {Tuan D. Pham and
                  Honghui Wang and
                  Xiaobo Zhou and
                  Dominik Beck and
                  Miriam Brandl and
                  Gerard Hoehn and
                  Joseph Azok and
                  Marie{-}Luise Brennan and
                  Stanley L. Hazen and
                  King C. Li and
                  Stephen T. C. Wong},
  title        = {Computational Prediction Models for Early Detection of Risk of Cardiovascular
                  Events Using Mass Spectrometry Data},
  journal      = {{IEEE} Trans. Inf. Technol. Biomed.},
  volume       = {12},
  number       = {5},
  pages        = {636--643},
  year         = {2008},
  url          = {https://doi.org/10.1109/TITB.2007.908756},
  doi          = {10.1109/TITB.2007.908756},
  timestamp    = {Wed, 13 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/titb/PhamWZBBHABHLW08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aina/LiTTCH08,
  author       = {Xiaorong Li and
                  Stephen John Turner and
                  Kok Heng Tong and
                  Hoong{-}Maeng Chan and
                  Terence Hung},
  title        = {Design of an SLA-Driven QoS Management Platform for Provisioning Multimedia
                  Personalized Services},
  booktitle    = {22nd International Conference on Advanced Information Networking and
                  Applications, {AINA} 2008, Workshops Proceedings, GinoWan, Okinawa,
                  Japan, March 25-28, 2008},
  pages        = {1405--1409},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/WAINA.2008.256},
  doi          = {10.1109/WAINA.2008.256},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/aina/LiTTCH08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asiams/ChenCTW08,
  author       = {Xinjun Chen and
                  Wentong Cai and
                  Stephen John Turner and
                  Yong Wang},
  title        = {Shared Variable Management in SOAr-DSGrid},
  booktitle    = {Second Asia International Conference on Modelling and Simulation,
                  {AMS} 2008, Kuala Lumpur, Malaysia, May 13-15, 2008},
  pages        = {154--161},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/AMS.2008.161},
  doi          = {10.1109/AMS.2008.161},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/asiams/ChenCTW08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bliss/YanciPA08,
  author       = {Asier Goikoetxea Yanci and
                  Stephen Pickles and
                  Tughrul Arslan},
  editor       = {Adrian Stoica and
                  Tughrul Arslan and
                  Daniel Howard and
                  Tetsuya Higuchi and
                  Ahmed O. El{-}Rayis},
  title        = {Detecting Voltage Glitch Attacks on Secure Devices},
  booktitle    = {2008 {ECSIS} Symposium on Bio-inspired, Learning, and Intelligent
                  Systems for Security, {BLISS} 2008, Edinburgh, UK, 4-6 August 2008},
  pages        = {75--80},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/BLISS.2008.26},
  doi          = {10.1109/BLISS.2008.26},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/bliss/YanciPA08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/Turner08,
  author       = {Stephen John Turner},
  editor       = {David J. Roberts and
                  Abdulmotaleb El{-}Saddik and
                  Alois Ferscha},
  title        = {Distributed Simulation on the Grid: Opportunities and Challenges},
  booktitle    = {12th {IEEE/ACM} International Symposium on Distributed Simulation
                  and Real-Time Applications, 27-29 October 2008, Vancouver, BC, Canada,
                  Proceedings},
  pages        = {3},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/DS-RT.2008.49},
  doi          = {10.1109/DS-RT.2008.49},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dsrt/Turner08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/EdwardsBTDTSMR08,
  author       = {Todd L. Edwards and
                  William S. Bush and
                  Stephen D. Turner and
                  Scott M. Dudek and
                  Eric Torstenson and
                  Mike Schmidt and
                  Eden Martin and
                  Marylyn D. Ritchie},
  editor       = {Elena Marchiori and
                  Jason H. Moore},
  title        = {Generating Linkage Disequilibrium Patterns in Data Simulations Using
                  genomeSIMLA},
  booktitle    = {Evolutionary Computation, Machine Learning and Data Mining in Bioinformatics,
                  6th European Conference, EvoBIO 2008, Naples, Italy, March 26-28,
                  2008. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4973},
  pages        = {24--35},
  publisher    = {Springer},
  year         = {2008},
  url          = {https://doi.org/10.1007/978-3-540-78757-0\_3},
  doi          = {10.1007/978-3-540-78757-0\_3},
  timestamp    = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/evoW/EdwardsBTDTSMR08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fecs/TurnerF08,
  author       = {Stephen W. Turner and
                  Michael Farmer},
  editor       = {Hamid R. Arabnia and
                  Victor A. Clincy and
                  Nasser Tadayon},
  title        = {Assessment of Student Performance in an Internet-Based Multimedia
                  Classroom},
  booktitle    = {Proceedings of the 2008 International Conference on Frontiers in Education:
                  Computer Science {\&} Computer Engineering, {FECS} 2008, July
                  14-17, 2008, Las Vegas, Nevada, {USA}},
  pages        = {411--415},
  publisher    = {{CSREA} Press},
  year         = {2008},
  timestamp    = {Mon, 21 Dec 2015 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/fecs/TurnerF08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hoti/FeehrerRSGYPHT08,
  author       = {John R. Feehrer and
                  Paul Rotker and
                  Milton Shih and
                  Paul Gingras and
                  Peter Yakutis and
                  Stephen Phillips and
                  John Heath and
                  Sebastian Turullols},
  title        = {Coherency Hub Design for Multi-Node Victoria Falls Server Systems},
  booktitle    = {16th Annual {IEEE} Symposium on High Performance Interconnects {(HOTI}
                  2008), 26-28 August 2008, Stanford, CA, {USA}},
  pages        = {43--50},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/HOTI.2008.12},
  doi          = {10.1109/HOTI.2008.12},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/hoti/FeehrerRSGYPHT08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iadis/FarrierGT08,
  author       = {Stephen Farrier and
                  Patricia Gannon{-}Leary and
                  Chris Turnock},
  editor       = {Miguel Baptista Nunes and
                  Maggie McPherson},
  title        = {Risk Managing Your Vle: Strategic Implications For Learning Providers},
  booktitle    = {{IADIS} International Conference e-Learning 2008, Amsterdam, The Netherlands,
                  July 22-25, 2008. Proceedings},
  pages        = {33--37},
  publisher    = {{IADIS}},
  year         = {2008},
  timestamp    = {Sun, 01 Mar 2009 21:54:10 +0100},
  biburl       = {https://dblp.org/rec/conf/iadis/FarrierGT08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/AydtTCLLG08,
  author       = {Heiko Aydt and
                  Stephen John Turner and
                  Wentong Cai and
                  Malcolm Yoke Hean Low and
                  Peter Lendermann and
                  Boon{-}Ping Gan},
  editor       = {Marian Bubak and
                  G. Dick van Albada and
                  Jack J. Dongarra and
                  Peter M. A. Sloot},
  title        = {Symbiotic Simulation Control in Semiconductor Manufacturing},
  booktitle    = {Computational Science - {ICCS} 2008, 8th International Conference,
                  Krak{\'{o}}w, Poland, June 23-25, 2008, Proceedings, Part {III}},
  series       = {Lecture Notes in Computer Science},
  volume       = {5103},
  pages        = {26--35},
  publisher    = {Springer},
  year         = {2008},
  url          = {https://doi.org/10.1007/978-3-540-69389-5\_5},
  doi          = {10.1007/978-3-540-69389-5\_5},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iccS/AydtTCLLG08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/TullyMKC08,
  author       = {Stephen Tully and
                  Hyungpil Moon and
                  George Kantor and
                  Howie Choset},
  title        = {Iterated filters for bearing-only {SLAM}},
  booktitle    = {2008 {IEEE} International Conference on Robotics and Automation, {ICRA}
                  2008, May 19-23, 2008, Pasadena, California, {USA}},
  pages        = {1442--1448},
  publisher    = {{IEEE}},
  year         = {2008},
  url          = {https://doi.org/10.1109/ROBOT.2008.4543405},
  doi          = {10.1109/ROBOT.2008.4543405},
  timestamp    = {Mon, 22 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icra/TullyMKC08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/WrigleyTBW08,
  author       = {Stuart N. Wrigley and
                  Simon Tucker and
                  Guy J. Brown and
                  Steve Whittaker},
  title        = {The influence of audio presentation style on multitasking during teleconferences},
  booktitle    = {9th Annual Conference of the International Speech Communication Association,
                  {INTERSPEECH} 2008, Brisbane, Australia, September 22-26, 2008},
  pages        = {801--804},
  publisher    = {{ISCA}},
  year         = {2008},
  url          = {https://doi.org/10.21437/Interspeech.2008-245},
  doi          = {10.21437/INTERSPEECH.2008-245},
  timestamp    = {Tue, 11 Jun 2024 16:45:43 +0200},
  biburl       = {https://dblp.org/rec/conf/interspeech/WrigleyTBW08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispd/LiAHMQV08,
  author       = {Zhuo Li and
                  Charles J. Alpert and
                  Shiyan Hu and
                  Tuhin Muhmud and
                  Stephen T. Quay and
                  Paul G. Villarrubia},
  editor       = {David Z. Pan and
                  Gi{-}Joon Nam},
  title        = {Fast interconnect synthesis with layer assignment},
  booktitle    = {Proceedings of the 2008 International Symposium on Physical Design,
                  {ISPD} 2008, Portland, Oregon, USA, April 13-16, 2008},
  pages        = {71--77},
  publisher    = {{ACM}},
  year         = {2008},
  url          = {https://doi.org/10.1145/1353629.1353648},
  doi          = {10.1145/1353629.1353648},
  timestamp    = {Tue, 06 Nov 2018 11:07:47 +0100},
  biburl       = {https://dblp.org/rec/conf/ispd/LiAHMQV08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/massdata/PhamWZBBHABHW08,
  author       = {Tuan D. Pham and
                  Honghui Wang and
                  Xiaobo Zhou and
                  Dominik Beck and
                  Miriam Brandl and
                  Gerard Hoehn and
                  Joseph Azok and
                  Marie{-}Luise Brennan and
                  Stanley L. Hazen and
                  Stephen T. C. Wong},
  editor       = {Petra Perner and
                  Ovidio Salvetti},
  title        = {Classification of Mass Spectrometry Based Protein Markers by Kriging
                  Error Matching},
  booktitle    = {Advances in Mass Data Analysis of Images and Signals in Medicine,
                  Biotechnology, Chemistry and Food Industry, Third International Conference,
                  {MDA} 2008, Leipzig, Germany, July 14, 2008, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5108},
  pages        = {82--94},
  publisher    = {Springer},
  year         = {2008},
  url          = {https://doi.org/10.1007/978-3-540-70715-8\_8},
  doi          = {10.1007/978-3-540-70715-8\_8},
  timestamp    = {Tue, 14 May 2019 10:00:48 +0200},
  biburl       = {https://dblp.org/rec/conf/massdata/PhamWZBBHABHW08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mlmi/TuckerKW08,
  author       = {Simon Tucker and
                  Nicos Kyprianou and
                  Steve Whittaker},
  editor       = {Andrei Popescu{-}Belis and
                  Rainer Stiefelhagen},
  title        = {Time-Compressing Speech: {ASR} Transcripts Are an Effective Way to
                  Support Gist Extraction},
  booktitle    = {Machine Learning for Multimodal Interaction, 5th International Workshop,
                  {MLMI} 2008, Utrecht, The Netherlands, September 8-10, 2008. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5237},
  pages        = {226--235},
  publisher    = {Springer},
  year         = {2008},
  url          = {https://doi.org/10.1007/978-3-540-85853-9\_21},
  doi          = {10.1007/978-3-540-85853-9\_21},
  timestamp    = {Mon, 11 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/mlmi/TuckerKW08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mmvr/TurinskyFTDSSWH08,
  author       = {Andrei L. Turinsky and
                  Elena Fanea and
                  Quang Trinh and
                  Xiaoli Dong and
                  Julie N. Stromer and
                  Xueling Shu and
                  Stephen Wat and
                  Benedikt Hallgr{\'{\i}}msson and
                  Jonathan W. Hill and
                  Carol Edwards and
                  Brenda Grosenick and
                  Masumi Yajima and
                  Christoph W. Sensen},
  editor       = {James D. Westwood and
                  Randy S. Haluck and
                  Helene M. Hoffman and
                  Greg T. Mogel and
                  Roger Phillips and
                  Richard A. Robb and
                  Kirby G. Vosburgh},
  title        = {Integration of Genomic and Medical Data into a 3D Atlas of Human Anatomy},
  booktitle    = {Medicine Meets Virtual Reality 16 - parallel, combinatorial, convergent:
                  NextMed by Design, {MMVR} 2008, Long Beach, CA, USA, January 29, 2008},
  series       = {Studies in Health Technology and Informatics},
  volume       = {132},
  pages        = {526--531},
  publisher    = {{IOS} Press},
  year         = {2008},
  timestamp    = {Tue, 09 Jan 2018 17:48:16 +0100},
  biburl       = {https://dblp.org/rec/conf/mmvr/TurinskyFTDSSWH08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/AydtTCL08,
  author       = {Heiko Aydt and
                  Stephen John Turner and
                  Wentong Cai and
                  Malcolm Yoke Hean Low},
  editor       = {Francesco Quaglia and
                  Jason Liu},
  title        = {Symbiotic Simulation Systems: An Extended Definition Motivated by
                  Symbiosis in Biology},
  booktitle    = {22st International Workshop on Principles of Advanced and Distributed
                  Simulation, {PADS} 2008, Roma, Italy, June 3-6, 2008},
  pages        = {109--116},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/PADS.2008.17},
  doi          = {10.1109/PADS.2008.17},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pads/AydtTCL08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/PanTCL08,
  author       = {Ke Pan and
                  Stephen John Turner and
                  Wentong Cai and
                  Zengxiang Li},
  editor       = {Francesco Quaglia and
                  Jason Liu},
  title        = {A Hybrid {HLA} Time Management Algorithm Based on Both Conditional
                  and Unconditional Information},
  booktitle    = {22st International Workshop on Principles of Advanced and Distributed
                  Simulation, {PADS} 2008, Roma, Italy, June 3-6, 2008},
  pages        = {203--211},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/PADS.2008.11},
  doi          = {10.1109/PADS.2008.11},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/PanTCL08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/TaylorTS08,
  author       = {Simon J. E. Taylor and
                  Stephen John Turner and
                  Steffen Stra{\ss}burger},
  editor       = {Francesco Quaglia and
                  Jason Liu},
  title        = {Clarifying Interoperability: The {SISO} {CSPI} {PDG} Standard for
                  Commercial Off-The-Shelf Simulation Package Interoperability Reference
                  Models},
  booktitle    = {22st International Workshop on Principles of Advanced and Distributed
                  Simulation, {PADS} 2008, Roma, Italy, June 3-6, 2008},
  pages        = {153},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/PADS.2008.35},
  doi          = {10.1109/PADS.2008.35},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pads/TaylorTS08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scss/ClarkST08,
  author       = {Stephen O. Clark and
                  Steven T. Shorrock and
                  Nic Turley},
  editor       = {Felix Redmill and
                  Tom Anderson},
  title        = {Human Factors Safety Assurance for Changing {ATM} Systems},
  booktitle    = {Improvements in System Safety - Proceedings of the Sixteenth Safety-Critical
                  Systems Symposium, Brighton, UK, February 5-7, 2008},
  pages        = {155--173},
  publisher    = {Springer},
  year         = {2008},
  url          = {https://doi.org/10.1007/978-1-84800-100-8\_10},
  doi          = {10.1007/978-1-84800-100-8\_10},
  timestamp    = {Fri, 15 May 2020 12:05:38 +0200},
  biburl       = {https://dblp.org/rec/conf/scss/ClarkST08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/TurnerQPE08,
  author       = {Scott A. Turner and
                  Ricardo Quintana{-}Castillo and
                  Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and
                  Stephen H. Edwards},
  editor       = {J. D. Dougherty and
                  Susan H. Rodger and
                  Sue Fitzgerald and
                  Mark Guzdial},
  title        = {Misunderstandings about object-oriented design: experiences using
                  code reviews},
  booktitle    = {Proceedings of the 39th {SIGCSE} Technical Symposium on Computer Science
                  Education, {SIGCSE} 2008, Portland, OR, USA, March 12-15, 2008},
  pages        = {97--101},
  publisher    = {{ACM}},
  year         = {2008},
  url          = {https://doi.org/10.1145/1352135.1352169},
  doi          = {10.1145/1352135.1352169},
  timestamp    = {Wed, 10 Mar 2021 13:17:16 +0100},
  biburl       = {https://dblp.org/rec/conf/sigcse/TurnerQPE08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tpcg/LongshawTH08,
  author       = {Stephen M. Longshaw and
                  Martin J. Turner and
                  W. Terry Hewitt},
  editor       = {Ik Soo Lim and
                  Wen Tang},
  title        = {Interactive Grid Based Binning for Information Visualization},
  booktitle    = {{EG} {UK} Theory and Practice of Computer Graphics, Manchester, United
                  Kingdom, 2008. Proceedings},
  pages        = {35--42},
  publisher    = {Eurographics Association},
  year         = {2008},
  url          = {https://doi.org/10.2312/LocalChapterEvents/TPCG/TPCG08/035-042},
  doi          = {10.2312/LOCALCHAPTEREVENTS/TPCG/TPCG08/035-042},
  timestamp    = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/tpcg/LongshawTH08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/AydtTCLLGA08,
  author       = {Heiko Aydt and
                  Stephen John Turner and
                  Wentong Cai and
                  Malcolm Yoke Hean Low and
                  Peter Lendermann and
                  Boon{-}Ping Gan and
                  Rassul Ayani},
  editor       = {Scott J. Mason and
                  Raymond R. Hill and
                  Lars M{\"{o}}nch and
                  Oliver Rose and
                  Thomas Jefferson and
                  John W. Fowler},
  title        = {Preventive what-if analysis in symbiotic simulation},
  booktitle    = {Proceedings of the 2008 Winter Simulation Conference, Global Gateway
                  to Discovery, {WSC} 2008, InterContinental Hotel, Miami, Florida,
                  USA, December 7-10, 2008},
  pages        = {750--758},
  publisher    = {{WSC}},
  year         = {2008},
  url          = {https://doi.org/10.1109/WSC.2008.4736137},
  doi          = {10.1109/WSC.2008.4736137},
  timestamp    = {Thu, 10 Jun 2021 22:19:17 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/AydtTCLLGA08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/LiCTP08,
  author       = {Zengxiang Li and
                  Wentong Cai and
                  Stephen John Turner and
                  Ke Pan},
  editor       = {Scott J. Mason and
                  Raymond R. Hill and
                  Lars M{\"{o}}nch and
                  Oliver Rose and
                  Thomas Jefferson and
                  John W. Fowler},
  title        = {Improving performance by replicating simulations with alternative
                  synchronization approaches},
  booktitle    = {Proceedings of the 2008 Winter Simulation Conference, Global Gateway
                  to Discovery, {WSC} 2008, InterContinental Hotel, Miami, Florida,
                  USA, December 7-10, 2008},
  pages        = {1112--1120},
  publisher    = {{WSC}},
  year         = {2008},
  url          = {https://doi.org/10.1109/WSC.2008.4736180},
  doi          = {10.1109/WSC.2008.4736180},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/LiCTP08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/LiangTG08,
  author       = {Yuanxi Liang and
                  Stephen John Turner and
                  Boon{-}Ping Gan},
  editor       = {Scott J. Mason and
                  Raymond R. Hill and
                  Lars M{\"{o}}nch and
                  Oliver Rose and
                  Thomas Jefferson and
                  John W. Fowler},
  title        = {Predictive-conservative synchronization for commercial simulation
                  package interoperability},
  booktitle    = {Proceedings of the 2008 Winter Simulation Conference, Global Gateway
                  to Discovery, {WSC} 2008, InterContinental Hotel, Miami, Florida,
                  USA, December 7-10, 2008},
  pages        = {1103--1111},
  publisher    = {{WSC}},
  year         = {2008},
  url          = {https://doi.org/10.1109/WSC.2008.4736179},
  doi          = {10.1109/WSC.2008.4736179},
  timestamp    = {Thu, 10 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/LiangTG08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TaylorTS08,
  author       = {Simon J. E. Taylor and
                  Stephen John Turner and
                  Steffen Stra{\ss}burger},
  editor       = {Scott J. Mason and
                  Raymond R. Hill and
                  Lars M{\"{o}}nch and
                  Oliver Rose and
                  Thomas Jefferson and
                  John W. Fowler},
  title        = {Guidelines for commercial off-the-shelf Simulation Package interoperability},
  booktitle    = {Proceedings of the 2008 Winter Simulation Conference, Global Gateway
                  to Discovery, {WSC} 2008, InterContinental Hotel, Miami, Florida,
                  USA, December 7-10, 2008},
  pages        = {193--204},
  publisher    = {{WSC}},
  year         = {2008},
  url          = {https://doi.org/10.1109/WSC.2008.4736068},
  doi          = {10.1109/WSC.2008.4736068},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/TaylorTS08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/FuLWOT08,
  author       = {Xiuju Fu and
                  Xiaorong Li and
                  Lipo Wang and
                  David Ong and
                  Stephen John Turner},
  editor       = {John Fulcher and
                  Lakhmi C. Jain},
  title        = {Data Mining in QoS-Aware Media Grids},
  booktitle    = {Computational Intelligence: {A} Compendium},
  series       = {Studies in Computational Intelligence},
  volume       = {115},
  pages        = {689--714},
  publisher    = {Springer},
  year         = {2008},
  url          = {https://doi.org/10.1007/978-3-540-78293-3\_16},
  doi          = {10.1007/978-3-540-78293-3\_16},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/series/sci/FuLWOT08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ease/2008,
  editor       = {Giuseppe Visaggio and
                  Maria Teresa Baldassarre and
                  Stephen G. Linkman and
                  Mark Turner},
  title        = {12th International Conference on Evaluation and Assessment in Software
                  Engineering, {EASE} 2008, University of Bari, Italy, 26-27 June 2008},
  series       = {Workshops in Computing},
  publisher    = {{BCS}},
  year         = {2008},
  url          = {http://ewic.bcs.org/category/16334},
  timestamp    = {Tue, 15 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ease/2008.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0802-3047,
  author       = {C. Saha and
                  Terence O'Donnell and
                  J. Godsell and
                  L. Carlioz and
                  Ningning Wang and
                  Paul McCloskey and
                  Stephen P. Beeby and
                  M.{-}J. Tudor and
                  Russel N. Torah},
  title        = {Step-up converter for electromagnetic vibrational energy scavenger},
  journal      = {CoRR},
  volume       = {abs/0802.3047},
  year         = {2008},
  url          = {http://arxiv.org/abs/0802.3047},
  eprinttype    = {arXiv},
  eprint       = {0802.3047},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-0802-3047.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iasc/BowmanLTCN07,
  author       = {Catherine D. D. Bowman and
                  Stephenie H. Lievense and
                  Edward W. Tunstel and
                  Eugene C. Chalfant and
                  Jeffrey S. Norris},
  title        = {{NASA} Robotics Education: Inspiring the Next Generation of Explorers},
  journal      = {Intell. Autom. Soft Comput.},
  volume       = {13},
  number       = {1},
  pages        = {69--80},
  year         = {2007},
  url          = {https://doi.org/10.1080/10798587.2007.10642951},
  doi          = {10.1080/10798587.2007.10642951},
  timestamp    = {Fri, 26 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/iasc/BowmanLTCN07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iee/KitchenhamBBTCL07,
  author       = {Barbara A. Kitchenham and
                  David Budgen and
                  Pearl Brereton and
                  Mark Turner and
                  Stuart M. Charters and
                  Stephen G. Linkman},
  title        = {Large-scale software engineering questions expert opinion or empirical
                  evidence?},
  journal      = {{IET} Softw.},
  volume       = {1},
  number       = {5},
  pages        = {161--171},
  year         = {2007},
  url          = {https://doi.org/10.1049/iet-sen:20060052},
  doi          = {10.1049/IET-SEN:20060052},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/iee/KitchenhamBBTCL07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jos/LendermannTLGJC07,
  author       = {Peter Lendermann and
                  Stephen John Turner and
                  Malcolm Y. H. Low and
                  Boon Ping Gan and
                  Nirupam Julka and
                  Lai Peng Chan and
                  Wentong Cai and
                  Loo Hay Lee and
                  Ek Peng Chew and
                  Suyan Teng and
                  Leon F. McGinnis},
  title        = {An integrated and adaptive decision-support framework for high-tech
                  manufacturing and service networks},
  journal      = {J. Simulation},
  volume       = {1},
  number       = {2},
  pages        = {69--79},
  year         = {2007},
  url          = {https://doi.org/10.1057/palgrave.jos.4250016},
  doi          = {10.1057/PALGRAVE.JOS.4250016},
  timestamp    = {Sat, 19 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jos/LendermannTLGJC07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BehzadCC0PLLLAK07,
  author       = {Arya Behzad and
                  Keith A. Carter and
                  Hung{-}Ming Chien and
                  Stephen Wu and
                  Meng{-}An Pan and
                  C. Paul Lee and
                  Qiang (Tom) Li and
                  John C. Leete and
                  Stephen Au and
                  Michael S. Kappes and
                  Zhimin Zhou and
                  Dayo Ojo and
                  Lijun Zhang and
                  Alireza Zolfaghari and
                  Jesse Castaneda and
                  Hooman Darabi and
                  Benson Yeung and
                  Ahmadreza Rofougaran and
                  Maryam Rofougaran and
                  Jason Trachewsky and
                  Tushar Moorti and
                  Rohit V. Gaikwad and
                  Amit Bagchi and
                  Joachim S. Hammerschmidt and
                  Jay Pattin and
                  Jacob J. Rael and
                  Bojko Marholev},
  title        = {A Fully Integrated {MIMO} Multiband Direct Conversion {CMOS} Transceiver
                  for {WLAN} Applications (802.11n)},
  journal      = {{IEEE} J. Solid State Circuits},
  volume       = {42},
  number       = {12},
  pages        = {2795--2808},
  year         = {2007},
  url          = {https://doi.org/10.1109/JSSC.2007.908667},
  doi          = {10.1109/JSSC.2007.908667},
  timestamp    = {Wed, 02 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jssc/BehzadCC0PLLLAK07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lre/MostefaMCPCTCTCTPMTBSBR07,
  author       = {Djamel Mostefa and
                  Nicolas Moreau and
                  Khalid Choukri and
                  Gerasimos Potamianos and
                  Stephen M. Chu and
                  Ambrish Tyagi and
                  Josep R. Casas and
                  Jordi Turmo and
                  Luca Cristoforetti and
                  Francesco Tobia and
                  Aristodemos Pnevmatikakis and
                  Vasileios Mylonakis and
                  Fotios Talantzis and
                  Susanne Burger and
                  Rainer Stiefelhagen and
                  Keni Bernardin and
                  Cedrick Rochet},
  title        = {The {CHIL} audiovisual corpus for lecture and meeting analysis inside
                  smart rooms},
  journal      = {Lang. Resour. Evaluation},
  volume       = {41},
  number       = {3-4},
  pages        = {389--407},
  year         = {2007},
  url          = {https://doi.org/10.1007/s10579-007-9054-4},
  doi          = {10.1007/S10579-007-9054-4},
  timestamp    = {Sun, 25 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/lre/MostefaMCPCTCTCTPMTBSBR07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/ShiTZRTDT07,
  author       = {Yonggang Shi and
                  Paul M. Thompson and
                  Greig I. de Zubicaray and
                  Stephen E. Rose and
                  Zhuowen Tu and
                  Ivo D. Dinov and
                  Arthur W. Toga},
  title        = {Direct mapping of hippocampal surfaces with intrinsic shape context},
  journal      = {NeuroImage},
  volume       = {37},
  number       = {3},
  pages        = {792--807},
  year         = {2007},
  url          = {https://doi.org/10.1016/j.neuroimage.2007.05.016},
  doi          = {10.1016/J.NEUROIMAGE.2007.05.016},
  timestamp    = {Fri, 30 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/neuroimage/ShiTZRTDT07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/ZhouCTWZ07,
  author       = {Suiping Zhou and
                  Wentong Cai and
                  Stephen John Turner and
                  Junhu Wei and
                  Wenbo Zong},
  title        = {Flexible State Update Mechanism for Large-Scale Distributed Wargame
                  Simulations},
  journal      = {Simul.},
  volume       = {83},
  number       = {10},
  pages        = {707--719},
  year         = {2007},
  url          = {https://doi.org/10.1177/0037549707085541},
  doi          = {10.1177/0037549707085541},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/simulation/ZhouCTWZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/TuanRDTK07,
  author       = {Tim Tuan and
                  Arifur Rahman and
                  Satyaki Das and
                  Steven Trimberger and
                  Sean Kao},
  title        = {A 90-nm Low-Power {FPGA} for Battery-Powered Applications},
  journal      = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
  volume       = {26},
  number       = {2},
  pages        = {296--300},
  year         = {2007},
  url          = {https://doi.org/10.1109/TCAD.2006.885731},
  doi          = {10.1109/TCAD.2006.885731},
  timestamp    = {Thu, 24 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcad/TuanRDTK07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkde/TuckerMSS07,
  author       = {Peter A. Tucker and
                  David Maier and
                  Tim Sheard and
                  Paul Stephens},
  title        = {Using Punctuation Schemes to Characterize Strategies for Querying
                  over Data Streams},
  journal      = {{IEEE} Trans. Knowl. Data Eng.},
  volume       = {19},
  number       = {9},
  pages        = {1227--1240},
  year         = {2007},
  url          = {https://doi.org/10.1109/TKDE.2007.1052},
  doi          = {10.1109/TKDE.2007.1052},
  timestamp    = {Tue, 07 Nov 2017 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tkde/TuckerMSS07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/ZengTLHPRL07,
  author       = {Zhihong Zeng and
                  Jilin Tu and
                  Ming Liu and
                  Thomas S. Huang and
                  Brian Pianfetti and
                  Dan Roth and
                  Stephen E. Levinson},
  title        = {Audio-Visual Affect Recognition},
  journal      = {{IEEE} Trans. Multim.},
  volume       = {9},
  number       = {2},
  pages        = {424--428},
  year         = {2007},
  url          = {https://doi.org/10.1109/TMM.2006.886310},
  doi          = {10.1109/TMM.2006.886310},
  timestamp    = {Thu, 01 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tmm/ZengTLHPRL07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomccap/ZhouCTLW07,
  author       = {Suiping Zhou and
                  Wentong Cai and
                  Stephen John Turner and
                  Bu{-}Sung Lee and
                  Junhu Wei},
  title        = {Critical causal order of events in distributed virtual environments},
  journal      = {{ACM} Trans. Multim. Comput. Commun. Appl.},
  volume       = {3},
  number       = {3},
  pages        = {15},
  year         = {2007},
  url          = {https://doi.org/10.1145/1236471.1236474},
  doi          = {10.1145/1236471.1236474},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tomccap/ZhouCTLW07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/TavaresTKFNMCHOLS07,
  author       = {Tulio Tavares and
                  George Teodoro and
                  Tahsin M. Kur{\c{c}} and
                  Renato Ferreira and
                  Dorgival Olavo Guedes Neto and
                  Wagner Meira Jr. and
                  {\"{U}}mit V. {\c{C}}ataly{\"{u}}rek and
                  Shannon Hastings and
                  Scott Oster and
                  Stephen Langella and
                  Joel H. Saltz},
  title        = {An Efficient and Reliable Scientific Workflow System},
  booktitle    = {Seventh {IEEE} International Symposium on Cluster Computing and the
                  Grid (CCGrid 2007), 14-17 May 2007, Rio de Janeiro, Brazil},
  pages        = {445--452},
  publisher    = {{IEEE} Computer Society},
  year         = {2007},
  url          = {https://doi.org/10.1109/CCGRID.2007.20},
  doi          = {10.1109/CCGRID.2007.20},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ccgrid/TavaresTKFNMCHOLS07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccnc/LiJFCHHOTV07,
  author       = {Xiaorong Li and
                  Wei Jie and
                  Xiuju Fu and
                  Hoong{-}Maeng Chan and
                  Quoc{-}Thuan Ho and
                  Terence Hung and
                  David Ong and
                  Stephen John Turner and
                  Bharadwaj Veeravalli},
  title        = {A Multi-Agent Method for Streaming Quality Monitoring and Analysis
                  over Media Grid},
  booktitle    = {4th {IEEE} Consumer Communications and Networking Conference, {CCNC}
                  2007, Las Vegas, NV, USA, January 11-13, 2007},
  pages        = {327--331},
  publisher    = {{IEEE}},
  year         = {2007},
  url          = {https://doi.org/10.1109/CCNC.2007.71},
  doi          = {10.1109/CCNC.2007.71},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ccnc/LiJFCHHOTV07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/TuanST07,
  author       = {Tim Tuan and
                  Tom Strader and
                  Steve Trimberger},
  title        = {Analysis of Data Remanence in a 90nm {FPGA}},
  booktitle    = {Proceedings of the {IEEE} 2007 Custom Integrated Circuits Conference,
                  {CICC} 2007, DoubleTree Hotel, San Jose, California, USA, September
                  16-19, 2007},
  pages        = {93--96},
  publisher    = {{IEEE}},
  year         = {2007},
  url          = {https://doi.org/10.1109/CICC.2007.4405689},
  doi          = {10.1109/CICC.2007.4405689},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/cicc/TuanST07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/LiCTP07,
  author       = {Zengxiang Li and
                  Wentong Cai and
                  Stephen John Turner and
                  Ke Pan},
  editor       = {David J. Roberts and
                  Georgios Theodoropoulos and
                  Abdulmotaleb El{-}Saddik},
  title        = {Federate Migration in a Service Oriented {HLA} {RTI}},
  booktitle    = {11th {IEEE} International Symposium on Distributed Simulation and
                  Real-Time Applications, {DS-RT} 2007, Chania, Greece, 22-24 October
                  2007},
  pages        = {113--121},
  publisher    = {{IEEE} Computer Society},
  year         = {2007},
  url          = {https://doi.org/10.1109/DS-RT.2007.31},
  doi          = {10.1109/DS-RT.2007.31},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dsrt/LiCTP07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ease/BudgenKCTBL07,
  author       = {David Budgen and
                  Barbara A. Kitchenham and
                  Stuart M. Charters and
                  Mark Turner and
                  Pearl Brereton and
                  Stephen G. Linkman},
  editor       = {Barbara A. Kitchenham and
                  Pearl Brereton and
                  Mark Turner},
  title        = {Preliminary results of a study of the completeness and clarity of
                  structured abstracts},
  booktitle    = {11th International Conference on Evaluation and Assessment in Software
                  Engineering, {EASE} 2007, Keele University, UK, 2-3 April 2007},
  series       = {Workshops in Computing},
  publisher    = {{BCS}},
  year         = {2007},
  url          = {http://ewic.bcs.org/content/ConWebDoc/10676},
  timestamp    = {Mon, 14 Sep 2020 16:49:35 +0200},
  biburl       = {https://dblp.org/rec/conf/ease/BudgenKCTBL07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esem/BaileyBTKBL07,
  author       = {John Bailey and
                  David Budgen and
                  Mark Turner and
                  Barbara A. Kitchenham and
                  Pearl Brereton and
                  Stephen G. Linkman},
  title        = {Evidence relating to Object-Oriented software design: {A} survey},
  booktitle    = {Proceedings of the First International Symposium on Empirical Software
                  Engineering and Measurement, {ESEM} 2007, September 20-21, 2007, Madrid,
                  Spain},
  pages        = {482--484},
  publisher    = {{ACM} / {IEEE} Computer Society},
  year         = {2007},
  url          = {https://doi.org/10.1109/ESEM.2007.58},
  doi          = {10.1109/ESEM.2007.58},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/esem/BaileyBTKBL07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/SwiftTCG07,
  author       = {Stephen Swift and
                  Allan Tucker and
                  Jason Crampton and
                  David Garway{-}Heath},
  editor       = {Hod Lipson},
  title        = {An improved restricted growth function genetic algorithm for the consensus
                  clustering of retinal nerve fibre data},
  booktitle    = {Genetic and Evolutionary Computation Conference, {GECCO} 2007, Proceedings,
                  London, England, UK, July 7-11, 2007},
  pages        = {2174--2181},
  publisher    = {{ACM}},
  year         = {2007},
  url          = {https://doi.org/10.1145/1276958.1277376},
  doi          = {10.1145/1276958.1277376},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/gecco/SwiftTCG07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/TuckerSC07,
  author       = {Allan Tucker and
                  Stephen Swift and
                  Jason Crampton},
  editor       = {Hod Lipson},
  title        = {Efficiency updates for the restricted growth function {GA} for grouping
                  problems},
  booktitle    = {Genetic and Evolutionary Computation Conference, {GECCO} 2007, Proceedings,
                  London, England, UK, July 7-11, 2007},
  pages        = {1536},
  publisher    = {{ACM}},
  year         = {2007},
  url          = {https://doi.org/10.1145/1276958.1277265},
  doi          = {10.1145/1276958.1277265},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/gecco/TuckerSC07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwn/Turner07,
  author       = {Stephen Turner},
  editor       = {Hamid R. Arabnia and
                  Victor A. Clincy and
                  Laurence Tianruo Yang},
  title        = {Dynamic Simple Channel Assignment Strategies for Multiple-Channel
                  Ad Hoc Networks},
  booktitle    = {Proceedings of the 2007 International Conference on Wireless Networks,
                  June 25-28, 2007, Las Vegas, Nevada, {USA}},
  pages        = {146--152},
  publisher    = {{CSREA} Press},
  year         = {2007},
  timestamp    = {Mon, 09 Feb 2009 10:38:02 +0100},
  biburl       = {https://dblp.org/rec/conf/icwn/Turner07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icws/PanTCL07,
  author       = {Ke Pan and
                  Stephen John Turner and
                  Wentong Cai and
                  Zengxiang Li},
  title        = {A Service Oriented {HLA} {RTI} on the Grid},
  booktitle    = {2007 {IEEE} International Conference on Web Services {(ICWS} 2007),
                  July 9-13, 2007, Salt Lake City, Utah, {USA}},
  pages        = {984--992},
  publisher    = {{IEEE} Computer Society},
  year         = {2007},
  url          = {https://doi.org/10.1109/ICWS.2007.20},
  doi          = {10.1109/ICWS.2007.20},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icws/PanTCL07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/PedeltyDMBPTRJVPNJSLPP07,
  author       = {Jeffrey A. Pedelty and
                  Sadashiva Devadiga and
                  Edward J. Masuoka and
                  Molly E. Brown and
                  Jorge E. Pinz{\'{o}}n and
                  Compton J. Tucker and
                  David P. Roy and
                  Junchang Ju and
                  Eric F. Vermote and
                  Stephen D. Prince and
                  Jyoteshwar R. Nagol and
                  Christopher Justice and
                  Crystal Schaaf and
                  Jicheng Liu and
                  Jeffrey L. Privette and
                  Ana C. T. Pinheiro},
  title        = {Generating a long-term land data record from the {AVHRR} and {MODIS}
                  Instruments},
  booktitle    = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
                  {IGARSS} 2007, July 23-28, 2007, Barcelona, Spain, Proceedings},
  pages        = {1021--1025},
  publisher    = {{IEEE}},
  year         = {2007},
  url          = {https://doi.org/10.1109/IGARSS.2007.4422974},
  doi          = {10.1109/IGARSS.2007.4422974},
  timestamp    = {Wed, 16 Oct 2019 14:14:53 +0200},
  biburl       = {https://dblp.org/rec/conf/igarss/PedeltyDMBPTRJVPNJSLPP07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/TullyMMKC07,
  author       = {Stephen Tully and
                  Hyungpil Moon and
                  Deryck Morales and
                  George Kantor and
                  Howie Choset},
  title        = {Hybrid localization using the hierarchical atlas},
  booktitle    = {2007 {IEEE/RSJ} International Conference on Intelligent Robots and
                  Systems, October 29 - November 2, 2007, Sheraton Hotel and Marina,
                  San Diego, California, {USA}},
  pages        = {2857--2864},
  publisher    = {{IEEE}},
  year         = {2007},
  url          = {https://doi.org/10.1109/IROS.2007.4399553},
  doi          = {10.1109/IROS.2007.4399553},
  timestamp    = {Wed, 16 Oct 2019 14:14:51 +0200},
  biburl       = {https://dblp.org/rec/conf/iros/TullyMMKC07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/BehzadCCWPLLLAKZOZZCDYRRTMGBRM07,
  author       = {Arya Behzad and
                  Keith A. Carter and
                  Ed Chien and
                  Steve Wu and
                  Michael Pan and
                  C. Paul Lee and
                  Tom Li and
                  John C. Leete and
                  Stephen Au and
                  Michael S. Kappes and
                  Zhimin Zhou and
                  Dayo Ojo and
                  Lijun Zhang and
                  Alireza Zolfaghari and
                  Jesse Castaneda and
                  Hooman Darabi and
                  Benson Yeung and
                  Reza Rofougaran and
                  Maryam Rofougaran and
                  Jason Trachewsky and
                  Tushar Moorti and
                  Rohit V. Gaikwad and
                  Amit Bagchi and
                  Jacob J. Rael and
                  Bojko Marholev},
  title        = {A Fully Integrated {MIMO} Multi-Band Direct-Conversion {CMOS} Transceiver
                  for {WLAN} Applications (802.11n)},
  booktitle    = {2007 {IEEE} International Solid-State Circuits Conference, {ISSCC}
                  2007, Digest of Technical Papers, San Francisco, CA, USA, February
                  11-15, 2007},
  pages        = {560--622},
  publisher    = {{IEEE}},
  year         = {2007},
  url          = {https://doi.org/10.1109/ISSCC.2007.373543},
  doi          = {10.1109/ISSCC.2007.373543},
  timestamp    = {Wed, 02 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/isscc/BehzadCCWPLLLAKZOZZCDYRRTMGBRM07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lcn/DinhHSCOB07,
  author       = {Tuan Le Dinh and
                  Wen Hu and
                  Pavan Sikka and
                  Peter I. Corke and
                  Leslie Overs and
                  Stephen Brosnan},
  title        = {Design and Deployment of a Remote Robust Sensor Network: Experiences
                  from an Outdoor Water Quality Monitoring Network},
  booktitle    = {32nd Annual {IEEE} Conference on Local Computer Networks {(LCN} 2007),
                  15-18 October 2007, Clontarf Castle, Dublin, Ireland, Proceedings},
  pages        = {799--806},
  publisher    = {{IEEE} Computer Society},
  year         = {2007},
  url          = {https://doi.org/10.1109/LCN.2007.39},
  doi          = {10.1109/LCN.2007.39},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/lcn/DinhHSCOB07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/MurrayHTKCMR07,
  author       = {Gabriel Murray and
                  Pei{-}Yun Hsueh and
                  Simon Tucker and
                  Jonathan Kilgour and
                  Jean Carletta and
                  Johanna D. Moore and
                  Steve Renals},
  editor       = {Candace L. Sidner and
                  Tanja Schultz and
                  Matthew Stone and
                  ChengXiang Zhai},
  title        = {Automatic Segmentation and Summarization of Meeting Speech},
  booktitle    = {Human Language Technology Conference of the North American Chapter
                  of the Association of Computational Linguistics, Proceedings, April
                  22-27, 2007, Rochester, New York, {USA}},
  pages        = {9--10},
  publisher    = {The Association for Computational Linguistics},
  year         = {2007},
  url          = {https://aclanthology.org/N07-4005/},
  timestamp    = {Wed, 07 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/naacl/MurrayHTKCMR07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/PanTCL07,
  author       = {Ke Pan and
                  Stephen John Turner and
                  Wentong Cai and
                  Zengxiang Li},
  title        = {An Efficient Sort-Based {DDM} Matching Algorithm for {HLA} Applications
                  with a Large Spatial Environment},
  booktitle    = {21st International Workshop on Principles of Advanced and Distributed
                  Simulation, PADS'07, San Diego, California, USA, June 12-15, 2007},
  pages        = {70--82},
  publisher    = {{IEEE} Computer Society},
  year         = {2007},
  url          = {https://doi.org/10.1109/PADS.2007.14},
  doi          = {10.1109/PADS.2007.14},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/PanTCL07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scsc/WangTCC07,
  author       = {Yong Wang and
                  Stephen John Turner and
                  Wentong Cai and
                  Xinjun Chen},
  editor       = {Gabriel A. Wainer},
  title        = {Time management in a service-oriented architecture for distributed
                  simulation on the grid},
  booktitle    = {Proceedings of the 2007 Summer Computer Simulation Conference, {SCSC}
                  2007, San Diego, California, USA, July 16-19, 2007},
  pages        = {392--399},
  publisher    = {Simulation Councils, Inc.},
  year         = {2007},
  url          = {https://dl.acm.org/citation.cfm?id=1357972},
  timestamp    = {Wed, 10 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/scsc/WangTCC07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tpcg/GobeawanXT07,
  author       = {Like Gobeawan and
                  Shuhong Xu and
                  Stephen John Turner},
  editor       = {Ik Soo Lim and
                  David Duce},
  title        = {Seamless Mesh Stitching Using Curve Approximation},
  booktitle    = {{EG} {UK} Theory and Practice of Computer Graphics, Bangor, United
                  Kingdom, June 13-15, 2007},
  pages        = {165--172},
  publisher    = {Eurographics Association},
  year         = {2007},
  url          = {https://doi.org/10.2312/LocalChapterEvents/TPCG/TPCG07/165-172},
  doi          = {10.2312/LOCALCHAPTEREVENTS/TPCG/TPCG07/165-172},
  timestamp    = {Mon, 22 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/tpcg/GobeawanXT07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/LowTLPCLB07,
  author       = {Malcolm Y. H. Low and
                  Stephen John Turner and
                  Ding Ling and
                  Hai L. Peng and
                  Lai Peng Chan and
                  Peter Lendermann and
                  Stephen J. Buckley},
  editor       = {Shane G. Henderson and
                  Bahar Biller and
                  Ming{-}Hua Hsieh and
                  John Shortle and
                  Jeffrey D. Tew and
                  Russell R. Barton},
  title        = {Symbiotic simulation for business process re-engineering in high-tech
                  manufacturing and service networks},
  booktitle    = {Proceedings of the Winter Simulation Conference, {WSC} 2007, Washington,
                  DC, USA, December 9-12, 2007},
  pages        = {568--576},
  publisher    = {{WSC}},
  year         = {2007},
  url          = {https://doi.org/10.1109/WSC.2007.4419649},
  doi          = {10.1109/WSC.2007.4419649},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/LowTLPCLB07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TaylorMSTLL07,
  author       = {Simon J. E. Taylor and
                  Navonil Mustafee and
                  Steffen Stra{\ss}burger and
                  Stephen John Turner and
                  Malcolm Y. H. Low and
                  John Ladbrook},
  editor       = {Shane G. Henderson and
                  Bahar Biller and
                  Ming{-}Hua Hsieh and
                  John Shortle and
                  Jeffrey D. Tew and
                  Russell R. Barton},
  title        = {The {SISO} {CSPI} {PDG} standard for commercial off-the-shelf simulation
                  package interoperability reference models},
  booktitle    = {Proceedings of the Winter Simulation Conference, {WSC} 2007, Washington,
                  DC, USA, December 9-12, 2007},
  pages        = {594--602},
  publisher    = {{WSC}},
  year         = {2007},
  url          = {https://doi.org/10.1109/WSC.2007.4419652},
  doi          = {10.1109/WSC.2007.4419652},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/TaylorMSTLL07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0711-3314,
  author       = {Stephen P. Beeby and
                  M.{-}J. Tudor and
                  Russel N. Torah and
                  E. Koukharenko and
                  S. Roberts and
                  Terence O'Donnell and
                  S. Roy},
  title        = {Macro and Micro Scale Electromagnetic Kinetic Energy Harvesting Generators},
  journal      = {CoRR},
  volume       = {abs/0711.3314},
  year         = {2007},
  url          = {http://arxiv.org/abs/0711.3314},
  eprinttype    = {arXiv},
  eprint       = {0711.3314},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-0711-3314.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0711-3316,
  author       = {Terence O'Donnell and
                  C. Saha and
                  Stephen P. Beeby and
                  M.{-}J. Tudor},
  title        = {Scaling Effects for Electromagnetic Vibrational Power Generators},
  journal      = {CoRR},
  volume       = {abs/0711.3316},
  year         = {2007},
  url          = {http://arxiv.org/abs/0711.3316},
  eprinttype    = {arXiv},
  eprint       = {0711.3316},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-0711-3316.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/PattonSSXLDST06,
  author       = {G. W. Patton and
                  Robert M. Stephens and
                  I. A. Sidorov and
                  X. Xiao and
                  Richard A. Lempicki and
                  Dimiter S. Dimitrov and
                  Robert H. Shoemaker and
                  G. Tudor},
  title        = {Transcriptomic response to differentiation induction},
  journal      = {{BMC} Bioinform.},
  volume       = {7},
  pages        = {81},
  year         = {2006},
  url          = {https://doi.org/10.1186/1471-2105-7-81},
  doi          = {10.1186/1471-2105-7-81},
  timestamp    = {Wed, 17 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/bmcbi/PattonSSXLDST06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ecra/ChauT06,
  author       = {Stephen B. Chau and
                  Paul Turner},
  title        = {Utilisation of mobile handheld devices for care management at an Australian
                  aged care facility},
  journal      = {Electron. Commer. Res. Appl.},
  volume       = {5},
  number       = {4},
  pages        = {305--312},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.elerap.2006.04.005},
  doi          = {10.1016/J.ELERAP.2006.04.005},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ecra/ChauT06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gandc/ClevisTLDGL06,
  author       = {Quintijn Clevis and
                  Gregory E. Tucker and
                  Stephen T. Lancaster and
                  Arnaud Desitter and
                  Nicole Gasparini and
                  Gary Lock},
  title        = {A simple algorithm for the mapping of {TIN} data onto a static grid:
                  Applied to the stratigraphic simulation of river meander deposits},
  journal      = {Comput. Geosci.},
  volume       = {32},
  number       = {6},
  pages        = {749--766},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.cageo.2005.05.012},
  doi          = {10.1016/J.CAGEO.2005.05.012},
  timestamp    = {Fri, 21 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/gandc/ClevisTLDGL06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcia/PhamTZW06,
  author       = {Tuan D. Pham and
                  Dat Tran and
                  Xiaobo Zhou and
                  Stephen T. C. Wong},
  title        = {Integrated Algorithms for Image Analysis and Classification of Nuclear
                  Division for High-Content Cell-Cycle Screening},
  journal      = {Int. J. Comput. Intell. Appl.},
  volume       = {6},
  number       = {1},
  pages        = {21--43},
  year         = {2006},
  url          = {https://doi.org/10.1142/S1469026806001769},
  doi          = {10.1142/S1469026806001769},
  timestamp    = {Wed, 01 Dec 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijcia/PhamTZW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WheelerBBBCCCDEFGHKKKLMMOPSSSSSSSSTTWY06,
  author       = {David L. Wheeler and
                  Tanya Barrett and
                  Dennis A. Benson and
                  Stephen H. Bryant and
                  Kathi Canese and
                  Vyacheslav Chetvernin and
                  Deanna M. Church and
                  Michael DiCuccio and
                  Ron Edgar and
                  Scott Federhen and
                  Lewis Y. Geer and
                  Wolfgang Helmberg and
                  Yuri Kapustin and
                  David L. Kenton and
                  Oleg Khovayko and
                  David J. Lipman and
                  Thomas L. Madden and
                  Donna R. Maglott and
                  James Ostell and
                  Kim D. Pruitt and
                  Gregory D. Schuler and
                  Lynn M. Schriml and
                  Edwin Sequeira and
                  Stephen T. Sherry and
                  Karl Sirotkin and
                  Alexandre Souvorov and
                  Grigory Starchenko and
                  Tugba O. Suzek and
                  Roman L. Tatusov and
                  Tatiana A. Tatusova and
                  Lukas Wagner and
                  Eugene Yaschenko},
  title        = {Database resources of the National Center for Biotechnology Information},
  journal      = {Nucleic Acids Res.},
  volume       = {34},
  number       = {Database-Issue},
  pages        = {173--180},
  year         = {2006},
  url          = {https://doi.org/10.1093/nar/gkj158},
  doi          = {10.1093/NAR/GKJ158},
  timestamp    = {Tue, 18 Jun 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/WheelerBBBCCCDEFGHKKKLMMOPSSSSSSSSTTWY06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/BalchDFGIKPSW06,
  author       = {Tucker R. Balch and
                  Frank Dellaert and
                  Adam Feldman and
                  Andrew Guillory and
                  Charles Lee Isbell Jr. and
                  Zia Khan and
                  Stephen C. Pratt and
                  Andrew N. Stein and
                  Hank Wilde},
  title        = {How Multirobot Systems Research will Accelerate our Understanding
                  of Social Animal Behavior},
  journal      = {Proc. {IEEE}},
  volume       = {94},
  number       = {7},
  pages        = {1445--1463},
  year         = {2006},
  url          = {https://doi.org/10.1109/JPROC.2006.876969},
  doi          = {10.1109/JPROC.2006.876969},
  timestamp    = {Tue, 25 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pieee/BalchDFGIKPSW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigsoft/CounsellSTM06,
  author       = {Steve Counsell and
                  Stephen Swift and
                  Allan Tucker and
                  Emilia Mendes},
  title        = {Object-oriented cohesion subjectivity amongst experienced and novice
                  developers: an empirical study},
  journal      = {{ACM} {SIGSOFT} Softw. Eng. Notes},
  volume       = {31},
  number       = {5},
  pages        = {1--10},
  year         = {2006},
  url          = {https://doi.org/10.1145/1163514.1163530},
  doi          = {10.1145/1163514.1163530},
  timestamp    = {Thu, 17 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sigsoft/CounsellSTM06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/LowGWWTC06,
  author       = {Malcolm Yoke Hean Low and
                  Boon{-}Ping Gan and
                  Junhu Wei and
                  Xiaoguang Wang and
                  Stephen John Turner and
                  Wentong Cai},
  title        = {Shared State Synchronization for HLA-Based Distributed Simulation},
  journal      = {Simul.},
  volume       = {82},
  number       = {8},
  pages        = {511--521},
  year         = {2006},
  url          = {https://doi.org/10.1177/0037549706069342},
  doi          = {10.1177/0037549706069342},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/simulation/LowGWWTC06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/TaylorWTL06,
  author       = {Simon J. E. Taylor and
                  Xiaoguang Wang and
                  Stephen John Turner and
                  Malcolm Y. H. Low},
  title        = {Integrating Heterogeneous Distributed {COTS} Discrete-Event Simulation
                  Packages: An Emerging Standards-Based Approach},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {A}},
  volume       = {36},
  number       = {1},
  pages        = {109--122},
  year         = {2006},
  url          = {https://doi.org/10.1109/TSMCA.2005.859167},
  doi          = {10.1109/TSMCA.2005.859167},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/TaylorWTL06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aspdac/PhamABBGHHJKKKLLNPPPPRVWWW06,
  author       = {Dac C. Pham and
                  Hans{-}Werner Anderson and
                  Erwin Behnen and
                  Mark Bolliger and
                  Sanjay Gupta and
                  H. Peter Hofstee and
                  Paul E. Harvey and
                  Charles R. Johns and
                  James A. Kahle and
                  Atsushi Kameyama and
                  John M. Keaty and
                  Bob Le and
                  Sang Lee and
                  Tuyen V. Nguyen and
                  John G. Petrovick and
                  Mydung Pham and
                  Juergen Pille and
                  Stephen D. Posluszny and
                  Mack W. Riley and
                  Joseph Verock and
                  James D. Warnock and
                  Steve Weitzel and
                  Dieter F. Wendel},
  editor       = {Fumiyasu Hirose},
  title        = {Key features of the design methodology enabling a multi-core SoC implementation
                  of a first-generation {CELL} processor},
  booktitle    = {Proceedings of the 2006 Conference on Asia South Pacific Design Automation:
                  {ASP-DAC} 2006, Yokohama, Japan, January 24-27, 2006},
  pages        = {871--878},
  publisher    = {{IEEE}},
  year         = {2006},
  url          = {https://doi.org/10.1109/ASPDAC.2006.1594796},
  doi          = {10.1109/ASPDAC.2006.1594796},
  timestamp    = {Fri, 15 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/aspdac/PhamABBGHHJKKKLLNPPPPRVWWW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/JieHTC06,
  author       = {Wei Jie and
                  Terence Hung and
                  Stephen John Turner and
                  Wentong Cai},
  title        = {Architecture Model for Information Service in Large Scale Grid Environments},
  booktitle    = {Sixth {IEEE} International Symposium on Cluster Computing and the
                  Grid (CCGrid 2006), 16-19 May 2006, Singapore},
  pages        = {107--114},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/CCGRID.2006.19},
  doi          = {10.1109/CCGRID.2006.19},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ccgrid/JieHTC06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/TheodoropoulosZCMTCXL06,
  author       = {Georgios Theodoropoulos and
                  Yi Zhang and
                  Dan Chen and
                  Rob Minson and
                  Stephen John Turner and
                  Wentong Cai and
                  Yong Xie and
                  Brian Logan},
  title        = {Large Scale Distributed Simulation on the Grid},
  booktitle    = {Sixth {IEEE} International Symposium on Cluster Computing and the
                  Grid (CCGrid 2006), 16-19 May 2006, Singapore},
  pages        = {63},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.ieeecomputersociety.org/10.1109/CCGRID.2006.151},
  doi          = {10.1109/CCGRID.2006.151},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ccgrid/TheodoropoulosZCMTCXL06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/TuckerW06,
  author       = {Simon Tucker and
                  Steve Whittaker},
  editor       = {Rebecca E. Grinter and
                  Tom Rodden and
                  Paul M. Aoki and
                  Edward Cutrell and
                  Robin Jeffries and
                  Gary M. Olson},
  title        = {Time is of the essence: an evaluation of temporal compression algorithms},
  booktitle    = {Proceedings of the 2006 Conference on Human Factors in Computing Systems,
                  {CHI} 2006, Montr{\'{e}}al, Qu{\'{e}}bec, Canada, April
                  22-27, 2006},
  pages        = {329--338},
  publisher    = {{ACM}},
  year         = {2006},
  url          = {https://doi.org/10.1145/1124772.1124822},
  doi          = {10.1145/1124772.1124822},
  timestamp    = {Mon, 11 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/chi/TuckerW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/RahmanDTT06,
  author       = {Arifur Rahman and
                  Satyaki Das and
                  Tim Tuan and
                  Steven Trimberger},
  title        = {Determination of Power Gating Granularity for {FPGA} Fabric},
  booktitle    = {Proceedings of the {IEEE} 2006 Custom Integrated Circuits Conference,
                  {CICC} 2006, DoubleTree Hotel, San Jose, California, USA, September
                  10-13, 2006},
  pages        = {9--12},
  publisher    = {{IEEE}},
  year         = {2006},
  url          = {https://doi.org/10.1109/CICC.2006.320938},
  doi          = {10.1109/CICC.2006.320938},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/cicc/RahmanDTT06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/complife/HirschTSMOKL06,
  author       = {Michael Hirsch and
                  Allan Tucker and
                  Stephen Swift and
                  Nigel J. Martin and
                  Christine A. Orengo and
                  Paul Kellam and
                  Xiaohui Liu},
  editor       = {Michael R. Berthold and
                  Robert C. Glen and
                  Ingrid Fischer},
  title        = {Improved Robustness in Time Series Analysis of Gene Expression Data
                  by Polynomial Model Based Clustering},
  booktitle    = {Computational Life Sciences II, Second International Symposium, CompLife
                  2006, Cambridge, UK, September 27-29, 2006, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4216},
  pages        = {1--10},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11875741\_1},
  doi          = {10.1007/11875741\_1},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/complife/HirschTSMOKL06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fpga/TuanKRDT06,
  author       = {Tim Tuan and
                  Sean Kao and
                  Arifur Rahman and
                  Satyaki Das and
                  Steven Trimberger},
  editor       = {Steven J. E. Wilton and
                  Andr{\'{e}} DeHon},
  title        = {A 90nm low-power {FPGA} for battery-powered applications},
  booktitle    = {Proceedings of the {ACM/SIGDA} 14th International Symposium on Field
                  Programmable Gate Arrays, {FPGA} 2006, Monterey, California, USA,
                  February 22-24, 2006},
  pages        = {3--11},
  publisher    = {{ACM}},
  year         = {2006},
  url          = {https://doi.org/10.1145/1117201.1117203},
  doi          = {10.1145/1117201.1117203},
  timestamp    = {Tue, 06 Nov 2018 16:58:23 +0100},
  biburl       = {https://dblp.org/rec/conf/fpga/TuanKRDT06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdm/PhamCZW06,
  author       = {Tuan D. Pham and
                  Vikram Chandramohan and
                  Xiaobo Zhou and
                  Stephen T. C. Wong},
  title        = {Robust Feature Extraction and Reduction of Mass Spectrometry Data
                  for Cancer Classification},
  booktitle    = {Workshops Proceedings of the 6th {IEEE} International Conference on
                  Data Mining {(ICDM} 2006), 18-22 December 2006, Hong Kong, China},
  pages        = {202--206},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/ICDMW.2006.143},
  doi          = {10.1109/ICDMW.2006.143},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icdm/PhamCZW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmcs/ZhangyPCTH06,
  author       = {ZhenQiu Zhang and
                  Gerasimos Potamianos and
                  Stephen M. Chu and
                  Jilin Tu and
                  Thomas S. Huang},
  title        = {Person Tracking in Smart Rooms using Dynamic Programming and Adaptive
                  Subspace Learning},
  booktitle    = {Proceedings of the 2006 {IEEE} International Conference on Multimedia
                  and Expo, {ICME} 2006, July 9-12 2006, Toronto, Ontario, Canada},
  pages        = {2061--2064},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/ICME.2006.262620},
  doi          = {10.1109/ICME.2006.262620},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icmcs/ZhangyPCTH06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iconip/TanNQK06,
  author       = {Tuan Zea Tan and
                  Geok See Ng and
                  Hiok Chai Quek and
                  Stephen C. L. Koh},
  editor       = {Irwin King and
                  Jun Wang and
                  Laiwan Chan and
                  DeLiang L. Wang},
  title        = {Ovarian Cancer Prognosis by Hemostasis and Complementary Learning},
  booktitle    = {Neural Information Processing, 13th International Conference, {ICONIP}
                  2006, Hong Kong, China, October 3-6, 2006, Proceedings, Part {III}},
  series       = {Lecture Notes in Computer Science},
  volume       = {4234},
  pages        = {145--154},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11893295\_17},
  doi          = {10.1007/11893295\_17},
  timestamp    = {Fri, 16 Aug 2024 07:48:40 +0200},
  biburl       = {https://dblp.org/rec/conf/iconip/TanNQK06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwn/Turner06,
  author       = {Stephen Turner},
  editor       = {Hamid R. Arabnia},
  title        = {Simple Channel Assignment Strategies for Multiple Channel Ad Hoc Networks},
  booktitle    = {Proceedings of the 2006 International Conference on Wireless Networks,
                  {ICWN} 2006, Las Vegas, Nevada, USA, June 26-29, 2006},
  pages        = {206--212},
  publisher    = {{CSREA} Press},
  year         = {2006},
  timestamp    = {Tue, 02 Jan 2007 13:08:22 +0100},
  biburl       = {https://dblp.org/rec/conf/icwn/Turner06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/CeccatoBBCDGRT06,
  author       = {Pietro Ceccato and
                  Michael A. Bell and
                  M. Benno Blumenthal and
                  Stephen J. Connor and
                  Tufa Dinku and
                  Emily K. Grover{-}Kopec and
                  Chester F. Ropelewski and
                  Madeleine C. Thomson},
  title        = {Use of Remote Sensing for Monitoring Climate Variability for Integrated
                  Early Warning Systems: Applications for Human Diseases and Desert
                  Locust Management},
  booktitle    = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
                  {IGARSS} 2006, July 31 - August 4, 2006, Denver, Colorado, USA, Proceedings},
  pages        = {270--274},
  publisher    = {{IEEE}},
  year         = {2006},
  url          = {https://doi.org/10.1109/IGARSS.2006.74},
  doi          = {10.1109/IGARSS.2006.74},
  timestamp    = {Wed, 08 Dec 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/igarss/CeccatoBBCDGRT06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/ChenCTW06,
  author       = {Xinjun Chen and
                  Wentong Cai and
                  Stephen John Turner and
                  Yong Wang},
  title        = {SOAr-DSGrid: Service-Oriented Architecture for Distributed Simulation
                  on the Grid},
  booktitle    = {20th {IEEE/ACM/SCS} Workshop on Principles of Advanced and Distributed
                  Simulation, {PADS} 2006, Singapore, May 23-26, 2006},
  pages        = {65--73},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/PADS.2006.33},
  doi          = {10.1109/PADS.2006.33},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pads/ChenCTW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/ChenTC06,
  author       = {Dan Chen and
                  Stephen John Turner and
                  Wentong Cai},
  title        = {A Framework for Robust HLA-based Distributed Simulations},
  booktitle    = {20th {IEEE/ACM/SCS} Workshop on Principles of Advanced and Distributed
                  Simulation, {PADS} 2006, Singapore, May 23-26, 2006},
  pages        = {183--192},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/PADS.2006.7},
  doi          = {10.1109/PADS.2006.7},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pads/ChenTC06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/HuangCTHZLFA06,
  author       = {Shell{-}Ying Huang and
                  Wentong Cai and
                  Stephen John Turner and
                  Wen{-}Jing Hsu and
                  Suiping Zhou and
                  Malcolm Yoke Hean Low and
                  Richard Fujimoto and
                  Rassul Ayani},
  title        = {A Generic Symbiotic Simulation Framework},
  booktitle    = {20th {IEEE/ACM/SCS} Workshop on Principles of Advanced and Distributed
                  Simulation, {PADS} 2006, Singapore, May 23-26, 2006},
  pages        = {131},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/PADS.2006.8},
  doi          = {10.1109/PADS.2006.8},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pads/HuangCTHZLFA06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/WangTT06,
  author       = {Xiaoguang Wang and
                  Stephen John Turner and
                  Simon J. E. Taylor},
  title        = {{COTS} Simulation Package {(CSP)} Interoperability -A Solution to
                  Synchronous Entity Passing},
  booktitle    = {20th {IEEE/ACM/SCS} Workshop on Principles of Advanced and Distributed
                  Simulation, {PADS} 2006, Singapore, May 23-26, 2006},
  pages        = {201--210},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/PADS.2006.13},
  doi          = {10.1109/PADS.2006.13},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/WangTT06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wiser/BudgenCTBKL06,
  author       = {David Budgen and
                  Stuart M. Charters and
                  Mark Turner and
                  Pearl Brereton and
                  Barbara A. Kitchenham and
                  Stephen G. Linkman},
  editor       = {Nikolay Mehandjiev and
                  Pearl Brereton and
                  John G. Hosking},
  title        = {Investigating the applicability of the evidence-based paradigm to
                  software engineering},
  booktitle    = {Proceedings of the 2006 Workshop on interdisciplinary software engineering
                  research, {WISER} 2006, Shanghai, China, May 20, 2006},
  pages        = {7--14},
  publisher    = {{ACM}},
  year         = {2006},
  url          = {https://doi.org/10.1145/1137661.1137665},
  doi          = {10.1145/1137661.1137665},
  timestamp    = {Tue, 24 Oct 2023 14:39:14 +0200},
  biburl       = {https://dblp.org/rec/conf/wiser/BudgenCTBKL06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/GanCT06,
  author       = {Boon{-}Ping Gan and
                  Lai Peng Chan and
                  Stephen John Turner},
  editor       = {L. Felipe Perrone and
                  Barry Lawson and
                  Jason Liu and
                  Frederick P. Wieland},
  title        = {Interoperating simulations of automatic material handling systems
                  and manufacturing processes},
  booktitle    = {Proceedings of the Winter Simulation Conference {WSC} 2006, Monterey,
                  California, USA, December 3-6, 2006},
  pages        = {1129--1135},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/WSC.2006.323203},
  doi          = {10.1109/WSC.2006.323203},
  timestamp    = {Mon, 29 Apr 2024 16:19:40 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/GanCT06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/LadbrookLSTTW06,
  author       = {John Ladbrook and
                  Malcolm Y. H. Low and
                  Steffen Stra{\ss}burger and
                  Simon J. E. Taylor and
                  Stephen John Turner and
                  Xiaoguang Wang},
  editor       = {L. Felipe Perrone and
                  Barry Lawson and
                  Jason Liu and
                  Frederick P. Wieland},
  title        = {Developing interoperability standards for distributed simulaton and
                  {COTS} simulation packages with the {CSPI} {PDG}},
  booktitle    = {Proceedings of the Winter Simulation Conference {WSC} 2006, Monterey,
                  California, USA, December 3-6, 2006},
  pages        = {1101--1110},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/WSC.2006.323200},
  doi          = {10.1109/WSC.2006.323200},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/LadbrookLSTTW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-cs-0603121,
  author       = {Scott A. Turner and
                  Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and
                  Stephen H. Edwards},
  title        = {minimUML: {A} Minimalist Approach to {UML} Diagraming for Early Computer
                  Science Education},
  journal      = {CoRR},
  volume       = {abs/cs/0603121},
  year         = {2006},
  url          = {http://arxiv.org/abs/cs/0603121},
  eprinttype    = {arXiv},
  eprint       = {cs/0603121},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-cs-0603121.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-cs-0607072,
  author       = {Scott A. Turner and
                  Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and
                  Stephen H. Edwards},
  title        = {Effect of Interface Style in Peer Review Comments for {UML} Designs},
  journal      = {CoRR},
  volume       = {abs/cs/0607072},
  year         = {2006},
  url          = {http://arxiv.org/abs/cs/0607072},
  eprinttype    = {arXiv},
  eprint       = {cs/0607072},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-cs-0607072.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/AliodABBBBBCGHHLMMMMORSSSTVTTW05,
  author       = {Diego Moll{\'{a}} Aliod and
                  Eduardo Alonso and
                  Srinivas Bangalore and
                  Joseph E. Beck and
                  Bir Bhanu and
                  Jim Blythe and
                  Mark S. Boddy and
                  Amedeo Cesta and
                  Marko Grobelnik and
                  Dilek Hakkani{-}T{\"{u}}r and
                  Sanda M. Harabagiu and
                  Alain L{\'{e}}ger and
                  Deborah L. McGuinness and
                  Stacy Marsella and
                  Natasa Milic{-}Frayling and
                  Dunja Mladenic and
                  Daniel Oblinger and
                  Paul E. Rybski and
                  Pavel Shvaiko and
                  Stephen F. Smith and
                  Biplav Srivastava and
                  Sheila Tejada and
                  Hannes H{\"{o}}gni Vilhj{\'{a}}lmsson and
                  Kristinn R. Th{\'{o}}risson and
                  G{\"{o}}khan T{\"{u}}r and
                  Jos{\'{e}} Luis Vicedo Gonz{\'{a}}lez and
                  Holger Wache},
  title        = {The Workshops at the Twentieth National Conference on Artificial Intelligence},
  journal      = {{AI} Mag.},
  volume       = {26},
  number       = {4},
  pages        = {102--108},
  year         = {2005},
  url          = {https://doi.org/10.1609/aimag.v26i4.1855},
  doi          = {10.1609/AIMAG.V26I4.1855},
  timestamp    = {Tue, 25 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/aim/AliodABBBBBCGHHLMMMMORSSSTVTTW05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/DonofrioRBDWNFMGTOPFPSLD05,
  author       = {Nicole Donofrio and
                  Ravi Rajagopalon and
                  Douglas E. Brown and
                  Stephen E. Diener and
                  Donald Windham and
                  Shelly Nolin and
                  Anna Floyd and
                  Thomas K. Mitchell and
                  Natalia Galadima and
                  Sara Tucker and
                  Marc J. Orbach and
                  Gayatri Patel and
                  Mark L. Farman and
                  Vishal Pampanwar and
                  Cari Soderlund and
                  Yong{-}Hwan Lee and
                  Ralph A. Dean},
  title        = {'PACLIMS': {A} component {LIM} system for high-throughput functional
                  genomic analysis},
  journal      = {{BMC} Bioinform.},
  volume       = {6},
  pages        = {94},
  year         = {2005},
  url          = {https://doi.org/10.1186/1471-2105-6-94},
  doi          = {10.1186/1471-2105-6-94},
  timestamp    = {Sun, 15 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/bmcbi/DonofrioRBDWNFMGTOPFPSLD05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ec/TuckerCS05,
  author       = {Allan Tucker and
                  Jason Crampton and
                  Stephen Swift},
  title        = {{RGFGA:} An Efficient Representation and Crossover for Grouping Genetic
                  Algorithms},
  journal      = {Evol. Comput.},
  volume       = {13},
  number       = {4},
  pages        = {477--499},
  year         = {2005},
  url          = {https://doi.org/10.1162/106365605774666903},
  doi          = {10.1162/106365605774666903},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ec/TuckerCS05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/CaiYLT05,
  author       = {Wentong Cai and
                  Zijing Yuan and
                  Malcolm Yoke Hean Low and
                  Stephen John Turner},
  title        = {Federate migration in HLA-based simulation},
  journal      = {Future Gener. Comput. Syst.},
  volume       = {21},
  number       = {1},
  pages        = {87--95},
  year         = {2005},
  url          = {https://doi.org/10.1016/j.future.2004.09.019},
  doi          = {10.1016/J.FUTURE.2004.09.019},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/fgcs/CaiYLT05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpca/DennisFSSTTT05,
  author       = {John M. Dennis and
                  Aim{\'{e}} Fournier and
                  William F. Spotz and
                  Amik St.{-}Cyr and
                  Mark A. Taylor and
                  Stephen J. Thomas and
                  Henry M. Tufo},
  title        = {High-Resolution Mesh Convergence Properties and Parallel Efficiency
                  of a Spectral Element Atmospheric Dynamical Core},
  journal      = {Int. J. High Perform. Comput. Appl.},
  volume       = {19},
  number       = {3},
  pages        = {225--235},
  year         = {2005},
  url          = {https://doi.org/10.1177/1094342005056108},
  doi          = {10.1177/1094342005056108},
  timestamp    = {Thu, 12 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijhpca/DennisFSSTTT05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jeric/TurnerPE05,
  author       = {Scott A. Turner and
                  Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and
                  Stephen H. Edwards},
  title        = {minimUML: {A} minimalist approach to {UML} diagramming for early computer
                  science education},
  journal      = {{ACM} J. Educ. Resour. Comput.},
  volume       = {5},
  number       = {4},
  pages        = {1:1--1:28},
  year         = {2005},
  url          = {https://doi.org/10.1145/1186639.1186640},
  doi          = {10.1145/1186639.1186640},
  timestamp    = {Sun, 17 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jeric/TurnerPE05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jwsr/JieZHTC05,
  author       = {Wei Jie and
                  Tianyi Zang and
                  Terence Hung and
                  Stephen John Turner and
                  Wentong Cai},
  title        = {Information Management for Computational Grids},
  journal      = {Int. J. Web Serv. Res.},
  volume       = {2},
  number       = {3},
  pages        = {69--82},
  year         = {2005},
  url          = {https://doi.org/10.4018/jwsr.2005070103},
  doi          = {10.4018/JWSR.2005070103},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jwsr/JieZHTC05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/BarrettSTWNLRLFE05,
  author       = {Tanya Barrett and
                  Tugba O. Suzek and
                  Dennis B. Troup and
                  Stephen E. Wilhite and
                  Wing{-}Chi Ngau and
                  Pierre Ledoux and
                  Dmitry Rudnev and
                  Alex E. Lash and
                  Wataru Fujibuchi and
                  Ron Edgar},
  title        = {{NCBI} {GEO:} mining millions of expression profiles - database and
                  tools},
  journal      = {Nucleic Acids Res.},
  volume       = {33},
  number       = {Database-Issue},
  pages        = {562--566},
  year         = {2005},
  url          = {https://doi.org/10.1093/nar/gki022},
  doi          = {10.1093/NAR/GKI022},
  timestamp    = {Sun, 17 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/BarrettSTWNLRLFE05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WheelerBBBCCDEFHKKLMMOPPSSSSSSSTTWY05,
  author       = {David L. Wheeler and
                  Tanya Barrett and
                  Dennis A. Benson and
                  Stephen H. Bryant and
                  Kathi Canese and
                  Deanna M. Church and
                  Michael DiCuccio and
                  Ron Edgar and
                  Scott Federhen and
                  Wolfgang Helmberg and
                  David L. Kenton and
                  Oleg Khovayko and
                  David J. Lipman and
                  Thomas L. Madden and
                  Donna R. Maglott and
                  James Ostell and
                  Joan U. Pontius and
                  Kim D. Pruitt and
                  Gregory D. Schuler and
                  Lynn M. Schriml and
                  Edwin Sequeira and
                  Steven T. Sherry and
                  Karl Sirotkin and
                  Grigory Starchenko and
                  Tugba O. Suzek and
                  Roman L. Tatusov and
                  Tatiana A. Tatusova and
                  Lukas Wagner and
                  Eugene Yaschenko},
  title        = {Database resources of the National Center for Biotechnology Information},
  journal      = {Nucleic Acids Res.},
  volume       = {33},
  number       = {Database-Issue},
  pages        = {39--45},
  year         = {2005},
  url          = {https://doi.org/10.1093/nar/gki062},
  doi          = {10.1093/NAR/GKI062},
  timestamp    = {Tue, 18 Jun 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/WheelerBBBCCDEFHKKLMMOPPSSSSSSSTTWY05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/TaylorTMAA05,
  author       = {Simon J. E. Taylor and
                  Stephen John Turner and
                  Navonil Mustafee and
                  Henrik Ahlander and
                  Rassul Ayani},
  title        = {A Comparison of {CMB-} and HLA-Based Approaches to Type {I} Interoperability
                  Reference Model Problems for COTS-Based Distributed Simulation},
  journal      = {Simul.},
  volume       = {81},
  number       = {1},
  pages        = {33--43},
  year         = {2005},
  url          = {https://doi.org/10.1177/0037549705052455},
  doi          = {10.1177/0037549705052455},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/simulation/TaylorTMAA05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/TaylorTV05,
  author       = {Simon J. E. Taylor and
                  Stephen John Turner and
                  Alexander Verbraeck},
  title        = {Preface to the Special Issue on Applications of Parallel and Distributed
                  Simulation in Industry},
  journal      = {Simul.},
  volume       = {81},
  number       = {1},
  pages        = {3--4},
  year         = {2005},
  url          = {https://doi.org/10.1177/0037549705054576},
  doi          = {10.1177/0037549705054576},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/simulation/TaylorTV05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/WangTLG05,
  author       = {Xiaoguang Wang and
                  Stephen John Turner and
                  Malcolm Yoke Hean Low and
                  Boon{-}Ping Gan},
  title        = {Optimistic Synchronization in HLA-Based Distributed Simulation},
  journal      = {Simul.},
  volume       = {81},
  number       = {4},
  pages        = {279--291},
  year         = {2005},
  url          = {https://doi.org/10.1177/0037549705054931},
  doi          = {10.1177/0037549705054931},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/simulation/WangTLG05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/technometrics/TurlachVW05,
  author       = {Berwin A. Turlach and
                  William N. Venables and
                  Stephen J. Wright},
  title        = {Simultaneous Variable Selection},
  journal      = {Technometrics},
  volume       = {47},
  number       = {3},
  pages        = {349--363},
  year         = {2005},
  url          = {https://doi.org/10.1198/004017005000000139},
  doi          = {10.1198/004017005000000139},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/technometrics/TurlachVW05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/CaiTLZ05,
  author       = {Wentong Cai and
                  Stephen John Turner and
                  Bu{-}Sung Lee and
                  Junlan Zhou},
  title        = {An alternative time management mechanism for distributed simulations},
  journal      = {{ACM} Trans. Model. Comput. Simul.},
  volume       = {15},
  number       = {2},
  pages        = {109--137},
  year         = {2005},
  url          = {https://doi.org/10.1145/1060576.1060577},
  doi          = {10.1145/1060576.1060577},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tomacs/CaiTLZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/ChenTCGL05,
  author       = {Dan Chen and
                  Stephen John Turner and
                  Wentong Cai and
                  Boon{-}Ping Gan and
                  Malcolm Yoke Hean Low},
  title        = {Algorithms for HLA-based distributed simulation cloning},
  journal      = {{ACM} Trans. Model. Comput. Simul.},
  volume       = {15},
  number       = {4},
  pages        = {316--345},
  year         = {2005},
  url          = {https://doi.org/10.1145/1113316.1113318},
  doi          = {10.1145/1113316.1113318},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tomacs/ChenTCGL05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anss/CaiTZWZ05,
  author       = {Wentong Cai and
                  Stephen John Turner and
                  Suiping Zhou and
                  Junhu Wei and
                  Wenbo Zong},
  title        = {Performance Evaluation of a Bandwidth Requirements Reduction Technique
                  Based on Timely State Update},
  booktitle    = {Proceedings 38th Annual Simulation Symposium {(ANSS-38} 2005), 4-6
                  April 2005, San Diego, CA, {USA}},
  pages        = {225--232},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://doi.org/10.1109/ANSS.2005.35},
  doi          = {10.1109/ANSS.2005.35},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/anss/CaiTZWZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atal/LowLLTCL05,
  author       = {Malcolm Yoke Hean Low and
                  Kong Wei Lye and
                  Peter Lendermann and
                  Stephen John Turner and
                  Reman Tat Wee Chim and
                  Surya Hadisaputra Leo},
  editor       = {Michal Pechoucek and
                  Donald Steiner and
                  Simon G. Thompson},
  title        = {An agent-based approach for managing symbiotic simulation of semiconductor
                  assembly and test operation},
  booktitle    = {4rd International Joint Conference on Autonomous Agents and Multiagent
                  Systems {(AAMAS} 2005), July 25-29, 2005, Utrecht, The Netherlands
                  - Special Track for Industrial Applications},
  pages        = {85--92},
  publisher    = {{ACM}},
  year         = {2005},
  url          = {https://doi.org/10.1145/1082473.1082809},
  doi          = {10.1145/1082473.1082809},
  timestamp    = {Wed, 07 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/atal/LowLLTCL05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/SwiftSCT05,
  author       = {Stephen Swift and
                  Amy Shi and
                  Jason Crampton and
                  Allan Tucker},
  title        = {{ICARUS:} intelligent coupon allocation for retailers using search},
  booktitle    = {Proceedings of the {IEEE} Congress on Evolutionary Computation, {CEC}
                  2005, 2-4 September 2005, Edinburgh, {UK}},
  pages        = {182--189},
  publisher    = {{IEEE}},
  year         = {2005},
  url          = {https://doi.org/10.1109/CEC.2005.1554683},
  doi          = {10.1109/CEC.2005.1554683},
  timestamp    = {Thu, 16 Dec 2021 13:59:05 +0100},
  biburl       = {https://dblp.org/rec/conf/cec/SwiftSCT05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/WellnerFTW05,
  author       = {Pierre Wellner and
                  Mike Flynn and
                  Simon Tucker and
                  Steve Whittaker},
  editor       = {Gerrit C. van der Veer and
                  Carolyn Gale},
  title        = {A meeting browser evaluation test},
  booktitle    = {Extended Abstracts Proceedings of the 2005 Conference on Human Factors
                  in Computing Systems, {CHI} 2005, Portland, Oregon, USA, April 2-7,
                  2005},
  pages        = {2021--2024},
  publisher    = {{ACM}},
  year         = {2005},
  url          = {https://doi.org/10.1145/1056808.1057082},
  doi          = {10.1145/1056808.1057082},
  timestamp    = {Mon, 11 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/chi/WellnerFTW05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/BeacomBBRSVDKSC05,
  author       = {Tom Beacom and
                  Timothy C. Buchholtz and
                  D. Bradley and
                  Jack Randolph and
                  Salvatore N. Storino and
                  Mark Veldhuizen and
                  Sherman M. Dance and
                  Jente B. Kuang and
                  Steve Schwinn and
                  Sue Cox and
                  Fred Ziegler and
                  J. Kao and
                  Chuck Li and
                  Christophe Tretz and
                  J. Cabellon and
                  Andrew Freemyer and
                  Matthew Tubbs},
  title        = {Fine-grained power managed dual-thread vector scalar unit for the
                  first-generation {CELL} processor},
  booktitle    = {Proceedings of the {IEEE} 2005 Custom Integrated Circuits Conference,
                  {CICC} 2005, DoubleTree Hotel, San Jose, California, USA, September
                  18-21, 2005},
  pages        = {235--238},
  publisher    = {{IEEE}},
  year         = {2005},
  url          = {https://doi.org/10.1109/CICC.2005.1568650},
  doi          = {10.1109/CICC.2005.1568650},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/cicc/BeacomBBRSVDKSC05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ZengTPLZZHL05,
  author       = {Zhihong Zeng and
                  Jilin Tu and
                  Brian Pianfetti and
                  Ming Liu and
                  Tong Zhang and
                  ZhenQiu Zhang and
                  Thomas S. Huang and
                  Stephen E. Levinson},
  title        = {Audio-Visual Affect Recognition through Multi-Stream Fused {HMM} for
                  {HCI}},
  booktitle    = {2005 {IEEE} Computer Society Conference on Computer Vision and Pattern
                  Recognition {(CVPR} 2005), 20-26 June 2005, San Diego, CA, {USA}},
  pages        = {967--972},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://doi.org/10.1109/CVPR.2005.77},
  doi          = {10.1109/CVPR.2005.77},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/ZengTPLZZHL05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/GanLWT05,
  author       = {Boon{-}Ping Gan and
                  Malcolm Yoke Hean Low and
                  Xiaoguang Wang and
                  Stephen John Turner},
  title        = {Using Manufacturing Process Flow for Time Synchronization in HLA-Based
                  Simulation},
  booktitle    = {9th {IEEE} International Symposium on Distributed Simulation and Real-Time
                  Applications {(DS-RT} 2005), 10-12 October 2005, Montreal, Canada},
  pages        = {148--160},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://doi.org/10.1109/DISTRA.2005.42},
  doi          = {10.1109/DISTRA.2005.42},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dsrt/GanLWT05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/TaylorBWT05,
  author       = {Simon J. E. Taylor and
                  Leif Bohli and
                  Xiaoguang Wang and
                  Stephen John Turner},
  title        = {Investigating Distributed Simulation at The Ford Motor Company},
  booktitle    = {9th {IEEE} International Symposium on Distributed Simulation and Real-Time
                  Applications {(DS-RT} 2005), 10-12 October 2005, Montreal, Canada},
  pages        = {139--147},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://doi.org/10.1109/DISTRA.2005.25},
  doi          = {10.1109/DISTRA.2005.25},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dsrt/TaylorBWT05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/TuckerW05,
  author       = {Simon Tucker and
                  Steve Whittaker},
  title        = {Novel Techniques For Time-Compressing Speech: An Exploratory Study},
  booktitle    = {2005 {IEEE} International Conference on Acoustics, Speech, and Signal
                  Processing, {ICASSP} '05, Philadelphia, Pennsylvania, USA, March 18-23,
                  2005},
  pages        = {477--480},
  publisher    = {{IEEE}},
  year         = {2005},
  url          = {https://doi.org/10.1109/ICASSP.2005.1415154},
  doi          = {10.1109/ICASSP.2005.1415154},
  timestamp    = {Mon, 11 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/TuckerW05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwn/Turner05,
  author       = {Stephen Turner},
  editor       = {Laurence Tianruo Yang and
                  Hamid R. Arabnia and
                  Li{-}Chun Wang},
  title        = {Channel-Changing Heuristics in High-Mobility Ad Hoc Networks with
                  Varying Traffic Demands},
  booktitle    = {Proceedings of the 2005 International Conference on Wireless Networks,
                  {ICWN} 2005, Las Vegas, Nevada, USA, June 27-30, 2005},
  pages        = {317--323},
  publisher    = {{CSREA} Press},
  year         = {2005},
  timestamp    = {Tue, 29 Oct 2019 17:54:20 +0100},
  biburl       = {https://dblp.org/rec/conf/icwn/Turner05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ChuZKLITCD05,
  author       = {Anhua Chu and
                  Jakob J. van Zyl and
                  Yunjin Kim and
                  Yunling Lou and
                  David A. Imel and
                  Wayne Tung and
                  Bruce Chapman and
                  Stephen L. Durden},
  title        = {{AIRSAR} automated web-based data processing and distribution system},
  booktitle    = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
                  {IGARSS} 2005, July 25-29, 2005, Seoul, Korea, Proceedings},
  pages        = {1218--1220},
  publisher    = {{IEEE}},
  year         = {2005},
  url          = {https://doi.org/10.1109/IGARSS.2005.1525337},
  doi          = {10.1109/IGARSS.2005.1525337},
  timestamp    = {Sat, 19 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/igarss/ChuZKLITCD05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mlmi/WhittakerLT05,
  author       = {Steve Whittaker and
                  Rachel Laban and
                  Simon Tucker},
  editor       = {Steve Renals and
                  Samy Bengio},
  title        = {Analysing Meeting Records: An Ethnographic Study and Technological
                  Implications},
  booktitle    = {Machine Learning for Multimodal Interaction, Second International
                  Workshop, {MLMI} 2005, Edinburgh, UK, July 11-13, 2005, Revised Selected
                  Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {3869},
  pages        = {101--113},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11677482\_9},
  doi          = {10.1007/11677482\_9},
  timestamp    = {Mon, 11 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/mlmi/WhittakerLT05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/TeoTJ05,
  author       = {Peihan Teo and
                  Stephen John Turner and
                  Zoltan Juhasz},
  title        = {Optimistic Protocol Analysis in a Performance Analyzer and Prediction
                  Tool},
  booktitle    = {19th Workshop on Parallel and Distributed Simulation, {PADS} 20055,
                  Monterey, CA, USA, June 1-3, 2005},
  pages        = {49--58},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://doi.org/10.1109/PADS.2005.17},
  doi          = {10.1109/PADS.2005.17},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/TeoTJ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/XieTCT05,
  author       = {Yong Xie and
                  Yong Meng Teo and
                  Wentong Cai and
                  Stephen John Turner},
  title        = {Servicing Provisioning for HLA-Based Distributed Simulation on the
                  Grid},
  booktitle    = {19th Workshop on Parallel and Distributed Simulation, {PADS} 20055,
                  Monterey, CA, USA, June 1-3, 2005},
  pages        = {282--291},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://doi.org/10.1109/PADS.2005.26},
  doi          = {10.1109/PADS.2005.26},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pads/XieTCT05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scam/CounsellST05,
  author       = {Steve Counsell and
                  Stephen Swift and
                  Allan Tucker},
  title        = {Object-oriented cohesion as a surrogate of software comprehension:
                  an empirical study},
  booktitle    = {5th {IEEE} International Workshop on Source Code Analysis and Manipulation
                  {(SCAM} 2005), 30 September - 1 October 2005, Budapest, Hungary},
  pages        = {161--172},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://doi.org/10.1109/SCAM.2005.19},
  doi          = {10.1109/SCAM.2005.19},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/scam/CounsellST05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sensys/TollePSCTTBDBGH05,
  author       = {Gilman Tolle and
                  Joseph Polastre and
                  Robert Szewczyk and
                  David E. Culler and
                  Neil Turner and
                  Kevin Tu and
                  Stephen Burgess and
                  Todd Dawson and
                  Philip Buonadonna and
                  David Gay and
                  Wei Hong},
  editor       = {Jason Redi and
                  Hari Balakrishnan and
                  Feng Zhao},
  title        = {A macroscope in the redwoods},
  booktitle    = {Proceedings of the 3rd International Conference on Embedded Networked
                  Sensor Systems, SenSys 2005, San Diego, California, USA, November
                  2-4, 2005},
  pages        = {51--63},
  publisher    = {{ACM}},
  year         = {2005},
  url          = {https://doi.org/10.1145/1098918.1098925},
  doi          = {10.1145/1098918.1098925},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sensys/TollePSCTTBDBGH05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/GanLLTWT05,
  author       = {Boon{-}Ping Gan and
                  Peter Lendermann and
                  Malcolm Yoke Hean Low and
                  Stephen John Turner and
                  Xiaoguang Wang and
                  Simon J. E. Taylor},
  title        = {Interoperating autosched {AP} using the high level architecture},
  booktitle    = {Proceedings of the 37th Winter Simulation Conference, Orlando, FL,
                  USA, December 4-7, 2005},
  pages        = {394--401},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://doi.org/10.1109/WSC.2005.1574274},
  doi          = {10.1109/WSC.2005.1574274},
  timestamp    = {Thu, 10 Jun 2021 22:18:45 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/GanLLTWT05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/LendermannLGJCLTTCWHMB05,
  author       = {Peter Lendermann and
                  Malcolm Y. H. Low and
                  Boon{-}Ping Gan and
                  Nirupam Julka and
                  Lai Peng Chan and
                  Loo Hay Lee and
                  Simon J. E. Taylor and
                  Stephen John Turner and
                  Wentong Cai and
                  Xiaoguang Wang and
                  Terence Hung and
                  Leon F. McGinnis and
                  Stephen J. Buckley},
  title        = {An integrated and adaptive decision-support framework for high-tech
                  manufacturing and service networks},
  booktitle    = {Proceedings of the 37th Winter Simulation Conference, Orlando, FL,
                  USA, December 4-7, 2005},
  pages        = {2052--2062},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://doi.org/10.1109/WSC.2005.1574487},
  doi          = {10.1109/WSC.2005.1574487},
  timestamp    = {Thu, 10 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/LendermannLGJCLTTCWHMB05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/WangTTLG05,
  author       = {Xiaoguang Wang and
                  Stephen John Turner and
                  Simon J. E. Taylor and
                  Malcolm Y. H. Low and
                  Boon{-}Ping Gan},
  title        = {A {COTS} Simulation Package Emulator {(CSPE)} for investigating {COTS}
                  simulation package interoperability},
  booktitle    = {Proceedings of the 37th Winter Simulation Conference, Orlando, FL,
                  USA, December 4-7, 2005},
  pages        = {402--411},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://doi.org/10.1109/WSC.2005.1574275},
  doi          = {10.1109/WSC.2005.1574275},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/WangTTLG05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-nlin-0511072,
  author       = {May Lim and
                  Dan Braha and
                  Sanith Wijesinghe and
                  Stephenson Tucker and
                  Yaneer Bar{-}Yam},
  title        = {Connectivity and Cost Trade-offs in Multihop Wireless Networks},
  journal      = {CoRR},
  volume       = {abs/nlin/0511072},
  year         = {2005},
  url          = {http://arxiv.org/abs/nlin/0511072},
  eprinttype    = {arXiv},
  eprint       = {nlin/0511072},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-nlin-0511072.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/concurrency/Turner04,
  author       = {Stephen John Turner},
  title        = {Special Issue: Distributed Simulation and Real-Time Applications},
  journal      = {Concurr. Pract. Exp.},
  volume       = {16},
  number       = {15},
  pages        = {1477--1481},
  year         = {2004},
  url          = {https://doi.org/10.1002/cpe.935},
  doi          = {10.1002/CPE.935},
  timestamp    = {Thu, 21 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/concurrency/Turner04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/ZengCTZL04,
  author       = {Yi Zeng and
                  Wentong Cai and
                  Stephen John Turner and
                  Suiping Zhou and
                  Bu{-}Sung Lee},
  title        = {Characterization and delivery of directly coupled causal messages
                  in distributed systems},
  journal      = {Future Gener. Comput. Syst.},
  volume       = {20},
  number       = {1},
  pages        = {171--178},
  year         = {2004},
  url          = {https://doi.org/10.1016/j.future.2003.07.013},
  doi          = {10.1016/J.FUTURE.2003.07.013},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/fgcs/ZengCTZL04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcise/McMahonLCCCSS04,
  author       = {Chris A. McMahon and
                  Alistair Lowe and
                  Steve J. Culley and
                  Mark Corderoy and
                  Rose Crossland and
                  Tulan Shah and
                  Dave Stewart},
  title        = {Waypoint: An Integrated Search and Retrieval System for Engineering
                  Documents},
  journal      = {J. Comput. Inf. Sci. Eng.},
  volume       = {4},
  number       = {4},
  pages        = {329--338},
  year         = {2004},
  url          = {https://doi.org/10.1115/1.1812557},
  doi          = {10.1115/1.1812557},
  timestamp    = {Thu, 07 Jan 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jcise/McMahonLCCCSS04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/ZhouCLT04,
  author       = {Suiping Zhou and
                  Wentong Cai and
                  Bu{-}Sung Lee and
                  Stephen John Turner},
  title        = {Time-space consistency in large-scale distributed virtual environments},
  journal      = {{ACM} Trans. Model. Comput. Simul.},
  volume       = {14},
  number       = {1},
  pages        = {31--47},
  year         = {2004},
  url          = {https://doi.org/10.1145/974734.974736},
  doi          = {10.1145/974734.974736},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tomacs/ZhouCLT04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/ChenTGC04,
  author       = {Dan Chen and
                  Stephen John Turner and
                  Boon{-}Ping Gan and
                  Wentong Cai},
  title        = {HLA-Based Distributed Simulation Cloning},
  booktitle    = {8th {IEEE} International Symposium on Distributed Simulation and Real-Time
                  Applications {(DS-RT} 2004), 21-23 October 2004, Budapest, Hungary},
  pages        = {244--247},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/DS-RT.2004.23},
  doi          = {10.1109/DS-RT.2004.23},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dsrt/ChenTGC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/TaylorPPT04,
  author       = {Simon J. E. Taylor and
                  George V. Popescu and
                  J. Mark Pullen and
                  Stephen John Turner},
  title        = {Distributed Simulation and the Grid: Position Statements},
  booktitle    = {8th {IEEE} International Symposium on Distributed Simulation and Real-Time
                  Applications {(DS-RT} 2004), 21-23 October 2004, Budapest, Hungary},
  pages        = {144--149},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/DS-RT.2004.14},
  doi          = {10.1109/DS-RT.2004.14},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dsrt/TaylorPPT04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/ZongWCT04,
  author       = {Wenbo Zong and
                  Yong Wang and
                  Wentong Cai and
                  Stephen John Turner},
  title        = {Grid Services and Service Discovery for HLA-Based Distributed Simulation},
  booktitle    = {8th {IEEE} International Symposium on Distributed Simulation and Real-Time
                  Applications {(DS-RT} 2004), 21-23 October 2004, Budapest, Hungary},
  pages        = {116--124},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/DS-RT.2004.22},
  doi          = {10.1109/DS-RT.2004.22},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dsrt/ZongWCT04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icarcv/WangWBT04,
  author       = {Xin Wang and
                  Brian Stephen Wong and
                  W. M. Bai and
                  Chen Guan Tui},
  title        = {X-ray image segmentation using wavelet method},
  booktitle    = {8th International Conference on Control, Automation, Robotics and
                  Vision, {ICARCV} 2004, Kunming, China, 6-9 December 2004, Proceedings},
  pages        = {1129--1133},
  publisher    = {{IEEE}},
  year         = {2004},
  url          = {https://doi.org/10.1109/ICARCV.2004.1469003},
  doi          = {10.1109/ICARCV.2004.1469003},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/icarcv/WangWBT04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/YuanCLT04,
  author       = {Zijing Yuan and
                  Wentong Cai and
                  Yoke{-}Hean Low and
                  Stephen John Turner},
  editor       = {Marian Bubak and
                  G. Dick van Albada and
                  Peter M. A. Sloot and
                  Jack J. Dongarra},
  title        = {Federate Migration in HLA-Based Simulation},
  booktitle    = {Computational Science - {ICCS} 2004, 4th International Conference,
                  Krak{\'{o}}w, Poland, June 6-9, 2004, Proceedings, Part {III}},
  series       = {Lecture Notes in Computer Science},
  volume       = {3038},
  pages        = {856--864},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/978-3-540-24688-6\_110},
  doi          = {10.1007/978-3-540-24688-6\_110},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iccS/YuanCLT04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmi/ZengTLZRZHRL04,
  author       = {Zhihong Zeng and
                  Jilin Tu and
                  Ming Liu and
                  Tong Zhang and
                  Nicholas Rizzolo and
                  ZhenQiu Zhang and
                  Thomas S. Huang and
                  Dan Roth and
                  Stephen E. Levinson},
  editor       = {Rajeev Sharma and
                  Trevor Darrell and
                  Mary P. Harper and
                  Gianni Lazzari and
                  Matthew A. Turk},
  title        = {Bimodal HCI-related affect recognition},
  booktitle    = {Proceedings of the 6th International Conference on Multimodal Interfaces,
                  {ICMI} 2004, State College, PA, USA, October 13-15, 2004},
  pages        = {137--143},
  publisher    = {{ACM}},
  year         = {2004},
  url          = {https://doi.org/10.1145/1027933.1027958},
  doi          = {10.1145/1027933.1027958},
  timestamp    = {Fri, 03 Jul 2020 08:57:26 +0200},
  biburl       = {https://dblp.org/rec/conf/icmi/ZengTLZRZHRL04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/OlsenWT04,
  author       = {Dan R. Olsen and
                  Stephen Bart Wood and
                  Jonathan Turner},
  title        = {Metrics for Human Driving of Multiple Robots},
  booktitle    = {Proceedings of the 2004 {IEEE} International Conference on Robotics
                  and Automation, {ICRA} 2004, April 26 - May 1, 2004, New Orleans,
                  LA, {USA}},
  pages        = {2315--2320},
  publisher    = {{IEEE}},
  year         = {2004},
  url          = {https://doi.org/10.1109/ROBOT.2004.1307407},
  doi          = {10.1109/ROBOT.2004.1307407},
  timestamp    = {Mon, 22 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icra/OlsenWT04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwn/Turner04,
  author       = {Stephen W. Turner},
  editor       = {Hamid R. Arabnia and
                  Laurence Tianruo Yang and
                  Chi{-}Hsiang Yeh},
  title        = {Channel-Changing Strategies to Preserve Bandwidth of Flows in Ad Hoc
                  Networks},
  booktitle    = {Proceedings of the International Conference on Wireless Networks,
                  {ICWN} '04, June 21-24, 2004, Las Vegas, Nevada, USA, Volume 1},
  pages        = {172--178},
  publisher    = {{CSREA} Press},
  year         = {2004},
  timestamp    = {Mon, 22 Nov 2004 14:01:57 +0100},
  biburl       = {https://dblp.org/rec/conf/icwn/Turner04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icws/ZangJHLTC04,
  author       = {Tianyi Zang and
                  Wei Jie and
                  Terence Hung and
                  Zhou Lei and
                  Stephen John Turner and
                  Wentong Cai},
  title        = {The Design and Implementation of An OGSA-based Grid Information Service},
  booktitle    = {Proceedings of the {IEEE} International Conference on Web Services
                  (ICWS'04), June 6-9, 2004, San Diego, California, {USA}},
  pages        = {566},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/ICWS.2004.1314783},
  doi          = {10.1109/ICWS.2004.1314783},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icws/ZangJHLTC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/TuluF04,
  author       = {Zeynep Tulu and
                  Stephen J. Frasier},
  title        = {Design considerations for bistatic radar probing of winds in clear
                  air conditions},
  booktitle    = {2004 {IEEE} International Geoscience and Remote Sensing Symposium,
                  {IGARSS} 2004, Anchorage, Alaska, USA, 20-24 September 2004},
  pages        = {3662--3665},
  publisher    = {{IEEE}},
  year         = {2004},
  url          = {https://doi.org/10.1109/IGARSS.2004.1369913},
  doi          = {10.1109/IGARSS.2004.1369913},
  timestamp    = {Wed, 16 Oct 2019 14:14:53 +0200},
  biburl       = {https://dblp.org/rec/conf/igarss/TuluF04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/WangTLASHPS04,
  author       = {Peng Wang and
                  George W. Turner and
                  Daniel A. Lauer and
                  Matthew Allen and
                  Stephen C. Simms and
                  David Hart and
                  Mary Papakhian and
                  Craig A. Stewart},
  title        = {{LINPACK} Performance on a Geographically Distributed Linux Cluster},
  booktitle    = {18th International Parallel and Distributed Processing Symposium {(IPDPS}
                  2004), {CD-ROM} / Abstracts Proceedings, 26-30 April 2004, Santa Fe,
                  New Mexico, {USA}},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/IPDPS.2004.1303301},
  doi          = {10.1109/IPDPS.2004.1303301},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ipps/WangTLASHPS04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jbi/KellamSTVMOL04,
  author       = {Paul Kellam and
                  Stephen Swift and
                  Allan Tucker and
                  Veronica Vinciotti and
                  Nigel J. Martin and
                  Christine A. Orengo and
                  Xiaohui Liu},
  editor       = {Xavier Messeguer and
                  Gabriel Valiente},
  title        = {Consensus Clustering and Functional Interpretation of Gene Expression
                  Data},
  booktitle    = {Proceedings of the 5th Annual Spanish Bioinformatics Conference, Barcelona,
                  Catalonia, Spain, November 29-30, 2004},
  pages        = {6},
  publisher    = {Technical University of Catalonia, Barcelona},
  year         = {2004},
  timestamp    = {Mon, 11 Jul 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/jbi/KellamSTVMOL04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mabs/WangTW04,
  author       = {Fang Wang and
                  Stephen John Turner and
                  Lihua Wang},
  editor       = {Paul Davidsson and
                  Brian Logan and
                  Keiki Takadama},
  title        = {Agent Communication in Distributed Simulations},
  booktitle    = {Multi-Agent and Multi-Agent-Based Simulation, Joint Workshop {MABS}
                  2004, New York, NY, USA, July 19, 2004, Revised Selected Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {3415},
  pages        = {11--24},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/978-3-540-32243-6\_2},
  doi          = {10.1007/978-3-540-32243-6\_2},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/mabs/WangTW04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mlmi/TuckerW04,
  author       = {Simon Tucker and
                  Steve Whittaker},
  editor       = {Samy Bengio and
                  Herv{\'{e}} Bourlard},
  title        = {Accessing Multimodal Meeting Data: Systems, Problems and Possibilities},
  booktitle    = {Machine Learning for Multimodal Interaction, First International Workshop,MLMI
                  2004, Martigny, Switzerland, June 21-23, 2004, Revised Selected Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {3361},
  pages        = {1--11},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/978-3-540-30568-2\_1},
  doi          = {10.1007/978-3-540-30568-2\_1},
  timestamp    = {Mon, 11 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/mlmi/TuckerW04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pacis/ChauT04,
  author       = {Stephen B. Chau and
                  Paul Turner},
  title        = {Examining the Utilisation of Mobile Handheld Devices at an Australian
                  Aged Care Facility},
  booktitle    = {Pacific Asia Conference on Information Systems, {PACIS} 2004, Shanghai,
                  China, July 8-11, 2004},
  pages        = {50},
  publisher    = {AISeL},
  year         = {2004},
  url          = {http://aisel.aisnet.org/pacis2004/50},
  timestamp    = {Sat, 03 Mar 2012 13:26:52 +0100},
  biburl       = {https://dblp.org/rec/conf/pacis/ChauT04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/WangTLG04,
  author       = {Xiaoguang Wang and
                  Stephen John Turner and
                  Yoke{-}Hean Low and
                  Boon{-}Ping Gan},
  editor       = {Johannes L{\"{u}}thi and
                  Axel Lehmann and
                  Ernest H. Page and
                  Thom McLean},
  title        = {Optimistic Synchronization in {HLA} Based Distributed Simulation},
  booktitle    = {18th Workshop on Parallel and Distributed Simulation, {PADS} 2004,
                  Kufstein, Austria, May 16-19, 2004},
  pages        = {123--130},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/PADS.2004.1301293},
  doi          = {10.1109/PADS.2004.1301293},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pads/WangTLG04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/ZengCT04,
  author       = {Yi Zeng and
                  Wentong Cai and
                  Stephen John Turner},
  editor       = {Johannes L{\"{u}}thi and
                  Axel Lehmann and
                  Ernest H. Page and
                  Thom McLean},
  title        = {Batch Based Cancellation: {A} Rollback Optimal Cancellation Scheme
                  in Time Warp Simulations},
  booktitle    = {18th Workshop on Parallel and Distributed Simulation, {PADS} 2004,
                  Kufstein, Austria, May 16-19, 2004},
  pages        = {78--86},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/PADS.2004.1301288},
  doi          = {10.1109/PADS.2004.1301288},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pads/ZengCT04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/ZhouTCZP04,
  author       = {Suiping Zhou and
                  Stephen John Turner and
                  Wentong Cai and
                  Hanfeng Zhao and
                  Xiaolin Pang},
  editor       = {Johannes L{\"{u}}thi and
                  Axel Lehmann and
                  Ernest H. Page and
                  Thom McLean},
  title        = {A Utility Model for Timely State Update in Distributed Wargame Simulations},
  booktitle    = {18th Workshop on Parallel and Distributed Simulation, {PADS} 2004,
                  Kufstein, Austria, May 16-19, 2004},
  pages        = {105--111},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/PADS.2004.1301291},
  doi          = {10.1109/PADS.2004.1301291},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pads/ZhouTCZP04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ram/WangWT04,
  author       = {Xin Wang and
                  Brian Stephen Wong and
                  Chen Guan Tui},
  title        = {X-ray image segmentation based on genetic algorithm and maximum fuzzy
                  entropy},
  booktitle    = {2004 {IEEE} Conference on Robotics, Automation and Mechatronics, {RAM}
                  2004, December 1-3, 2004, Singapore},
  pages        = {991--995},
  publisher    = {{IEEE}},
  year         = {2004},
  url          = {https://doi.org/10.1109/RAMECH.2004.1438054},
  doi          = {10.1109/RAMECH.2004.1438054},
  timestamp    = {Thu, 12 Aug 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ram/WangWT04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sgp/BhatIT04,
  author       = {Pravin Bhat and
                  Stephen Ingram and
                  Greg Turk},
  editor       = {Jean{-}Daniel Boissonnat and
                  Pierre Alliez},
  title        = {Geometric Texture Synthesis by Example},
  booktitle    = {Second Eurographics Symposium on Geometry Processing, Nice, France,
                  July 8-10, 2004},
  series       = {{ACM} International Conference Proceeding Series},
  volume       = {71},
  pages        = {41--44},
  publisher    = {Eurographics Association},
  year         = {2004},
  url          = {https://doi.org/10.2312/SGP/SGP04/043-046},
  doi          = {10.2312/SGP/SGP04/043-046},
  timestamp    = {Tue, 06 Nov 2018 16:58:19 +0100},
  biburl       = {https://dblp.org/rec/conf/sgp/BhatIT04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/TuckerMDSJV04,
  author       = {Allen B. Tucker and
                  Dennis McCowan and
                  Fadi P. Deek and
                  Chris Stephenson and
                  Jill Jones and
                  Anita Verno},
  editor       = {Daniel T. Joyce and
                  Deborah Knox and
                  Wanda P. Dann and
                  Thomas L. Naps},
  title        = {Implementation challenges for a {K-12} computer science curriculum},
  booktitle    = {Proceedings of the 35th {SIGCSE} Technical Symposium on Computer Science
                  Education, {SIGCSE} 2004, Norfolk, Virginia, USA, March 3-7, 2004},
  pages        = {334--335},
  publisher    = {{ACM}},
  year         = {2004},
  url          = {https://doi.org/10.1145/971300.971418},
  doi          = {10.1145/971300.971418},
  timestamp    = {Thu, 10 Jun 2021 16:43:03 +0200},
  biburl       = {https://dblp.org/rec/conf/sigcse/TuckerMDSJV04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/ChenTCGL04,
  author       = {Dan Chen and
                  Stephen John Turner and
                  Wentong Cai and
                  Boon{-}Ping Gan and
                  Malcolm Yoke Hean Low},
  title        = {Incremental HLA-Based Distributed Simulation Cloning},
  booktitle    = {Proceedings of the 36th conference on Winter simulation, Washington,
                  DC, USA, December 5-8, 2004},
  pages        = {386--394},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {http://www.informs-sim.org/wsc04papers/046.pdf},
  timestamp    = {Thu, 10 Jun 2021 22:19:50 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/ChenTCGL04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TaylorLPRST04,
  author       = {Simon J. E. Taylor and
                  Peter Lendermann and
                  Ray J. Paul and
                  Steven W. Reichenthal and
                  Steffen Stra{\ss}burger and
                  Stephen John Turner},
  title        = {Panel on Future Challenges in Modeling Methodology},
  booktitle    = {Proceedings of the 36th conference on Winter simulation, Washington,
                  DC, USA, December 5-8, 2004},
  pages        = {327--335},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {http://www.informs-sim.org/wsc04papers/039.pdf},
  timestamp    = {Thu, 10 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/TaylorLPRST04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/WangTW04,
  author       = {Lihua Wang and
                  Stephen John Turner and
                  Fang Wang},
  title        = {Resolving Mutually Exclusive Interactions in Agent Based Distributed
                  Simulations},
  booktitle    = {Proceedings of the 36th conference on Winter simulation, Washington,
                  DC, USA, December 5-8, 2004},
  pages        = {783--791},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {http://www.informs-sim.org/wsc04papers/097.pdf},
  timestamp    = {Thu, 10 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/WangTW04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ecra/TungDCCL03,
  author       = {Lai Lai Tung and
                  Roger Debreceny and
                  Ying{-}Git Chan and
                  Aaron Tuck{-}Loon Chan and
                  Stephen Ee{-}Boon Le},
  title        = {Interacting with hypertext: an experimental investigation of navigation
                  tools},
  journal      = {Electron. Commer. Res. Appl.},
  volume       = {2},
  number       = {1},
  pages        = {61--72},
  year         = {2003},
  url          = {https://doi.org/10.1016/S1567-4223(03)00006-1},
  doi          = {10.1016/S1567-4223(03)00006-1},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ecra/TungDCCL03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhci/CoxLTNWTA03,
  author       = {Stephen Cox and
                  Michael Lincoln and
                  Judy Tryggvason and
                  Melanie Nakisa and
                  Mark Wells and
                  Marcus Tutt and
                  Sanja Abbott},
  title        = {The Development and Evaluation of a Speech-to-Sign Translation System
                  to Assist Transactions},
  journal      = {Int. J. Hum. Comput. Interact.},
  volume       = {16},
  number       = {2},
  pages        = {141--161},
  year         = {2003},
  url          = {https://doi.org/10.1207/S15327590IJHC1602\_02},
  doi          = {10.1207/S15327590IJHC1602\_02},
  timestamp    = {Thu, 18 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijhci/CoxLTNWTA03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmms/HayneST03,
  author       = {Stephen C. Hayne and
                  C. A. P. Smith and
                  Dan Turk},
  title        = {The effectiveness of groups recognizing patterns},
  journal      = {Int. J. Hum. Comput. Stud.},
  volume       = {59},
  number       = {5},
  pages        = {523--543},
  year         = {2003},
  url          = {https://doi.org/10.1016/S1071-5819(03)00046-6},
  doi          = {10.1016/S1071-5819(03)00046-6},
  timestamp    = {Fri, 21 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijmms/HayneST03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/EckersleyESTNSMJRHHJKLMMSNRRRSTUPVWWT03,
  author       = {Peter Eckersley and
                  Gary F. Egan and
                  Erik De Schutter and
                  Yiyuan Tang and
                  Mirko Novak and
                  V{\'{a}}clav Sebesta and
                  Line Matthiessen and
                  Iiro P. J{\"{a}}{\"{a}}skel{\"{a}}inen and
                  Ulla Ruotsalainen and
                  Andreas V. M. Herz and
                  K. Peter Hoffmann and
                  Raphael Ritz and
                  Viji Ravindranath and
                  Francesco Beltrame and
                  Shun{-}ichi Amari and
                  Shiro Usui and
                  Soo{-}Young Lee and
                  Jaap van Pelt and
                  Jan G. Bjaalie and
                  Andrzej Wr{\'{o}}bel and
                  Fernando Mira da Silva and
                  Carmen Gonz{\'{a}}lez and
                  Sten Grillner and
                  Paul F. M. J. Verschure and
                  Turgay Dalkara and
                  Robert Bennett and
                  David Willshaw and
                  Stephen H. Koslow and
                  Perry L. Miller and
                  Shankar Subramaniam and
                  Arthur W. Toga},
  title        = {Neuroscience data and tool sharing - {A} legal and policy framework
                  for neuroinformatics},
  journal      = {Neuroinformatics},
  volume       = {1},
  number       = {2},
  pages        = {149--165},
  year         = {2003},
  url          = {https://doi.org/10.1007/s12021-003-0002-1},
  doi          = {10.1007/S12021-003-0002-1},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ni/EckersleyESTNSMJRHHJKLMMSNRRRSTUPVWWT03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scp/ReesST03,
  author       = {D. Ll. L. Rees and
                  Karen Stephenson and
                  John V. Tucker},
  title        = {The algebraic structure of interfaces},
  journal      = {Sci. Comput. Program.},
  volume       = {49},
  number       = {1-3},
  pages        = {47--88},
  year         = {2003},
  url          = {https://doi.org/10.1016/j.scico.2003.04.001},
  doi          = {10.1016/J.SCICO.2003.04.001},
  timestamp    = {Wed, 17 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/scp/ReesST03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamsc/ThomasDTF03,
  author       = {Stephen J. Thomas and
                  John M. Dennis and
                  Henry M. Tufo and
                  Paul F. Fischer},
  title        = {A Schwarz Preconditioner for the Cubed-Sphere},
  journal      = {{SIAM} J. Sci. Comput.},
  volume       = {25},
  number       = {2},
  pages        = {442--453},
  year         = {2003},
  url          = {https://doi.org/10.1137/S1064827502409420},
  doi          = {10.1137/S1064827502409420},
  timestamp    = {Thu, 30 Jul 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/siamsc/ThomasDTF03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
  author       = {James Allan and
                  Jay Aslam and
                  Nicholas J. Belkin and
                  Chris Buckley and
                  James P. Callan and
                  W. Bruce Croft and
                  Susan T. Dumais and
                  Norbert Fuhr and
                  Donna Harman and
                  David J. Harper and
                  Djoerd Hiemstra and
                  Thomas Hofmann and
                  Eduard H. Hovy and
                  Wessel Kraaij and
                  John D. Lafferty and
                  Victor Lavrenko and
                  David D. Lewis and
                  Liz Liddy and
                  R. Manmatha and
                  Andrew McCallum and
                  Jay M. Ponte and
                  John M. Prager and
                  Dragomir R. Radev and
                  Philip Resnik and
                  Stephen E. Robertson and
                  Ronald Rosenfeld and
                  Salim Roukos and
                  Mark Sanderson and
                  Richard M. Schwartz and
                  Amit Singhal and
                  Alan F. Smeaton and
                  Howard R. Turtle and
                  Ellen M. Voorhees and
                  Ralph M. Weischedel and
                  Jinxi Xu and
                  ChengXiang Zhai},
  title        = {Challenges in information retrieval and language modeling: report
                  of a workshop held at the center for intelligent information retrieval,
                  University of Massachusetts Amherst, September 2002},
  journal      = {{SIGIR} Forum},
  volume       = {37},
  number       = {1},
  pages        = {31--47},
  year         = {2003},
  url          = {https://doi.org/10.1145/945546.945549},
  doi          = {10.1145/945546.945549},
  timestamp    = {Sun, 22 Oct 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/ChenTGCWJ03,
  author       = {Dan Chen and
                  Stephen John Turner and
                  Boon{-}Ping Gan and
                  Wentong Cai and
                  Junhu Wei and
                  Nirupam Julka},
  title        = {Alternative Solutions for Distributed Simulation Cloning},
  journal      = {Simul.},
  volume       = {79},
  number       = {5-6},
  pages        = {299--315},
  year         = {2003},
  url          = {https://doi.org/10.1177/0037549703037147},
  doi          = {10.1177/0037549703037147},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/simulation/ChenTGCWJ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/JohnsonCKTMFH03,
  author       = {Stephen B. Johnson and
                  David A. Campbell and
                  Michael Krauthammer and
                  P. Karina Tulipano and
                  Eneida A. Mendon{\c{c}}a and
                  Carol Friedman and
                  George Hripcsak},
  title        = {A Native {XML} Database Design for Clinical Document Research},
  booktitle    = {{AMIA} 2003, American Medical Informatics Association Annual Symposium,
                  Washington, DC, USA, November 8-12, 2003},
  publisher    = {{AMIA}},
  year         = {2003},
  url          = {https://knowledge.amia.org/amia-55142-a2003a-1.616734/t-002-1.618748/f-001-1.618749/a-266-1.619288/a-267-1.619285},
  timestamp    = {Wed, 17 Apr 2024 11:48:28 +0200},
  biburl       = {https://dblp.org/rec/conf/amia/JohnsonCKTMFH03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anss/ChenGJTCW03,
  author       = {Dan Chen and
                  Boon{-}Ping Gan and
                  Nirupam Julka and
                  Stephen John Turner and
                  Wentong Cai and
                  Junhu Wei},
  title        = {Evaluating Alternative Solutions for Cloning in Distributed Simulation},
  booktitle    = {Proceedings 36th Annual Simulation Symposium {(ANSS-36} 2003), Orlando,
                  Florida, USA, March 30 - April 2, 2003},
  pages        = {201--208},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://doi.org/10.1109/SIMSYM.2003.1192814},
  doi          = {10.1109/SIMSYM.2003.1192814},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/anss/ChenGJTCW03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anss/ChenLCT03,
  author       = {Dan Chen and
                  Bu{-}Sung Lee and
                  Wentong Cai and
                  Stephen John Turner},
  title        = {Design and Development of a Cluster Gateway for Cluster-based {HLA}
                  Distributed Virtual Simulation Environments},
  booktitle    = {Proceedings 36th Annual Simulation Symposium {(ANSS-36} 2003), Orlando,
                  Florida, USA, March 30 - April 2, 2003},
  pages        = {193--200},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://doi.org/10.1109/SIMSYM.2003.1192813},
  doi          = {10.1109/SIMSYM.2003.1192813},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/anss/ChenLCT03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anss/LiuCTL03,
  author       = {Li Liu and
                  Wentong Cai and
                  Stephen John Turner and
                  Guangya Li},
  title        = {Improving Data Filtering Accuracy in Hierarchical Federations},
  booktitle    = {Proceedings 36th Annual Simulation Symposium {(ANSS-36} 2003), Orlando,
                  Florida, USA, March 30 - April 2, 2003},
  pages        = {209--215},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://doi.org/10.1109/SIMSYM.2003.1192815},
  doi          = {10.1109/SIMSYM.2003.1192815},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/anss/LiuCTL03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cw/ZhouCTZ03,
  author       = {Suiping Zhou and
                  Wentong Cai and
                  Stephen John Turner and
                  Hanfeng Zhao},
  title        = {A Consistency Model for Evaluating Distributed Virtual Environments},
  booktitle    = {2nd International Conference on Cyberworlds {(CW} 2003), 3-5 December
                  2003, Singapore},
  pages        = {85--91},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://doi.org/10.1109/CYBER.2003.1253439},
  doi          = {10.1109/CYBER.2003.1253439},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cw/ZhouCTZ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/WangTW03,
  author       = {Lihua Wang and
                  Stephen John Turner and
                  Fang Wang},
  title        = {Interest Management in Agent-Based Distributed Simulations},
  booktitle    = {7th {IEEE} International Symposium on Distributed Simulation and Real-Time
                  Applications {(DS-RT} 2003), 23-25 October 2003, Delft, The Netherlands},
  pages        = {20--29},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://doi.org/10.1109/DISRTA.2003.1242993},
  doi          = {10.1109/DISRTA.2003.1242993},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dsrt/WangTW03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ida/CounsellLNST03,
  author       = {Steve Counsell and
                  Xiaohui Liu and
                  Rajaa Najjar and
                  Stephen Swift and
                  Allan Tucker},
  editor       = {Michael R. Berthold and
                  Hans{-}Joachim Lenz and
                  Elizabeth Bradley and
                  Rudolf Kruse and
                  Christian Borgelt},
  title        = {Applying Intelligent Data Analysis to Coupling Relationships in Object-Oriented
                  Software},
  booktitle    = {Advances in Intelligent Data Analysis V, 5th International Symposium
                  on Intelligent Data Analysis, {IDA} 2003, Berlin, Germany, August
                  28-30, 2003, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {2810},
  pages        = {440--450},
  publisher    = {Springer},
  year         = {2003},
  url          = {https://doi.org/10.1007/978-3-540-45231-7\_41},
  doi          = {10.1007/978-3-540-45231-7\_41},
  timestamp    = {Wed, 09 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ida/CounsellLNST03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/CaiLTLL03,
  author       = {Wentong Cai and
                  Guangya Li and
                  Stephen John Turner and
                  Bu{-}Sung Lee and
                  Li Liu},
  title        = {Implementation of Federation Management Services over Federation Community
                  Networks},
  booktitle    = {Proceedings of the 17th Workshop on Parallel and Distributed Simulation,
                  {PADS} 2003, June 10-13, 2003, San Diego, CA, {USA}},
  pages        = {50--60},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://doi.org/10.1109/PADS.2003.1207420},
  doi          = {10.1109/PADS.2003.1207420},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/CaiLTLL03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/TuckerDJMSV03,
  author       = {Allen B. Tucker and
                  Fadi P. Deek and
                  Jill Jones and
                  Dennis McCowan and
                  Chris Stephenson and
                  Anita Verno},
  editor       = {Scott Grissom and
                  Deborah Knox and
                  Daniel T. Joyce and
                  Wanda P. Dann},
  title        = {Toward a {K-12} computer science curriculum},
  booktitle    = {Proceedings of the 34th {SIGCSE} Technical Symposium on Computer Science
                  Education, {SIGCSE} 2003, Reno, Nevada, USA, February 19-23, 2003},
  pages        = {305--306},
  publisher    = {{ACM}},
  year         = {2003},
  url          = {https://doi.org/10.1145/611892.611912},
  doi          = {10.1145/611892.611912},
  timestamp    = {Thu, 10 Jun 2021 16:43:03 +0200},
  biburl       = {https://dblp.org/rec/conf/sigcse/TuckerDJMSV03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/GanLWWTC03,
  author       = {Boon{-}Ping Gan and
                  Malcolm Yoke Hean Low and
                  Junhu Wei and
                  Xiaoguang Wang and
                  Stephen John Turner and
                  Wentong Cai},
  editor       = {Stephen E. Chick and
                  Paul J. Sanchez and
                  David M. Ferrin and
                  Douglas J. Morrice},
  title        = {Distributed simulation and manufacturing: synchronization and management
                  of shared state in HLA-based distributed simulation},
  booktitle    = {Proceedings of the 35th Winter Simulation Conference: Driving Innovation,
                  New Orleans, Louisiana, USA, December 7-10, 2003},
  pages        = {847--854},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://doi.org/10.1109/WSC.2003.1261503},
  doi          = {10.1109/WSC.2003.1261503},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/wsc/GanLWWTC03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/ZengCT03,
  author       = {Yi Zeng and
                  Wentong Cai and
                  Stephen John Turner},
  editor       = {Stephen E. Chick and
                  Paul J. Sanchez and
                  David M. Ferrin and
                  Douglas J. Morrice},
  title        = {Parallel distributed simulation and modeling methods: causal order
                  based time warp: a tradeoff of optimism},
  booktitle    = {Proceedings of the 35th Winter Simulation Conference: Driving Innovation,
                  New Orleans, Louisiana, USA, December 7-10, 2003},
  pages        = {855--863},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://doi.org/10.1109/WSC.2003.1261504},
  doi          = {10.1109/WSC.2003.1261504},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/wsc/ZengCT03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aiedam/McMahonCLSWC02,
  author       = {Chris A. McMahon and
                  Rose Crossland and
                  Alistair Lowe and
                  Tulan Shah and
                  J. H. Sims Williams and
                  Steve J. Culley},
  title        = {No zero match browsing of hierarchically categorized information entities},
  journal      = {Artif. Intell. Eng. Des. Anal. Manuf.},
  volume       = {16},
  number       = {3},
  pages        = {243--257},
  year         = {2002},
  url          = {https://doi.org/10.1017/S0890060402163098},
  doi          = {10.1017/S0890060402163098},
  timestamp    = {Thu, 24 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/aiedam/McMahonCLSWC02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/candc/TurcotteMS02,
  author       = {Marcel Turcotte and
                  Stephen H. Muggleton and
                  Michael J. E. Sternberg},
  title        = {Generating Protein Three-dimensional Fold Signatures using Inductive
                  Logic Programming},
  journal      = {Comput. Chem.},
  volume       = {26},
  number       = {1},
  pages        = {57--64},
  year         = {2002},
  url          = {https://doi.org/10.1016/S0097-8485(01)00100-0},
  doi          = {10.1016/S0097-8485(01)00100-0},
  timestamp    = {Sat, 30 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/candc/TurcotteMS02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/JieCT02,
  author       = {Wei Jie and
                  Wentong Cai and
                  Stephen John Turner},
  title        = {{POEMS:} {A} Parallel Object-oriented Environment for Multi-computer
                  Systems},
  journal      = {Comput. J.},
  volume       = {45},
  number       = {5},
  pages        = {540--560},
  year         = {2002},
  url          = {https://doi.org/10.1093/comjnl/45.5.540},
  doi          = {10.1093/COMJNL/45.5.540},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cj/JieCT02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ida/CounsellLMST02,
  author       = {Steve Counsell and
                  Xiaohui Liu and
                  Janet McFall and
                  Stephen Swift and
                  Allan Tucker},
  title        = {Evolutionary algorithms for grouping high dimensional Email data},
  journal      = {Intell. Data Anal.},
  volume       = {6},
  number       = {6},
  pages        = {503--516},
  year         = {2002},
  url          = {http://content.iospress.com/articles/intelligent-data-analysis/ida00108},
  timestamp    = {Mon, 05 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ida/CounsellLMST02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ida/KellamLMOST02,
  author       = {Paul Kellam and
                  Xiaohui Liu and
                  Nigel J. Martin and
                  Christine A. Orengo and
                  Stephen Swift and
                  Allan Tucker},
  title        = {A framework for modelling virus gene expression data},
  journal      = {Intell. Data Anal.},
  volume       = {6},
  number       = {3},
  pages        = {267--279},
  year         = {2002},
  url          = {http://content.iospress.com/articles/intelligent-data-analysis/ida00092},
  timestamp    = {Mon, 11 Jul 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ida/KellamLMOST02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcns/TunstallRS02,
  author       = {Mark J. Tunstall and
                  Alan Roberts and
                  Stephen R. Soffe},
  title        = {Modelling Inter-Segmental Coordination of Neuronal Oscillators: Synaptic
                  Mechanisms for Uni-Directional Coupling During Swimming in Xenopus
                  Tadpoles},
  journal      = {J. Comput. Neurosci.},
  volume       = {13},
  number       = {2},
  pages        = {143--158},
  year         = {2002},
  url          = {https://doi.org/10.1023/A:1020114324350},
  doi          = {10.1023/A:1020114324350},
  timestamp    = {Thu, 16 Jul 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jcns/TunstallRS02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmobile/ZhangLWT02,
  author       = {Junbiao Zhang and
                  Jun Li and
                  Stephen B. Weinstein and
                  Nan Tu},
  title        = {Virtual operator based {AAA} in wireless {LAN} hot spots with ad-hoc
                  networking support},
  journal      = {{ACM} {SIGMOBILE} Mob. Comput. Commun. Rev.},
  volume       = {6},
  number       = {3},
  pages        = {10--21},
  year         = {2002},
  url          = {https://doi.org/10.1145/581291.581297},
  doi          = {10.1145/581291.581297},
  timestamp    = {Sun, 17 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sigmobile/ZhangLWT02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wc/LiWZT02,
  author       = {Jun Li and
                  Stephen B. Weinstein and
                  Junbiao Zhang and
                  Nan Tu},
  title        = {Public access mobility {LAN:} extending the wireless internet into
                  the {LAN} enwronment},
  journal      = {{IEEE} Wirel. Commun.},
  volume       = {9},
  number       = {3},
  pages        = {22--30},
  year         = {2002},
  url          = {https://doi.org/10.1109/MWC.2002.1016707},
  doi          = {10.1109/MWC.2002.1016707},
  timestamp    = {Tue, 24 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/wc/LiWZT02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acis/ChauT02,
  author       = {Stephen B. Chau and
                  Paul Turner},
  title        = {An Exploration of Factors that influence the ability of Small and
                  Medium Sized Enterprises to Engage in Electronic Commerce: preliminary
                  findings from 34 Australian case studies},
  booktitle    = {Australasian Conference on Information Systems, {ACIS} 2002, Melbourne,
                  Australia, December 3-6, 2002},
  year         = {2002},
  url          = {https://aisel.aisnet.org/acis2002/8},
  timestamp    = {Thu, 16 May 2024 17:06:13 +0200},
  biburl       = {https://dblp.org/rec/conf/acis/ChauT02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/assets/CoxLTNWTA02,
  author       = {Stephen Cox and
                  Michael Lincoln and
                  Judy Tryggvason and
                  Melanie Nakisa and
                  Mark Wells and
                  Marcus Tutt and
                  Sanja Abbott},
  editor       = {Vicki L. Hanson and
                  Julie A. Jacko},
  title        = {Tessa, a system to aid communication with deaf people},
  booktitle    = {Proceedings of the {ACM} Conference on Assistive Technologies, {ASSETS}
                  2002, Edinburgh, Scotland, UK, July 8-10, 2002},
  pages        = {205--212},
  publisher    = {{ACM}},
  year         = {2002},
  url          = {https://doi.org/10.1145/638249.638287},
  doi          = {10.1145/638249.638287},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/assets/CoxLTNWTA02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/CaoSTJKSN02,
  author       = {Junwei Cao and
                  Daniel P. Spooner and
                  James D. Turner and
                  Stephen A. Jarvis and
                  Darren J. Kerbyson and
                  Subhash Saini and
                  Graham R. Nudd},
  title        = {Agent-Based Resource Management for Grid Computing},
  booktitle    = {2nd {IEEE} International Symposium on Cluster Computing and the Grid
                  (CCGrid 2002), 22-24 May 2002, Berlin, Germany},
  pages        = {350--351},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://doi.org/10.1109/CCGRID.2002.1017159},
  doi          = {10.1109/CCGRID.2002.1017159},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ccgrid/CaoSTJKSN02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/CaiLTLL02,
  author       = {Wentong Cai and
                  Guangya Li and
                  Stephen John Turner and
                  Bu{-}Sung Lee and
                  Li Liu},
  title        = {Automatic Construction of Hierarchical Federations Architecture},
  booktitle    = {6th {IEEE} International Workshop on Distributed Simulation and Real-Time
                  Applications {(DS-RT} 2002), 11-13 October 2002, Fort Worth, TX, {USA}},
  pages        = {50--58},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://doi.org/10.1109/DISRTA.2002.1166888},
  doi          = {10.1109/DISRTA.2002.1166888},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dsrt/CaiLTLL02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/CaiTZ02,
  author       = {Wentong Cai and
                  Stephen John Turner and
                  Hanfeng Zhao},
  title        = {A Load Management System for Running HLA-Based Distributed Simulations
                  over the Grid},
  booktitle    = {6th {IEEE} International Workshop on Distributed Simulation and Real-Time
                  Applications {(DS-RT} 2002), 11-13 October 2002, Fort Worth, TX, {USA}},
  pages        = {7--14},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://doi.org/10.1109/DISRTA.2002.1166883},
  doi          = {10.1109/DISRTA.2002.1166883},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dsrt/CaiTZ02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecis/ChauT02,
  author       = {Stephen B. Chau and
                  Paul Turner},
  editor       = {Stanislaw Wrycza},
  title        = {A Framework For Analysing Factors Influencing Small To Medium Sized
                  Enterprises (SMEs) Ability To Derive Benefit From The Conduct Of Web-based
                  Electronic Commerce {(EC)-34} Australian Case Studies},
  booktitle    = {Proceedings of the 10th European Conference on Information Systems,
                  Information Systems and the Future of the Digital Economy, {ECIS}
                  2002, Gdansk, Poland, June 6-8, 2002},
  pages        = {625--639},
  year         = {2002},
  url          = {http://aisel.aisnet.org/ecis2002/110},
  timestamp    = {Mon, 05 Dec 2016 15:14:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ecis/ChauT02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/HuangJTFD02,
  author       = {Zhi Huang and
                  Xiuping Jia and
                  Brian Turner and
                  William Foley and
                  Stephen Dury},
  title        = {Use of {HYMAP} image data to estimate sideroxylonal-A concentration
                  of eucalypt foliage},
  booktitle    = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
                  2002, Toronto, Ontario, Canada, 24-28 June 2002},
  pages        = {1652--1654},
  publisher    = {{IEEE}},
  year         = {2002},
  url          = {https://doi.org/10.1109/IGARSS.2002.1026210},
  doi          = {10.1109/IGARSS.2002.1026210},
  timestamp    = {Wed, 16 Oct 2019 14:14:53 +0200},
  biburl       = {https://dblp.org/rec/conf/igarss/HuangJTFD02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/CaoJSTKN02,
  author       = {Junwei Cao and
                  Stephen A. Jarvis and
                  Daniel P. Spooner and
                  James D. Turner and
                  Darren J. Kerbyson and
                  Graham R. Nudd},
  title        = {Performance Prediction Technology for Agent-Based Resource Management
                  in Grid Environments},
  booktitle    = {16th International Parallel and Distributed Processing Symposium {(IPDPS}
                  2002), 15-19 April 2002, Fort Lauderdale, FL, USA, CD-ROM/Abstracts
                  Proceedings},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://doi.org/10.1109/IPDPS.2002.1015660},
  doi          = {10.1109/IPDPS.2002.1015660},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ipps/CaoJSTKN02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/CaiXTL02,
  author       = {Wentong Cai and
                  Percival Xavier and
                  Stephen John Turner and
                  Bu{-}Sung Lee},
  editor       = {Frederick Wieland and
                  Philip A. Wilsey and
                  Lorenzo Donatiello and
                  Francesco Quaglia},
  title        = {A scalable architecture for supporting interactive games on the internet},
  booktitle    = {Proceedings of the 16th Workshop on Parallel and Distributed Simulation,
                  {PADS} 2002, Washington, D.C., USA, May 12-15, 2002},
  pages        = {60--67},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://doi.org/10.1109/PADS.2002.1004201},
  doi          = {10.1109/PADS.2002.1004201},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/CaiXTL02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/ZhouCTL02,
  author       = {Suiping Zhou and
                  Wentong Cai and
                  Stephen John Turner and
                  Francis B. S. Lee},
  editor       = {Frederick Wieland and
                  Philip A. Wilsey and
                  Lorenzo Donatiello and
                  Francesco Quaglia},
  title        = {Critical causality in distributed virtual environments},
  booktitle    = {Proceedings of the 16th Workshop on Parallel and Distributed Simulation,
                  {PADS} 2002, Washington, D.C., USA, May 12-15, 2002},
  pages        = {53--59},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://doi.org/10.1109/PADS.2002.1004200},
  doi          = {10.1109/PADS.2002.1004200},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pads/ZhouCTL02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pdpta/JieCTC02,
  author       = {Wei Jie and
                  Wentong Cai and
                  Stephen John Turner and
                  Wai Keong Chong},
  editor       = {Hamid R. Arabnia},
  title        = {A Parallel Object-oriented Environment for Cluster Computing},
  booktitle    = {Proceedings of the International Conference on Parallel and Distributed
                  Processing Techniques and Applications, {PDPTA} '02, June 24 - 27,
                  2002, Las Vegas, Nevada, USA, Volume 4},
  pages        = {1948--1954},
  publisher    = {{CSREA} Press},
  year         = {2002},
  timestamp    = {Wed, 10 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pdpta/JieCTC02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siguccs/TuckerPZ02,
  author       = {Stephen Tucker and
                  Andrew Pigou and
                  Thom D. Zaugg},
  editor       = {Pamela Vogel and
                  Catherine Yang and
                  Nancy J. Bauer},
  title        = {e-Learning: making it happen now},
  booktitle    = {Proceedings of the 30th annual {ACM} {SIGUCCS} conference on User
                  services: Charting Bold Courses - New Worlds in User Services, Providence,
                  Rhode Island, USA, November 20-23, 2002},
  pages        = {292--293},
  publisher    = {{ACM}},
  year         = {2002},
  url          = {https://doi.org/10.1145/588646.588726},
  doi          = {10.1145/588646.588726},
  timestamp    = {Tue, 06 Nov 2018 16:58:10 +0100},
  biburl       = {https://dblp.org/rec/conf/siguccs/TuckerPZ02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/FerschaJT01,
  author       = {Alois Ferscha and
                  James Johnson and
                  Stephen John Turner},
  title        = {Distributed simulation performance data mining},
  journal      = {Future Gener. Comput. Syst.},
  volume       = {18},
  number       = {1},
  pages        = {157--174},
  year         = {2001},
  url          = {https://doi.org/10.1016/S0167-739X(01)00050-4},
  doi          = {10.1016/S0167-739X(01)00050-4},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/fgcs/FerschaJT01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/PetersonGHTLSDPH01,
  author       = {Larry Peterson and
                  Yitzchak Gottlieb and
                  Mike Hibler and
                  Patrick Tullmann and
                  Jay Lepreau and
                  Stephen Schwab and
                  Hrishikesh Dandekar and
                  Andrew Purtell and
                  John Hartman},
  title        = {An {OS} interface for active routers},
  journal      = {{IEEE} J. Sel. Areas Commun.},
  volume       = {19},
  number       = {3},
  pages        = {473--487},
  year         = {2001},
  url          = {https://doi.org/10.1109/49.917708},
  doi          = {10.1109/49.917708},
  timestamp    = {Wed, 12 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jsac/PetersonGHTLSDPH01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/SwiftTML01,
  author       = {Stephen Swift and
                  Allan Tucker and
                  Nigel J. Martin and
                  Xiaohui Liu},
  title        = {Grouping multivariate time series variables: applications to chemical
                  process and visual field data},
  journal      = {Knowl. Based Syst.},
  volume       = {14},
  number       = {3-4},
  pages        = {147--154},
  year         = {2001},
  url          = {https://doi.org/10.1016/S0950-7051(01)00091-0},
  doi          = {10.1016/S0950-7051(01)00091-0},
  timestamp    = {Sat, 25 Feb 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/kbs/SwiftTML01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ml/TurcotteMS01,
  author       = {Marcel Turcotte and
                  Stephen H. Muggleton and
                  Michael J. E. Sternberg},
  title        = {The Effect of Relational Background Knowledge on Learning of Protein
                  Three-Dimensional Fold Signatures},
  journal      = {Mach. Learn.},
  volume       = {43},
  number       = {1/2},
  pages        = {81--95},
  year         = {2001},
  url          = {https://doi.org/10.1023/A:1007672817406},
  doi          = {10.1023/A:1007672817406},
  timestamp    = {Sat, 30 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ml/TurcotteMS01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scpe/GanLCTJHH01,
  author       = {Boon{-}Ping Gan and
                  Yoke{-}Hean Low and
                  Wentong Cai and
                  Stephen John Turner and
                  Sanjay Jain and
                  Wen{-}Jing Hsu and
                  Shell{-}Ying Huang},
  title        = {The Development of Conservative Superstep Protocols for Shared Memory
                  Multiprocessor Systems},
  journal      = {Parallel Distributed Comput. Pract.},
  volume       = {4},
  number       = {1},
  year         = {2001},
  url          = {http://www.scpe.org/index.php/scpe/article/view/222},
  timestamp    = {Mon, 01 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/scpe/GanLCTJHH01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigops/LeeCTK01,
  author       = {Bu{-}Sung Lee and
                  Wentong Cai and
                  Stephen John Turner and
                  Jit{-}Beng Koh},
  title        = {Comparison of Network Protocol and Architecture for Distributed Virtual
                  Simulation Environment},
  journal      = {{ACM} {SIGOPS} Oper. Syst. Rev.},
  volume       = {35},
  number       = {3},
  pages        = {30--42},
  year         = {2001},
  url          = {https://doi.org/10.1145/383237.383242},
  doi          = {10.1145/383237.383242},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sigops/LeeCTK01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/TuckerSL01,
  author       = {Allan Tucker and
                  Stephen Swift and
                  Xiaohui Liu},
  title        = {Variable grouping in multivariate time series via correlation},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
  volume       = {31},
  number       = {2},
  pages        = {235--245},
  year         = {2001},
  url          = {https://doi.org/10.1109/3477.915346},
  doi          = {10.1109/3477.915346},
  timestamp    = {Thu, 08 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/TuckerSL01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acis/ChauT01,
  author       = {Stephen B. Chau and
                  Paul Turner},
  title        = {A Four Phase Model of {EC} Business Transformation amongst Small to
                  Medium Sized Enterprises: Preliminary Findings from 34 Australian
                  Case Studies},
  booktitle    = {Australasian Conference on Information Systems, {ACIS} 2001, Coffs
                  Harbour, Australia, December 5-7, 2001},
  year         = {2001},
  url          = {https://aisel.aisnet.org/acis2001/3},
  timestamp    = {Thu, 16 May 2024 17:06:13 +0200},
  biburl       = {https://dblp.org/rec/conf/acis/ChauT01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/JiGTC01,
  author       = {Zhengrong Ji and
                  Boon{-}Ping Gan and
                  Stephen John Turner and
                  Wentong Cai},
  title        = {Parallel Federates - An Architecture for Hybrid Distributed Simulation},
  booktitle    = {5th {IEEE} International Workshop on Distributed Simulation and Real-Time
                  Applications {(DS-RT} 2001), 13-15 August 2001, Cincinnati, OH, {USA}},
  pages        = {97--104},
  publisher    = {{IEEE} Computer Society},
  year         = {2001},
  url          = {https://doi.org/10.1109/DISTRA.2001.946449},
  doi          = {10.1109/DISTRA.2001.946449},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dsrt/JiGTC01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceis/CounsellLSTM01,
  author       = {Steve Counsell and
                  Xiaohui Liu and
                  Stephen Swift and
                  Allan Tucker and
                  Janet McFall},
  title        = {Optimising the Grouping of Email Users to Servers Using Intelligent
                  Data Analysis},
  booktitle    = {{ICEIS} 2001, Proceedings of the 3rd International Conference on Enterprise
                  Information Systems, Setubal, Portugal, July 7-10, 2001},
  pages        = {489--496},
  year         = {2001},
  timestamp    = {Thu, 01 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iceis/CounsellLSTM01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpads/JieCT01,
  author       = {Wei Jie and
                  Wentong Cai and
                  Stephen John Turner},
  title        = {Dynamic Load-Balancing in a Data Parallel Object-Oriented System},
  booktitle    = {Eigth International Conference on Parallel and Distributed Systems,
                  {ICPADS} 2001, KyongJu City, Korea, June 26-29, 2001},
  pages        = {279--288},
  publisher    = {{IEEE} Computer Society},
  year         = {2001},
  url          = {https://doi.org/10.1109/ICPADS.2001.934831},
  doi          = {10.1109/ICPADS.2001.934831},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icpads/JieCT01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ida/KellamLMOST01,
  author       = {Paul Kellam and
                  Xiaohui Liu and
                  Nigel J. Martin and
                  Christine A. Orengo and
                  Stephen Swift and
                  Allan Tucker},
  editor       = {Frank Hoffmann and
                  David J. Hand and
                  Niall M. Adams and
                  Douglas H. Fisher and
                  Gabriela Guimar{\~{a}}es},
  title        = {A Framework for Modelling Short, High-Dimensional Multivariate Time
                  Series: Preliminary Results in Virus Gene Expression Data Analysis},
  booktitle    = {Advances in Intelligent Data Analysis, 4th International Conference,
                  {IDA} 2001, Cascais, Portugal, September 13-15, 2001, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {2189},
  pages        = {218--227},
  publisher    = {Springer},
  year         = {2001},
  url          = {https://doi.org/10.1007/3-540-44816-0\_22},
  doi          = {10.1007/3-540-44816-0\_22},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ida/KellamLMOST01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/JieCT01,
  author       = {Wei Jie and
                  Wentong Cai and
                  Stephen John Turner},
  title        = {Dynamic Load-balancing Using Prediction in a Parallel Object-oriented
                  System},
  booktitle    = {Proceedings of the 15th International Parallel {\&} Distributed
                  Processing Symposium (IPDPS-01), San Francisco, CA, USA, April 23-27,
                  2001},
  pages        = {76},
  publisher    = {{IEEE} Computer Society},
  year         = {2001},
  url          = {https://doi.org/10.1109/IPDPS.2001.925024},
  doi          = {10.1109/IPDPS.2001.925024},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ipps/JieCT01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/CaiTG01,
  author       = {Wentong Cai and
                  Stephen John Turner and
                  Boon{-}Ping Gan},
  editor       = {Rajive L. Bagrodia and
                  Ewa Deelman and
                  Philip A. Wilsey},
  title        = {Hierarchical federations: an architecture for information hiding},
  booktitle    = {Proceedings of the 15th Workshop on Parallel and Distributed Simulation,
                  {PADS} 2001, Lake Arrowhead, California, USA, May 15-18, 2001},
  pages        = {67--74},
  publisher    = {{IEEE} Computer Society},
  year         = {2001},
  url          = {https://doi.org/10.1109/PADS.2001.924622},
  doi          = {10.1109/PADS.2001.924622},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pads/CaiTG01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/ZhangCT01,
  author       = {Ye Zhang and
                  Wentong Cai and
                  Stephen John Turner},
  editor       = {Rajive L. Bagrodia and
                  Ewa Deelman and
                  Philip A. Wilsey},
  title        = {A parallel object-oriented manufacturing simulation language},
  booktitle    = {Proceedings of the 15th Workshop on Parallel and Distributed Simulation,
                  {PADS} 2001, Lake Arrowhead, California, USA, May 15-18, 2001},
  pages        = {101--108},
  publisher    = {{IEEE} Computer Society},
  year         = {2001},
  url          = {https://doi.org/10.1109/PADS.2001.924626},
  doi          = {10.1109/PADS.2001.924626},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pads/ZhangCT01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/robocup/StancliffBBESS01,
  author       = {Stephen B. Stancliff and
                  Ravi Balasubramanian and
                  Tucker R. Balch and
                  Rosemary Emery and
                  Kevin Sikorski and
                  Ashley W. Stroupe},
  editor       = {Andreas Birk and
                  Silvia Coradeschi and
                  Satoshi Tadokoro},
  title        = {{CMU} Hammerheads 2001 Team Description},
  booktitle    = {RoboCup 2001: Robot Soccer World Cup {V}},
  series       = {Lecture Notes in Computer Science},
  volume       = {2377},
  pages        = {631--634},
  publisher    = {Springer},
  year         = {2001},
  url          = {https://doi.org/10.1007/3-540-45603-1\_100},
  doi          = {10.1007/3-540-45603-1\_100},
  timestamp    = {Tue, 14 May 2019 10:00:53 +0200},
  biburl       = {https://dblp.org/rec/conf/robocup/StancliffBBESS01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uist/MacIntyreMVHTC01,
  author       = {Blair MacIntyre and
                  Elizabeth D. Mynatt and
                  Stephen Voida and
                  Klaus Marius Hansen and
                  Joe Tullio and
                  Gregory M. Corso},
  editor       = {Joe Marks and
                  Elizabeth D. Mynatt},
  title        = {Support for multitasking and background awareness using interactive
                  peripheral displays},
  booktitle    = {Proceedings of the 14th Annual {ACM} Symposium on User Interface Software
                  and Technology, {UIST} 2001, Disney's BoardWalk Inn Resort, Walt Disney
                  World, Orlando, Florida, USA, November 11-14, 2001},
  pages        = {41--50},
  publisher    = {{ACM}},
  year         = {2001},
  url          = {https://doi.org/10.1145/502348.502355},
  doi          = {10.1145/502348.502355},
  timestamp    = {Tue, 06 Nov 2018 16:58:06 +0100},
  biburl       = {https://dblp.org/rec/conf/uist/MacIntyreMVHTC01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/GanLJTC01,
  author       = {Boon{-}Ping Gan and
                  Li Liu and
                  Zhengrong Ji and
                  Stephen John Turner and
                  Wentong Cai},
  editor       = {Matthew W. Rohrer and
                  Deborah J. Medeiros and
                  Mark R. Grabau},
  title        = {Managing event traces for a web front-end to a parallel simulation},
  booktitle    = {Proceedings of the 33nd conference on Winter simulation, {WSC} 2001,
                  Arlington, VA, USA, December 9-12, 2001},
  pages        = {637--644},
  publisher    = {{WSC}},
  year         = {2001},
  url          = {https://doi.org/10.1109/WSC.2001.977349},
  doi          = {10.1109/WSC.2001.977349},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/GanLJTC01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc3185,
  author       = {Stephen Farrell and
                  Sean Turner},
  title        = {Reuse of {CMS} Content Encryption Keys},
  journal      = {{RFC}},
  volume       = {3185},
  pages        = {1--10},
  year         = {2001},
  url          = {https://doi.org/10.17487/RFC3185},
  doi          = {10.17487/RFC3185},
  timestamp    = {Tue, 14 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rfc/rfc3185.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/etai/TurcotteMS00,
  author       = {Marcel Turcotte and
                  Stephen H. Muggleton and
                  Michael J. E. Sternberg},
  title        = {Use of Inductive Logic Programming to Learn Principles of Protein
                  Structure},
  journal      = {Electron. Trans. Artif. Intell.},
  volume       = {4},
  number       = {B},
  pages        = {119--124},
  year         = {2000},
  url          = {http://www.ep.liu.se/ej/etai/2000/013/},
  timestamp    = {Sat, 30 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/etai/TurcotteMS00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jors/GanT00,
  author       = {Boon{-}Ping Gan and
                  Stephen John Turner},
  title        = {An asynchronous protocol for virtual factory simulation on shared
                  memory multiprocessor systems},
  journal      = {J. Oper. Res. Soc.},
  volume       = {51},
  number       = {4},
  pages        = {413--422},
  year         = {2000},
  url          = {https://doi.org/10.1057/palgrave.jors.2600914},
  doi          = {10.1057/PALGRAVE.JORS.2600914},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jors/GanT00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/TurnerCG00,
  author       = {Stephen John Turner and
                  Wentong Cai and
                  Boon{-}Ping Gan},
  title        = {Adapting a Supply-Chain Simulation for {HLA}},
  booktitle    = {4th International Workshop on Distributed Simulation and Real-Time
                  Applications {(DS-RT} 2000), 25-17 August 2000, San Francisco, CA,
                  {USA}},
  pages        = {71--78},
  publisher    = {{IEEE} Computer Society},
  year         = {2000},
  url          = {https://doi.org/10.1109/DISRTA.2000.874065},
  doi          = {10.1109/DISRTA.2000.874065},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dsrt/TurnerCG00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esm/ZhangCT00,
  author       = {Ye Zhang and
                  Wentong Cai and
                  Stephen John Turner},
  editor       = {Rik Van Landeghem},
  title        = {Parallel discrete event simulation of manufacturing systems using
                  parsec},
  booktitle    = {14\({}^{\mbox{th}}\) European Simulation Multiconference - Simulation
                  and Modelling: Enablers for a Better Quality of Life, May 23-26, 2000,
                  Ghent, Belgium},
  pages        = {296--301},
  publisher    = {{SCS} Europe},
  year         = {2000},
  timestamp    = {Wed, 10 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/esm/ZhangCT00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/ThomasTRC00,
  author       = {Federico Thomas and
                  Colin Turnbull and
                  Llu{\'{\i}}s Ros and
                  Stephen Cameron},
  title        = {Computing Signed Distances between Free-Form Objects},
  booktitle    = {Proceedings of the 2000 {IEEE} International Conference on Robotics
                  and Automation, {ICRA} 2000, April 24-28, 2000, San Francisco, CA,
                  {USA}},
  pages        = {3713--3718},
  publisher    = {{IEEE}},
  year         = {2000},
  url          = {https://doi.org/10.1109/ROBOT.2000.845310},
  doi          = {10.1109/ROBOT.2000.845310},
  timestamp    = {Mon, 22 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icra/ThomasTRC00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/TurnerAL00,
  author       = {Kenneth J. Turner and
                  F. Javier Argul{-}Marin and
                  Stephen D. Laing},
  editor       = {Jos{\'{e}} D. P. Rolim},
  title        = {Concurrent Specification and Timing Analysis of Digital Hardware Using
                  {SDL}},
  booktitle    = {Parallel and Distributed Processing, 15 {IPDPS} 2000 Workshops, Cancun,
                  Mexico, May 1-5, 2000, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {1800},
  pages        = {1001--1008},
  publisher    = {Springer},
  year         = {2000},
  url          = {https://doi.org/10.1007/3-540-45591-4\_137},
  doi          = {10.1007/3-540-45591-4\_137},
  timestamp    = {Tue, 14 May 2019 10:00:41 +0200},
  biburl       = {https://dblp.org/rec/conf/ipps/TurnerAL00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/GanLJTCHH00,
  author       = {Boon{-}Ping Gan and
                  Yoke{-}Hean Low and
                  Sanjay Jain and
                  Stephen John Turner and
                  Wentong Cai and
                  Wen{-}Jing Hsu and
                  Shell{-}Ying Huang},
  editor       = {Lorenzo Donatiello and
                  Stephen John Turner and
                  David Bruce},
  title        = {Load balancing for conservative simulation on shared memory multiprocessor
                  systems},
  booktitle    = {Proceedings of the 14th Workshop on Parallel and Distributed Simulation,
                  {PADS} 2000, Bologna, Italy, May 28-31, 2000},
  pages        = {139--146},
  publisher    = {{IEEE} Computer Society},
  year         = {2000},
  url          = {https://doi.org/10.1109/PADS.2000.847157},
  doi          = {10.1109/PADS.2000.847157},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/GanLJTCHH00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/DamianoKTB00,
  author       = {Brian Damiano and
                  Stephen W. Kercel and
                  Raymond W. Tucker Jr. and
                  S. Alenka Brown{-}VanHoozer},
  title        = {Recognizing a voice from its model},
  booktitle    = {Proceedings of the {IEEE} International Conference on Systems, Man
                  {\&} Cybernetics: "Cybernetics Evolving to Systems, Humans, Organizations,
                  and their Complex Interactions", Sheraton Music City Hotel, Nashville,
                  Tennessee, USA, 8-11 October 2000},
  pages        = {2216--2221},
  publisher    = {{IEEE}},
  year         = {2000},
  url          = {https://doi.org/10.1109/ICSMC.2000.886445},
  doi          = {10.1109/ICSMC.2000.886445},
  timestamp    = {Wed, 16 Oct 2019 14:14:51 +0200},
  biburl       = {https://dblp.org/rec/conf/smc/DamianoKTB00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/GanLJTCH00,
  author       = {Boon{-}Ping Gan and
                  Li Liu and
                  Sanjay Jain and
                  Stephen John Turner and
                  Wentong Cai and
                  Wen{-}Jing Hsu},
  editor       = {Paul A. Fishwick and
                  Keebom Kang and
                  Jeffrey A. Joines and
                  Russell R. Barton},
  title        = {Manufacturing sypply chain management: distributed supply chain simulation
                  across enterprise boundaries},
  booktitle    = {Proceedings of the 32nd conference on Winter simulation, {WSC} 2000,
                  Wyndham Palace Resort {\&} Spa, Orlando, FL, USA, December 10-13,
                  2000},
  pages        = {1245--1251},
  publisher    = {{WSC}},
  year         = {2000},
  url          = {https://doi.org/10.1109/WSC.2000.899092},
  doi          = {10.1109/WSC.2000.899092},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/wsc/GanLJTCH00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/pads/2000,
  editor       = {Lorenzo Donatiello and
                  Stephen John Turner and
                  David Bruce},
  title        = {Proceedings of the 14th Workshop on Parallel and Distributed Simulation,
                  {PADS} 2000, Bologna, Italy, May 28-31, 2000},
  publisher    = {{IEEE} Computer Society},
  year         = {2000},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6840/proceeding},
  isbn         = {0-7695-0667-4},
  timestamp    = {Wed, 16 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/2000.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mor/StephenT99,
  author       = {Tamon Stephen and
                  Levent Tun{\c{c}}el},
  title        = {On a Representation of the Matching Polytope Via Semidefinite Liftings},
  journal      = {Math. Oper. Res.},
  volume       = {24},
  number       = {1},
  pages        = {1--7},
  year         = {1999},
  url          = {https://doi.org/10.1287/moor.24.1.1},
  doi          = {10.1287/MOOR.24.1.1},
  timestamp    = {Fri, 30 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/mor/StephenT99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pc/CaiZTS99,
  author       = {Wentong Cai and
                  Kang Zhang and
                  Stephen John Turner and
                  Chengzheng Sun},
  title        = {Interlock avoidance in transparent and dynamic parallel program instrumentation
                  using logical clocks},
  journal      = {Parallel Comput.},
  volume       = {25},
  number       = {5},
  pages        = {569--591},
  year         = {1999},
  url          = {https://doi.org/10.1016/S0167-8191(99)00010-1},
  doi          = {10.1016/S0167-8191(99)00010-1},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pc/CaiZTS99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/LowLCHHJT99,
  author       = {Yoke{-}Hean Low and
                  Chu{-}Cheow Lim and
                  Wentong Cai and
                  Shell{-}Ying Huang and
                  Wen{-}Jing Hsu and
                  Sanjay Jain and
                  Stephen John Turner},
  title        = {Survey of Languages and Runtime Libraries for Parallel Discrete-Event
                  Simulation},
  journal      = {Simul.},
  volume       = {72},
  number       = {3},
  pages        = {170--186},
  year         = {1999},
  url          = {https://doi.org/10.1177/003754979907200309},
  doi          = {10.1177/003754979907200309},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/simulation/LowLCHHJT99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/arvlsi/BrittonWSWTBBDEEMTCJTHR99,
  author       = {Charles L. Britton Jr. and
                  R. J. Warmack and
                  Stephen F. Smith and
                  Alan L. Wintenberg and
                  T. Thundat and
                  G. M. Brown and
                  W. L. Bryan and
                  J. C. Depriest and
                  M. Nance Ericson and
                  M. S. Emery and
                  Michael Roy Moore and
                  G. W. Turner and
                  Lloyd G. Clonts and
                  R. L. Jones and
                  T. D. Threatt and
                  Z. Hu and
                  James M. Rochelle},
  title        = {Battery-powered, Wireless {MEMS} Sensors for High-Sensitivity Chemical
                  and Biological Sensing},
  booktitle    = {18th Conference on Advanced Research in {VLSI} {(ARVLSI} '99), 21-24
                  March 1999, Atlanta, GA, {USA}},
  pages        = {359--368},
  publisher    = {{IEEE} Computer Society},
  year         = {1999},
  url          = {https://doi.org/10.1109/ARVLSI.1999.756060},
  doi          = {10.1109/ARVLSI.1999.756060},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/arvlsi/BrittonWSWTBBDEEMTCJTHR99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/LiangCLT99,
  author       = {Lawrence A. H. Liang and
                  Wentong Cai and
                  Bu{-}Sung Lee and
                  Stephen John Turner},
  title        = {Performance Analysis of Packet Bundling Techniques in {DIS}},
  booktitle    = {3rd International Workshop on Distributed Interactive Simulation and
                  Real-Time Applications {(DIS-RT} '99), 22-23 October 1999, Greenbelt,
                  MD, {USA}},
  pages        = {75},
  publisher    = {{IEEE} Computer Society},
  year         = {1999},
  url          = {https://doi.org/10.1109/DISRTA.1999.807728},
  doi          = {10.1109/DISRTA.1999.807728},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dsrt/LiangCLT99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ida/SwiftTL99,
  author       = {Stephen Swift and
                  Allan Tucker and
                  Xiaohui Liu},
  editor       = {David J. Hand and
                  Joost N. Kok and
                  Michael R. Berthold},
  title        = {Evolutionary Computation to Search for Strongly Correlated Variables
                  in High-Dimensional Time-Series},
  booktitle    = {Advances in Intelligent Data Analysis, Third International Symposium,
                  IDA-99, Amsterdam, The Netherlands, August 1999, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {1642},
  pages        = {51--62},
  publisher    = {Springer},
  year         = {1999},
  url          = {https://doi.org/10.1007/3-540-48412-4\_5},
  doi          = {10.1007/3-540-48412-4\_5},
  timestamp    = {Wed, 07 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ida/SwiftTL99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/pads/1999,
  editor       = {Richard M. Fujimoto and
                  Stephen John Turner},
  title        = {Proceedings of the Thirteenth Workshop on Parallel and Distributed
                  Simulation, {PADS} '99, Atlanta, GA, USA, May 1-4, 1999},
  publisher    = {{IEEE} Computer Society},
  year         = {1999},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6213/proceeding},
  isbn         = {0-7695-0155-9},
  timestamp    = {Wed, 16 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/1999.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsa/Turner98,
  author       = {Stephen John Turner},
  title        = {Models of computation for parallel discrete event simulation},
  journal      = {J. Syst. Archit.},
  volume       = {44},
  number       = {6-7},
  pages        = {395--409},
  year         = {1998},
  url          = {https://doi.org/10.1016/S1383-7621(97)00055-6},
  doi          = {10.1016/S1383-7621(97)00055-6},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jsa/Turner98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esm/CuiT98,
  author       = {Qung Ming Cui and
                  Stephen John Turner},
  editor       = {Richard N. Zobel and
                  Dietmar P. F. M{\"{o}}ller},
  title        = {Reducing Null Messages in The Conservative Parallel Simulation of
                  Timed Petri Nets},
  booktitle    = {12\({}^{\mbox{th}}\) European Simulation Multiconference - Simulation
                  - Past, Present and Future, June 16-19, 1998, Machester, United Kingdom},
  pages        = {69--73},
  publisher    = {{SCS} Europe},
  year         = {1998},
  timestamp    = {Fri, 28 Apr 2006 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/esm/CuiT98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/TurnbullC98,
  author       = {Colin Turnbull and
                  Stephen Cameron},
  title        = {Computing Distances between NURBS-defined Convex Objects},
  booktitle    = {Proceedings of the {IEEE} International Conference on Robotics and
                  Automation, ICRA-98, Leuven, Belgium, May 16-20, 1998},
  pages        = {3685--3690},
  publisher    = {{IEEE} Computer Society},
  year         = {1998},
  url          = {https://doi.org/10.1109/ROBOT.1998.681406},
  doi          = {10.1109/ROBOT.1998.681406},
  timestamp    = {Mon, 22 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icra/TurnbullC98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ilp/TurcotteMS98,
  author       = {Marcel Turcotte and
                  Stephen H. Muggleton and
                  Michael J. E. Sternberg},
  editor       = {David Page},
  title        = {Application of Inductive Logic Programming to Discover Rules Governing
                  the Three-Dimensional Topology of Protein Structure},
  booktitle    = {Inductive Logic Programming, 8th International Workshop, ILP-98, Madison,
                  Wisconsin, USA, July 22-24, 1998, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {1446},
  pages        = {53--64},
  publisher    = {Springer},
  year         = {1998},
  url          = {https://doi.org/10.1007/BFb0027310},
  doi          = {10.1007/BFB0027310},
  timestamp    = {Sat, 30 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ilp/TurcotteMS98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/LimLCHHT98,
  author       = {Chu{-}Cheow Lim and
                  Yoke{-}Hean Low and
                  Wentong Cai and
                  Wen{-}Jing Hsu and
                  Shell{-}Ying Huang and
                  Stephen John Turner},
  editor       = {Jos{\'{e}} D. P. Rolim},
  title        = {An Empirical Comparison of Runtime Systems for Conservative Parallel
                  Simulation},
  booktitle    = {Parallel and Distributed Processing, 10 IPPS/SPDP'98 Workshops Held
                  in Conjunction with the 12th International Parallel Processing Symposium
                  and 9th Symposium on Parallel and Distributed Processing, Orlando,
                  Florida, USA, March 30 - April 3, 1998, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {1388},
  pages        = {123--134},
  publisher    = {Springer},
  year         = {1998},
  url          = {https://doi.org/10.1007/3-540-64359-1\_683},
  doi          = {10.1007/3-540-64359-1\_683},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ipps/LimLCHHT98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/TurnerCLLHH98,
  author       = {Stephen John Turner and
                  Wentong Cai and
                  Chu{-}Cheow Lim and
                  Yoke{-}Hean Low and
                  Wen{-}Jing Hsu and
                  Shell{-}Ying Huang},
  editor       = {Brian W. Unger and
                  Alois Ferscha},
  title        = {A Methodology for Automating the Parallelization of Manufacturing
                  Simulations},
  booktitle    = {Proceedings of the 12th Workshop on Parallel and Distributed Simulation,
                  {PADS} '98, Banff, Alberta, Canada, May 26-29, 1998},
  pages        = {126--133},
  publisher    = {{IEEE} Computer Society},
  year         = {1998},
  url          = {https://doi.org/10.1109/PADS.1998.685278},
  doi          = {10.1109/PADS.1998.685278},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pads/TurnerCLLHH98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ais/TuckettTJ97,
  author       = {J. Tuckett and
                  Peter J. Thomas and
                  Stephen R. Jones},
  title        = {Expert Opinion on the Future of Multimedia Based Education},
  journal      = {{AI} Soc.},
  volume       = {11},
  number       = {1},
  pages        = {88--103},
  year         = {1997},
  url          = {https://doi.org/10.1007/BF02812441},
  doi          = {10.1007/BF02812441},
  timestamp    = {Fri, 15 Mar 2019 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ais/TuckettTJ97.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hotos/FordMLCRT97,
  author       = {Bryan Ford and
                  Kevin Van Maren and
                  Jay Lepreau and
                  Stephen Clawson and
                  Bart Robinson and
                  Jeff Turner},
  title        = {The Flux {OS} Toolkit: Reusable Components for {OS} Implementation},
  booktitle    = {Proceedings of The Sixth Workshop on Hot Topics in Operating Systems,
                  HotOS-VI, Cape Cod, Massachusetts, USA, May 5-6, 1997},
  pages        = {14--19},
  publisher    = {{IEEE} Computer Society},
  year         = {1997},
  url          = {https://doi.org/10.1109/HOTOS.1997.595175},
  doi          = {10.1109/HOTOS.1997.595175},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/hotos/FordMLCRT97.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/CaiLT97,
  author       = {Wentong Cai and
                  Emmanuelle Letertre and
                  Stephen John Turner},
  editor       = {Alois Ferscha and
                  Rassul Ayani and
                  Carl Tropper},
  title        = {Dag Consistent Parallel Simulation: {A} Predictable and Robust Conservative
                  Algorithm},
  booktitle    = {Proceedings of the Eleventh Workshop on Parallel and Distributed Simulation,
                  {PADS} '97, Lockenhaus, Austria, June 10-13, 1997},
  pages        = {178--181},
  publisher    = {{IEEE} Computer Society},
  year         = {1997},
  url          = {https://doi.org/10.1109/PADS.1997.594604},
  doi          = {10.1109/PADS.1997.594604},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pads/CaiLT97.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pcfd/RycroftT97,
  author       = {N. C. Rycroft and
                  Stephen R. Turnock},
  editor       = {David R. Emerson and
                  Akin Ecer and
                  Jacques P{\'{e}}riaux and
                  Nobuyuki Satofuka},
  title        = {Hybrid Cell Finite Volume Euler Solutions of Flow Around a Main-Jib
                  Sail Using an {IBM} {SP2}},
  booktitle    = {Conference on Parallel Computational Fluid Dynamics 1997, Manchester,
                  UK, May 19-21, 1997},
  pages        = {263--272},
  publisher    = {North Holland},
  year         = {1997},
  url          = {https://doi.org/10.1016/b978-044482849-1/50032-4},
  doi          = {10.1016/B978-044482849-1/50032-4},
  timestamp    = {Fri, 29 May 2020 15:29:13 +0200},
  biburl       = {https://dblp.org/rec/conf/pcfd/RycroftT97.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pdpta/TurnerY97,
  author       = {Stephen John Turner and
                  Norlaily Yaacob},
  editor       = {Hamid R. Arabnia},
  title        = {A Transformational Approach to Object-Based Concurrent Reflective
                  Language},
  booktitle    = {Proceedings of the International Conference on Parallel and Distributed
                  Processing Techniques and Applications, {PDPTA} 1997, June 30 - July
                  3, 1997, Las Vegas, Nevada, {USA}},
  pages        = {226--244},
  publisher    = {{CSREA} Press},
  year         = {1997},
  timestamp    = {Fri, 28 Apr 2006 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pdpta/TurnerY97.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/GeistCHT96,
  author       = {Robert Geist and
                  Madhu Chetuparambil and
                  Stephen T. Hedetniemi and
                  A. Joe Turner},
  title        = {Computing Research Programs in the {US}},
  journal      = {Commun. {ACM}},
  volume       = {39},
  number       = {12},
  pages        = {96--99},
  year         = {1996},
  url          = {https://doi.org/10.1145/240483.240505},
  doi          = {10.1145/240483.240505},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cacm/GeistCHT96.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esm/CuiT96,
  author       = {Qing Ming Cui and
                  Stephen J. Turner},
  editor       = {Andr{\'{a}}s J{\'{a}}vor and
                  Axel Lehmann and
                  Istvan Moln{\'{a}}r},
  title        = {A New Approach To The Distributed Simulation of Timed Petri Nets},
  booktitle    = {Modelling and Simulation, ESM96, June 2-6, 1996, Budapest University
                  of Economic Sciences},
  pages        = {90--94},
  publisher    = {SCS, The Society for Computer Simulation International},
  year         = {1996},
  timestamp    = {Mon, 27 Feb 2023 10:45:50 +0100},
  biburl       = {https://dblp.org/rec/conf/esm/CuiT96.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/BlumeEFGLLHPPPPRTW96,
  author       = {William Blume and
                  Rudolf Eigenmann and
                  Keith Faigin and
                  John Grout and
                  Jaejin Lee and
                  Thomas Lawrence and
                  Jay P. Hoeflinger and
                  David A. Padua and
                  Yunheung Paek and
                  Paul Petersen and
                  William M. Pottenger and
                  Lawrence Rauchwerger and
                  Peng Tu and
                  Stephen Weatherford},
  editor       = {Howard Jay Siegel},
  title        = {Restructuring Programs for High-Speed Computers with Polaris},
  booktitle    = {Proceedings of the 1996 International Conference on Parallel Processing
                  Workshop, {ICCPW} 1996, Bloomingdale, IL, USA, August 12-16, 1996},
  pages        = {149--161},
  publisher    = {{IEEE} Computer Society},
  year         = {1996},
  url          = {https://doi.org/10.1109/ICPPW.1996.538601},
  doi          = {10.1109/ICPPW.1996.538601},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpp/BlumeEFGLLHPPPPRTW96.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/idw/LeeC96,
  author       = {John W. T. Lee and
                  Stephen Chi{-}fai Chan},
  editor       = {Joseph Fong and
                  Brian Siu},
  title        = {Extending Path Expression to Tree Expression in {OODM}},
  booktitle    = {Multimedia, Knowledge-Based {\&} Object-Oriented Databases, 7th
                  International Hong Kong Computer Society Database Workshop, May 1996},
  pages        = {248--263},
  publisher    = {Springer, Singapore},
  year         = {1996},
  timestamp    = {Thu, 16 Mar 2017 15:23:09 +0100},
  biburl       = {https://dblp.org/rec/conf/idw/LeeC96.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/osdi/FordHLTBC96,
  author       = {Bryan Ford and
                  Mike Hibler and
                  Jay Lepreau and
                  Patrick Tullmann and
                  Godmar Back and
                  Stephen Clawson},
  editor       = {Karin Petersen and
                  Willy Zwaenepoel},
  title        = {Microkernels Meet Recursive Virtual Machines},
  booktitle    = {Proceedings of the Second {USENIX} Symposium on Operating Systems
                  Design and Implementation (OSDI), Seattle, Washington, USA, October
                  28-31, 1996},
  pages        = {137--151},
  publisher    = {{ACM}},
  year         = {1996},
  url          = {https://doi.org/10.1145/238721.238769},
  doi          = {10.1145/238721.238769},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/osdi/FordHLTBC96.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/TurnerNC95,
  author       = {Stephen W. Turner and
                  Lionel M. Ni and
                  Betty H. C. Cheng},
  title        = {Contention-Free 2D-Mesh Cluster Allocation in Hypercubes},
  journal      = {{IEEE} Trans. Computers},
  volume       = {44},
  number       = {8},
  pages        = {1051--1055},
  year         = {1995},
  url          = {https://doi.org/10.1109/12.403722},
  doi          = {10.1109/12.403722},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tc/TurnerNC95.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anss/BackT95,
  author       = {Adam Back and
                  Stephen John Turner},
  title        = {Time-stamp generation for optimistic parallel computing},
  booktitle    = {Proceedings 28st Annual Simulation Symposium {(SS} '95), April 25-28,
                  1995, Santa Barbara, California, {USA}},
  pages        = {144},
  publisher    = {{IEEE} Computer Society},
  year         = {1995},
  url          = {https://doi.org/10.1109/SIMSYM.1995.393585},
  doi          = {10.1109/SIMSYM.1995.393585},
  timestamp    = {Fri, 05 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/anss/BackT95.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpcn/BackT95,
  author       = {Adam Back and
                  Stephen John Turner},
  editor       = {Louis O. Hertzberger and
                  Giuseppe Serazzi},
  title        = {Using optimistic execution techniques as a parallelisation tool for
                  general purpose computing},
  booktitle    = {High-Performance Computing and Networking, International Conference
                  and Exhibition, {HPCN} Europe 1995, Milan, Italy, May 3-5, 1995, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {919},
  pages        = {21--26},
  publisher    = {Springer},
  year         = {1995},
  url          = {https://doi.org/10.1007/BFb0046604},
  doi          = {10.1007/BFB0046604},
  timestamp    = {Fri, 05 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/hpcn/BackT95.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icannga/RobertsT95,
  author       = {Stephen G. Roberts and
                  Mike Turega},
  editor       = {David W. Pearson and
                  Nigel C. Steele and
                  Rudolf F. Albrecht},
  title        = {Evolving Neural Network Structures: An Evaluation of Encoding Techniques},
  booktitle    = {Artificial Neural Nets and Genetic Algorithms, {ICANNGA} 1995, Proceedings
                  of the International Conference in Al{\`{e}}s, France, 1995},
  pages        = {96--99},
  publisher    = {Springer},
  year         = {1995},
  url          = {https://doi.org/10.1007/978-3-7091-7535-4\_27},
  doi          = {10.1007/978-3-7091-7535-4\_27},
  timestamp    = {Fri, 05 Jul 2019 13:13:56 +0200},
  biburl       = {https://dblp.org/rec/conf/icannga/RobertsT95.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pdpcs/TanCT95,
  author       = {Hung{-}Khoon Tan and
                  Wentong Cai and
                  Stephen John Turner},
  editor       = {M. H. Hamza},
  title        = {{VPE:} {A} Visual Programming Environment for Parallel Processing},
  booktitle    = {Proceedings of the Seventh {IASTED/ISMM} International Conference
                  on Parallel and Distributed Computing and Systems, Washington, D.C.,
                  USA, October 19-21, 1995},
  pages        = {359--362},
  publisher    = {{IASTED/ACTA} Press},
  year         = {1995},
  timestamp    = {Wed, 10 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pdpcs/TanCT95.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/CaiT94,
  author       = {Wentong Cai and
                  Stephen John Turner},
  title        = {An Approach to the Run-Time Monitoring of Parallel Programs},
  journal      = {Comput. J.},
  volume       = {37},
  number       = {4},
  pages        = {333--345},
  year         = {1994},
  url          = {https://doi.org/10.1093/comjnl/37.4.333},
  doi          = {10.1093/COMJNL/37.4.333},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cj/CaiT94.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lcpc/BlumeEFGHPPPRTW94,
  author       = {William Blume and
                  Rudolf Eigenmann and
                  Keith Faigin and
                  John Grout and
                  Jay P. Hoeflinger and
                  David A. Padua and
                  Paul Petersen and
                  William M. Pottenger and
                  Lawrence Rauchwerger and
                  Peng Tu and
                  Stephen Weatherford},
  editor       = {Keshav Pingali and
                  Utpal Banerjee and
                  David Gelernter and
                  Alexandru Nicolau and
                  David A. Padua},
  title        = {Polaris: Improving the Effectiveness of Parallelizing Compilers},
  booktitle    = {Languages and Compilers for Parallel Computing, 7th International
                  Workshop, LCPC'94, Ithaca, NY, USA, August 8-10, 1994, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {892},
  pages        = {141--154},
  publisher    = {Springer},
  year         = {1994},
  url          = {https://doi.org/10.1007/BFb0025876},
  doi          = {10.1007/BFB0025876},
  timestamp    = {Fri, 24 Dec 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/lcpc/BlumeEFGHPPPRTW94.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/BlanchardLT94,
  author       = {Timothy David Blanchard and
                  Thomas W. Lake and
                  Stephen John Turner},
  editor       = {D. K. Arvind and
                  Rajive L. Bagrodia and
                  Jason Yi{-}Bing Lin},
  title        = {Cooperative acceleration: robust conservative distributed discrete
                  event simulation},
  booktitle    = {Proceedings of the Eighth Workshop on Parallel and Distributed Simulation,
                  {PADS} 1994, Edinburgh, Scotland, United Kingdom, July 6-8, 1994},
  pages        = {58--64},
  publisher    = {{ACM}},
  year         = {1994},
  url          = {https://doi.org/10.1145/182478.182494},
  doi          = {10.1145/182478.182494},
  timestamp    = {Fri, 20 May 2022 12:42:41 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/BlanchardLT94.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pads/WoodT94,
  author       = {Kenneth R. Wood and
                  Stephen John Turner},
  editor       = {D. K. Arvind and
                  Rajive L. Bagrodia and
                  Jason Yi{-}Bing Lin},
  title        = {A generalized carrier-null method for conservative parallel simulation},
  booktitle    = {Proceedings of the Eighth Workshop on Parallel and Distributed Simulation,
                  {PADS} 1994, Edinburgh, Scotland, United Kingdom, July 6-8, 1994},
  pages        = {50--57},
  publisher    = {{ACM}},
  year         = {1994},
  url          = {https://doi.org/10.1145/182478.182492},
  doi          = {10.1145/182478.182492},
  timestamp    = {Fri, 05 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pads/WoodT94.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/TurnerNC94,
  author       = {Stephen W. Turner and
                  Lionel M. Ni and
                  Betty H. C. Cheng},
  editor       = {Gary M. Johnson},
  title        = {Time and/or space sharing in a workstation cluster environment},
  booktitle    = {Proceedings Supercomputing '94, Washington, DC, USA, November 14-18,
                  1994},
  pages        = {630--639},
  publisher    = {{IEEE} Computer Society},
  year         = {1994},
  url          = {https://doi.org/10.1109/SUPERC.1994.344327},
  doi          = {10.1109/SUPERC.1994.344327},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sc/TurnerNC94.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/TurnerV94,
  author       = {Stephen W. Turner and
                  Alexander V. Veidenbaum},
  editor       = {Gary M. Johnson},
  title        = {Scalability of the Cedar system},
  booktitle    = {Proceedings Supercomputing '94, Washington, DC, USA, November 14-18,
                  1994},
  pages        = {247--254},
  publisher    = {{IEEE} Computer Society},
  year         = {1994},
  url          = {https://doi.org/10.1109/SUPERC.1994.344284},
  doi          = {10.1109/SUPERC.1994.344284},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sc/TurnerV94.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/WhiteAHKMOOTW93,
  author       = {Stephanie White and
                  Mack W. Alford and
                  Julian Holtzman and
                  C. Stephen Kuehl and
                  Brian McCay and
                  David Oliver and
                  David Owens and
                  Colin Tully and
                  Allan Willey},
  title        = {Systems Engineering of Computer-Based Systems, State of Practice Working
                  Group},
  journal      = {Computer},
  volume       = {26},
  number       = {11},
  pages        = {54--65},
  year         = {1993},
  url          = {http://doi.ieeecomputersociety.org/10.1109/MC.1993.10115},
  doi          = {10.1109/MC.1993.10115},
  timestamp    = {Wed, 12 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/computer/WhiteAHKMOOTW93.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/CaiMT93,
  author       = {Wentong Cai and
                  Wendy J. Milne and
                  Stephen John Turner},
  title        = {Graphical Views of the Behavior of Parallel Programs},
  journal      = {J. Parallel Distributed Comput.},
  volume       = {18},
  number       = {2},
  pages        = {223--230},
  year         = {1993},
  url          = {https://doi.org/10.1006/jpdc.1993.1058},
  doi          = {10.1006/JPDC.1993.1058},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jpdc/CaiMT93.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sp/HamiltonSTVW93,
  author       = {Lisa Hamilton and
                  Mark A. Stalzer and
                  R. Steven Turley and
                  John L. Visher and
                  Stephen M. Wandzura},
  title        = {FastScat\({}^{\mbox{TM}}\): An Object-Oriented Program for Fast Scattering
                  Computation},
  journal      = {Sci. Program.},
  volume       = {2},
  number       = {4},
  pages        = {171--178},
  year         = {1993},
  url          = {https://doi.org/10.1155/1993/213747},
  doi          = {10.1155/1993/213747},
  timestamp    = {Thu, 30 Jul 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sp/HamiltonSTVW93.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ton/GibbensKT93,
  author       = {Richard J. Gibbens and
                  Frank P. Kelly and
                  Stephen R. E. Turner},
  title        = {Dynamic routing in multiparented networks},
  journal      = {{IEEE/ACM} Trans. Netw.},
  volume       = {1},
  number       = {2},
  pages        = {261--270},
  year         = {1993},
  url          = {https://doi.org/10.1109/90.222932},
  doi          = {10.1109/90.222932},
  timestamp    = {Sat, 27 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ton/GibbensKT93.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icci/CzejdoTEL93,
  author       = {Bogdan D. Czejdo and
                  Ralph P. Tucci and
                  David W. Embley and
                  Stephen W. Liddle},
  editor       = {Osman Abou{-}Rabia and
                  Carl K. Chang and
                  Waldemar W. Koczkodaj},
  title        = {Graphical Query Specification with Participation Constraints},
  booktitle    = {Computing and Information - ICCI'93, Fifth International Conference
                  on Computing and Information, Sudbury, Ontario, Canada, May 27-29,
                  1993, Proceedings},
  pages        = {433--437},
  publisher    = {{IEEE} Computer Society},
  year         = {1993},
  timestamp    = {Thu, 21 Mar 2002 14:11:16 +0100},
  biburl       = {https://dblp.org/rec/conf/icci/CzejdoTEL93.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/TurnerNC93,
  author       = {Stephen W. Turner and
                  Lionel M. Ni and
                  Betty H. C. Cheng},
  editor       = {Alok N. Choudhary and
                  P. Bruce Berra},
  title        = {Contention-Free 2D-Mesh Cluster Allocation in Hypercubes},
  booktitle    = {Proceedings of the 1993 International Conference on Parallel Processing,
                  Syracuse University, NY, USA, August 16-20, 1993. Volume {II:} Software},
  pages        = {125--129},
  publisher    = {{CRC} Press},
  year         = {1993},
  url          = {https://doi.org/10.1109/ICPP.1993.64},
  doi          = {10.1109/ICPP.1993.64},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpp/TurnerNC93.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/KuckDLSZVKYGJWBYEPEHJLMAT93,
  author       = {David J. Kuck and
                  Edward S. Davidson and
                  Duncan H. Lawrie and
                  Ahmed H. Sameh and
                  Chuan{-}Qi Zhu and
                  Alexander V. Veidenbaum and
                  Jeff Konicek and
                  Pen{-}Chung Yew and
                  Kyle A. Gallivan and
                  William Jalby and
                  Harry A. G. Wijshoff and
                  Randall Bramley and
                  Ulrike Meier Yang and
                  Perry A. Emrath and
                  David A. Padua and
                  Rudolf Eigenmann and
                  Jay P. Hoeflinger and
                  Greg P. Jaxon and
                  Zhiyuan Li and
                  T. Murphy and
                  John T. Andrews and
                  Stephen W. Turner},
  editor       = {Alan Jay Smith},
  title        = {The Cedar System and an Initial Performance Study},
  booktitle    = {Proceedings of the 20th Annual International Symposium on Computer
                  Architecture, San Diego, CA, USA, May 1993},
  pages        = {213--223},
  publisher    = {{ACM}},
  year         = {1993},
  url          = {https://doi.org/10.1145/165123.165157},
  doi          = {10.1145/165123.165157},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/isca/KuckDLSZVKYGJWBYEPEHJLMAT93.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/WorthingtonT93,
  author       = {Stephen Worthington and
                  Laurence E. Turner},
  title        = {A method of evaluating the effects of signal quantization at arbitrary
                  locations in recursive digital filters},
  booktitle    = {1993 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
                  1993, Chicago, Illinois, USA, May 3-6, 1993},
  pages        = {615--618},
  publisher    = {{IEEE}},
  year         = {1993},
  timestamp    = {Wed, 16 Oct 2019 14:14:49 +0200},
  biburl       = {https://dblp.org/rec/conf/iscas/WorthingtonT93.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/air/Turner92,
  author       = {Stephen John Turner},
  title        = {A concurrent solution to computer security},
  journal      = {Artif. Intell. Rev.},
  volume       = {6},
  number       = {2},
  pages        = {191--201},
  year         = {1992},
  url          = {https://doi.org/10.1007/BF00150233},
  doi          = {10.1007/BF00150233},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/air/Turner92.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccd/WhiteAMOTHKOW92,
  author       = {Stephanie White and
                  Mack W. Alford and
                  Brian McCay and
                  David Oliver and
                  Colin Tully and
                  Julian Holtzman and
                  C. Stephen Kuehl and
                  David Owens and
                  Allan Willey},
  title        = {Trends in Computer-Based Systems Engineering},
  booktitle    = {Proceedings 1992 {IEEE} International Conference on Computer Design:
                  {VLSI} in Computer {\&} Processors, {ICCD} '92, Cambridge, MA,
                  USA, October 11-14, 1992},
  pages        = {12--15},
  publisher    = {{IEEE} Computer Society},
  year         = {1992},
  url          = {https://doi.org/10.1109/ICCD.1992.276215},
  doi          = {10.1109/ICCD.1992.276215},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccd/WhiteAMOTHKOW92.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mam/Turner91,
  author       = {Stephen Turner},
  title        = {Introduction to image processing with the {A100}},
  journal      = {Microprocess. Microsystems},
  volume       = {15},
  number       = {4},
  pages        = {219--229},
  year         = {1991},
  url          = {https://doi.org/10.1016/0141-9331(91)90121-U},
  doi          = {10.1016/0141-9331(91)90121-U},
  timestamp    = {Tue, 25 May 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/mam/Turner91.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/FeldmannNDR91,
  author       = {Peter Feldmann and
                  Tuyen V. Nguyen and
                  Stephen W. Director and
                  Ronald A. Rohrer},
  title        = {Sensitivity computation in piecewise approximate circuit simulation},
  journal      = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
  volume       = {10},
  number       = {2},
  pages        = {171--183},
  year         = {1991},
  url          = {https://doi.org/10.1109/43.68404},
  doi          = {10.1109/43.68404},
  timestamp    = {Thu, 24 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcad/FeldmannNDR91.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/GallivanJTVW91,
  author       = {Kyle A. Gallivan and
                  William Jalby and
                  Stephen W. Turner and
                  Alexander V. Veidenbaum and
                  Harry A. G. Wijshoff},
  title        = {Preliminary Performance Analysis of the Cedar Multiprocessor Memory
                  System},
  booktitle    = {Proceedings of the International Conference on Parallel Processing,
                  {ICPP} '91, Austin, Texas, USA, August 1991. Volume {I:} Architecture/Hardware},
  pages        = {71--75},
  publisher    = {{CRC} Press},
  year         = {1991},
  timestamp    = {Tue, 09 Jan 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpp/GallivanJTVW91.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/KonicekTVZDDHSYFKLLPABMTW91,
  author       = {Jeff Konicek and
                  Tracy Tilton and
                  Alexander V. Veidenbaum and
                  Chuan{-}Qi Zhu and
                  Edward S. Davidson and
                  Ruppert A. Downing and
                  Michael J. Haney and
                  Manish Sharma and
                  Pen{-}Chung Yew and
                  P. Michael Farmwald and
                  David J. Kuck and
                  Daniel M. Lavery and
                  Robert A. Lindsey and
                  D. Pointer and
                  John T. Andrews and
                  Thomas Beck and
                  T. Murphy and
                  Stephen W. Turner and
                  Nancy J. Warter},
  title        = {The Organization of the Cedar System},
  booktitle    = {Proceedings of the International Conference on Parallel Processing,
                  {ICPP} '91, Austin, Texas, USA, August 1991. Volume {I:} Architecture/Hardware},
  pages        = {49--56},
  publisher    = {{CRC} Press},
  year         = {1991},
  timestamp    = {Mon, 28 Jul 2014 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icpp/KonicekTVZDDHSYFKLLPABMTW91.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mie/FraserT91,
  author       = {Robert B. Fraser and
                  Stephen Z. Turney},
  editor       = {Klaus{-}Peter Adlassnig and
                  Georg Grabner and
                  Stellan Bengtsson and
                  Rolf Hansen},
  title        = {A Bayesian Approach to the Detection of Acute Disorders in a Respiratory
                  Intensive Care Unit},
  booktitle    = {Medical Informatics Europe 1991, Proceedings, Vienna, Austria, August
                  19-22, 1991},
  series       = {Lecture Notes in Medical Informatics},
  volume       = {45},
  pages        = {265--269},
  publisher    = {Springer},
  year         = {1991},
  url          = {https://doi.org/10.1007/978-3-642-93503-9\_47},
  doi          = {10.1007/978-3-642-93503-9\_47},
  timestamp    = {Wed, 31 May 2017 13:20:44 +0200},
  biburl       = {https://dblp.org/rec/conf/mie/FraserT91.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mie/FraserWDTCRE91,
  author       = {Robert B. Fraser and
                  Aizik Wolf and
                  C. Michael Dunham and
                  Stephen Z. Turney and
                  Brad M. Cushing and
                  Ameen I. Ramzy and
                  James N. Eastham},
  editor       = {Klaus{-}Peter Adlassnig and
                  Georg Grabner and
                  Stellan Bengtsson and
                  Rolf Hansen},
  title        = {An Expert System for the Diagnosis, Treatment, and Triage of Head
                  Injuries in Remote Environments},
  booktitle    = {Medical Informatics Europe 1991, Proceedings, Vienna, Austria, August
                  19-22, 1991},
  series       = {Lecture Notes in Medical Informatics},
  volume       = {45},
  pages        = {275--279},
  publisher    = {Springer},
  year         = {1991},
  url          = {https://doi.org/10.1007/978-3-642-93503-9\_49},
  doi          = {10.1007/978-3-642-93503-9\_49},
  timestamp    = {Wed, 31 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/mie/FraserWDTCRE91.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/MarksteinMNP91,
  author       = {Victoria Markstein and
                  Peter W. Markstein and
                  Tung Nguyen and
                  Steve Poole},
  editor       = {Joanne L. Martin},
  title        = {Wide format floating-point math libraries},
  booktitle    = {Proceedings Supercomputing '91, Albuquerque, NM, USA, November 18-22,
                  1991},
  pages        = {130--138},
  publisher    = {{ACM}},
  year         = {1991},
  url          = {https://doi.org/10.1145/125826.125903},
  doi          = {10.1145/125826.125903},
  timestamp    = {Fri, 10 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sc/MarksteinMNP91.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigada/BrosgolFGMRT91,
  author       = {Ben Brosgol and
                  Stephen Faris and
                  Marc H. Graham and
                  James W. Moore and
                  Jean{-}Pierre Rosen and
                  S. Tucker Taft},
  editor       = {Judy Bamberger},
  title        = {Ada and {SQL}},
  booktitle    = {Proceedings of the Conference on TRI-Ada 1991 - Today's Accomplishments;
                  Tomorrow's Expectations, TRI-Ada 1991, San Jose, California, USA,
                  October 21-25, 1991},
  pages        = {257--266},
  publisher    = {{ACM}},
  year         = {1991},
  url          = {https://doi.org/10.1145/126551.126578},
  doi          = {10.1145/126551.126578},
  timestamp    = {Mon, 09 May 2022 14:25:34 +0200},
  biburl       = {https://dblp.org/rec/conf/sigada/BrosgolFGMRT91.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:tr/tum/TUM-I-9014,
  author       = {Stephen L. Bloom and
                  Zolt{\'{a}}n {\'{E}}sik and
                  Dirk Taubner},
  title        = {Iteration theories of synchronization trees},
  journal      = {Forschungsberichte, {TU} Munich},
  volume       = {{TUM} {I} 9014},
  pages        = {1--60},
  year         = {1990},
  url          = {https://d-nb.info/901424242},
  timestamp    = {Sun, 10 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/tr/tum/TUM-I-9014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:tr/tum/TUM-I-9034,
  author       = {Stephen F. McCormick and
                  Ulrich R{\"{u}}de},
  title        = {On local refinement higher order methods for elliptic partial differential
                  equations},
  journal      = {Forschungsberichte, {TU} Munich},
  volume       = {{TUM} {I} 9034},
  pages        = {1--22},
  year         = {1990},
  url          = {https://d-nb.info/910513376},
  timestamp    = {Sun, 10 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/tr/tum/TUM-I-9034.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/FloydTD89,
  author       = {Stephen A. Floyd and
                  Charles F. Turner III and
                  K. Roscoe Davis},
  title        = {Model-based decision support systems: An effective implementation
                  framework},
  journal      = {Comput. Oper. Res.},
  volume       = {16},
  number       = {5},
  pages        = {481--491},
  year         = {1989},
  url          = {https://doi.org/10.1016/0305-0548(89)90035-X},
  doi          = {10.1016/0305-0548(89)90035-X},
  timestamp    = {Tue, 18 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cor/FloydTD89.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccad/NguyenFDR89,
  author       = {Tuyen V. Nguyen and
                  Peter Feldmann and
                  Stephen W. Director and
                  Ronald A. Rohrer},
  title        = {{SPECS} simulation validation with efficient transient sensitivity
                  computation},
  booktitle    = {1989 {IEEE} International Conference on Computer-Aided Design, {ICCAD}
                  1989, Santa Clara, CA, USA, November 5-9, 1989. Digest of Technical
                  Papers},
  pages        = {252--255},
  publisher    = {{IEEE} Computer Society},
  year         = {1989},
  url          = {https://doi.org/10.1109/ICCAD.1989.76947},
  doi          = {10.1109/ICCAD.1989.76947},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccad/NguyenFDR89.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/TanPTH88,
  author       = {Robert K.{-}Z. Tan and
                  M. Prabhakaran and
                  C. S. Tung and
                  Stephen C. Harvey},
  title        = {{AUGUR:} a program to predict, display and analyze the tertiary structure
                  of {B-DNA}},
  journal      = {Comput. Appl. Biosci.},
  volume       = {4},
  number       = {1},
  pages        = {147--151},
  year         = {1988},
  url          = {https://doi.org/10.1093/bioinformatics/4.1.147},
  doi          = {10.1093/BIOINFORMATICS/4.1.147},
  timestamp    = {Tue, 01 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/bioinformatics/TanPTH88.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ics/TezduyarGLNP88,
  author       = {T. E. Tezduyar and
                  Roland Glowinski and
                  J. Liou and
                  Tung Nguyen and
                  Steve Poole},
  editor       = {Jacques Lenfant},
  title        = {Block-iterative finite element computations for incompressible flow
                  problems},
  booktitle    = {Proceedings of the 2nd international conference on Supercomputing,
                  {ICS} 1988, Saint Malo, France, July 4-8, 1988},
  pages        = {284--294},
  publisher    = {{ACM}},
  year         = {1988},
  url          = {https://doi.org/10.1145/55364.55392},
  doi          = {10.1145/55364.55392},
  timestamp    = {Fri, 10 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ics/TezduyarGLNP88.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ics/TurnerV88,
  author       = {Stephen W. Turner and
                  Alexander V. Veidenbaum},
  editor       = {Jacques Lenfant},
  title        = {Performance of a shared memory system for vector multiprocessors},
  booktitle    = {Proceedings of the 2nd international conference on Supercomputing,
                  {ICS} 1988, Saint Malo, France, July 4-8, 1988},
  pages        = {315--325},
  publisher    = {{ACM}},
  year         = {1988},
  url          = {https://doi.org/10.1145/55364.55395},
  doi          = {10.1145/55364.55395},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ics/TurnerV88.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/air/RossDMBKTMSAMa87,
  author       = {Simon Ross and
                  Tony Dodd and
                  Wendy J. Milne and
                  Mervyn Bennun and
                  Elpida T. Keravnou and
                  Stephen John Turner and
                  Stephen J. Maskell and
                  Kathryn Seifert and
                  Chris Alphey and
                  Yasmin Merali and
                  Jason Cooper and
                  Saad A. Mehdi},
  title        = {Book reviews},
  journal      = {Artif. Intell. Rev.},
  volume       = {1},
  number       = {4},
  pages        = {275--295},
  year         = {1987},
  url          = {https://doi.org/10.1007/BF00142927},
  doi          = {10.1007/BF00142927},
  timestamp    = {Wed, 24 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/air/RossDMBKTMSAMa87.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/MaloneGTBC87,
  author       = {Thomas W. Malone and
                  Kenneth R. Grant and
                  Franklyn A. Turbak and
                  Stephen A. Brobst and
                  Michael D. Cohen},
  title        = {Intelligent Information-Sharing Systems},
  journal      = {Commun. {ACM}},
  volume       = {30},
  number       = {5},
  pages        = {390--402},
  year         = {1987},
  url          = {https://doi.org/10.1145/22899.22903},
  doi          = {10.1145/22899.22903},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cacm/MaloneGTBC87.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/TungH86,
  author       = {C. S. Tung and
                  Stephen C. Harvey},
  title        = {Computer graphics program to reveal the dependence of the gross three-
                  dimensional structure of the {B-DNA} double helix on primary structure},
  journal      = {Nucleic Acids Res.},
  volume       = {14},
  number       = {1},
  pages        = {381--387},
  year         = {1986},
  url          = {https://doi.org/10.1093/nar/14.1.381},
  doi          = {10.1093/NAR/14.1.381},
  timestamp    = {Sun, 17 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nar/TungH86.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spe/HortonT86,
  author       = {I. A. Horton and
                  Stephen John Turner},
  title        = {Using Coroutines in Pascal},
  journal      = {Softw. Pract. Exp.},
  volume       = {16},
  number       = {1},
  pages        = {45--61},
  year         = {1986},
  url          = {https://doi.org/10.1002/spe.4380160105},
  doi          = {10.1002/SPE.4380160105},
  timestamp    = {Fri, 05 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/spe/HortonT86.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/TurnerO84,
  author       = {Stephen J. Turner and
                  Gregory O'Brien},
  title        = {A fuzzy set theory approach to periodical binding decisions},
  journal      = {J. Am. Soc. Inf. Sci.},
  volume       = {35},
  number       = {4},
  pages        = {228--234},
  year         = {1984},
  url          = {https://doi.org/10.1002/asi.4630350406},
  doi          = {10.1002/ASI.4630350406},
  timestamp    = {Wed, 13 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jasis/TurnerO84.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/MaibaumT84,
  author       = {T. S. E. Maibaum and
                  Wladyslaw M. Turski},
  editor       = {Terry A. Straeter and
                  William E. Howden and
                  Jean{-}Claude Rault},
  title        = {On What Exactly Is Going On When Software Is Developed Step-by-Step},
  booktitle    = {Proceedings, 7th International Conference on Software Engineering,
                  Orlando, Florida, USA, March 26-29, 1984},
  pages        = {528--533},
  publisher    = {{IEEE} Computer Society},
  year         = {1984},
  url          = {http://dl.acm.org/citation.cfm?id=802014},
  timestamp    = {Mon, 14 May 2012 18:17:12 +0200},
  biburl       = {https://dblp.org/rec/conf/icse/MaibaumT84.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/eh/campbell84/Turner84,
  author       = {Stephen John Turner},
  editor       = {John A. Campbell},
  title        = {W-Grammars for Logic Programming},
  booktitle    = {Implementations of Prolog.},
  pages        = {352--368},
  publisher    = {Ellis Horwood/Halsted Press/Wiley},
  year         = {1984},
  timestamp    = {Mon, 05 Aug 2019 16:47:22 +0200},
  biburl       = {https://dblp.org/rec/books/eh/campbell84/Turner84.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/RobinsonT81,
  author       = {Earl J. Robinson and
                  Stephen J. Turner},
  title        = {Improving library effectiveness: {A} proposal for applying fuzzy set
                  concepts in the management of large collections},
  journal      = {J. Am. Soc. Inf. Sci.},
  volume       = {32},
  number       = {6},
  pages        = {458--462},
  year         = {1981},
  url          = {https://doi.org/10.1002/asi.4630320610},
  doi          = {10.1002/ASI.4630320610},
  timestamp    = {Wed, 13 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jasis/RobinsonT81.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/TrueswellT79,
  author       = {Richard W. Trueswell and
                  Stephen J. Turner},
  title        = {Simulating circulation-use characteristic curves using circulation
                  data},
  journal      = {J. Am. Soc. Inf. Sci.},
  volume       = {30},
  number       = {2},
  pages        = {83--87},
  year         = {1979},
  url          = {https://doi.org/10.1002/asi.4630300204},
  doi          = {10.1002/ASI.4630300204},
  timestamp    = {Wed, 13 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jasis/TrueswellT79.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmsj/EhrsamMMT78,
  author       = {William R. Ehrsam and
                  Stephen M. Matyas and
                  Carl H. Meyer and
                  Walter L. Tuchman},
  title        = {A Cryptographic Key Management Scheme for Implementing the Data Encryption
                  Standard},
  journal      = {{IBM} Syst. J.},
  volume       = {17},
  number       = {2},
  pages        = {106--125},
  year         = {1978},
  url          = {https://doi.org/10.1147/sj.172.0106},
  doi          = {10.1147/SJ.172.0106},
  timestamp    = {Fri, 13 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ibmsj/EhrsamMMT78.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/Turner77,
  author       = {Stephen J. Turner},
  title        = {The identifier method of measuring use as applied to modeling the
                  circulation use of books from a university library},
  journal      = {J. Am. Soc. Inf. Sci.},
  volume       = {28},
  number       = {2},
  pages        = {96--100},
  year         = {1977},
  url          = {https://doi.org/10.1002/asi.4630280206},
  doi          = {10.1002/ASI.4630280206},
  timestamp    = {Wed, 13 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jasis/Turner77.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/TuftsLR76,
  author       = {Donald W. Tufts and
                  Stephen E. Levinson and
                  R. Rao},
  title        = {Measuring pitch and formant frequencies for a speech understanding
                  system},
  booktitle    = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
                  {ICASSP} '76, Philadelphia, Pennsylvania, USA, April 12-14, 1976},
  pages        = {314--317},
  publisher    = {{IEEE}},
  year         = {1976},
  url          = {https://doi.org/10.1109/ICASSP.1976.1169986},
  doi          = {10.1109/ICASSP.1976.1169986},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/TuftsLR76.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/afips/MathisCDMWFHHTW74,
  author       = {Robert F. Mathis and
                  Stephen R. Crocker and
                  Marvin Denicoff and
                  Victor Mitchell and
                  Frederick W. Weingarten and
                  Edward A. Feustel and
                  Lance J. Hoffman and
                  David K. Hsiao and
                  Rein Turn and
                  William A. Wulf},
  title        = {Research in data security: policies and projects},
  booktitle    = {American Federation of Information Processing Societies: 1974 National
                  Computer Conference, 6-10 May 1974, Chicago, Illinois, {USA}},
  series       = {{AFIPS} Conference Proceedings},
  volume       = {43},
  pages        = {993--999},
  publisher    = {{AFIPS} Press},
  year         = {1974},
  url          = {https://doi.org/10.1145/1500175.1500368},
  doi          = {10.1145/1500175.1500368},
  timestamp    = {Wed, 14 Apr 2021 16:50:07 +0200},
  biburl       = {https://dblp.org/rec/conf/afips/MathisCDMWFHHTW74.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}