default search action
Search dblp for Publications
export results for "Stephen Tu"
@article{DBLP:journals/compsec/TuptukH24, author = {Nilufer Tuptuk and Stephen Hailes}, title = {Identifying vulnerabilities of industrial control systems using evolutionary multiobjective optimisation}, journal = {Comput. Secur.}, volume = {137}, pages = {103593}, year = {2024}, url = {https://doi.org/10.1016/j.cose.2023.103593}, doi = {10.1016/J.COSE.2023.103593}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/compsec/TuptukH24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fcomp/TurnerMU24, author = {Adam Brian Turner and Stephen James McCombie and Allon J. Uhlmann}, title = {Editorial: The impacts of cyber threat in the maritime ecosystem}, journal = {Frontiers Comput. Sci.}, volume = {6}, year = {2024}, url = {https://doi.org/10.3389/fcomp.2024.1378160}, doi = {10.3389/FCOMP.2024.1378160}, timestamp = {Mon, 08 Jul 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/fcomp/TurnerMU24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jmlr/TuFS24, author = {Stephen Tu and Roy Frostig and Mahdi Soltanolkotabi}, title = {Learning from many trajectories}, journal = {J. Mach. Learn. Res.}, volume = {25}, pages = {216:1--216:109}, year = {2024}, url = {https://jmlr.org/papers/v25/23-1145.html}, timestamp = {Mon, 16 Sep 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jmlr/TuFS24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jors/PetropoulosLAAAABBBBBCCCCCCDDDEEEF24, author = {Fotios Petropoulos and Gilbert Laporte and Emel Aktas and Sibel A. Alumur and Claudia Archetti and Hayriye Ayhan and Maria Battarra and Julia A. Bennell and Jean{-}Marie Bourjolly and John E. Boylan and Mich{\`{e}}le Breton and David Canca and Laurent Charlin and Bo Chen and Cihan Tugrul Cicek and Louis Anthony Cox and Christine S. M. Currie and Erik Demeulemeester and Li Ding and Stephen M. Disney and Matthias Ehrgott and Martin J. Eppler and G{\"{u}}nes Erdogan and Bernard Fortz and L. Alberto Franco and Jens Frische and Salvatore Greco and Amanda J. Gregory and Raimo P. H{\"{a}}m{\"{a}}l{\"{a}}inen and Willy Herroelen and Mike Hewitt and Jan Holmstr{\"{o}}m and John N. Hooker and Tug{\c{c}}e Isik and Jill Johnes and Bahar Yetis Kara and {\"{O}}zlem Karsu and Katherine Kent and Charlotte K{\"{o}}hler and Martin H. Kunc and Yong{-}Hong Kuo and Adam N. Letchford and Janny Leung and Dong Li and Haitao Li and Judit Lienert and Ivana Ljubic and Andrea Lodi and Sebasti{\'{a}}n Lozano and Virginie Lurkin and Silvano Martello and Ian G. McHale and Gerald Midgley and John D. W. Morecroft and Akshay Mutha and Ceyda Oguz and Sanja Petrovic and Ulrich Pferschy and Harilaos N. Psaraftis and Sam Rose and Lauri Saarinen and Sa{\"{\i}}d Salhi and Jing{-}Sheng Song and Dimitrios Sotiros and Kathryn E. Stecke and Arne K. Strauss and Isten{\c{c}} Tarhan and Clemens Thielen and Paolo Toth and Tom Van Woensel and Greet Vanden Berghe and Christos Vasilakis and Vikrant Vaze and Daniele Vigo and Kai Virtanen and Xun Wang and Rafal Weron and Leroy White and Mike Yearworth and E. Alper Yildirim and Georges Zaccour and Xuying Zhao}, title = {Operational Research: methods and applications}, journal = {J. Oper. Res. Soc.}, volume = {75}, number = {3}, pages = {423--617}, year = {2024}, url = {https://doi.org/10.1080/01605682.2023.2253852}, doi = {10.1080/01605682.2023.2253852}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jors/PetropoulosLAAAABBBBBCCCCCCDDDEEEF24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jssc/NishiPTCSZTNWDG24, author = {Yoshinori Nishi and John W. Poulton and Walker J. Turner and Xi Chen and Sanquan Song and Brian Zimmer and Stephen G. Tell and Nikola Nedovic and John M. Wilson and William J. Dally and C. Thomas Gray}, title = {A 0.190-pJ/bit 25.2-Gb/s/wire Inverter-Based AC-Coupled Transceiver for Short-Reach Die-to-Die Interfaces in 5-nm {CMOS}}, journal = {{IEEE} J. Solid State Circuits}, volume = {59}, number = {4}, pages = {1146--1157}, year = {2024}, url = {https://doi.org/10.1109/JSSC.2023.3338478}, doi = {10.1109/JSSC.2023.3338478}, timestamp = {Mon, 15 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jssc/NishiPTCSZTNWDG24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/qmi/TullSZC24, author = {Sean Tull and Razin A. Shaikh and Sara Sabrina Zemljic and Stephen Clark}, title = {From conceptual spaces to quantum concepts: formalising and learning structured conceptual models}, journal = {Quantum Mach. Intell.}, volume = {6}, number = {1}, pages = {21}, year = {2024}, url = {https://doi.org/10.1007/s42484-023-00134-z}, doi = {10.1007/S42484-023-00134-Z}, timestamp = {Mon, 29 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/qmi/TullSZC24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbe/BelyaevaGWWCSA24, author = {Irina Belyaeva and Ben Gabrielson and Yu{-}Ping Wang and Tony W. Wilson and Vince D. Calhoun and Julia M. Stephen and T{\"{u}}lay Adali}, title = {Learning Spatiotemporal Brain Dynamics in Adolescents via Multimodal {MEG} and fMRI Data Fusion Using Joint Tensor/Matrix Decomposition}, journal = {{IEEE} Trans. Biomed. Eng.}, volume = {71}, number = {7}, pages = {2189--2200}, year = {2024}, url = {https://doi.org/10.1109/TBME.2024.3364704}, doi = {10.1109/TBME.2024.3364704}, timestamp = {Fri, 02 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tbe/BelyaevaGWWCSA24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/DrummondTD24, author = {Ross Drummond and Matthew C. Turner and Stephen R. Duncan}, title = {Reduced-Order Neural Network Synthesis With Robustness Guarantees}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {35}, number = {1}, pages = {1182--1191}, year = {2024}, url = {https://doi.org/10.1109/TNNLS.2022.3182893}, doi = {10.1109/TNNLS.2022.3182893}, timestamp = {Fri, 26 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnn/DrummondTD24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tvt/AiZKXNT24, author = {Zhengyang Ai and Weiting Zhang and Jiawen Kang and Minrui Xu and Dusit Niyato and Stephen John Turner}, title = {Identifier-Driven Resource Orchestration With Quantum Computing for Differentiated Services in IoT-MMEC Networks}, journal = {{IEEE} Trans. Veh. Technol.}, volume = {73}, number = {7}, pages = {9958--9971}, year = {2024}, url = {https://doi.org/10.1109/TVT.2024.3364210}, doi = {10.1109/TVT.2024.3364210}, timestamp = {Thu, 22 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tvt/AiZKXNT24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/CurryTCMKSHS24, author = {Michael J. Curry and Vinzenz Thoma and Darshan Chakrabarti and Stephen McAleer and Christian Kroer and Tuomas Sandholm and Niao He and Sven Seuken}, editor = {Michael J. Wooldridge and Jennifer G. Dy and Sriraam Natarajan}, title = {Automated Design of Affine Maximizer Mechanisms in Dynamic Settings}, booktitle = {Thirty-Eighth {AAAI} Conference on Artificial Intelligence, {AAAI} 2024, Thirty-Sixth Conference on Innovative Applications of Artificial Intelligence, {IAAI} 2024, Fourteenth Symposium on Educational Advances in Artificial Intelligence, {EAAI} 2014, February 20-27, 2024, Vancouver, Canada}, pages = {9626--9635}, publisher = {{AAAI} Press}, year = {2024}, url = {https://doi.org/10.1609/aaai.v38i9.28819}, doi = {10.1609/AAAI.V38I9.28819}, timestamp = {Tue, 02 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aaai/CurryTCMKSHS24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eucnc/FayeCSSFBCDFFKMMPPST24, author = {S{\'{e}}bastien Faye and Miguel Camelo and Jean{-}S{\'{e}}bastien Sottet and Christoph Sommer and Mario Franke and Julien Baudouin and German Castellanos and R{\'{e}}gis Decorme and Maria Pia Fanti and Ramin Fuladi and Gunes Kesik and Beatriz Mendes and Chris Murphy and Stephen Parker and Simon Pryor and Sidi Mohammed Senouci and Ion Turcanu}, title = {Integrating Network Digital Twinning into Future AI-based 6G Systems: The 6G-TWIN Vision}, booktitle = {Joint European Conference on Networks and Communications {\&} 6G Summit, EuCNC/6G Summit 2024, Antwerp, Belgium, June 3-6, 2024}, pages = {883--888}, publisher = {{IEEE}}, year = {2024}, url = {https://doi.org/10.1109/EuCNC/6GSummit60053.2024.10597058}, doi = {10.1109/EUCNC/6GSUMMIT60053.2024.10597058}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eucnc/FayeCSSFBCDFFKMMPPST24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eusipco/Belyaeva0WCSA24, author = {Irina Belyaeva and Yu{-}Ping Wang and Tony W. Wilson and Vince D. Calhoun and Julia M. Stephen and T{\"{u}}lay Adali}, title = {Assessing Pediatric Cognitive Development via Multisensory Brain Imaging Analysis}, booktitle = {32nd European Signal Processing Conference, {EUSIPCO} 2024, Lyon, France, August 26-30, 2024}, pages = {1362--1366}, publisher = {{IEEE}}, year = {2024}, url = {https://ieeexplore.ieee.org/document/10714926}, timestamp = {Wed, 06 Nov 2024 15:31:16 +0100}, biburl = {https://dblp.org/rec/conf/eusipco/Belyaeva0WCSA24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hicss/EloLTV24, author = {Jenny Elo and Juuli Lumivalo and Tuure Tuunanen and Stephen L. Vargo}, editor = {Tung X. Bui}, title = {Enabling Value Co-Creation in Partner Collaboration Ecosystems: An Institutional Work Perspective}, booktitle = {57th Hawaii International Conference on System Sciences, {HICSS} 2024, Hilton Hawaiian Village Waikiki Beach Resort, Hawaii, USA, January 3-6, 2024}, pages = {308--317}, publisher = {ScholarSpace}, year = {2024}, url = {https://hdl.handle.net/10125/106412}, timestamp = {Thu, 04 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/hicss/EloLTV24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hri/JansenMHTYBWL24, author = {Chipp Jansen and Zhengtao Ma and Lissy Hatfield and Boyuan Tuo and Elif Ozden Yenigun and Sharon Baurley and Stephen Jia Wang and Kun{-}Pyo Lee}, editor = {Dan Grollman and Elizabeth Broadbent and Wendy Ju and Harold Soh and Tom Williams}, title = {Textile Robotic Interaction for Designer-Robot Collaboration}, booktitle = {Companion of the 2024 {ACM/IEEE} International Conference on Human-Robot Interaction, {HRI} 2024, Boulder, CO, USA, March 11-15, 2024}, pages = {563--567}, publisher = {{ACM}}, year = {2024}, url = {https://doi.org/10.1145/3610978.3640722}, doi = {10.1145/3610978.3640722}, timestamp = {Mon, 01 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/hri/JansenMHTYBWL24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/XieTSELZ24, author = {Rong Xie and Anqi Tu and Chuang Shi and Stephen Elliott and Huiyong Li and Le Zhang}, title = {Cognitive Virtual Sensing Technique for Feedforward Active Noise Control}, booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing, {ICASSP} 2024, Seoul, Republic of Korea, April 14-19, 2024}, pages = {981--985}, publisher = {{IEEE}}, year = {2024}, url = {https://doi.org/10.1109/ICASSP48485.2024.10446463}, doi = {10.1109/ICASSP48485.2024.10446463}, timestamp = {Mon, 05 Aug 2024 15:26:37 +0200}, biburl = {https://dblp.org/rec/conf/icassp/XieTSELZ24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/LiangSZLESHM24, author = {Yongyuan Liang and Yanchao Sun and Ruijie Zheng and Xiangyu Liu and Benjamin Eysenbach and Tuomas Sandholm and Furong Huang and Stephen Marcus McAleer}, title = {Game-Theoretic Robust Reinforcement Learning Handles Temporally-Coupled Perturbations}, booktitle = {The Twelfth International Conference on Learning Representations, {ICLR} 2024, Vienna, Austria, May 7-11, 2024}, publisher = {OpenReview.net}, year = {2024}, url = {https://openreview.net/forum?id=wZWTHU7AsQ}, timestamp = {Wed, 07 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iclr/LiangSZLESHM24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/McAleerLWBSF24, author = {Stephen Marcus McAleer and JB Lanier and Kevin A. Wang and Pierre Baldi and Tuomas Sandholm and Roy Fox}, title = {Toward Optimal Policy Population Growth in Two-Player Zero-Sum Games}, booktitle = {The Twelfth International Conference on Learning Representations, {ICLR} 2024, Vienna, Austria, May 7-11, 2024}, publisher = {OpenReview.net}, year = {2024}, url = {https://openreview.net/forum?id=J2TZgj3Tac}, timestamp = {Wed, 07 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iclr/McAleerLWBSF24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/MoskovitzSSSSDM24, author = {Ted Moskovitz and Aaditya K. Singh and DJ Strouse and Tuomas Sandholm and Ruslan Salakhutdinov and Anca D. Dragan and Stephen Marcus McAleer}, title = {Confronting Reward Model Overoptimization with Constrained {RLHF}}, booktitle = {The Twelfth International Conference on Learning Representations, {ICLR} 2024, Vienna, Austria, May 7-11, 2024}, publisher = {OpenReview.net}, year = {2024}, url = {https://openreview.net/forum?id=gkfUvn0fLU}, timestamp = {Mon, 29 Jul 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iclr/MoskovitzSSSSDM24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/LiPGYBGLDGMHLJL24, author = {Nathaniel Li and Alexander Pan and Anjali Gopal and Summer Yue and Daniel Berrios and Alice Gatti and Justin D. Li and Ann{-}Kathrin Dombrowski and Shashwat Goel and Gabriel Mukobi and Nathan Helm{-}Burger and Rassin Lababidi and Lennart Justen and Andrew B. Liu and Michael Chen and Isabelle Barrass and Oliver Zhang and Xiaoyuan Zhu and Rishub Tamirisa and Bhrugu Bharathi and Ariel Herbert{-}Voss and Cort B. Breuer and Andy Zou and Mantas Mazeika and Zifan Wang and Palash Oswal and Weiran Lin and Adam A. Hunt and Justin Tienken{-}Harder and Kevin Y. Shih and Kemper Talley and John Guan and Ian Steneker and David Campbell and Brad Jokubaitis and Steven Basart and Stephen Fitz and Ponnurangam Kumaraguru and Kallol Krishna Karmakar and Uday Kiran Tupakula and Vijay Varadharajan and Yan Shoshitaishvili and Jimmy Ba and Kevin M. Esvelt and Alexandr Wang and Dan Hendrycks}, title = {The {WMDP} Benchmark: Measuring and Reducing Malicious Use with Unlearning}, booktitle = {Forty-first International Conference on Machine Learning, {ICML} 2024, Vienna, Austria, July 21-27, 2024}, publisher = {OpenReview.net}, year = {2024}, url = {https://openreview.net/forum?id=xlr6AUDuJz}, timestamp = {Mon, 02 Sep 2024 16:45:29 +0200}, biburl = {https://dblp.org/rec/conf/icml/LiPGYBGLDGMHLJL24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/TuDCGG24, author = {Weijie Tu and Weijian Deng and Dylan Campbell and Stephen Gould and Tom Gedeon}, title = {An Empirical Study Into What Matters for Calibrating Vision-Language Models}, booktitle = {Forty-first International Conference on Machine Learning, {ICML} 2024, Vienna, Austria, July 21-27, 2024}, publisher = {OpenReview.net}, year = {2024}, url = {https://openreview.net/forum?id=qoxuPshrZb}, timestamp = {Mon, 02 Sep 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icml/TuDCGG24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/ZiemannTPM24, author = {Ingvar M. Ziemann and Stephen Tu and George J. Pappas and Nikolai Matni}, title = {Sharp Rates in Dependent Learning Theory: Avoiding Sample Size Deflation for the Square Loss}, booktitle = {Forty-first International Conference on Machine Learning, {ICML} 2024, Vienna, Austria, July 21-27, 2024}, publisher = {OpenReview.net}, year = {2024}, url = {https://openreview.net/forum?id=DHtF8Y6PqS}, timestamp = {Mon, 02 Sep 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icml/ZiemannTPM24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/ONeillRMGPLPGMJ24, author = {Abby O'Neill and Abdul Rehman and Abhiram Maddukuri and Abhishek Gupta and Abhishek Padalkar and Abraham Lee and Acorn Pooley and Agrim Gupta and Ajay Mandlekar and Ajinkya Jain and Albert Tung and Alex Bewley and Alexander Herzog and Alex Irpan and Alexander Khazatsky and Anant Rai and Anchit Gupta and Andrew Wang and Anikait Singh and Animesh Garg and Aniruddha Kembhavi and Annie Xie and Anthony Brohan and Antonin Raffin and Archit Sharma and Arefeh Yavary and Arhan Jain and Ashwin Balakrishna and Ayzaan Wahid and Ben Burgess{-}Limerick and Beomjoon Kim and Bernhard Sch{\"{o}}lkopf and Blake Wulfe and Brian Ichter and Cewu Lu and Charles Xu and Charlotte Le and Chelsea Finn and Chen Wang and Chenfeng Xu and Cheng Chi and Chenguang Huang and Christine Chan and Christopher Agia and Chuer Pan and Chuyuan Fu and Coline Devin and Danfei Xu and Daniel Morton and Danny Driess and Daphne Chen and Deepak Pathak and Dhruv Shah and Dieter B{\"{u}}chler and Dinesh Jayaraman and Dmitry Kalashnikov and Dorsa Sadigh and Edward Johns and Ethan Paul Foster and Fangchen Liu and Federico Ceola and Fei Xia and Feiyu Zhao and Freek Stulp and Gaoyue Zhou and Gaurav S. Sukhatme and Gautam Salhotra and Ge Yan and Gilbert Feng and Giulio Schiavi and Glen Berseth and Gregory Kahn and Guanzhi Wang and Hao Su and Haoshu Fang and Haochen Shi and Henghui Bao and Heni Ben Amor and Henrik I. Christensen and Hiroki Furuta and Homer Walke and Hongjie Fang and Huy Ha and Igor Mordatch and Ilija Radosavovic and Isabel Leal and Jacky Liang and Jad Abou{-}Chakra and Jaehyung Kim and Jaimyn Drake and Jan Peters and Jan Schneider and Jasmine Hsu and Jeannette Bohg and Jeffrey Bingham and Jeffrey Wu and Jensen Gao and Jiaheng Hu and Jiajun Wu and Jialin Wu and Jiankai Sun and Jianlan Luo and Jiayuan Gu and Jie Tan and Jihoon Oh and Jimmy Wu and Jingpei Lu and Jingyun Yang and Jitendra Malik and Jo{\~{a}}o Silv{\'{e}}rio and Joey Hejna and Jonathan Booher and Jonathan Tompson and Jonathan Yang and Jordi Salvador and Joseph J. Lim and Junhyek Han and Kaiyuan Wang and Kanishka Rao and Karl Pertsch and Karol Hausman and Keegan Go and Keerthana Gopalakrishnan and Ken Goldberg and Kendra Byrne and Kenneth Oslund and Kento Kawaharazuka and Kevin Black and Kevin Lin and Kevin Zhang and Kiana Ehsani and Kiran Lekkala and Kirsty Ellis and Krishan Rana and Krishnan Srinivasan and Kuan Fang and Kunal Pratap Singh and Kuo{-}Hao Zeng and Kyle Hatch and Kyle Hsu and Laurent Itti and Lawrence Yunliang Chen and Lerrel Pinto and Li Fei{-}Fei and Liam Tan and Linxi Jim Fan and Lionel Ott and Lisa Lee and Luca Weihs and Magnum Chen and Marion Lepert and Marius Memmel and Masayoshi Tomizuka and Masha Itkina and Mateo Guaman Castro and Max Spero and Maximilian Du and Michael Ahn and Michael C. Yip and Mingtong Zhang and Mingyu Ding and Minho Heo and Mohan Kumar Srirama and Mohit Sharma and Moo Jin Kim and Naoaki Kanazawa and Nicklas Hansen and Nicolas Heess and Nikhil J. Joshi and Niko S{\"{u}}nderhauf and Ning Liu and Norman Di Palo and Nur Muhammad (Mahi) Shafiullah and Oier Mees and Oliver Kroemer and Osbert Bastani and Pannag R. Sanketi and Patrick Tree Miller and Patrick Yin and Paul Wohlhart and Peng Xu and Peter David Fagan and Peter Mitrano and Pierre Sermanet and Pieter Abbeel and Priya Sundaresan and Qiuyu Chen and Quan Vuong and Rafael Rafailov and Ran Tian and Ria Doshi and Roberto Mart{\'{\i}}n{-}Mart{\'{\i}}n and Rohan Baijal and Rosario Scalise and Rose Hendrix and Roy Lin and Runjia Qian and Ruohan Zhang and Russell Mendonca and Rutav Shah and Ryan Hoque and Ryan Julian and Samuel Bustamante and Sean Kirmani and Sergey Levine and Shan Lin and Sherry Moore and Shikhar Bahl and Shivin Dass and Shubham D. Sonawani and Shuran Song and Sichun Xu and Siddhant Haldar and Siddharth Karamcheti and Simeon Adebola and Simon Guist and Soroush Nasiriany and Stefan Schaal and Stefan Welker and Stephen Tian and Subramanian Ramamoorthy and Sudeep Dasari and Suneel Belkhale and Sungjae Park and Suraj Nair and Suvir Mirchandani and Takayuki Osa and Tanmay Gupta and Tatsuya Harada and Tatsuya Matsushima and Ted Xiao and Thomas Kollar and Tianhe Yu and Tianli Ding and Todor Davchev and Tony Z. Zhao and Travis Armstrong and Trevor Darrell and Trinity Chung and Vidhi Jain and Vincent Vanhoucke and Wei Zhan and Wenxuan Zhou and Wolfram Burgard and Xi Chen and Xiaolong Wang and Xinghao Zhu and Xinyang Geng and Xiyuan Liu and Liangwei Xu and Xuanlin Li and Yao Lu and Yecheng Jason Ma and Yejin Kim and Yevgen Chebotar and Yifan Zhou and Yifeng Zhu and Yilin Wu and Ying Xu and Yixuan Wang and Yonatan Bisk and Yoonyoung Cho and Youngwoon Lee and Yuchen Cui and Yue Cao and Yueh{-}Hua Wu and Yujin Tang and Yuke Zhu and Yunchu Zhang and Yunfan Jiang and Yunshuang Li and Yunzhu Li and Yusuke Iwasawa and Yutaka Matsuo and Zehan Ma and Zhuo Xu and Zichen Jeff Cui and Zichen Zhang and Zipeng Lin}, title = {Open X-Embodiment: Robotic Learning Datasets and {RT-X} Models : Open X-Embodiment Collaboration}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2024, Yokohama, Japan, May 13-17, 2024}, pages = {6892--6903}, publisher = {{IEEE}}, year = {2024}, url = {https://doi.org/10.1109/ICRA57147.2024.10611477}, doi = {10.1109/ICRA57147.2024.10611477}, timestamp = {Tue, 12 Nov 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icra/ONeillRMGPLPGMJ24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/InceBDFG24, author = {Turker Ince and Steven Beninati and Ozer Can Devecioglu and Stephen J. Frasier and Moncef Gabbouj}, title = {Water Region Segmentation in {SAR} Images Based on Compact Operational Unets}, booktitle = {{IGARSS} 2024 - 2024 {IEEE} International Geoscience and Remote Sensing Symposium, Athens, Greece, July 7-12, 2024}, pages = {8237--8241}, publisher = {{IEEE}}, year = {2024}, url = {https://doi.org/10.1109/IGARSS53475.2024.10641981}, doi = {10.1109/IGARSS53475.2024.10641981}, timestamp = {Thu, 26 Sep 2024 12:36:11 +0200}, biburl = {https://dblp.org/rec/conf/igarss/InceBDFG24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcai/0001ZCDM0SS24, author = {Paul Friedrich and Yulun Zhang and Michael J. Curry and Ludwig Dierks and Stephen McAleer and Jiaoyang Li and Tuomas Sandholm and Sven Seuken}, title = {Scalable Mechanism Design for Multi-Agent Path Finding}, booktitle = {Proceedings of the Thirty-Third International Joint Conference on Artificial Intelligence, {IJCAI} 2024, Jeju, South Korea, August 3-9, 2024}, pages = {58--66}, publisher = {ijcai.org}, year = {2024}, url = {https://www.ijcai.org/proceedings/2024/7}, timestamp = {Fri, 25 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ijcai/0001ZCDM0SS24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/memea/BuchananTCMF24, author = {Russell Buchanan and Shihfan Jack Tu and Marco Camurri and Stephen J. Mellon and Maurice F. Fallon}, title = {3D Freehand Ultrasound using Visual Inertial and Deep Inertial Odometry for Measuring Patellar Tracking}, booktitle = {{IEEE} International Symposium on Medical Measurements and Applications, MeMeA 2024, Eindhoven, The Netherlands, June 26-28, 2024}, pages = {1--6}, publisher = {{IEEE}}, year = {2024}, url = {https://doi.org/10.1109/MeMeA60663.2024.10596905}, doi = {10.1109/MEMEA60663.2024.10596905}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/memea/BuchananTCMF24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mie/TurnerIGBSHHOVK24, author = {Jonathan Turner and Sin{\'{e}}ad Impey and Frances Gibbons and Anthony M. Bolger and Gaye Stephens and Lucy Hederman and Ramisa Hamed and Ciara O'Meara and Ferran de la Varga and John Kommala and Matthew Nicholson and Daniel Farrell and Miriam Galvin and Mark Heverin and {\'{E}}anna Mac Domhnaill and Robert McFarlane and Dara Meldrum and Deirdre Murray and Orla Hardiman}, editor = {John Mantas and Arie Hasman and George Demiris and Kaija Saranto and Michael Marschollek and Theodoros N. Arvanitis and Ivana Ognjanovic and Arriel Benis and Parisis Gallos and Emmanouil Zoulias and Elisavet Andrikopoulou}, title = {Data and Process Harmonisation of Multi-National, Multi-Site Research Data}, booktitle = {Digital Health and Informatics Innovations for Sustainable Health Care Systems - Proceedings of {MIE} 2024, Athens, Greece, 25-29 August 2024}, series = {Studies in Health Technology and Informatics}, volume = {316}, pages = {1411--1412}, publisher = {{IOS} Press}, year = {2024}, url = {https://doi.org/10.3233/SHTI240675}, doi = {10.3233/SHTI240675}, timestamp = {Tue, 15 Oct 2024 14:17:47 +0200}, biburl = {https://dblp.org/rec/conf/mie/TurnerIGBSHHOVK24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigdial/TuPMFCDC24, author = {Sichang Tu and Abigail Powers and Natalie Merrill and Negar Fani and Sierra Carter and Stephen Doogan and Jinho D. Choi}, editor = {Tatsuya Kawahara and Vera Demberg and Stefan Ultes and Koji Inoue and Shikib Mehri and David M. Howcroft and Kazunori Komatani}, title = {Automating {PTSD} Diagnostics in Clinical Interviews: Leveraging Large Language Models for Trauma Assessments}, booktitle = {Proceedings of the 25th Annual Meeting of the Special Interest Group on Discourse and Dialogue, {SIGDIAL} 2024, Kyoto, Japan, September 18 - 20, 2024}, pages = {644--663}, publisher = {Association for Computational Linguistics}, year = {2024}, url = {https://aclanthology.org/2024.sigdial-1.55}, timestamp = {Fri, 04 Oct 2024 16:06:14 +0200}, biburl = {https://dblp.org/rec/conf/sigdial/TuPMFCDC24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/vlsit/VyasMPHKWZDLKMP24, author = {Pratik B. Vyas and Ludovico Megalini and Ashish Pal and Joshua Holt and Archana Kumar and Stephen Weeks and Charisse Zhao and Lucien Date and Hansel Lo and Michel Khoury and Safdar Muhammad and Fabian Piallat and Ricky Fang and William Charles and Pratim Palit and Jinghe Yang and Qintao Zhang and Jang Seok Oh and Bryan Turner and Samphy Hong and Aswin Prathap Pitchiya and Benjamin Briggs and Jiao Yang and Dae Yang and Fengshou Wang and Joseph Lee and Gopal Prabhu and Dustin Ho and Carlos Caballero and Durga Chaturvedula and Zheng Yuan and Yi Zheng and David A. Britz and Stephen Krause and Raghav Sreenivasan and Michael Chudzik and Subi Kengeri and Siddarth A. Krishnan and El Mehdi Bazizi}, title = {Novel Material, Process and Device Innovations for Next Generation Silicon Carbide (SiC) Trench {MOSFET} Technology}, booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits 2024, Honolulu, HI, USA, June 16-20, 2024}, pages = {1--2}, publisher = {{IEEE}}, year = {2024}, url = {https://doi.org/10.1109/VLSITechnologyandCir46783.2024.10631445}, doi = {10.1109/VLSITECHNOLOGYANDCIR46783.2024.10631445}, timestamp = {Fri, 18 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/vlsit/VyasMPHKWZDLKMP24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/vtc/VuGHCI24, author = {Tung T. Vu and Swaroop Gopalam and Stephen V. Hanly and Iain B. Collings and Hazer Inaltekin}, title = {Minimizing Clearing Time in mmWave Networks with Overlapping Coverage}, booktitle = {99th {IEEE} Vehicular Technology Conference, {VTC} Spring 2024, Singapore, June 24-27, 2024}, pages = {1--6}, publisher = {{IEEE}}, year = {2024}, url = {https://doi.org/10.1109/VTC2024-Spring62846.2024.10683319}, doi = {10.1109/VTC2024-SPRING62846.2024.10683319}, timestamp = {Mon, 07 Oct 2024 22:58:56 +0200}, biburl = {https://dblp.org/rec/conf/vtc/VuGHCI24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2401-08585, author = {Sean Tull and Razin A. Shaikh and Sara Sabrina Zemljic and Stephen Clark}, title = {From Conceptual Spaces to Quantum Concepts: Formalising and Learning Structured Conceptual Models}, journal = {CoRR}, volume = {abs/2401.08585}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2401.08585}, doi = {10.48550/ARXIV.2401.08585}, eprinttype = {arXiv}, eprint = {2401.08585}, timestamp = {Wed, 07 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2401-08585.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2401-17044, author = {Paul Friedrich and Yulun Zhang and Michael J. Curry and Ludwig Dierks and Stephen McAleer and Jiaoyang Li and Tuomas Sandholm and Sven Seuken}, title = {Scalable Mechanism Design for Multi-Agent Path Finding}, journal = {CoRR}, volume = {abs/2401.17044}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2401.17044}, doi = {10.48550/ARXIV.2401.17044}, eprinttype = {arXiv}, eprint = {2401.17044}, timestamp = {Fri, 25 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2401-17044.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2402-05928, author = {Ingvar M. Ziemann and Stephen Tu and George J. Pappas and Nikolai Matni}, title = {Sharp Rates in Dependent Learning Theory: Avoiding Sample Size Deflation for the Square Loss}, journal = {CoRR}, volume = {abs/2402.05928}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2402.05928}, doi = {10.48550/ARXIV.2402.05928}, eprinttype = {arXiv}, eprint = {2402.05928}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2402-05928.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2402-07417, author = {Weijie Tu and Weijian Deng and Dylan Campbell and Stephen Gould and Tom Gedeon}, title = {An Empirical Study Into What Matters for Calibrating Vision-Language Models}, journal = {CoRR}, volume = {abs/2402.07417}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2402.07417}, doi = {10.48550/ARXIV.2402.07417}, eprinttype = {arXiv}, eprint = {2402.07417}, timestamp = {Fri, 16 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2402-07417.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2402-08129, author = {Michael J. Curry and Vinzenz Thoma and Darshan Chakrabarti and Stephen McAleer and Christian Kroer and Tuomas Sandholm and Niao He and Sven Seuken}, title = {Automated Design of Affine Maximizer Mechanisms in Dynamic Settings}, journal = {CoRR}, volume = {abs/2402.08129}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2402.08129}, doi = {10.48550/ARXIV.2402.08129}, eprinttype = {arXiv}, eprint = {2402.08129}, timestamp = {Mon, 19 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2402-08129.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2403-03218, author = {Nathaniel Li and Alexander Pan and Anjali Gopal and Summer Yue and Daniel Berrios and Alice Gatti and Justin D. Li and Ann{-}Kathrin Dombrowski and Shashwat Goel and Long Phan and Gabriel Mukobi and Nathan Helm{-}Burger and Rassin Lababidi and Lennart Justen and Andrew B. Liu and Michael Chen and Isabelle Barrass and Oliver Zhang and Xiaoyuan Zhu and Rishub Tamirisa and Bhrugu Bharathi and Adam Khoja and Zhenqi Zhao and Ariel Herbert{-}Voss and Cort B. Breuer and Andy Zou and Mantas Mazeika and Zifan Wang and Palash Oswal and Weiran Liu and Adam A. Hunt and Justin Tienken{-}Harder and Kevin Y. Shih and Kemper Talley and John Guan and Russell Kaplan and Ian Steneker and David Campbell and Brad Jokubaitis and Alex Levinson and Jean Wang and William Qian and Kallol Krishna Karmakar and Steven Basart and Stephen Fitz and Mindy Levine and Ponnurangam Kumaraguru and Uday Kiran Tupakula and Vijay Varadharajan and Yan Shoshitaishvili and Jimmy Ba and Kevin M. Esvelt and Alexandr Wang and Dan Hendrycks}, title = {The {WMDP} Benchmark: Measuring and Reducing Malicious Use With Unlearning}, journal = {CoRR}, volume = {abs/2403.03218}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2403.03218}, doi = {10.48550/ARXIV.2403.03218}, eprinttype = {arXiv}, eprint = {2403.03218}, timestamp = {Tue, 20 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2403-03218.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2403-07953, author = {Geonhwa Jeong and Po{-}An Tsai and Abhimanyu Rajeshkumar Bambhaniya and Stephen W. Keckler and Tushar Krishna}, title = {Abstracting Sparse {DNN} Acceleration via Structured Sparse Tensor Decomposition}, journal = {CoRR}, volume = {abs/2403.07953}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2403.07953}, doi = {10.48550/ARXIV.2403.07953}, eprinttype = {arXiv}, eprint = {2403.07953}, timestamp = {Thu, 04 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2403-07953.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2404-09097, author = {Naifeng Zhang and Stephen McAleer and Tuomas Sandholm}, title = {Faster Game Solving via Hyperparameter Schedules}, journal = {CoRR}, volume = {abs/2404.09097}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2404.09097}, doi = {10.48550/ARXIV.2404.09097}, eprinttype = {arXiv}, eprint = {2404.09097}, timestamp = {Wed, 15 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2404-09097.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2404-09932, author = {Usman Anwar and Abulhair Saparov and Javier Rando and Daniel Paleka and Miles Turpin and Peter Hase and Ekdeep Singh Lubana and Erik Jenner and Stephen Casper and Oliver Sourbut and Benjamin L. Edelman and Zhaowei Zhang and Mario G{\"{u}}nther and Anton Korinek and Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and Lewis Hammond and Eric J. Bigelow and Alexander Pan and Lauro Langosco and Tomasz Korbak and Heidi Zhang and Ruiqi Zhong and Se{\'{a}}n {\'{O}} h{\'{E}}igeartaigh and Gabriel Recchia and Giulio Corsi and Alan Chan and Markus Anderljung and Lilian Edwards and Yoshua Bengio and Danqi Chen and Samuel Albanie and Tegan Maharaj and Jakob N. Foerster and Florian Tram{\`{e}}r and He He and Atoosa Kasirzadeh and Yejin Choi and David Krueger}, title = {Foundational Challenges in Assuring Alignment and Safety of Large Language Models}, journal = {CoRR}, volume = {abs/2404.09932}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2404.09932}, doi = {10.48550/ARXIV.2404.09932}, eprinttype = {arXiv}, eprint = {2404.09932}, timestamp = {Wed, 07 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2404-09932.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2404-15847, author = {Russell Buchanan and Shihfan Jack Tu and Marco Camurri and Stephen J. Mellon and Maurice F. Fallon}, title = {3D Freehand Ultrasound using Visual Inertial and Deep Inertial Odometry for Measuring Patellar Tracking}, journal = {CoRR}, volume = {abs/2404.15847}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2404.15847}, doi = {10.48550/ARXIV.2404.15847}, eprinttype = {arXiv}, eprint = {2404.15847}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2404-15847.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2405-11178, author = {Sichang Tu and Abigail Powers and Natalie Merrill and Negar Fani and Sierra Carter and Stephen Doogan and Jinho D. Choi}, title = {Automating {PTSD} Diagnostics in Clinical Interviews: Leveraging Large Language Models for Trauma Assessments}, journal = {CoRR}, volume = {abs/2405.11178}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2405.11178}, doi = {10.48550/ARXIV.2405.11178}, eprinttype = {arXiv}, eprint = {2405.11178}, timestamp = {Wed, 12 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2405-11178.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2406-13868, author = {Geonhwa Jeong and Po{-}An Tsai and Stephen W. Keckler and Tushar Krishna}, title = {{SDQ:} Sparse Decomposed Quantization for {LLM} Inference}, journal = {CoRR}, volume = {abs/2406.13868}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2406.13868}, doi = {10.48550/ARXIV.2406.13868}, eprinttype = {arXiv}, eprint = {2406.13868}, timestamp = {Fri, 12 Jul 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2406-13868.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2406-17583, author = {Sean Tull and Robin Lorenz and Stephen Clark and Ilyas Khan and Bob Coecke}, title = {Towards Compositional Interpretability for {XAI}}, journal = {CoRR}, volume = {abs/2406.17583}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2406.17583}, doi = {10.48550/ARXIV.2406.17583}, eprinttype = {arXiv}, eprint = {2406.17583}, timestamp = {Mon, 22 Jul 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2406-17583.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2409-12382, author = {Paul Lutkus and Deepika Anantharaman and Stephen Tu and Lars Lindemann}, title = {Incremental Composition of Learned Control Barrier Functions in Unknown Environments}, journal = {CoRR}, volume = {abs/2409.12382}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2409.12382}, doi = {10.48550/ARXIV.2409.12382}, eprinttype = {arXiv}, eprint = {2409.12382}, timestamp = {Thu, 17 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2409-12382.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/TurnerKGU23, author = {Stephen W. Turner and Murat Karakus and Evrim Guler and Suleyman Uludag}, title = {A Promising Integration of {SDN} and Blockchain for IoT Networks: {A} Survey}, journal = {{IEEE} Access}, volume = {11}, pages = {29800--29822}, year = {2023}, url = {https://doi.org/10.1109/ACCESS.2023.3260777}, doi = {10.1109/ACCESS.2023.3260777}, timestamp = {Sat, 29 Apr 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/TurnerKGU23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bioinformatics/CoudertGCPBNSRBBAAAABBNB23, author = {Elisabeth Coudert and Sebastien Gehant and Edouard De Castro and Monica Pozzato and Delphine Baratin and Teresa Batista Neto and Christian J. A. Sigrist and Nicole Redaschi and Alan J. Bridge and Lucila Aimo and Ghislaine Argoud{-}Puy and Andrea H. Auchincloss and Kristian B. Axelsen and Parit Bansal and Marie{-}Claude Blatter and Jerven T. Bolleman and Emmanuel Boutet and Lionel Breuza and Blanca Cabrera Gil and Cristina Casals{-}Casas and Kamal Chikh Echioukh and B{\'{e}}atrice A. Cuche and Anne Estreicher and Maria Livia Famiglietti and Marc Feuermann and Elisabeth Gasteiger and Pascale Gaudet and Vivienne Baillie Gerritsen and Arnaud Gos and Nadine Gruaz{-}Gumowski and Chantal Hulo and Nevila Hyka{-}Nouspikel and Florence Jungo and Arnaud Kerhornou and Philippe Le Mercier and Damien Lieberherr and Patrick Masson and Anne Morgat and Venkatesh Muthukrishnan and Salvo Paesano and Ivo Pedruzzi and Sandrine Pilbout and Lucille Pourcel and Sylvain Poux and Manuela Pruess and Catherine Rivoire and Karin Sonesson and Shyamala Sundaram and Alex Bateman and Maria Jesus Martin and Sandra E. Orchard and Michele Magrane and Shadab Ahmad and Emanuele Alpi and Emily H. Bowler{-}Barnett and Ramona Britto and Hema Bye{-}A{-}Jee and Austra Cukura and Paul Denny and Tunca Dogan and Thankgod Ebenezer and Jun Fan and Penelope Garmiri and Leonardo Jose da Costa Gonzales and Emma Hatton{-}Ellis and Abdulrahman Hussein and Alexandr Ignatchenko and Giuseppe Insana and Rizwan Ishtiaq and Vishal Joshi and Dushyanth Jyothi and Swaathi Kandasamy and Antonia Lock and Aurelien Luciani and Marija Lugaric and Jie Luo and Yvonne Lussi and Alistair MacDougall and F{\'{a}}bio Madeira and Mahdi Mahmoudy and Alok Mishra and Katie Moulang and Andrew Nightingale and Sangya Pundir and Guoying Qi and Shriya Raj and Pedro Raposo and Daniel Rice and Rabie Saidi and Rafael Santos and Elena Speretta and James D. Stephenson and Prabhat Totoo and Edward Turner and Nidhi Tyagi and Preethi Vasudev and Kate Warner and Xavier Watkins and Rossana Zaru and Hermann Zellner and Cathy H. Wu and Cecilia N. Arighi and Leslie Arminski and Chuming Chen and Yongxing Chen and Hongzhan Huang and Kati Laiho and Peter B. McGarvey and Darren A. Natale and Karen Ross and C. R. Vinayaka and Qinghua Wang and Yuqi Wang}, title = {Annotation of biologically relevant ligands in UniProtKB using ChEBI}, journal = {Bioinform.}, volume = {39}, number = {1}, year = {2023}, url = {https://doi.org/10.1093/bioinformatics/btac793}, doi = {10.1093/BIOINFORMATICS/BTAC793}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bioinformatics/CoudertGCPBNSRBBAAAABBNB23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cphysics/FattebertDPT23, author = {Jean{-}Luc Fattebert and Stephen Dewitt and Aurelien Perron and John Turner}, title = {Thermo4PFM: Facilitating Phase-field simulations of alloys with thermodynamic driving forces}, journal = {Comput. Phys. Commun.}, volume = {288}, pages = {108739}, year = {2023}, url = {https://doi.org/10.1016/j.cpc.2023.108739}, doi = {10.1016/J.CPC.2023.108739}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cphysics/FattebertDPT23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/csm/GuoNRSORYSKIB23, author = {Jianlin Guo and Yukimasa Nagai and Benjamin A. Rolfe and Takenori Sumi and Philip V. Orlik and Joerg Robert and Kazuto Yano and Steve Shellhammer and Shoichi Kitazawa and Yasuhiko Inoue and Tuncer Baykas}, title = {{IEEE} 802.19.3 Coexistence Recommendations for {IEEE} 802.11 and {IEEE} 802.15.4 Based Systems Operating in {SUB-1} GHz Frequency Bands}, journal = {{IEEE} Commun. Stand. Mag.}, volume = {7}, number = {2}, pages = {72--82}, year = {2023}, url = {https://doi.org/10.1109/MCOMSTD.0009.2100046}, doi = {10.1109/MCOMSTD.0009.2100046}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/csm/GuoNRSORYSKIB23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/dm/KeletiLLLR23, author = {Tam{\'{a}}s Keleti and Stephen Lacina and Changshuo Liu and Mengzhen Liu and Jos{\'{e}} Ram{\'{o}}n Tuir{\'{a}}n Rangel}, title = {Tiling of rectangles with squares and related problems via Diophantine approximation}, journal = {Discret. Math.}, volume = {346}, number = {9}, pages = {113442}, year = {2023}, url = {https://doi.org/10.1016/j.disc.2023.113442}, doi = {10.1016/J.DISC.2023.113442}, timestamp = {Tue, 12 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/dm/KeletiLLLR23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fini/WangAABDHKLMMPRSTWWT23, author = {Lei Wang and Jos{\'{e}} Luis Ambite and Abhishek M. Appaji and Janine Bijsterbosch and J{\'{e}}r{\^{o}}me Dock{\`{e}}s and Rick Herrick and Alexander Kogan and Howard Lander and Daniel S. Marcus and Stephen Moore and Jean{-}Baptiste Poline and Arcot Rajasekar and Satya S. Sahoo and Matthew D. Turner and Xiaochen Wang and Yue Wang and Jessica A. Turner}, title = {NeuroBridge: a prototype platform for discovery of the long-tail neuroimaging data}, journal = {Frontiers Neuroinformatics}, volume = {17}, year = {2023}, url = {https://doi.org/10.3389/fninf.2023.1215261}, doi = {10.3389/FNINF.2023.1215261}, timestamp = {Tue, 13 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/fini/WangAABDHKLMMPRSTWWT23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ieeesp/TurnerMU23, author = {Adam Brian Turner and Stephen McCombie and Allon J. Uhlmann}, title = {Ransomware-Bitcoin Threat Intelligence Sharing Using Structured Threat Information Expression}, journal = {{IEEE} Secur. Priv.}, volume = {21}, number = {3}, pages = {47--57}, year = {2023}, url = {https://doi.org/10.1109/MSEC.2022.3166282}, doi = {10.1109/MSEC.2022.3166282}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ieeesp/TurnerMU23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ior/AravenaMZPCTWWW23, author = {Ignacio Aravena and Daniel K. Molzahn and Shixuan Zhang and Cosmin G. Petra and Frank E. Curtis and Shenyinying Tu and Andreas W{\"{a}}chter and Ermin Wei and Elizabeth Wong and Amin Gholami and Kaizhao Sun and Xu Andy Sun and Stephen T. Elbert and Jesse Holzer and Arun Veeramany}, title = {Recent Developments in Security-Constrained {AC} Optimal Power Flow: Overview of Challenge 1 in the {ARPA-E} Grid Optimization Competition}, journal = {Oper. Res.}, volume = {71}, number = {6}, pages = {1997--2014}, year = {2023}, url = {https://doi.org/10.1287/opre.2022.0315}, doi = {10.1287/OPRE.2022.0315}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ior/AravenaMZPCTWWW23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jamia/YangVSTG23, author = {Siyue Yang and Paul Varghese and Ellen Stephenson and Karen Tu and Jessica L. Gronsbell}, title = {Machine learning approaches for electronic health records phenotyping: a methodical review}, journal = {J. Am. Medical Informatics Assoc.}, volume = {30}, number = {2}, pages = {367--381}, year = {2023}, url = {https://doi.org/10.1093/jamia/ocac216}, doi = {10.1093/JAMIA/OCAC216}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jamia/YangVSTG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jbi/WoenselTMAAABCEHRKKMMMPRTWP23, author = {William Van Woensel and Samson W. Tu and Wojtek Michalowski and Syed Sibte Raza Abidi and Samina Abidi and Jos{\'{e}} Ram{\'{o}}n Alonso and Alessio Bottrighi and Marc Carrier and Ruth Edry and Irit Hochberg and Malvika Rao and Stephen P. Kingwell and Alexandra Kogan and Mar Marcos and Bego{\~{n}}a Mart{\'{\i}}nez{-}Salvador and Martin Michalowski and Luca Piovesan and David Ria{\~{n}}o and Paolo Terenziani and Szymon Wilk and Mor Peleg}, title = {A community-of-practice-based evaluation methodology for knowledge intensive computational methods and its application to multimorbidity decision support}, journal = {J. Biomed. Informatics}, volume = {142}, pages = {104395}, year = {2023}, url = {https://doi.org/10.1016/j.jbi.2023.104395}, doi = {10.1016/J.JBI.2023.104395}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jbi/WoenselTMAAABCEHRKKMMMPRTWP23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jssc/NishiPTCSZTNWDG23, author = {Yoshinori Nishi and John W. Poulton and Walker J. Turner and Xi Chen and Sanquan Song and Brian Zimmer and Stephen G. Tell and Nikola Nedovic and John M. Wilson and William J. Dally and C. Thomas Gray}, title = {A 0.297-pJ/Bit 50.4-Gb/s/Wire Inverter-Based Short-Reach Simultaneous Bi-Directional Transceiver for Die-to-Die Interface in 5-nm {CMOS}}, journal = {{IEEE} J. Solid State Circuits}, volume = {58}, number = {4}, pages = {1062--1073}, year = {2023}, url = {https://doi.org/10.1109/JSSC.2022.3232024}, doi = {10.1109/JSSC.2022.3232024}, timestamp = {Sat, 29 Apr 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jssc/NishiPTCSZTNWDG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/KelleherSMYMSNJVSHSPBEMO23, author = {Keith J. Kelleher and Timothy Sheils and Stephen L. Mathias and Jeremy J. Yang and Vincent T. Metzger and Vishal B. Siramshetty and Dac{-}Trung Nguyen and Lars Juhl Jensen and Dusica Vidovic and Stephan C. Sch{\"{u}}rer and Jayme Holmes and Karlie R. Sharma and Ajay Pillai and Cristian Bologa and Jeremy S. Edwards and Ewy A. Math{\'{e}} and Tudor I. Oprea}, title = {Pharos 2023: an integrated resource for the understudied human proteome}, journal = {Nucleic Acids Res.}, volume = {51}, number = {{D1}}, pages = {1405--1416}, year = {2023}, url = {https://doi.org/10.1093/nar/gkac1033}, doi = {10.1093/NAR/GKAC1033}, timestamp = {Tue, 08 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/KelleherSMYMSNJVSHSPBEMO23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/MartinAAAABBBBBBBBLBRCCfDDDHNFGGGMG23, author = {Fergal J. Martin and M. Ridwan Amode and Alisha Aneja and Olanrewaju Austine{-}Orimoloye and Andrey G. Azov and If Barnes and Arne Becker and Ruth Bennett and Andrew E. Berry and Jyothish Bhai and Simarpreet Kaur Bhurji and Alexandra Bignell and Sanjay Boddu and Paulo R. B. Lins and Lucy Brooks and Shashank Budhanuru Ramaraju and Mehrnaz Charkhchi and Alexander Cockburn and Luca Da Rin Fioretto and Claire Davidson and Kamalkumar Jayantilal Dodiya and Sarah M. Donaldson and Bilal El Houdaigui and Tamara El Naboulsi and Reham Fatima and Carlos Garc{\'{\i}}a{-}Gir{\'{o}}n and Thiago Augusto Lopes Genez and Gurpreet S. Ghattaoraya and Jose Gonzalez Martinez and Cristi Guijarro and Matthew Hardy and Zoe Hollis and Thibaut Hourlier and Toby Hunt and Mike P. Kay and Vinay Kaykala and Tuan Le and Diana Lemos and Diego Marques{-}Coelho and Jos{\'{e}} Carlos Marug{\'{a}}n and Gabriela Alejandra Merino and Louisse Paola Mirabueno and Aleena Mushtaq and Syed Nakib Hossain and Denye N. Ogeh and Manoj Pandian Sakthivel and Anne Parker and Malcolm Perry and Ivana Pilizota and Irina Prosovetskaia and Jos{\'{e}} G. P{\'{e}}rez{-}Silva and Ahamed Imran Abdul Salam and Nuno Saraiva{-}Agostinho and Helen Schuilenburg and Dan Sheppard and Swati Sinha and Botond Sipos and William Stark and Emily Steed and Ranjit Sukumaran and Dulika Sumathipala and Marie{-}Marthe Suner and Likhitha Surapaneni and Ky{\"{o}}sti Sutinen and Michal Szpak and Francesca Floriana Tricomi and David Urbina{-}G{\'{o}}mez and Andres Veidenberg and Thomas A. Walsh and Brandon Walts and Elizabeth Wass and Natalie L. Willhoft and Jamie Allen and Jorge {\'{A}}lvarez{-}Jarreta and Marc Chakiachvili and Bethany Flint and Stefano Giorgetti and Leanne Haggerty and Garth R Ilsley and Jane E. Loveland and Benjamin Moore and Jonathan M. Mudge and John G. Tate and David Thybert and Stephen J. Trevanion and Andrea Winterbottom and Adam Frankish and Sarah E. Hunt and Magali Ruffier and Fiona Cunningham and Sarah Dyer and Robert D. Finn and Kevin L. Howe and Peter W. Harrison and Andrew D. Yates and Paul Flicek}, title = {Ensembl 2023}, journal = {Nucleic Acids Res.}, volume = {51}, number = {{D1}}, pages = {933--941}, year = {2023}, url = {https://doi.org/10.1093/nar/gkac958}, doi = {10.1093/NAR/GKAC958}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/MartinAAAABBBBBBBBLBRCCfDDDHNFGGGMG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nature/MankowitzMZGSPL23, author = {Daniel J. Mankowitz and Andrea Michi and Anton Zhernov and Marco Gelmi and Marco Selvi and Cosmin Paduraru and Edouard Leurent and Shariq Iqbal and Jean{-}Baptiste Lespiau and Alex Ahern and Thomas K{\"{o}}ppe and Kevin Millikin and Stephen Gaffney and Sophie Elster and Jackson Broshear and Chris Gamble and Kieran Milan and Robert Tung and Minjae Hwang and A. Taylan Cemgil and Mohammadamin Barekatain and Yujia Li and Amol Mandhane and Thomas Hubert and Julian Schrittwieser and Demis Hassabis and Pushmeet Kohli and Martin A. Riedmiller and Oriol Vinyals and David Silver}, title = {Faster sorting algorithms discovered using deep reinforcement learning}, journal = {Nat.}, volume = {618}, number = {7964}, pages = {257--263}, year = {2023}, url = {https://doi.org/10.1038/s41586-023-06004-9}, doi = {10.1038/S41586-023-06004-9}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nature/MankowitzMZGSPL23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ni/BelyaevaGWWCSA23, author = {Irina Belyaeva and Ben Gabrielson and Yu{-}Ping Wang and Tony W. Wilson and Vince D. Calhoun and Julia M. Stephen and T{\"{u}}lay Adali}, title = {Multi-Subject Analysis for Brain Developmental Patterns Discovery via Tensor Decomposition of {MEG} Data}, journal = {Neuroinformatics}, volume = {21}, number = {1}, pages = {115--141}, year = {2023}, url = {https://doi.org/10.1007/s12021-022-09599-y}, doi = {10.1007/S12021-022-09599-Y}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ni/BelyaevaGWWCSA23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ni/BelyaevaGWWCSA23a, author = {Irina Belyaeva and Ben Gabrielson and Yu{-}Ping Wang and Tony W. Wilson and Vince D. Calhoun and Julia M. Stephen and T{\"{u}}lay Adali}, title = {Correction to: Multi-Subject Analysis for Brain Developmental Patterns Discovery via Tensor Decomposition of {MEG} Data}, journal = {Neuroinformatics}, volume = {21}, number = {1}, pages = {143}, year = {2023}, url = {https://doi.org/10.1007/s12021-023-09620-y}, doi = {10.1007/S12021-023-09620-Y}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ni/BelyaevaGWWCSA23a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/KelaherMMSMTB23, author = {Brendan P. Kelaher and Kim I. Monteforte and Stephen G. Morris and Thomas A. Schlacher and Duane T. March and James P. Tucker and Paul A. Butcher}, title = {Drone-Based Assessment of Marine Megafauna off Wave-Exposed Sandy Beaches}, journal = {Remote. Sens.}, volume = {15}, number = {16}, pages = {4018}, year = {2023}, url = {https://doi.org/10.3390/rs15164018}, doi = {10.3390/RS15164018}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/KelaherMMSMTB23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/TurnerHS23, author = {Alexander P. Turner and Stephen Hayes and Don Sharkey}, title = {The Classification of Movement in Infants for the Autonomous Monitoring of Neurological Development}, journal = {Sensors}, volume = {23}, number = {10}, pages = {4800}, year = {2023}, url = {https://doi.org/10.3390/s23104800}, doi = {10.3390/S23104800}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sensors/TurnerHS23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmi/BassSSWSTAFGSR23, author = {Cher Bass and Mariana da Silva and Carole H. Sudre and Logan Z. J. Williams and Helena S. Sousa and Petru{-}Daniel Tudosiu and Fidel Alfaro{-}Almagro and Sean P. Fitzgibbon and Matthew F. Glasser and Stephen M. Smith and Emma C. Robinson}, title = {ICAM-Reg: Interpretable Classification and Regression With Feature Attribution for Mapping Neurological Phenotypes in Individual Scans}, journal = {{IEEE} Trans. Medical Imaging}, volume = {42}, number = {4}, pages = {959--970}, year = {2023}, url = {https://doi.org/10.1109/TMI.2022.3221890}, doi = {10.1109/TMI.2022.3221890}, timestamp = {Thu, 27 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tmi/BassSSWSTAFGSR23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmlr/SrivastavaRRSAF23, author = {Aarohi Srivastava and Abhinav Rastogi and Abhishek Rao and Abu Awal Md Shoeb and Abubakar Abid and Adam Fisch and Adam R. Brown and Adam Santoro and Aditya Gupta and Adri{\`{a}} Garriga{-}Alonso and Agnieszka Kluska and Aitor Lewkowycz and Akshat Agarwal and Alethea Power and Alex Ray and Alex Warstadt and Alexander W. Kocurek and Ali Safaya and Ali Tazarv and Alice Xiang and Alicia Parrish and Allen Nie and Aman Hussain and Amanda Askell and Amanda Dsouza and Ambrose Slone and Ameet Rahane and Anantharaman S. Iyer and Anders Andreassen and Andrea Madotto and Andrea Santilli and Andreas Stuhlm{\"{u}}ller and Andrew M. Dai and Andrew La and Andrew K. Lampinen and Andy Zou and Angela Jiang and Angelica Chen and Anh Vuong and Animesh Gupta and Anna Gottardi and Antonio Norelli and Anu Venkatesh and Arash Gholamidavoodi and Arfa Tabassum and Arul Menezes and Arun Kirubarajan and Asher Mullokandov and Ashish Sabharwal and Austin Herrick and Avia Efrat and Aykut Erdem and Ayla Karakas and B. Ryan Roberts and Bao Sheng Loe and Barret Zoph and Bartlomiej Bojanowski and Batuhan {\"{O}}zyurt and Behnam Hedayatnia and Behnam Neyshabur and Benjamin Inden and Benno Stein and Berk Ekmekci and Bill Yuchen Lin and Blake Howald and Bryan Orinion and Cameron Diao and Cameron Dour and Catherine Stinson and Cedrick Argueta and C{\`{e}}sar Ferri Ram{\'{\i}}rez and Chandan Singh and Charles Rathkopf and Chenlin Meng and Chitta Baral and Chiyu Wu and Chris Callison{-}Burch and Chris Waites and Christian Voigt and Christopher D. Manning and Christopher Potts and Cindy Ramirez and Clara E. Rivera and Clemencia Siro and Colin Raffel and Courtney Ashcraft and Cristina Garbacea and Damien Sileo and Dan Garrette and Dan Hendrycks and Dan Kilman and Dan Roth and Daniel Freeman and Daniel Khashabi and Daniel Levy and Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and Danielle Perszyk and Danny Hernandez and Danqi Chen and Daphne Ippolito and Dar Gilboa and David Dohan and David Drakard and David Jurgens and Debajyoti Datta and Deep Ganguli and Denis Emelin and Denis Kleyko and Deniz Yuret and Derek Chen and Derek Tam and Dieuwke Hupkes and Diganta Misra and Dilyar Buzan and Dimitri Coelho Mollo and Diyi Yang and Dong{-}Ho Lee and Dylan Schrader and Ekaterina Shutova and Ekin Dogus Cubuk and Elad Segal and Eleanor Hagerman and Elizabeth Barnes and Elizabeth Donoway and Ellie Pavlick and Emanuele Rodol{\`{a}} and Emma Lam and Eric Chu and Eric Tang and Erkut Erdem and Ernie Chang and Ethan A. Chi and Ethan Dyer and Ethan J. Jerzak and Ethan Kim and Eunice Engefu Manyasi and Evgenii Zheltonozhskii and Fanyue Xia and Fatemeh Siar and Fernando Mart{\'{\i}}nez{-}Plumed and Francesca Happ{\'{e}} and Fran{\c{c}}ois Chollet and Frieda Rong and Gaurav Mishra and Genta Indra Winata and Gerard de Melo and Germ{\'{a}}n Kruszewski and Giambattista Parascandolo and Giorgio Mariani and Gloria Wang and Gonzalo Jaimovitch{-}L{\'{o}}pez and Gregor Betz and Guy Gur{-}Ari and Hana Galijasevic and Hannah Kim and Hannah Rashkin and Hannaneh Hajishirzi and Harsh Mehta and Hayden Bogar and Henry Shevlin and Hinrich Sch{\"{u}}tze and Hiromu Yakura and Hongming Zhang and Hugh Mee Wong and Ian Ng and Isaac Noble and Jaap Jumelet and Jack Geissinger and Jackson Kernion and Jacob Hilton and Jaehoon Lee and Jaime Fern{\'{a}}ndez Fisac and James B. Simon and James Koppel and James Zheng and James Zou and Jan Kocon and Jana Thompson and Janelle Wingfield and Jared Kaplan and Jarema Radom and Jascha Sohl{-}Dickstein and Jason Phang and Jason Wei and Jason Yosinski and Jekaterina Novikova and Jelle Bosscher and Jennifer Marsh and Jeremy Kim and Jeroen Taal and Jesse H. Engel and Jesujoba Alabi and Jiacheng Xu and Jiaming Song and Jillian Tang and Joan Waweru and John Burden and John Miller and John U. Balis and Jonathan Batchelder and Jonathan Berant and J{\"{o}}rg Frohberg and Jos Rozen and Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and Joseph Boudeman and Joseph Guerr and Joseph Jones and Joshua B. Tenenbaum and Joshua S. Rule and Joyce Chua and Kamil Kanclerz and Karen Livescu and Karl Krauth and Karthik Gopalakrishnan and Katerina Ignatyeva and Katja Markert and Kaustubh D. Dhole and Kevin Gimpel and Kevin Omondi and Kory Mathewson and Kristen Chiafullo and Ksenia Shkaruta and Kumar Shridhar and Kyle McDonell and Kyle Richardson and Laria Reynolds and Leo Gao and Li Zhang and Liam Dugan and Lianhui Qin and Lidia Contreras Ochando and Louis{-}Philippe Morency and Luca Moschella and Lucas Lam and Lucy Noble and Ludwig Schmidt and Luheng He and Luis Oliveros Col{\'{o}}n and Luke Metz and L{\"{u}}tfi Kerem Senel and Maarten Bosma and Maarten Sap and Maartje ter Hoeve and Maheen Farooqi and Manaal Faruqui and Mantas Mazeika and Marco Baturan and Marco Marelli and Marco Maru and Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and Marie Tolkiehn and Mario Giulianelli and Martha Lewis and Martin Potthast and Matthew L. Leavitt and Matthias Hagen and M{\'{a}}ty{\'{a}}s Schubert and Medina Baitemirova and Melody Arnaud and Melvin McElrath and Michael A. Yee and Michael Cohen and Michael Gu and Michael I. Ivanitskiy and Michael Starritt and Michael Strube and Michal Swedrowski and Michele Bevilacqua and Michihiro Yasunaga and Mihir Kale and Mike Cain and Mimee Xu and Mirac Suzgun and Mitch Walker and Mo Tiwari and Mohit Bansal and Moin Aminnaseri and Mor Geva and Mozhdeh Gheini and Mukund Varma T. and Nanyun Peng and Nathan A. Chi and Nayeon Lee and Neta Gur{-}Ari Krakover and Nicholas Cameron and Nicholas Roberts and Nick Doiron and Nicole Martinez and Nikita Nangia and Niklas Deckers and Niklas Muennighoff and Nitish Shirish Keskar and Niveditha Iyer and Noah Constant and Noah Fiedel and Nuan Wen and Oliver Zhang and Omar Agha and Omar Elbaghdadi and Omer Levy and Owain Evans and Pablo Antonio Moreno Casares and Parth Doshi and Pascale Fung and Paul Pu Liang and Paul Vicol and Pegah Alipoormolabashi and Peiyuan Liao and Percy Liang and Peter Chang and Peter Eckersley and Phu Mon Htut and Pinyu Hwang and Piotr Milkowski and Piyush Patil and Pouya Pezeshkpour and Priti Oli and Qiaozhu Mei and Qing Lyu and Qinlang Chen and Rabin Banjade and Rachel Etta Rudolph and Raefer Gabriel and Rahel Habacker and Ramon Risco and Rapha{\"{e}}l Milli{\`{e}}re and Rhythm Garg and Richard Barnes and Rif A. Saurous and Riku Arakawa and Robbe Raymaekers and Robert Frank and Rohan Sikand and Roman Novak and Roman Sitelew and Ronan LeBras and Rosanne Liu and Rowan Jacobs and Rui Zhang and Ruslan Salakhutdinov and Ryan Chi and Ryan Lee and Ryan Stovall and Ryan Teehan and Rylan Yang and Sahib Singh and Saif M. Mohammad and Sajant Anand and Sam Dillavou and Sam Shleifer and Sam Wiseman and Samuel Gruetter and Samuel R. Bowman and Samuel S. Schoenholz and Sanghyun Han and Sanjeev Kwatra and Sarah A. Rous and Sarik Ghazarian and Sayan Ghosh and Sean Casey and Sebastian Bischoff and Sebastian Gehrmann and Sebastian Schuster and Sepideh Sadeghi and Shadi Hamdan and Sharon Zhou and Shashank Srivastava and Sherry Shi and Shikhar Singh and Shima Asaadi and Shixiang Shane Gu and Shubh Pachchigar and Shubham Toshniwal and Shyam Upadhyay and Shyamolima (Shammie) Debnath and Siamak Shakeri and Simon Thormeyer and Simone Melzi and Siva Reddy and Sneha Priscilla Makini and Soo{-}Hwan Lee and Spencer Torene and Sriharsha Hatwar and Stanislas Dehaene and Stefan Divic and Stefano Ermon and Stella Biderman and Stephanie Lin and Stephen Prasad and Steven T. Piantadosi and Stuart M. Shieber and Summer Misherghi and Svetlana Kiritchenko and Swaroop Mishra and Tal Linzen and Tal Schuster and Tao Li and Tao Yu and Tariq Ali and Tatsu Hashimoto and Te{-}Lin Wu and Th{\'{e}}o Desbordes and Theodore Rothschild and Thomas Phan and Tianle Wang and Tiberius Nkinyili and Timo Schick and Timofei Kornev and Titus Tunduny and Tobias Gerstenberg and Trenton Chang and Trishala Neeraj and Tushar Khot and Tyler Shultz and Uri Shaham and Vedant Misra and Vera Demberg and Victoria Nyamai and Vikas Raunak and Vinay V. Ramasesh and Vinay Uday Prabhu and Vishakh Padmakumar and Vivek Srikumar and William Fedus and William Saunders and William Zhang and Wout Vossen and Xiang Ren and Xiaoyu Tong and Xinran Zhao and Xinyi Wu and Xudong Shen and Yadollah Yaghoobzadeh and Yair Lakretz and Yangqiu Song and Yasaman Bahri and Yejin Choi and Yichi Yang and Yiding Hao and Yifu Chen and Yonatan Belinkov and Yu Hou and Yufang Hou and Yuntao Bai and Zachary Seid and Zhuoye Zhao and Zijian Wang and Zijie J. Wang and Zirui Wang and Ziyi Wu}, title = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities of language models}, journal = {Trans. Mach. Learn. Res.}, volume = {2023}, year = {2023}, url = {https://openreview.net/forum?id=uyTL5Bvosj}, timestamp = {Tue, 06 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tmlr/SrivastavaRRSAF23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/toms/BestuzhevaBCCDDEGGGGGHHHHKLMMMMPRS23, author = {Ksenia Bestuzheva and Mathieu Besan{\c{c}}on and Weikun Chen and Antonia Chmiela and Tim Donkiewicz and Jasper van Doornmalen and Leon Eifler and Oliver Gaul and Gerald Gamrath and Ambros M. Gleixner and Leona Gottwald and Christoph Graczyk and Katrin Halbig and Alexander Hoen and Christopher Hojny and Rolf van der Hulst and Thorsten Koch and Marco E. L{\"{u}}bbecke and Stephen J. Maher and Frederic Matter and Erik M{\"{u}}hmer and Benjamin M{\"{u}}ller and Marc E. Pfetsch and Daniel Rehfeldt and Steffan Schlein and Franziska Schl{\"{o}}sser and Felipe Serrano and Yuji Shinano and Boro Sofranac and Mark Turner and Stefan Vigerske and Fabian Wegscheider and Philipp Wellner and Dieter Weninger and Jakob Witzig}, title = {Enabling Research through the {SCIP} Optimization Suite 8.0}, journal = {{ACM} Trans. Math. Softw.}, volume = {49}, number = {2}, pages = {22:1--22:21}, year = {2023}, url = {https://doi.org/10.1145/3585516}, doi = {10.1145/3585516}, timestamp = {Tue, 16 Jul 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/toms/BestuzhevaBCCDDEGGGGGHHHHKLMMMMPRS23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acivs/DuongTKNLBN23, author = {Dat Q. Duong and Tuan{-}Anh Tran and Phuong Nhi Nguyen Kieu and Tien K. Nguyen and Bao Le and Stephen Baker and Binh T. Nguyen}, editor = {Jacques Blanc{-}Talon and Patrice Delmas and Wilfried Philips and Paul Scheunders}, title = {A Deep Learning Approach to Segment High-Content Images of the E. coli Bacteria}, booktitle = {Advanced Concepts for Intelligent Vision Systems - 21st International Conference, {ACIVS} 2023 Kumamoto, Japan, August 21-23, 2023 Proceedings}, series = {Lecture Notes in Computer Science}, volume = {14124}, pages = {184--195}, publisher = {Springer}, year = {2023}, url = {https://doi.org/10.1007/978-3-031-45382-3\_16}, doi = {10.1007/978-3-031-45382-3\_16}, timestamp = {Tue, 28 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/acivs/DuongTKNLBN23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/blockchain2/LiuWTO23, author = {Liang Liu and Qiao Wang and Stephen John Turnbull and Kazumasa Omote}, title = {The Validator's Dilemma in PoW Blockchain: An Evolutionary Game Perspective}, booktitle = {{IEEE} International Conference on Blockchain, Blockchain 2023, Danzhou, China, December 17-21, 2023}, pages = {17--24}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/Blockchain60715.2023.00013}, doi = {10.1109/BLOCKCHAIN60715.2023.00013}, timestamp = {Thu, 22 Feb 2024 20:11:26 +0100}, biburl = {https://dblp.org/rec/conf/blockchain2/LiuWTO23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cogsci/TullSZC23, author = {Sean Tull and Razin A. Shaikh and Sara Sabrina Zemljic and Stephen Clark}, editor = {Micah B. Goldwater and Florencia K. Anggoro and Brett K. Hayes and Desmond C. Ong}, title = {A Quantum Model of Concepts}, booktitle = {Proceedings of the 45th Annual Meeting of the Cognitive Science Society, CogSci 2023, Sydney, NSW, Australia, July 26-29, 2023}, publisher = {cognitivesciencesociety.org}, year = {2023}, url = {https://escholarship.org/uc/item/5vj7c6d8}, timestamp = {Thu, 02 May 2024 16:36:09 +0200}, biburl = {https://dblp.org/rec/conf/cogsci/TullSZC23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/RenDBSTBXTXVXSZ23, author = {Allen Z. Ren and Anushri Dixit and Alexandra Bodrova and Sumeet Singh and Stephen Tu and Noah Brown and Peng Xu and Leila Takayama and Fei Xia and Jake Varley and Zhenjia Xu and Dorsa Sadigh and Andy Zeng and Anirudha Majumdar}, editor = {Jie Tan and Marc Toussaint and Kourosh Darvish}, title = {Robots That Ask For Help: Uncertainty Alignment for Large Language Model Planners}, booktitle = {Conference on Robot Learning, CoRL 2023, 6-9 November 2023, Atlanta, GA, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {229}, pages = {661--682}, publisher = {{PMLR}}, year = {2023}, url = {https://proceedings.mlr.press/v229/ren23a.html}, timestamp = {Tue, 12 Nov 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/corl/RenDBSTBXTXVXSZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/WangNSLCSZHL23, author = {Ziyan Wang and Giljoo Nam and Tuur Stuyck and Stephen Lombardi and Chen Cao and Jason M. Saragih and Michael Zollh{\"{o}}fer and Jessica K. Hodgins and Christoph Lassner}, title = {NeuWigs: {A} Neural Dynamic Model for Volumetric Hair Capture and Animation}, booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2023, Vancouver, BC, Canada, June 17-24, 2023}, pages = {8641--8651}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/CVPR52729.2023.00835}, doi = {10.1109/CVPR52729.2023.00835}, timestamp = {Mon, 28 Aug 2023 16:14:07 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/WangNSLCSZHL23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/OgundepoGRCRADD23, author = {Odunayo Ogundepo and Tajuddeen Gwadabe and Clara Rivera and Jonathan H. Clark and Sebastian Ruder and David Ifeoluwa Adelani and Bonaventure Dossou and Abdou Aziz Diop and Claytone Sikasote and Gilles Hacheme and Happy Buzaaba and Ignatius Ezeani and Rooweither Mabuya and Salomey Osei and Chris Emezue and Albert Kahira and Shamsuddeen Hassan Muhammad and Akintunde Oladipo and Abraham Toluwase Owodunni and Atnafu Lambebo Tonja and Iyanuoluwa Shode and Akari Asai and Aremu Anuoluwapo and Ayodele Awokoya and Bernard Opoku and Chiamaka Chukwuneke and Christine Mwase and Clemencia Siro and Stephen Arthur and Tunde Ajayi and Verrah Otiende and Andre Niyongabo Rubungo and Boyd Sinkala and Daniel A. Ajisafe and Emeka Onwuegbuzia and Falalu Ibrahim Lawan and Ibrahim Said Ahmad and Jesujoba O. Alabi and Chinedu E. Mbonu and Mofetoluwa Adeyemi and Mofya Phiri and Orevaoghene Ahia and Ruqayya Nasir Iro and Sonia Adhiambo}, editor = {Houda Bouamor and Juan Pino and Kalika Bali}, title = {Cross-lingual Open-Retrieval Question Answering for African Languages}, booktitle = {Findings of the Association for Computational Linguistics: {EMNLP} 2023, Singapore, December 6-10, 2023}, pages = {14957--14972}, publisher = {Association for Computational Linguistics}, year = {2023}, url = {https://doi.org/10.18653/v1/2023.findings-emnlp.997}, doi = {10.18653/V1/2023.FINDINGS-EMNLP.997}, timestamp = {Fri, 12 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/OgundepoGRCRADD23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eusipco/KoldovskyCAO23, author = {Zbynek Koldovsk{\'{y}} and Jaroslav Cmejla and T{\"{u}}lay Adali and Stephen O'Regan}, title = {Independent Vector Extraction Constrained on Manifold of Half-Length Filters}, booktitle = {31st European Signal Processing Conference, {EUSIPCO} 2023, Helsinki, Finland, September 4-8, 2023}, pages = {940--944}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.23919/EUSIPCO58844.2023.10289896}, doi = {10.23919/EUSIPCO58844.2023.10289896}, timestamp = {Mon, 06 Nov 2023 12:35:15 +0100}, biburl = {https://dblp.org/rec/conf/eusipco/KoldovskyCAO23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/gsi/TumpachP23, author = {Alice Barbara Tumpach and Stephen C. Preston}, editor = {Frank Nielsen and Fr{\'{e}}d{\'{e}}ric Barbaresco}, title = {Three Methods to Put a Riemannian Metric on Shape Space}, booktitle = {Geometric Science of Information - 6th International Conference, {GSI} 2023, St. Malo, France, August 30 - September 1, 2023, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {14071}, pages = {3--11}, publisher = {Springer}, year = {2023}, url = {https://doi.org/10.1007/978-3-031-38271-0\_1}, doi = {10.1007/978-3-031-38271-0\_1}, timestamp = {Mon, 14 Aug 2023 16:16:24 +0200}, biburl = {https://dblp.org/rec/conf/gsi/TumpachP23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icacit/TurnerJMU23, author = {Stephen W. Turner and Tyler Judd and Aaron Moore and Suleyman Uludag}, title = {A Framework for an Automated Assessment System}, booktitle = {International Symposium on Accreditation of Engineering and Computing Education, {ICACIT} 2023, Lima, Peru, November 2-3, 2023}, pages = {1--6}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/ICACIT59946.2023.10403674}, doi = {10.1109/ICACIT59946.2023.10403674}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icacit/TurnerJMU23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icc/NikunramMTS23, author = {Chanikarn Nikunram and Wasin Meesena and Stephen John Turner and Sucha Supittayapornpong}, title = {Minimizing Age of Processed Information in Wireless Networks}, booktitle = {{IEEE} International Conference on Communications, {ICC} 2023, Rome, Italy, May 28 - June 1, 2023}, pages = {69--75}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/ICC45041.2023.10278805}, doi = {10.1109/ICC45041.2023.10278805}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icc/NikunramMTS23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccps/GaoSCFPGGTP23, author = {Qitong Gao and Stephen L. Schmidt and Afsana Chowdhury and Guangyu Feng and Jennifer J. Peters and Katherine Genty and Warren M. Grill and Dennis A. Turner and Miroslav Pajic}, editor = {Sayan Mitra and Nalini Venkatasubramanian and Abhishek Dubey and Lu Feng and Mahsa Ghasemi and Jonathan Sprinkle}, title = {Offline Learning of Closed-Loop Deep Brain Stimulation Controllers for Parkinson Disease Treatment}, booktitle = {Proceedings of the {ACM/IEEE} 14th International Conference on Cyber-Physical Systems, {ICCPS} 2023, (with CPS-IoT Week 2023), San Antonio, TX, USA, May 9-12, 2023}, pages = {44--55}, publisher = {{ACM}}, year = {2023}, url = {https://doi.org/10.1145/3576841.3585925}, doi = {10.1145/3576841.3585925}, timestamp = {Wed, 17 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iccps/GaoSCFPGGTP23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/McAleerFLS23, author = {Stephen Marcus McAleer and Gabriele Farina and Marc Lanctot and Tuomas Sandholm}, title = {{ESCHER:} Eschewing Importance Sampling in Games by Computing a History Value Function to Estimate Regret}, booktitle = {The Eleventh International Conference on Learning Representations, {ICLR} 2023, Kigali, Rwanda, May 1-5, 2023}, publisher = {OpenReview.net}, year = {2023}, url = {https://openreview.net/forum?id=35QyoZv8cKO}, timestamp = {Wed, 24 Jul 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iclr/McAleerFLS23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/LanTRHABD23, author = {Charline Le Lan and Stephen Tu and Mark Rowland and Anna Harutyunyan and Rishabh Agarwal and Marc G. Bellemare and Will Dabney}, editor = {Andreas Krause and Emma Brunskill and Kyunghyun Cho and Barbara Engelhardt and Sivan Sabato and Jonathan Scarlett}, title = {Bootstrapped Representations in Reinforcement Learning}, booktitle = {International Conference on Machine Learning, {ICML} 2023, 23-29 July 2023, Honolulu, Hawaii, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {202}, pages = {18686--18713}, publisher = {{PMLR}}, year = {2023}, url = {https://proceedings.mlr.press/v202/le-lan23a.html}, timestamp = {Wed, 02 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icml/LanTRHABD23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/PfrommerSWMT23, author = {Daniel Pfrommer and Max Simchowitz and Tyler Westenbroek and Nikolai Matni and Stephen Tu}, editor = {Andreas Krause and Emma Brunskill and Kyunghyun Cho and Barbara Engelhardt and Sivan Sabato and Jonathan Scarlett}, title = {The Power of Learned Locally Linear Models for Nonlinear Policy Optimization}, booktitle = {International Conference on Machine Learning, {ICML} 2023, 23-29 July 2023, Honolulu, Hawaii, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {202}, pages = {27737--27821}, publisher = {{PMLR}}, year = {2023}, url = {https://proceedings.mlr.press/v202/pfrommer23a.html}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icml/PfrommerSWMT23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/BrandfonbrenerTSWBMV23, author = {David Brandfonbrener and Stephen Tu and Avi Singh and Stefan Welker and Chad Boodoo and Nikolai Matni and Jake Varley}, title = {Visual Backtracking Teleoperation: {A} Data Collection Protocol for Offline Image-Based Reinforcement Learning}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2023, London, UK, May 29 - June 2, 2023}, pages = {11336--11342}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/ICRA48891.2023.10161096}, doi = {10.1109/ICRA48891.2023.10161096}, timestamp = {Tue, 08 Aug 2023 10:24:29 +0200}, biburl = {https://dblp.org/rec/conf/icra/BrandfonbrenerTSWBMV23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icsrs/TullinoKBCJ23, author = {Stephen K. Tullino and Andrew S. Keys and Robert A. Bettinger and Amy M. Cox and David R. Jacques}, title = {A Conceptual Spacecraft Operational Survivability Estimation Based on Pre-Launch Test and Evaluation}, booktitle = {7th International Conference on System Reliability and Safety, {ICSRS} 2023, Bologna, Italy, November 22-24, 2023}, pages = {265--271}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/ICSRS59833.2023.10381447}, doi = {10.1109/ICSRS59833.2023.10381447}, timestamp = {Fri, 09 Feb 2024 20:38:51 +0100}, biburl = {https://dblp.org/rec/conf/icsrs/TullinoKBCJ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isbi/ZhangWSWTLPF23, author = {Yulun Zhang and Donglai Wei and Richard Schalek and Yuelong Wu and Stephen G. Turney and Jeff Lichtman and Hanspeter Pfister and Yun Fu}, title = {High-Throughput Microscopy Image Deblurring with Graph Reasoning Attention Network}, booktitle = {20th {IEEE} International Symposium on Biomedical Imaging, {ISBI} 2023, Cartagena, Colombia, April 18-21, 2023}, pages = {1--5}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/ISBI53787.2023.10230473}, doi = {10.1109/ISBI53787.2023.10230473}, timestamp = {Fri, 25 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/isbi/ZhangWSWTLPF23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/l4dc/AbeyruwanBBCDJS23, author = {Saminda Abeyruwan and Alex Bewley and Nicholas Matthew Boffi and Krzysztof Marcin Choromanski and David B. D'Ambrosio and Deepali Jain and Pannag R. Sanketi and Anish Shankar and Vikas Sindhwani and Sumeet Singh and Jean{-}Jacques E. Slotine and Stephen Tu}, editor = {Nikolai Matni and Manfred Morari and George J. Pappas}, title = {Agile Catching with Whole-Body {MPC} and Blackbox Policy Learning}, booktitle = {Learning for Dynamics and Control Conference, {L4DC} 2023, 15-16 June 2023, Philadelphia, PA, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {211}, pages = {851--863}, publisher = {{PMLR}}, year = {2023}, url = {https://proceedings.mlr.press/v211/abeyruwan23a.html}, timestamp = {Fri, 16 Jun 2023 14:48:17 +0200}, biburl = {https://dblp.org/rec/conf/l4dc/AbeyruwanBBCDJS23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/l4dc/ZhangKLTLTM23, author = {Thomas T. C. K. Zhang and Katie Kang and Bruce D. Lee and Claire J. Tomlin and Sergey Levine and Stephen Tu and Nikolai Matni}, editor = {Nikolai Matni and Manfred Morari and George J. Pappas}, title = {Multi-Task Imitation Learning for Linear Dynamical Systems}, booktitle = {Learning for Dynamics and Control Conference, {L4DC} 2023, 15-16 June 2023, Philadelphia, PA, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {211}, pages = {586--599}, publisher = {{PMLR}}, year = {2023}, url = {https://proceedings.mlr.press/v211/zhang23b.html}, timestamp = {Fri, 16 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/l4dc/ZhangKLTLTM23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/McAleerFZW0S23, author = {Stephen McAleer and Gabriele Farina and Gaoyue Zhou and Mingzhi Wang and Yaodong Yang and Tuomas Sandholm}, editor = {Alice Oh and Tristan Naumann and Amir Globerson and Kate Saenko and Moritz Hardt and Sergey Levine}, title = {Team-PSRO for Learning Approximate TMECor in Large Team Games via Cooperative Reinforcement Learning}, booktitle = {Advances in Neural Information Processing Systems 36: Annual Conference on Neural Information Processing Systems 2023, NeurIPS 2023, New Orleans, LA, USA, December 10 - 16, 2023}, year = {2023}, url = {http://papers.nips.cc/paper\_files/paper/2023/hash/8e4ccc9ca6ae2225c4cbb7782ab48daf-Abstract-Conference.html}, timestamp = {Fri, 01 Mar 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/nips/McAleerFZW0S23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/ZhangFACMHC0CS23, author = {Brian Hu Zhang and Gabriele Farina and Ioannis Anagnostides and Federico Cacciamani and Stephen McAleer and Andreas A. Haupt and Andrea Celli and Nicola Gatti and Vincent Conitzer and Tuomas Sandholm}, editor = {Alice Oh and Tristan Naumann and Amir Globerson and Kate Saenko and Moritz Hardt and Sergey Levine}, title = {Computing Optimal Equilibria and Mechanisms via Learning in Zero-Sum Extensive-Form Games}, booktitle = {Advances in Neural Information Processing Systems 36: Annual Conference on Neural Information Processing Systems 2023, NeurIPS 2023, New Orleans, LA, USA, December 10 - 16, 2023}, year = {2023}, url = {http://papers.nips.cc/paper\_files/paper/2023/hash/07be1a0850e58ca29e2b6ce31fc0c791-Abstract-Conference.html}, timestamp = {Fri, 01 Mar 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/nips/ZhangFACMHC0CS23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/ZiemannTPM23, author = {Ingvar M. Ziemann and Stephen Tu and George J. Pappas and Nikolai Matni}, editor = {Alice Oh and Tristan Naumann and Amir Globerson and Kate Saenko and Moritz Hardt and Sergey Levine}, title = {The noise level in linear regression with dependent data}, booktitle = {Advances in Neural Information Processing Systems 36: Annual Conference on Neural Information Processing Systems 2023, NeurIPS 2023, New Orleans, LA, USA, December 10 - 16, 2023}, year = {2023}, url = {http://papers.nips.cc/paper\_files/paper/2023/hash/ecffd829f90b0a4b6aa017b6df15904f-Abstract-Conference.html}, timestamp = {Fri, 01 Mar 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/nips/ZiemannTPM23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sc/BaderBBBCCCCDDF23, author = {Jonathan Bader and Jim Belak and Matthew T. Bement and Matthew Berry and Robert Carson and Daniela Cassol and Stephen Chan and John Coleman and Kastan Day and Alejandro Duque and Kjiersten Fagnan and Jeff Froula and Shantenu Jha and Daniel S. Katz and Piotr Kica and Volodymyr V. Kindratenko and Edward Kirton and Ramani Kothadia and Daniel E. Laney and Fabian Lehmann and Ulf Leser and Sabina Licholai and Maciej Malawski and Mario Melara and Elais Player Jackson and Matthew Rolchigo and Setareh Sarrafan and Seung{-}Jin Sul and Abdullah Syed and Lauritz Thamsen and Mikhail Titov and Matteo Turilli and Silvina Ca{\'{\i}}no{-}Lores and Anirban Mandal}, title = {Novel Approaches Toward Scalable Composable Workflows in Hyper-Heterogeneous Computing Environments}, booktitle = {Proceedings of the {SC} '23 Workshops of The International Conference on High Performance Computing, Network, Storage, and Analysis, {SC-W} 2023, Denver, CO, USA, November 12-17, 2023}, pages = {2097--2108}, publisher = {{ACM}}, year = {2023}, url = {https://doi.org/10.1145/3624062.3626283}, doi = {10.1145/3624062.3626283}, timestamp = {Tue, 28 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sc/BaderBBBCCCCDDF23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/siggraph/LyonsDBFTR23, author = {Deirdre V. Lyons and Christopher Lane Davis and Stephen Butchko and Whitton Frank and Brian Tull and Braden Roy}, editor = {Erik Brunvand and Anna Carolina Muller Queiroz}, title = {Gumball Dreams: Live Theatre in {VR}}, booktitle = {{ACM} {SIGGRAPH} 2023 Immersive Pavilion, {SIGGRAPH} 2023, Los Angeles, CA, USA, August 6-10, 2023}, pages = {8:1--8:2}, publisher = {{ACM}}, year = {2023}, url = {https://doi.org/10.1145/3588027.3595593}, doi = {10.1145/3588027.3595593}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/siggraph/LyonsDBFTR23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/vlsit/NishiPCSZTTN0DG23, author = {Yoshinori Nishi and John W. Poulton and Xi Chen and Sanquan Song and Brian Zimmer and Walker J. Turner and Stephen G. Tell and Nikola Nedovic and John M. Wilson and William J. Dally and C. Thomas Gray}, title = {A 0.190-pJ/bit 25.2-Gb/s/wire Inverter-Based AC-Coupled Transceiver for Short-Reach Die-to-Die Interfaces in 5-nm {CMOS}}, booktitle = {2023 {IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology and Circuits), Kyoto, Japan, June 11-16, 2023}, pages = {1--2}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.23919/VLSITechnologyandCir57934.2023.10185334}, doi = {10.23919/VLSITECHNOLOGYANDCIR57934.2023.10185334}, timestamp = {Sun, 30 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/vlsit/NishiPCSZTTN0DG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/www/WanigasekaraAGG23, author = {Prashan Wanigasekara and Rafid Al{-}Humaimidi and Turan Gojayev and Niloofar Gheissari and Achal Dave and Stephen Rawls and Fan Yang and Kechen Qin and Nalin Gupta and Spurthi Sandiri and Chevanthie Dissanayake and Zeynab Raeesy and Emre Barut and Chengwei Su}, editor = {Ying Ding and Jie Tang and Juan F. Sequeda and Lora Aroyo and Carlos Castillo and Geert{-}Jan Houben}, title = {Visual Item Selection With Voice Assistants: {A} systems perspective}, booktitle = {Companion Proceedings of the {ACM} Web Conference 2023, {WWW} 2023, Austin, TX, USA, 30 April 2023 - 4 May 2023}, pages = {500--507}, publisher = {{ACM}}, year = {2023}, url = {https://doi.org/10.1145/3543873.3584655}, doi = {10.1145/3543873.3584655}, timestamp = {Mon, 28 Aug 2023 21:17:11 +0200}, biburl = {https://dblp.org/rec/conf/www/WanigasekaraAGG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2302-02477, author = {Qitong Gao and Stephen L. Schmidt and Afsana Chowdhury and Guangyu Feng and Jennifer J. Peters and Katherine Genty and Warren M. Grill and Dennis A. Turner and Miroslav Pajic}, title = {Offline Learning of Closed-Loop Deep Brain Stimulation Controllers for Parkinson Disease Treatment}, journal = {CoRR}, volume = {abs/2302.02477}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2302.02477}, doi = {10.48550/ARXIV.2302.02477}, eprinttype = {arXiv}, eprint = {2302.02477}, timestamp = {Fri, 10 Feb 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2302-02477.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2302-14822, author = {Sean Tull and Razin A. Shaikh and Sara Sabrina Zemljic and Stephen Clark}, title = {Formalising and Learning a Quantum Model of Concepts}, journal = {CoRR}, volume = {abs/2302.14822}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2302.14822}, doi = {10.48550/ARXIV.2302.14822}, eprinttype = {arXiv}, eprint = {2302.14822}, timestamp = {Thu, 02 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2302-14822.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2304-01778, author = {Zbynek Koldovsk{\'{y}} and Jaroslav Cmejla and T{\"{u}}lay Adali and Stephen O'Regan}, title = {Independent Vector Extraction Constrained on Manifold of Half-Length Filters}, journal = {CoRR}, volume = {abs/2304.01778}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2304.01778}, doi = {10.48550/ARXIV.2304.01778}, eprinttype = {arXiv}, eprint = {2304.01778}, timestamp = {Thu, 20 Apr 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2304-01778.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2304-03949, author = {Sathya R. Chitturi and Zhurun Ji and Alexander Petsch and Cheng Peng and Zhantao Chen and Rajan Plumley and Mike Dunne and Sougata Mardanya and Sugata Chowdhury and Hongwei Chen and Arun Bansil and Adrian E. Feiguin and Alexander Kolesnikov and Dharmalingam Prabhakaran and Stephen Hayden and Daniel Ratner and Chunjing Jia and Youssef Nashed and Joshua J. Turner}, title = {Capturing dynamical correlations using implicit neural representations}, journal = {CoRR}, volume = {abs/2304.03949}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2304.03949}, doi = {10.48550/ARXIV.2304.03949}, eprinttype = {arXiv}, eprint = {2304.03949}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2304-03949.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2304-04425, author = {Rakpong Kaewpuang and Minrui Xu and Stephen John Turner and Dusit Niyato and Han Yu and Dong In Kim}, title = {Entangled Pair Resource Allocation under Uncertain Fidelity Requirements}, journal = {CoRR}, volume = {abs/2304.04425}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2304.04425}, doi = {10.48550/ARXIV.2304.04425}, eprinttype = {arXiv}, eprint = {2304.04425}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2304-04425.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2304-04640, author = {Jason Yik and Soikat Hasan Ahmed and Zergham Ahmed and Brian Anderson and Andreas G. Andreou and Chiara Bartolozzi and Arindam Basu and Douwe den Blanken and Petrut Bogdan and Sander M. Boht{\'{e}} and Younes Bouhadjar and Sonia M. Buckley and Gert Cauwenberghs and Federico Corradi and Guido de Croon and Andreea Danielescu and Anurag Reddy Daram and Mike Davies and Yigit Demirag and Jason Eshraghian and Jeremy Forest and Steve B. Furber and Michael Furlong and Aditya Gilra and Giacomo Indiveri and Siddharth Joshi and Vedant Karia and Lyes Khacef and James C. Knight and Laura Kriener and Rajkumar Kubendran and Dhireesha Kudithipudi and Gregor Lenz and Rajit Manohar and Christian Mayr and Konstantinos P. Michmizos and Dylan R. Muir and Emre Neftci and Thomas Nowotny and Fabrizio Ottati and Ay{\c{c}}a {\"{O}}zcelikkale and Noah Pacik{-}Nelson and Priyadarshini Panda and Pao{-}Sheng Sun and Melika Payvand and Christian Pehle and Mihai A. Petrovici and Christoph Posch and Alpha Renner and Yulia Sandamirskaya and Clemens JS Schaefer and Andr{\'{e}} van Schaik and Johannes Schemmel and Catherine D. Schuman and Jae{-}sun Seo and Sumit Bam Shrestha and Manolis Sifalakis and Amos Sironi and Kenneth Michael Stewart and Terrence C. Stewart and Philipp Stratmann and Guangzhi Tang and Jonathan Timcheck and Marian Verhelst and Craig M. Vineyard and Bernhard Vogginger and Amirreza Yousefzadeh and Biyan Zhou and Fatima Tuz Zohora and Charlotte Frenkel and Vijay Janapa Reddi}, title = {NeuroBench: Advancing Neuromorphic Computing through Collaborative, Fair and Representative Benchmarking}, journal = {CoRR}, volume = {abs/2304.04640}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2304.04640}, doi = {10.48550/ARXIV.2304.04640}, eprinttype = {arXiv}, eprint = {2304.04640}, timestamp = {Fri, 18 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2304-04640.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2305-05108, author = {Uchenna Daniel Ani and Jeremy M. Watson and Nilufer Tuptuk and Steve Hailes and Aslam Jawar}, title = {Socio-Technical Security Modelling: Analysis of State-of-the-Art, Application, and Maturity in Critical Industrial Infrastructure Environments/Domains}, journal = {CoRR}, volume = {abs/2305.05108}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2305.05108}, doi = {10.48550/ARXIV.2305.05108}, eprinttype = {arXiv}, eprint = {2305.05108}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2305-05108.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2305-09617, author = {Karan Singhal and Tao Tu and Juraj Gottweis and Rory Sayres and Ellery Wulczyn and Le Hou and Kevin Clark and Stephen Pfohl and Heather Cole{-}Lewis and Darlene Neal and Mike Schaekermann and Amy Wang and Mohamed Amin and Sami Lachgar and Philip Andrew Mansfield and Sushant Prakash and Bradley Green and Ewa Dominowska and Blaise Ag{\"{u}}era y Arcas and Nenad Tomasev and Yun Liu and Renee Wong and Christopher Semturs and S. Sara Mahdavi and Joelle K. Barral and Dale R. Webster and Gregory S. Corrado and Yossi Matias and Shekoofeh Azizi and Alan Karthikesalingam and Vivek Natarajan}, title = {Towards Expert-Level Medical Question Answering with Large Language Models}, journal = {CoRR}, volume = {abs/2305.09617}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2305.09617}, doi = {10.48550/ARXIV.2305.09617}, eprinttype = {arXiv}, eprint = {2305.09617}, timestamp = {Wed, 06 Nov 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2305-09617.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2305-09619, author = {Daniel Pfrommer and Max Simchowitz and Tyler Westenbroek and Nikolai Matni and Stephen Tu}, title = {The Power of Learned Locally Linear Models for Nonlinear Policy Optimization}, journal = {CoRR}, volume = {abs/2305.09619}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2305.09619}, doi = {10.48550/ARXIV.2305.09619}, eprinttype = {arXiv}, eprint = {2305.09619}, timestamp = {Wed, 24 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2305-09619.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2305-11165, author = {Ingvar M. Ziemann and Stephen Tu and George J. Pappas and Nikolai Matni}, title = {The noise level in linear regression with dependent data}, journal = {CoRR}, volume = {abs/2305.11165}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2305.11165}, doi = {10.48550/ARXIV.2305.11165}, eprinttype = {arXiv}, eprint = {2305.11165}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2305-11165.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2305-12284, author = {Amir Ali Ahmadi and Abraar Chaudhry and Vikas Sindhwani and Stephen Tu}, title = {Safely Learning Dynamical Systems}, journal = {CoRR}, volume = {abs/2305.12284}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2305.12284}, doi = {10.48550/ARXIV.2305.12284}, eprinttype = {arXiv}, eprint = {2305.12284}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2305-12284.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2306-05216, author = {Brian Hu Zhang and Gabriele Farina and Ioannis Anagnostides and Federico Cacciamani and Stephen Marcus McAleer and Andreas Alexander Haupt and Andrea Celli and Nicola Gatti and Vincent Conitzer and Tuomas Sandholm}, title = {Computing Optimal Equilibria and Mechanisms via Learning in Zero-Sum Extensive-Form Games}, journal = {CoRR}, volume = {abs/2306.05216}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2306.05216}, doi = {10.48550/ARXIV.2306.05216}, eprinttype = {arXiv}, eprint = {2306.05216}, timestamp = {Wed, 14 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2306-05216.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2306-05221, author = {Brian Hu Zhang and Gabriele Farina and Ioannis Anagnostides and Federico Cacciamani and Stephen Marcus McAleer and Andreas Alexander Haupt and Andrea Celli and Nicola Gatti and Vincent Conitzer and Tuomas Sandholm}, title = {Steering No-Regret Learners to Optimal Equilibria}, journal = {CoRR}, volume = {abs/2306.05221}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2306.05221}, doi = {10.48550/ARXIV.2306.05221}, eprinttype = {arXiv}, eprint = {2306.05221}, timestamp = {Wed, 14 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2306-05221.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2306-08205, author = {Saminda Abeyruwan and Alex Bewley and Nicholas M. Boffi and Krzysztof Choromanski and David B. D'Ambrosio and Deepali Jain and Pannag Sanketi and Anish Shankar and Vikas Sindhwani and Sumeet Singh and Jean{-}Jacques E. Slotine and Stephen Tu}, title = {Agile Catching with Whole-Body {MPC} and Blackbox Policy Learning}, journal = {CoRR}, volume = {abs/2306.08205}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2306.08205}, doi = {10.48550/ARXIV.2306.08205}, eprinttype = {arXiv}, eprint = {2306.08205}, timestamp = {Sun, 18 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2306-08205.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2306-10171, author = {Charline Le Lan and Stephen Tu and Mark Rowland and Anna Harutyunyan and Rishabh Agarwal and Marc G. Bellemare and Will Dabney}, title = {Bootstrapped Representations in Reinforcement Learning}, journal = {CoRR}, volume = {abs/2306.10171}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2306.10171}, doi = {10.48550/ARXIV.2306.10171}, eprinttype = {arXiv}, eprint = {2306.10171}, timestamp = {Wed, 02 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2306-10171.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2307-01928, author = {Allen Z. Ren and Anushri Dixit and Alexandra Bodrova and Sumeet Singh and Stephen Tu and Noah Brown and Peng Xu and Leila Takayama and Fei Xia and Jake Varley and Zhenjia Xu and Dorsa Sadigh and Andy Zeng and Anirudha Majumdar}, title = {Robots That Ask For Help: Uncertainty Alignment for Large Language Model Planners}, journal = {CoRR}, volume = {abs/2307.01928}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2307.01928}, doi = {10.48550/ARXIV.2307.01928}, eprinttype = {arXiv}, eprint = {2307.01928}, timestamp = {Tue, 12 Nov 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2307-01928.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2307-12062, author = {Yongyuan Liang and Yanchao Sun and Ruijie Zheng and Xiangyu Liu and Tuomas Sandholm and Furong Huang and Stephen McAleer}, title = {Game-Theoretic Robust Reinforcement Learning Handles Temporally-Coupled Perturbations}, journal = {CoRR}, volume = {abs/2307.12062}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2307.12062}, doi = {10.48550/ARXIV.2307.12062}, eprinttype = {arXiv}, eprint = {2307.12062}, timestamp = {Tue, 01 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2307-12062.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2309-05803, author = {Sumeet Singh and Stephen Tu and Vikas Sindhwani}, title = {Revisiting Energy Based Models as Policies: Ranking Noise Contrastive Estimation and Interpolating Energy Models}, journal = {CoRR}, volume = {abs/2309.05803}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2309.05803}, doi = {10.48550/ARXIV.2309.05803}, eprinttype = {arXiv}, eprint = {2309.05803}, timestamp = {Fri, 15 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2309-05803.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2310-04373, author = {Ted Moskovitz and Aaditya K. Singh and DJ Strouse and Tuomas Sandholm and Ruslan Salakhutdinov and Anca D. Dragan and Stephen McAleer}, title = {Confronting Reward Model Overoptimization with Constrained {RLHF}}, journal = {CoRR}, volume = {abs/2310.04373}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2310.04373}, doi = {10.48550/ARXIV.2310.04373}, eprinttype = {arXiv}, eprint = {2310.04373}, timestamp = {Fri, 20 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2310-04373.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2312-07843, author = {Roya Firoozi and Johnathan Tucker and Stephen Tian and Anirudha Majumdar and Jiankai Sun and Weiyu Liu and Yuke Zhu and Shuran Song and Ashish Kapoor and Karol Hausman and Brian Ichter and Danny Driess and Jiajun Wu and Cewu Lu and Mac Schwager}, title = {Foundation Models in Robotics: Applications, Challenges, and the Future}, journal = {CoRR}, volume = {abs/2312.07843}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2312.07843}, doi = {10.48550/ARXIV.2312.07843}, eprinttype = {arXiv}, eprint = {2312.07843}, timestamp = {Wed, 12 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2312-07843.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/AleneziH22, author = {Turki Alenezi and Stephen C. Hirtle}, title = {Normalized Attraction Travel Personality Representation for Improving Travel Recommender Systems}, journal = {{IEEE} Access}, volume = {10}, pages = {56493--56503}, year = {2022}, url = {https://doi.org/10.1109/ACCESS.2022.3178439}, doi = {10.1109/ACCESS.2022.3178439}, timestamp = {Mon, 13 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/AleneziH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aim/BaruPABCCFFJLLL22, author = {Chaitanya K. Baru and Michael Pozmantier and Ilkay Altintas and Stephen Baek and Jonathan Cohen and Laura E. Condon and Giulia Fanti and Raul Castro Fernandez and Ethan Jackson and Upmanu Lall and Bennett A. Landman and Hai Li and Claudia Marin and Beatriz Mart{\'{\i}}nez{-}L{\'{o}}pez and Dimitris N. Metaxas and Bradley D. Olsen and Grier P. Page and Yelda Turkan and Jingbo Zhang and Peng Zhang}, title = {Enabling {AI} Innovation via Data and Model Sharing: An Overview of the Nsf Convergence Accelerator Track {D}}, journal = {{AI} Mag.}, volume = {43}, number = {1}, pages = {93--104}, year = {2022}, url = {https://doi.org/10.1609/aimag.v43i1.19130}, doi = {10.1609/AIMAG.V43I1.19130}, timestamp = {Wed, 06 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/aim/BaruPABCCFFJLLL22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fdgth/HabererBTTTTMGDMA22, author = {Jessica E. Haberer and Robert Baijuka and John Bosco Tumuhairwe and Edna B. Tindimwebwa and James Tinkamanyire and Ellyk Tuhanamagyezi and Lawrence Musoke and Lindsey E. Garrison and Marisa Delsignore and Nicholas Musinguzi and Stephen Asiimwe}, title = {Implementation of Electronic Adherence Monitors and Associated Interventions for Routine {HIV} Antiretroviral Therapy in Uganda: Promising Findings}, journal = {Frontiers Digit. Health}, volume = {4}, year = {2022}, url = {https://doi.org/10.3389/fdgth.2022.899643}, doi = {10.3389/FDGTH.2022.899643}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/fdgth/HabererBTTTTMGDMA22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijhpca/TurnerBBBCCDFHJ22, author = {John A. Turner and James F. Belak and Nathan Barton and Matthew T. Bement and Neil N. Carlson and Robert Carson and Stephen Dewitt and Jean{-}Luc Fattebert and Neil Eugene Hodge and Zechariah Jibben and Wayne E. King and Lyle Levine and Christopher K. Newman and Alex Plotkowski and Balasubramaniam Radhakrishnan and Samuel Temple Reeve and Matthew Rolchigo and Adrian S. Sabau and Stuart R. Slattery and Benjamin Stump}, title = {ExaAM: Metal additive manufacturing simulation at the fidelity of the microstructure}, journal = {Int. J. High Perform. Comput. Appl.}, volume = {36}, number = {1}, pages = {13--39}, year = {2022}, url = {https://doi.org/10.1177/10943420211042558}, doi = {10.1177/10943420211042558}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijhpca/TurnerBBBCCDFHJ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/iotj/NgoenriangTNS22, author = {Napat Ngoenriang and Stephen John Turner and Dusit Niyato and Sucha Supittayapornpong}, title = {Joint {UAV} Placement and Data Delivery in Aerial Inspection Under Uncertainties}, journal = {{IEEE} Internet Things J.}, volume = {9}, number = {9}, pages = {6389--6403}, year = {2022}, url = {https://doi.org/10.1109/JIOT.2021.3113713}, doi = {10.1109/JIOT.2021.3113713}, timestamp = {Wed, 18 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/iotj/NgoenriangTNS22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcphy/WaltersTF22, author = {Stephen J. Walters and Ross J. Turner and Lawrence K. Forbes}, title = {Computing interfacial flows of viscous fluids}, journal = {J. Comput. Phys.}, volume = {471}, pages = {111626}, year = {2022}, url = {https://doi.org/10.1016/j.jcp.2022.111626}, doi = {10.1016/J.JCP.2022.111626}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jcphy/WaltersTF22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jmlr/BoffiTS22, author = {Nicholas M. Boffi and Stephen Tu and Jean{-}Jacques E. Slotine}, title = {Nonparametric adaptive control and prediction: theory and randomized algorithms}, journal = {J. Mach. Learn. Res.}, volume = {23}, pages = {281:1--281:46}, year = {2022}, url = {https://jmlr.org/papers/v23/22-0022.html}, timestamp = {Wed, 11 Sep 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jmlr/BoffiTS22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jssc/MaiDKTBGCBSK22, author = {Dawei Mai and Yann Donnelly and Michael Peter Kennedy and Stefano Tulisi and James Breslin and Patrick Griffin and Michael Connor and Stephen Brookes and Brian Shelly and Mike Keaveney}, title = {Wandering Spur Suppression in a 4.9-GHz Fractional-N Frequency Synthesizer}, journal = {{IEEE} J. Solid State Circuits}, volume = {57}, number = {7}, pages = {2011--2023}, year = {2022}, url = {https://doi.org/10.1109/JSSC.2022.3163080}, doi = {10.1109/JSSC.2022.3163080}, timestamp = {Thu, 27 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jssc/MaiDKTBGCBSK22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jssc/MehtaTTTGG22, author = {Nandish Mehta and Stephen G. Tell and Walker J. Turner and Lamar Tatro and Jih Ren Goh and C. Thomas Gray}, title = {An On-Chip Relaxation Oscillator in 5-nm FinFET Using a Frequency-Error Feedback Loop}, journal = {{IEEE} J. Solid State Circuits}, volume = {57}, number = {10}, pages = {2898--2908}, year = {2022}, url = {https://doi.org/10.1109/JSSC.2022.3183208}, doi = {10.1109/JSSC.2022.3183208}, timestamp = {Tue, 18 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jssc/MehtaTTTGG22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/CunninghamAAAAA22, author = {Fiona Cunningham and James E. Allen and Jamie Allen and Jorge {\'{A}}lvarez{-}Jarreta and M. Ridwan Amode and Irina M. Armean and Olanrewaju Austine{-}Orimoloye and Andrey G. Azov and If Barnes and Ruth Bennett and Andrew E. Berry and Jyothish Bhai and Alexandra Bignell and Konstantinos Billis and Sanjay Boddu and Lucy Brooks and Mehrnaz Charkhchi and Carla A. Cummins and Luca Da Rin Fioretto and Claire Davidson and Kamalkumar Jayantilal Dodiya and Sarah M. Donaldson and Bilal El Houdaigui and Tamara El Naboulsi and Reham Fatima and Carlos Garc{\'{\i}}a{-}Gir{\'{o}}n and Thiago A. L. Genez and Jose Gonzalez Martinez and Cristina Guijarro{-}Clarke and Arthur Gymer and Matthew Hardy and Zoe Hollis and Thibaut Hourlier and Toby Hunt and Thomas Juettemann and Vinay Kaikala and Mike P. Kay and Ilias Lavidas and Tuan Le and Diana Lemos and Jos{\'{e}} Carlos Marug{\'{a}}n and Shamika Mohanan and Aleena Mushtaq and Marc Naven and Denye N. Oheh and Anne Parker and Andrew Parton and Malcolm Perry and Ivana Pilizota and Irina Prosovetskaia and Manoj Pandian Sakthivel and Ahamed Imran Abdul Salam and Bianca M. Schmitt and Helen Schuilenburg and Dan Sheppard and Jos{\'{e}} G. P{\'{e}}rez{-}Silva and William Stark and Emily Steed and Ky{\"{o}}sti Sutinen and Ranjit Sukumaran and Dulika Sumathipala and Marie{-}Marthe Suner and Michal Szpak and Anja Thormann and Francesca Floriana Tricomi and David Urbina{-}G{\'{o}}mez and Andres Veidenberg and Thomas A. Walsh and Brandon Walts and Natalie L. Willhoft and Andrea Winterbottom and Elizabeth Wass and Marc Chakiachvili and Bethany Flint and Adam Frankish and Stefano Giorgetti and Leanne Haggerty and Sarah E. Hunt and Garth IIsley and Jane E. Loveland and Fergal J. Martin and Benjamin Moore and Jonathan M. Mudge and Matthieu Muffato and Emily Perry and Magali Ruffier and John G. Tate and David Thybert and Stephen J. Trevanion and Sarah Dyer and Peter W. Harrison and Kevin L. Howe and Andrew D. Yates and Daniel R. Zerbino and Paul Flicek}, title = {Ensembl 2022}, journal = {Nucleic Acids Res.}, volume = {50}, number = {{D1}}, pages = {988--995}, year = {2022}, url = {https://doi.org/10.1093/nar/gkab1049}, doi = {10.1093/NAR/GKAB1049}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/CunninghamAAAAA22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/VaradiADNNYYSWL22, author = {Mihaly Varadi and Stephen Anyango and Mandar S. Deshpande and Sreenath Nair and Cindy Natassia and Galabina Yordanova and David Yuan and Oana Stroe and Gemma Wood and Agata Laydon and Augustin Z{\'{\i}}dek and Tim Green and Kathryn Tunyasuvunakool and Stig Petersen and John Jumper and Ellen Clancy and Richard Green and Ankur Vora and Mira Lutfi and Michael Figurnov and Andrew Cowie and Nicole Hobbs and Pushmeet Kohli and Gerard J. Kleywegt and Ewan Birney and Demis Hassabis and Sameer Velankar}, title = {AlphaFold Protein Structure Database: massively expanding the structural coverage of protein-sequence space with high-accuracy models}, journal = {Nucleic Acids Res.}, volume = {50}, number = {{D1}}, pages = {439--444}, year = {2022}, url = {https://doi.org/10.1093/nar/gkab1061}, doi = {10.1093/NAR/GKAB1061}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/VaradiADNNYYSWL22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/YatesAAABBBCMCC22, author = {Andrew D. Yates and James E. Allen and M. Ridwan Amode and Andrey G. Azov and Matthieu Barba and Andr{\'{e}}s Becerra and Jyothish Bhai and Lahcen I. Campbell and Manuel Carbajo Martinez and Marc Chakiachvili and Kapeel Chougule and Mikkel B. Christensen and Bruno Contreras{-}Moreira and Alayne Cuzick and Luca Da Rin Fioretto and Paul Davis and Nishadi De Silva and Stavros Diamantakis and Sarah Dyer and Justin Elser and Carla V. Filippi and Astrid Gall and Dionysios Grigoriadis and Cristina Guijarro{-}Clarke and Parul Gupta and Kim E. Hammond{-}Kosack and Kevin L. Howe and Pankaj Jaiswal and Vinay Kaikala and Vivek Kumar and Sunita Kumari and Nick Langridge and Tuan Le and Manuel Luypaert and Gareth Maslen and Thomas Maurel and Benjamin Moore and Matthieu Muffato and Aleena Mushtaq and Guy Naamati and Sushma Naithani and Andrew Olson and Anne Parker and Michael Paulini and Helder Pedro and Emily Perry and Justin Preece and Mark Quinton{-}Tulloch and Faye Rodgers and Marc Rosello and Magali Ruffier and James Seager and Vasily Sitnik and Michal Szpak and John G. Tate and Marcela K. Tello{-}Ruiz and Stephen J. Trevanion and Martin Urban and Doreen Ware and Sharon Wei and Gary Williams and Andrea Winterbottom and Magdalena Zarowiecki and Robert D. Finn and Paul Flicek}, title = {Ensembl Genomes 2022: an expanding genome resource for non-vertebrates}, journal = {Nucleic Acids Res.}, volume = {50}, number = {{D1}}, pages = {996--1003}, year = {2022}, url = {https://doi.org/10.1093/nar/gkab1007}, doi = {10.1093/NAR/GKAB1007}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/YatesAAABBBCMCC22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/neuroimage/WallacePBMZSMLT22, author = {Grant Wallace and Stephen Polcyn and Paula P. Brooks and Anne C. Mennen and Ke Zhao and Paul S. Scotti and Sebastian Michelmann and Kai Li and Nicholas B. Turk{-}Browne and Jonathan D. Cohen and Kenneth A. Norman}, title = {RT-Cloud: {A} cloud-based software framework to simplify and standardize real-time fMRI}, journal = {NeuroImage}, volume = {257}, pages = {119295}, year = {2022}, url = {https://doi.org/10.1016/j.neuroimage.2022.119295}, doi = {10.1016/J.NEUROIMAGE.2022.119295}, timestamp = {Thu, 30 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/neuroimage/WallacePBMZSMLT22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/neuroimage/ZhangCZTXSWCW22, author = {Gemeng Zhang and Biao Cai and Aiying Zhang and Zhuozhuo Tu and Li Xiao and Julia M. Stephen and Tony W. Wilson and Vince D. Calhoun and Yu{-}Ping Wang}, title = {Detecting abnormal connectivity in schizophrenia via a joint directed acyclic graph estimation model}, journal = {NeuroImage}, volume = {260}, pages = {119451}, year = {2022}, url = {https://doi.org/10.1016/j.neuroimage.2022.119451}, doi = {10.1016/J.NEUROIMAGE.2022.119451}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/neuroimage/ZhangCZTXSWCW22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/spm/AdaliGHMS22, author = {T{\"{u}}lay Adali and Rodrigo Capobianco Guido and Tin Kam Ho and Klaus{-}Robert M{\"{u}}ller and Stephen C. Strother}, title = {Interpretability, Reproducibility, and Replicability [From the Guest Editors]}, journal = {{IEEE} Signal Process. Mag.}, volume = {39}, number = {4}, pages = {5--7}, year = {2022}, url = {https://doi.org/10.1109/MSP.2022.3170665}, doi = {10.1109/MSP.2022.3170665}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/spm/AdaliGHMS22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/spm/AdaliKASCA22, author = {T{\"{u}}lay Adali and Furkan Kantar and Mohammad Abu Baker Siddique Akhonda and Stephen C. Strother and Vince D. Calhoun and Evrim Acar}, title = {Reproducibility in Matrix and Tensor Decompositions: Focus on model match, interpretability, and uniqueness}, journal = {{IEEE} Signal Process. Mag.}, volume = {39}, number = {4}, pages = {8--24}, year = {2022}, url = {https://doi.org/10.1109/MSP.2022.3163870}, doi = {10.1109/MSP.2022.3163870}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/spm/AdaliKASCA22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcc/HollimanACDJT22, author = {Nicolas S. Holliman and Manu Antony and James Charlton and Stephen Dowsland and Philip James and Mark Turner}, title = {Petascale Cloud Supercomputing for Terapixel Visualization of a Digital Twin}, journal = {{IEEE} Trans. Cloud Comput.}, volume = {10}, number = {1}, pages = {583--594}, year = {2022}, url = {https://doi.org/10.1109/TCC.2019.2958087}, doi = {10.1109/TCC.2019.2958087}, timestamp = {Fri, 01 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcc/HollimanACDJT22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tse/KuhrmannTHKMLPF22, author = {Marco Kuhrmann and Paolo Tell and Regina Hebig and Jil Kl{\"{u}}nder and J{\"{u}}rgen M{\"{u}}nch and Oliver Linssen and Dietmar Pfahl and Michael Felderer and Christian R. Prause and Stephen G. MacDonell and Joyce Nakatumba{-}Nabende and David Raffo and Sarah Beecham and Eray T{\"{u}}z{\"{u}}n and Gustavo L{\'{o}}pez and Nicol{\'{a}}s Paez and Diego Fontdevila and Sherlock A. Licorish and Steffen K{\"{u}}pper and G{\"{u}}nther Ruhe and Eric Knauss and {\"{O}}zden {\"{O}}zcan{-}Top and Paul M. Clarke and Fergal McCaffery and Marcela Genero and Aurora Vizca{\'{\i}}no and Mario Piattini and Marcos Kalinowski and Tayana Conte and Rafael Prikladnicki and Stephan Krusche and Ahmet Coskun{\c{c}}ay and Ezequiel Scott and Fabio Calefato and Svetlana Pimonova and Rolf{-}Helge Pfeiffer and Ulrik Pagh Schultz and Rogardt Heldal and Masud Fazal{-}Baqaie and Craig Anslow and Maleknaz Nayebi and Kurt Schneider and Stefan Sauer and Dietmar Winkler and Stefan Biffl and Mar{\'{\i}}a Cecilia Bastarrica and Ita Richardson}, title = {What Makes Agile Software Development Agile?}, journal = {{IEEE} Trans. Software Eng.}, volume = {48}, number = {9}, pages = {3523--3539}, year = {2022}, url = {https://doi.org/10.1109/TSE.2021.3099532}, doi = {10.1109/TSE.2021.3099532}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tse/KuhrmannTHKMLPF22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acis/Lam0S22, author = {Yuk Tung Tonnie Lam and Peter Busch and Stephen Smith}, title = {Australia's Embrace of a Cashless Society: {A} Quantitative Analysis}, booktitle = {Australasian Conference on Information Systems, {ACIS} 2022, Melbourne, Australia, December 4-7, 2022}, pages = {24}, year = {2022}, url = {https://aisel.aisnet.org/acis2022/24}, timestamp = {Thu, 16 May 2024 17:06:12 +0200}, biburl = {https://dblp.org/rec/conf/acis/Lam0S22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl-louhi/TuDC22, author = {Sichang Tu and Stephen Doogan and Jinho D. Choi}, editor = {Alberto Lavelli and Eben Holderness and Antonio Jimeno{-}Yepes and Anne{-}Lyse Minard and James Pustejovsky and Fabio Rinaldi}, title = {Condition-Treatment Relation Extraction on Disease-related Social Media Data}, booktitle = {Proceedings of the 13th International Workshop on Health Text Mining and Information Analysis, LOUHI@EMNLP 2022, Abu Dhabi, United Arab Emirates (Hybrid), December 7, 2022}, pages = {218--228}, publisher = {Association for Computational Linguistics}, year = {2022}, url = {https://doi.org/10.18653/v1/2022.louhi-1.24}, doi = {10.18653/V1/2022.LOUHI-1.24}, timestamp = {Thu, 10 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl-louhi/TuDC22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aistats/BoffiTS22, author = {Nicholas M. Boffi and Stephen Tu and Jean{-}Jacques E. Slotine}, editor = {Gustau Camps{-}Valls and Francisco J. R. Ruiz and Isabel Valera}, title = {The role of optimization geometry in single neuron learning}, booktitle = {International Conference on Artificial Intelligence and Statistics, {AISTATS} 2022, 28-30 March 2022, Virtual Event}, series = {Proceedings of Machine Learning Research}, volume = {151}, pages = {11528--11549}, publisher = {{PMLR}}, year = {2022}, url = {https://proceedings.mlr.press/v151/boffi22a.html}, timestamp = {Sat, 30 Sep 2023 09:34:08 +0200}, biburl = {https://dblp.org/rec/conf/aistats/BoffiTS22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aistats/LanTOAB22, author = {Charline Le Lan and Stephen Tu and Adam Oberman and Rishabh Agarwal and Marc G. Bellemare}, editor = {Gustau Camps{-}Valls and Francisco J. R. Ruiz and Isabel Valera}, title = {On the Generalization of Representations in Reinforcement Learning}, booktitle = {International Conference on Artificial Intelligence and Statistics, {AISTATS} 2022, 28-30 March 2022, Virtual Event}, series = {Proceedings of Machine Learning Research}, volume = {151}, pages = {4132--4157}, publisher = {{PMLR}}, year = {2022}, url = {https://proceedings.mlr.press/v151/le-lan22a.html}, timestamp = {Fri, 20 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aistats/LanTOAB22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aistats/ShengCCSJ22, author = {Stephen Sheng and Keerthi Vasan G. C and Chi Po P. Choi and James Sharpnack and Tucker Jones}, editor = {Gustau Camps{-}Valls and Francisco J. R. Ruiz and Isabel Valera}, title = {An Unsupervised Hunt for Gravitational Lenses}, booktitle = {International Conference on Artificial Intelligence and Statistics, {AISTATS} 2022, 28-30 March 2022, Virtual Event}, series = {Proceedings of Machine Learning Research}, volume = {151}, pages = {9827--9843}, publisher = {{PMLR}}, year = {2022}, url = {https://proceedings.mlr.press/v151/sheng22a.html}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aistats/ShengCCSJ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amia/WangWAALMRTT0S22, author = {Xiaochen Wang and Yue Wang and Jos{\'{e}} Luis Ambite and Abhishek M. Appaji and Howard Lander and Stephen Moore and Arcot Rajasekar and Jessica A. D. Turner and Matthew D. Turner and Lei Wang and Satya S. Sahoo}, title = {Enabling Scientific Reproducibility through {FAIR} Data Management: An ontology-driven deep learning approach in the NeuroBridge Project}, booktitle = {{AMIA} 2022, American Medical Informatics Association Annual Symposium, Washington, DC, USA, November 5-9, 2022}, publisher = {{AMIA}}, year = {2022}, url = {https://knowledge.amia.org/76677-amia-1.4637602/f006-1.4642154/f006-1.4642155/1055-1.4642198/1165-1.4642195}, timestamp = {Wed, 14 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amia/WangWAALMRTT0S22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/XiaoZCLFVTSXXPK22, author = {Xuesu Xiao and Tingnan Zhang and Krzysztof Marcin Choromanski and Tsang{-}Wei Edward Lee and Anthony G. Francis and Jake Varley and Stephen Tu and Sumeet Singh and Peng Xu and Fei Xia and Sven Mikael Persson and Dmitry Kalashnikov and Leila Takayama and Roy Frostig and Jie Tan and Carolina Parada and Vikas Sindhwani}, editor = {Karen Liu and Dana Kulic and Jeffrey Ichnowski}, title = {Learning Model Predictive Controllers with Real-Time Attention for Real-World Navigation}, booktitle = {Conference on Robot Learning, CoRL 2022, 14-18 December 2022, Auckland, New Zealand}, series = {Proceedings of Machine Learning Research}, volume = {205}, pages = {1708--1721}, publisher = {{PMLR}}, year = {2022}, url = {https://proceedings.mlr.press/v205/xiao23a.html}, timestamp = {Tue, 12 Nov 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/corl/XiaoZCLFVTSXXPK22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/WangNSLZHL22, author = {Ziyan Wang and Giljoo Nam and Tuur Stuyck and Stephen Lombardi and Michael Zollh{\"{o}}fer and Jessica K. Hodgins and Christoph Lassner}, title = {{HVH:} Learning a Hybrid Neural Volumetric Representation for Dynamic Hair Performance Capture}, booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2022, New Orleans, LA, USA, June 18-24, 2022}, pages = {6133--6144}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/CVPR52688.2022.00605}, doi = {10.1109/CVPR52688.2022.00605}, timestamp = {Wed, 05 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/WangNSLZHL22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/data/OdebodeTAS22, author = {Afees Adegoke Odebode and Allan Tucker and Mahir Arzoky and Stephen Swift}, editor = {Alfredo Cuzzocrea and Oleg Gusikhin and Wil M. P. van der Aalst and Slimane Hammoudi}, title = {Estimating the Optimal Number of Clusters from Subsets of Ensembles}, booktitle = {Proceedings of the 11th International Conference on Data Science, Technology and Applications, {DATA} 2022, Lisbon, Portugal, July 11-13, 2022}, pages = {383--391}, publisher = {{SCITEPRESS}}, year = {2022}, url = {https://doi.org/10.5220/0011275000003269}, doi = {10.5220/0011275000003269}, timestamp = {Tue, 06 Jun 2023 14:58:01 +0200}, biburl = {https://dblp.org/rec/conf/data/OdebodeTAS22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/embc/BoonyakitanontG22, author = {Poomipat Boonyakitanont and Ben Gabrielson and Irina Belyaeva and Parthan Olikkal and Jitkomut Songsiri and Yu{-}Ping Wang and Tony W. Wilson and Vince D. Calhoun and Julia M. Stephen and T{\"{u}}lay Adali}, title = {An ICA-based framework for joint analysis of cognitive scores and {MEG} event-related fields}, booktitle = {44th Annual International Conference of the {IEEE} Engineering in Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland, United Kingdom, July 11-15, 2022}, pages = {3594--3598}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/EMBC48229.2022.9871122}, doi = {10.1109/EMBC48229.2022.9871122}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/embc/BoonyakitanontG22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/embc/RojasSCPTW22, author = {Erick Rojas and Stephen L. Schmidt and Afsana Chowdhury and Miroslav Pajic and Dennis A. Turner and Deborah S. Won}, title = {A comparison of an implanted accelerometer with a wearable accelerometer for closed-loop {DBS}}, booktitle = {44th Annual International Conference of the {IEEE} Engineering in Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland, United Kingdom, July 11-15, 2022}, pages = {3439--3442}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/EMBC48229.2022.9871232}, doi = {10.1109/EMBC48229.2022.9871232}, timestamp = {Thu, 22 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/embc/RojasSCPTW22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccps/GaoSKTGP22, author = {Qitong Gao and Stephen L. Schmidt and Karthik Kamaravelu and Dennis A. Turner and Warren M. Grill and Miroslav Pajic}, title = {Offline Policy Evaluation for Learning-based Deep Brain Stimulation Controllers}, booktitle = {13th {ACM/IEEE} International Conference on Cyber-Physical Systems, {ICCPS} 2022, Milano, Italy, May 4-6, 2022}, pages = {80--91}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/ICCPS54341.2022.00014}, doi = {10.1109/ICCPS54341.2022.00014}, timestamp = {Wed, 29 Jun 2022 17:24:41 +0200}, biburl = {https://dblp.org/rec/conf/iccps/GaoSKTGP22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icdh/TurnerSH22, author = {Alexander P. Turner and David Scott and Stephen Hayes}, editor = {Sheikh Iqbal Ahamed and Claudio Agostino Ardagna and Hongyi Bian and Mario A. Bochicchio and Carl K. Chang and Rong N. Chang and Ernesto Damiani and Lin Liu and Misha Pavel and Corrado Priami and Hossain Shahriar and Robert Ward and Fatos Xhafa and Jia Zhang and Farhana H. Zulkernine}, title = {The Classification of Multiple Interacting Gait Abnormalities Using Insole Sensors and Machine Learning}, booktitle = {{IEEE} International Conference on Digital Health, {ICDH} 2022, Barcelona, Spain, July 10-16, 2022}, pages = {69--76}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/ICDH55609.2022.00020}, doi = {10.1109/ICDH55609.2022.00020}, timestamp = {Tue, 20 Aug 2024 07:54:45 +0200}, biburl = {https://dblp.org/rec/conf/icdh/TurnerSH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icimth/BranescuaST22, author = {Marinela Branescu and Stephen Swift and Allan Tucker}, editor = {John Mantas and Parisis Gallos and Emmanouil Zoulias and Arie Hasman and Mowafa S. Househ and Marianna Diomidous and Joseph Liaskos and Martha Charalampidou}, title = {A Comparison of Convolutional Neural Networks and Traditional Feature-Based Classification Applied to Leukaemia Image Analysis}, booktitle = {Advances in Informatics, Management and Technology in Healthcare, {ICIMTH} 2022, 20th International Conference on Informatics, Management, and Technology in Healthcare, Virtual Event / Athens, Greece, 1-3 July 2022}, series = {Studies in Health Technology and Informatics}, volume = {295}, pages = {545--550}, publisher = {{IOS} Press}, year = {2022}, url = {https://doi.org/10.3233/SHTI220786}, doi = {10.3233/SHTI220786}, timestamp = {Wed, 03 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icimth/BranescuaST22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icmla/AlLuhaybiSCT22, author = {Mashael Al{-}Luhaybi and Stephen Swift and Steve Counsell and Allan Tucker}, editor = {M. Arif Wani and Mehmed M. Kantardzic and Vasile Palade and Daniel Neagu and Longzhi Yang and Kit Yan Chan}, title = {Exploring the Explicit Modelling of Bias in Machine Learning Classifiers: {A} Deep Multi-label ConvNet Approach}, booktitle = {21st {IEEE} International Conference on Machine Learning and Applications, {ICMLA} 2022, Nassau, Bahamas, December 12-14, 2022}, pages = {1799--1806}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/ICMLA55696.2022.00277}, doi = {10.1109/ICMLA55696.2022.00277}, timestamp = {Wed, 29 Mar 2023 19:23:50 +0200}, biburl = {https://dblp.org/rec/conf/icmla/AlLuhaybiSCT22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/kdd/FitzGeraldAABBB22, author = {Jack FitzGerald and Shankar Ananthakrishnan and Konstantine Arkoudas and Davide Bernardi and Abhishek Bhagia and Claudio Delli Bovi and Jin Cao and Rakesh Chada and Amit Chauhan and Luoxin Chen and Anurag Dwarakanath and Satyam Dwivedi and Turan Gojayev and Karthik Gopalakrishnan and Thomas Gueudr{\'{e}} and Dilek Hakkani{-}Tur and Wael Hamza and Jonathan J. H{\"{u}}ser and Kevin Martin Jose and Haidar Khan and Beiye Liu and Jianhua Lu and Alessandro Manzotti and Pradeep Natarajan and Karolina Owczarzak and Gokmen Oz and Enrico Palumbo and Charith Peris and Chandana Satya Prakash and Stephen Rawls and Andy Rosenbaum and Anjali Shenoy and Saleh Soltan and Mukund Harakere Sridhar and Lizhen Tan and Fabian Triefenbach and Pan Wei and Haiyang Yu and Shuai Zheng and G{\"{o}}khan T{\"{u}}r and Prem Natarajan}, editor = {Aidong Zhang and Huzefa Rangwala}, title = {Alexa Teacher Model: Pretraining and Distilling Multi-Billion-Parameter Encoders for Natural Language Understanding Systems}, booktitle = {{KDD} '22: The 28th {ACM} {SIGKDD} Conference on Knowledge Discovery and Data Mining, Washington, DC, USA, August 14 - 18, 2022}, pages = {2893--2902}, publisher = {{ACM}}, year = {2022}, url = {https://doi.org/10.1145/3534678.3539173}, doi = {10.1145/3534678.3539173}, timestamp = {Tue, 06 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/kdd/FitzGeraldAABBB22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/l4dc/DrummondDTPA22, author = {Ross Drummond and Stephen Duncan and Mathew Turner and Patricia Pauli and Frank Allg{\"{o}}wer}, editor = {Roya Firoozi and Negar Mehr and Esen Yel and Rika Antonova and Jeannette Bohg and Mac Schwager and Mykel J. Kochenderfer}, title = {Bounding the Difference Between Model Predictive Control and Neural Networks}, booktitle = {Learning for Dynamics and Control Conference, {L4DC} 2022, 23-24 June 2022, Stanford University, Stanford, CA, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {168}, pages = {817--829}, publisher = {{PMLR}}, year = {2022}, url = {https://proceedings.mlr.press/v168/drummond22a.html}, timestamp = {Fri, 20 May 2022 14:36:40 +0200}, biburl = {https://dblp.org/rec/conf/l4dc/DrummondDTPA22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/l4dc/TuRZM22, author = {Stephen Tu and Alexander Robey and Tingnan Zhang and Nikolai Matni}, editor = {Roya Firoozi and Negar Mehr and Esen Yel and Rika Antonova and Jeannette Bohg and Mac Schwager and Mykel J. Kochenderfer}, title = {On the Sample Complexity of Stability Constrained Imitation Learning}, booktitle = {Learning for Dynamics and Control Conference, {L4DC} 2022, 23-24 June 2022, Stanford University, Stanford, CA, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {168}, pages = {180--191}, publisher = {{PMLR}}, year = {2022}, url = {https://proceedings.mlr.press/v168/tu22a.html}, timestamp = {Fri, 20 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/l4dc/TuRZM22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/l4dc/ZhangTBSM22, author = {Thomas T. C. K. Zhang and Stephen Tu and Nicholas M. Boffi and Jean{-}Jacques E. Slotine and Nikolai Matni}, editor = {Roya Firoozi and Negar Mehr and Esen Yel and Rika Antonova and Jeannette Bohg and Mac Schwager and Mykel J. Kochenderfer}, title = {Adversarially Robust Stability Certificates can be Sample-Efficient}, booktitle = {Learning for Dynamics and Control Conference, {L4DC} 2022, 23-24 June 2022, Stanford University, Stanford, CA, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {168}, pages = {532--545}, publisher = {{PMLR}}, year = {2022}, url = {https://proceedings.mlr.press/v168/zhang22a.html}, timestamp = {Fri, 20 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/l4dc/ZhangTBSM22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mibam/ShieldsWVTIBR22, author = {Allison Shields and Kyle A. Williams and Sricharan S. Veeturi and Vincent M. Tutino and Ciprian N. Ionita and Daniel R. Bednarek and Stephen Rudin}, editor = {Barjor S. Gimi and Andrzej Kr{\'{o}}l}, title = {Initial evaluation of 2D and 3D simulated high-speed 1000 fps vascular contrast-flow image sequences using computational fluid dynamics {(CFD)}}, booktitle = {Medical Imaging 2022: Biomedical Applications in Molecular, Structural, and Functional Imaging, San Diego, CA, USA, February 20-24, 2022 / Online, March 21-27, 2022}, series = {{SPIE} Proceedings}, volume = {12036}, publisher = {{SPIE}}, year = {2022}, url = {https://doi.org/10.1117/12.2611170}, doi = {10.1117/12.2611170}, timestamp = {Thu, 21 Mar 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/mibam/ShieldsWVTIBR22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mtsr/TuM22, author = {Wen Ting Maria Tu and Stephen Makonin}, editor = {Emmanouel Garoufallou and Andreas Vlachidis}, title = {Designing PIDs for Reproducible Science Using Time-Series Data}, booktitle = {Metadata and Semantic Research - 16th Research Conference, {MTSR} 2022, London, UK, November 7-11, 2022, Revised Selected Papers}, series = {Communications in Computer and Information Science}, volume = {1789}, pages = {295--301}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-39141-5\_25}, doi = {10.1007/978-3-031-39141-5\_25}, timestamp = {Tue, 05 Sep 2023 18:04:38 +0200}, biburl = {https://dblp.org/rec/conf/mtsr/TuM22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/PfrommerZTM22, author = {Daniel Pfrommer and Thomas T. C. K. Zhang and Stephen Tu and Nikolai Matni}, editor = {Sanmi Koyejo and S. Mohamed and A. Agarwal and Danielle Belgrave and K. Cho and A. Oh}, title = {TaSIL: Taylor Series Imitation Learning}, booktitle = {Advances in Neural Information Processing Systems 35: Annual Conference on Neural Information Processing Systems 2022, NeurIPS 2022, New Orleans, LA, USA, November 28 - December 9, 2022}, year = {2022}, url = {http://papers.nips.cc/paper\_files/paper/2022/hash/7f10c3d66c3b7863a9cda255dcac5bb7-Abstract-Conference.html}, timestamp = {Mon, 08 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/nips/PfrommerZTM22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/ZiemannT22, author = {Ingvar M. Ziemann and Stephen Tu}, editor = {Sanmi Koyejo and S. Mohamed and A. Agarwal and Danielle Belgrave and K. Cho and A. Oh}, title = {Learning with little mixing}, booktitle = {Advances in Neural Information Processing Systems 35: Annual Conference on Neural Information Processing Systems 2022, NeurIPS 2022, New Orleans, LA, USA, November 28 - December 9, 2022}, year = {2022}, url = {http://papers.nips.cc/paper\_files/paper/2022/hash/1dc9fbdb6b4d9955ad377cb983232c9f-Abstract-Conference.html}, timestamp = {Mon, 08 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/nips/ZiemannT22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pkdd/Kara-IsittST22, author = {Fawzia Zehra Kara{-}Isitt and Stephen Swift and Allan Tucker}, editor = {Irena Koprinska and Paolo Mignone and Riccardo Guidotti and Szymon Jaroszewicz and Holger Fr{\"{o}}ning and Francesco Gullo and Pedro M. Ferreira and Damian Roqueiro and Gaia Ceddia and Slawomir Nowaczyk and Jo{\~{a}}o Gama and Rita P. Ribeiro and Ricard Gavald{\`{a}} and Elio Masciari and Zbigniew W. Ras and Ettore Ritacco and Francesca Naretto and Andreas Theissler and Przemyslaw Biecek and Wouter Verbeke and Gregor Schiele and Franz Pernkopf and Michaela Blott and Ilaria Bordino and Ivan Luciano Danesi and Giovanni Ponti and Lorenzo Severini and Annalisa Appice and Giuseppina Andresini and Ib{\'{e}}ria Medeiros and Guilherme Gra{\c{c}}a and Lee A. D. Cooper and Naghmeh Ghazaleh and Jonas Richiardi and Diego Saldana Miranda and Konstantinos Sechidis and Arif Canakoglu and Sara Pid{\`{o}} and Pietro Pinoli and Albert Bifet and Sepideh Pashami}, title = {Intelligently Detecting Information Online-Weaponisation Trends {(IDIOT)}}, booktitle = {Machine Learning and Principles and Practice of Knowledge Discovery in Databases - International Workshops of {ECML} {PKDD} 2022, Grenoble, France, September 19-23, 2022, Proceedings, Part {I}}, series = {Communications in Computer and Information Science}, volume = {1752}, pages = {197--214}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-23618-1\_13}, doi = {10.1007/978-3-031-23618-1\_13}, timestamp = {Fri, 11 Oct 2024 07:47:20 +0200}, biburl = {https://dblp.org/rec/conf/pkdd/Kara-IsittST22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/vlsit/NishiPCSZTTN0DG22, author = {Yoshinori Nishi and John W. Poulton and Xi Chen and Sanquan Song and Brian Zimmer and Walker J. Turner and Stephen G. Tell and Nikola Nedovic and John M. Wilson and William J. Dally and C. Thomas Gray}, title = {A 0.297-pJ/bit 50.4-Gb/s/wire Inverter-Based Short-Reach Simultaneous Bidirectional Transceiver for Die-to-Die Interface in 5nm {CMOS}}, booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022}, pages = {154--155}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830174}, doi = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830174}, timestamp = {Fri, 05 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/vlsit/NishiPCSZTTN0DG22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@misc{DBLP:data/10/PerolatVHTSBMCBAMECWGMK22, author = {Julien P{\'{e}}rolat and Bart De Vylder and Daniel Hennes and Eugene Tarassov and Florian Strub and Vincent de Boer and Paul Muller and Jerome T. Connor and Neil Burch and Thomas Anthony and Stephen McAleer and Romuald Elie and Sarah H. Cen and Zhe Wang and Audrunas Gruslys and Aleksandra Malysheva and Mina Khan and Sherjil Ozair and Finbarr Timbers and Toby Pohlen and Tom Eccles and Mark Rowland and Marc Lanctot and Jean{-}Baptiste Lespiau and Bilal Piot and Shayegan Omidshafiei and Edward Lockhart and Laurent Sifre and Nathalie Beauguerlange and R{\'{e}}mi Munos and David Silver and Satinder Singh and Demis Hassabis and Karl Tuyls}, title = {Figure Data for the paper "Mastering the Game of Stratego with Model-Free Multiagent Reinforcement Learning" (Version 1)}, publisher = {Zenodo}, year = {2022}, month = oct, howpublished = {\url{https://doi.org/10.5281/zenodo.7118519}}, note = {Accessed on YYYY-MM-DD.}, url = {https://doi.org/10.5281/zenodo.7118519}, doi = {10.5281/ZENODO.7118519}, timestamp = {Mon, 28 Oct 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/data/10/PerolatVHTSBMCBAMECWGMK22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2201-07700, author = {Stephen McAleer and Kevin Wang and John B. Lanier and Marc Lanctot and Pierre Baldi and Tuomas Sandholm and Roy Fox}, title = {Anytime {PSRO} for Two-Player Zero-Sum Games}, journal = {CoRR}, volume = {abs/2201.07700}, year = {2022}, url = {https://arxiv.org/abs/2201.07700}, eprinttype = {arXiv}, eprint = {2201.07700}, timestamp = {Thu, 28 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2201-07700.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2203-00543, author = {Charline Le Lan and Stephen Tu and Adam Oberman and Rishabh Agarwal and Marc G. Bellemare}, title = {On the Generalization of Representations in Reinforcement Learning}, journal = {CoRR}, volume = {abs/2203.00543}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2203.00543}, doi = {10.48550/ARXIV.2203.00543}, eprinttype = {arXiv}, eprint = {2203.00543}, timestamp = {Wed, 16 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2203-00543.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2203-11216, author = {Razin A. Shaikh and Sara Sabrina Zemljic and Sean Tull and Stephen Clark}, title = {The Conceptual {VAE}}, journal = {CoRR}, volume = {abs/2203.11216}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2203.11216}, doi = {10.48550/ARXIV.2203.11216}, eprinttype = {arXiv}, eprint = {2203.11216}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2203-11216.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2203-17193, author = {Stephen Tu and Roy Frostig and Mahdi Soltanolkotabi}, title = {Learning from many trajectories}, journal = {CoRR}, volume = {abs/2203.17193}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2203.17193}, doi = {10.48550/ARXIV.2203.17193}, eprinttype = {arXiv}, eprint = {2203.17193}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2203-17193.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2204-06486, author = {Ross Drummond and Stephen R. Duncan and Matthew C. Turner and Patricia Pauli and Frank Allg{\"{o}}wer}, title = {Bounding the difference between model predictive control and neural networks}, journal = {CoRR}, volume = {abs/2204.06486}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2204.06486}, doi = {10.48550/ARXIV.2204.06486}, eprinttype = {arXiv}, eprint = {2204.06486}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2204-06486.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2205-14812, author = {Daniel Pfrommer and Thomas T. C. K. Zhang and Stephen Tu and Nikolai Matni}, title = {TaSIL: Taylor Series Imitation Learning}, journal = {CoRR}, volume = {abs/2205.14812}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2205.14812}, doi = {10.48550/ARXIV.2205.14812}, eprinttype = {arXiv}, eprint = {2205.14812}, timestamp = {Wed, 01 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2205-14812.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2206-04122, author = {Stephen McAleer and Gabriele Farina and Marc Lanctot and Tuomas Sandholm}, title = {{ESCHER:} Eschewing Importance Sampling in Games by Computing a History Value Function to Estimate Regret}, journal = {CoRR}, volume = {abs/2206.04122}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2206.04122}, doi = {10.48550/ARXIV.2206.04122}, eprinttype = {arXiv}, eprint = {2206.04122}, timestamp = {Tue, 14 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2206-04122.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2206-04615, author = {Aarohi Srivastava and Abhinav Rastogi and Abhishek Rao and Abu Awal Md Shoeb and Abubakar Abid and Adam Fisch and Adam R. Brown and Adam Santoro and Aditya Gupta and Adri{\`{a}} Garriga{-}Alonso and Agnieszka Kluska and Aitor Lewkowycz and Akshat Agarwal and Alethea Power and Alex Ray and Alex Warstadt and Alexander W. Kocurek and Ali Safaya and Ali Tazarv and Alice Xiang and Alicia Parrish and Allen Nie and Aman Hussain and Amanda Askell and Amanda Dsouza and Ambrose Slone and Ameet Rahane and Anantharaman S. Iyer and Anders Andreassen and Andrea Madotto and Andrea Santilli and Andreas Stuhlm{\"{u}}ller and Andrew M. Dai and Andrew La and Andrew K. Lampinen and Andy Zou and Angela Jiang and Angelica Chen and Anh Vuong and Animesh Gupta and Anna Gottardi and Antonio Norelli and Anu Venkatesh and Arash Gholamidavoodi and Arfa Tabassum and Arul Menezes and Arun Kirubarajan and Asher Mullokandov and Ashish Sabharwal and Austin Herrick and Avia Efrat and Aykut Erdem and Ayla Karakas and B. Ryan Roberts and Bao Sheng Loe and Barret Zoph and Bartlomiej Bojanowski and Batuhan {\"{O}}zyurt and Behnam Hedayatnia and Behnam Neyshabur and Benjamin Inden and Benno Stein and Berk Ekmekci and Bill Yuchen Lin and Blake Howald and Bryan Orinion and Cameron Diao and Cameron Dour and Catherine Stinson and Cedrick Argueta and C{\`{e}}sar Ferri Ram{\'{\i}}rez and Chandan Singh and Charles Rathkopf and Chenlin Meng and Chitta Baral and Chiyu Wu and Chris Callison{-}Burch and Chris Waites and Christian Voigt and Christopher D. Manning and Christopher Potts and Cindy Ramirez and Clara E. Rivera and Clemencia Siro and Colin Raffel and Courtney Ashcraft and Cristina Garbacea and Damien Sileo and Dan Garrette and Dan Hendrycks and Dan Kilman and Dan Roth and Daniel Freeman and Daniel Khashabi and Daniel Levy and Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and Danielle Perszyk and Danny Hernandez and Danqi Chen and Daphne Ippolito and Dar Gilboa and David Dohan and David Drakard and David Jurgens and Debajyoti Datta and Deep Ganguli and Denis Emelin and Denis Kleyko and Deniz Yuret and Derek Chen and Derek Tam and Dieuwke Hupkes and Diganta Misra and Dilyar Buzan and Dimitri Coelho Mollo and Diyi Yang and Dong{-}Ho Lee and Dylan Schrader and Ekaterina Shutova and Ekin Dogus Cubuk and Elad Segal and Eleanor Hagerman and Elizabeth Barnes and Elizabeth Donoway and Ellie Pavlick and Emanuele Rodol{\`{a}} and Emma Lam and Eric Chu and Eric Tang and Erkut Erdem and Ernie Chang and Ethan A. Chi and Ethan Dyer and Ethan J. Jerzak and Ethan Kim and Eunice Engefu Manyasi and Evgenii Zheltonozhskii and Fanyue Xia and Fatemeh Siar and Fernando Mart{\'{\i}}nez{-}Plumed and Francesca Happ{\'{e}} and Fran{\c{c}}ois Chollet and Frieda Rong and Gaurav Mishra and Genta Indra Winata and Gerard de Melo and Germ{\'{a}}n Kruszewski and Giambattista Parascandolo and Giorgio Mariani and Gloria Wang and Gonzalo Jaimovitch{-}L{\'{o}}pez and Gregor Betz and Guy Gur{-}Ari and Hana Galijasevic and Hannah Kim and Hannah Rashkin and Hannaneh Hajishirzi and Harsh Mehta and Hayden Bogar and Henry Shevlin and Hinrich Sch{\"{u}}tze and Hiromu Yakura and Hongming Zhang and Hugh Mee Wong and Ian Ng and Isaac Noble and Jaap Jumelet and Jack Geissinger and Jackson Kernion and Jacob Hilton and Jaehoon Lee and Jaime Fern{\'{a}}ndez Fisac and James B. Simon and James Koppel and James Zheng and James Zou and Jan Kocon and Jana Thompson and Janelle Wingfield and Jared Kaplan and Jarema Radom and Jascha Sohl{-}Dickstein and Jason Phang and Jason Wei and Jason Yosinski and Jekaterina Novikova and Jelle Bosscher and Jennifer Marsh and Jeremy Kim and Jeroen Taal and Jesse H. Engel and Jesujoba Alabi and Jiacheng Xu and Jiaming Song and Jillian Tang and Joan Waweru and John Burden and John Miller and John U. Balis and Jonathan Batchelder and Jonathan Berant and J{\"{o}}rg Frohberg and Jos Rozen and Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and Joseph Boudeman and Joseph Guerr and Joseph Jones and Joshua B. Tenenbaum and Joshua S. Rule and Joyce Chua and Kamil Kanclerz and Karen Livescu and Karl Krauth and Karthik Gopalakrishnan and Katerina Ignatyeva and Katja Markert and Kaustubh D. Dhole and Kevin Gimpel and Kevin Omondi and Kory Mathewson and Kristen Chiafullo and Ksenia Shkaruta and Kumar Shridhar and Kyle McDonell and Kyle Richardson and Laria Reynolds and Leo Gao and Li Zhang and Liam Dugan and Lianhui Qin and Lidia Contreras Ochando and Louis{-}Philippe Morency and Luca Moschella and Lucas Lam and Lucy Noble and Ludwig Schmidt and Luheng He and Luis Oliveros Col{\'{o}}n and Luke Metz and L{\"{u}}tfi Kerem Senel and Maarten Bosma and Maarten Sap and Maartje ter Hoeve and Maheen Farooqi and Manaal Faruqui and Mantas Mazeika and Marco Baturan and Marco Marelli and Marco Maru and Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and Marie Tolkiehn and Mario Giulianelli and Martha Lewis and Martin Potthast and Matthew L. Leavitt and Matthias Hagen and M{\'{a}}ty{\'{a}}s Schubert and Medina Baitemirova and Melody Arnaud and Melvin McElrath and Michael A. Yee and Michael Cohen and Michael Gu and Michael I. Ivanitskiy and Michael Starritt and Michael Strube and Michal Swedrowski and Michele Bevilacqua and Michihiro Yasunaga and Mihir Kale and Mike Cain and Mimee Xu and Mirac Suzgun and Mitch Walker and Mo Tiwari and Mohit Bansal and Moin Aminnaseri and Mor Geva and Mozhdeh Gheini and Mukund Varma T. and Nanyun Peng and Nathan A. Chi and Nayeon Lee and Neta Gur{-}Ari Krakover and Nicholas Cameron and Nicholas Roberts and Nick Doiron and Nicole Martinez and Nikita Nangia and Niklas Deckers and Niklas Muennighoff and Nitish Shirish Keskar and Niveditha Iyer and Noah Constant and Noah Fiedel and Nuan Wen and Oliver Zhang and Omar Agha and Omar Elbaghdadi and Omer Levy and Owain Evans and Pablo Antonio Moreno Casares and Parth Doshi and Pascale Fung and Paul Pu Liang and Paul Vicol and Pegah Alipoormolabashi and Peiyuan Liao and Percy Liang and Peter Chang and Peter Eckersley and Phu Mon Htut and Pinyu Hwang and Piotr Milkowski and Piyush Patil and Pouya Pezeshkpour and Priti Oli and Qiaozhu Mei and Qing Lyu and Qinlang Chen and Rabin Banjade and Rachel Etta Rudolph and Raefer Gabriel and Rahel Habacker and Ramon Risco and Rapha{\"{e}}l Milli{\`{e}}re and Rhythm Garg and Richard Barnes and Rif A. Saurous and Riku Arakawa and Robbe Raymaekers and Robert Frank and Rohan Sikand and Roman Novak and Roman Sitelew and Ronan LeBras and Rosanne Liu and Rowan Jacobs and Rui Zhang and Ruslan Salakhutdinov and Ryan Chi and Ryan Lee and Ryan Stovall and Ryan Teehan and Rylan Yang and Sahib Singh and Saif M. Mohammad and Sajant Anand and Sam Dillavou and Sam Shleifer and Sam Wiseman and Samuel Gruetter and Samuel R. Bowman and Samuel S. Schoenholz and Sanghyun Han and Sanjeev Kwatra and Sarah A. Rous and Sarik Ghazarian and Sayan Ghosh and Sean Casey and Sebastian Bischoff and Sebastian Gehrmann and Sebastian Schuster and Sepideh Sadeghi and Shadi Hamdan and Sharon Zhou and Shashank Srivastava and Sherry Shi and Shikhar Singh and Shima Asaadi and Shixiang Shane Gu and Shubh Pachchigar and Shubham Toshniwal and Shyam Upadhyay and Shyamolima (Shammie) Debnath and Siamak Shakeri and Simon Thormeyer and Simone Melzi and Siva Reddy and Sneha Priscilla Makini and Soo{-}Hwan Lee and Spencer Torene and Sriharsha Hatwar and Stanislas Dehaene and Stefan Divic and Stefano Ermon and Stella Biderman and Stephanie Lin and Stephen Prasad and Steven T. Piantadosi and Stuart M. Shieber and Summer Misherghi and Svetlana Kiritchenko and Swaroop Mishra and Tal Linzen and Tal Schuster and Tao Li and Tao Yu and Tariq Ali and Tatsu Hashimoto and Te{-}Lin Wu and Th{\'{e}}o Desbordes and Theodore Rothschild and Thomas Phan and Tianle Wang and Tiberius Nkinyili and Timo Schick and Timofei Kornev and Titus Tunduny and Tobias Gerstenberg and Trenton Chang and Trishala Neeraj and Tushar Khot and Tyler Shultz and Uri Shaham and Vedant Misra and Vera Demberg and Victoria Nyamai and Vikas Raunak and Vinay V. Ramasesh and Vinay Uday Prabhu and Vishakh Padmakumar and Vivek Srikumar and William Fedus and William Saunders and William Zhang and Wout Vossen and Xiang Ren and Xiaoyu Tong and Xinran Zhao and Xinyi Wu and Xudong Shen and Yadollah Yaghoobzadeh and Yair Lakretz and Yangqiu Song and Yasaman Bahri and Yejin Choi and Yichi Yang and Yiding Hao and Yifu Chen and Yonatan Belinkov and Yu Hou and Yufang Hou and Yuntao Bai and Zachary Seid and Zhuoye Zhao and Zijian Wang and Zijie J. Wang and Zirui Wang and Ziyi Wu}, title = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities of language models}, journal = {CoRR}, volume = {abs/2206.04615}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2206.04615}, doi = {10.48550/ARXIV.2206.04615}, eprinttype = {arXiv}, eprint = {2206.04615}, timestamp = {Mon, 05 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2206-04615.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2206-07808, author = {Jack FitzGerald and Shankar Ananthakrishnan and Konstantine Arkoudas and Davide Bernardi and Abhishek Bhagia and Claudio Delli Bovi and Jin Cao and Rakesh Chada and Amit Chauhan and Luoxin Chen and Anurag Dwarakanath and Satyam Dwivedi and Turan Gojayev and Karthik Gopalakrishnan and Thomas Gueudr{\'{e}} and Dilek Hakkani{-}Tur and Wael Hamza and Jonathan J. H{\"{u}}ser and Kevin Martin Jose and Haidar Khan and Beiye Liu and Jianhua Lu and Alessandro Manzotti and Pradeep Natarajan and Karolina Owczarzak and Gokmen Oz and Enrico Palumbo and Charith Peris and Chandana Satya Prakash and Stephen Rawls and Andy Rosenbaum and Anjali Shenoy and Saleh Soltan and Mukund Harakere Sridhar and Liz Tan and Fabian Triefenbach and Pan Wei and Haiyang Yu and Shuai Zheng and G{\"{o}}khan T{\"{u}}r and Prem Natarajan}, title = {Alexa Teacher Model: Pretraining and Distilling Multi-Billion-Parameter Encoders for Natural Language Understanding Systems}, journal = {CoRR}, volume = {abs/2206.07808}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2206.07808}, doi = {10.48550/ARXIV.2206.07808}, eprinttype = {arXiv}, eprint = {2206.07808}, timestamp = {Tue, 06 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2206-07808.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2206-08269, author = {Ingvar M. Ziemann and Stephen Tu}, title = {Learning with little mixing}, journal = {CoRR}, volume = {abs/2206.08269}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2206.08269}, doi = {10.48550/ARXIV.2206.08269}, eprinttype = {arXiv}, eprint = {2206.08269}, timestamp = {Sun, 03 Jul 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2206-08269.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2206-15378, author = {Julien P{\'{e}}rolat and Bart De Vylder and Daniel Hennes and Eugene Tarassov and Florian Strub and Vincent de Boer and Paul Muller and Jerome T. Connor and Neil Burch and Thomas W. Anthony and Stephen McAleer and Romuald Elie and Sarah H. Cen and Zhe Wang and Audrunas Gruslys and Aleksandra Malysheva and Mina Khan and Sherjil Ozair and Finbarr Timbers and Toby Pohlen and Tom Eccles and Mark Rowland and Marc Lanctot and Jean{-}Baptiste Lespiau and Bilal Piot and Shayegan Omidshafiei and Edward Lockhart and Laurent Sifre and Nathalie Beauguerlange and R{\'{e}}mi Munos and David Silver and Satinder Singh and Demis Hassabis and Karl Tuyls}, title = {Mastering the Game of Stratego with Model-Free Multiagent Reinforcement Learning}, journal = {CoRR}, volume = {abs/2206.15378}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2206.15378}, doi = {10.48550/ARXIV.2206.15378}, eprinttype = {arXiv}, eprint = {2206.15378}, timestamp = {Wed, 02 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2206-15378.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2207-06541, author = {Stephen McAleer and John B. Lanier and Kevin A. Wang and Pierre Baldi and Roy Fox and Tuomas Sandholm}, title = {Self-Play {PSRO:} Toward Optimal Populations in Two-Player Zero-Sum Games}, journal = {CoRR}, volume = {abs/2207.06541}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2207.06541}, doi = {10.48550/ARXIV.2207.06541}, eprinttype = {arXiv}, eprint = {2207.06541}, timestamp = {Tue, 19 Jul 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2207-06541.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2208-01448, author = {Saleh Soltan and Shankar Ananthakrishnan and Jack FitzGerald and Rahul Gupta and Wael Hamza and Haidar Khan and Charith Peris and Stephen Rawls and Andy Rosenbaum and Anna Rumshisky and Chandana Satya Prakash and Mukund Sridhar and Fabian Triefenbach and Apurv Verma and G{\"{o}}khan T{\"{u}}r and Prem Natarajan}, title = {AlexaTM 20B: Few-Shot Learning Using a Large-Scale Multilingual Seq2Seq Model}, journal = {CoRR}, volume = {abs/2208.01448}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2208.01448}, doi = {10.48550/ARXIV.2208.01448}, eprinttype = {arXiv}, eprint = {2208.01448}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2208-01448.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2208-07965, author = {Uchenna Daniel Ani and Jeremy D. McK. Watson and Nilufer Tuptuk and Steve Hailes and Madeline Carr and Carsten Maple}, title = {Improving the Cybersecurity of Critical National Infrastructure using Modelling and Simulation}, journal = {CoRR}, volume = {abs/2208.07965}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2208.07965}, doi = {10.48550/ARXIV.2208.07965}, eprinttype = {arXiv}, eprint = {2208.07965}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2208-07965.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2209-10475, author = {Wen Ting Maria Tu and Stephen Makonin}, title = {Designing PIDs for Reproducible Science Using Time-Series Data}, journal = {CoRR}, volume = {abs/2209.10475}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2209.10475}, doi = {10.48550/ARXIV.2209.10475}, eprinttype = {arXiv}, eprint = {2209.10475}, timestamp = {Wed, 28 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2209-10475.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2209-10780, author = {Xuesu Xiao and Tingnan Zhang and Krzysztof Choromanski and Tsang{-}Wei Edward Lee and Anthony G. Francis and Jake Varley and Stephen Tu and Sumeet Singh and Peng Xu and Fei Xia and Sven Mikael Persson and Dmitry Kalashnikov and Leila Takayama and Roy Frostig and Jie Tan and Carolina Parada and Vikas Sindhwani}, title = {Learning Model Predictive Controllers with Real-Time Attention for Real-World Navigation}, journal = {CoRR}, volume = {abs/2209.10780}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2209.10780}, doi = {10.48550/ARXIV.2209.10780}, eprinttype = {arXiv}, eprint = {2209.10780}, timestamp = {Tue, 12 Nov 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2209-10780.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2210-00956, author = {Chanikarn Nikunram and Wasin Meesena and Stephen John Turner and Sucha Supittayapornpong}, title = {Minimizing Age of Processed Information in Wireless Networks}, journal = {CoRR}, volume = {abs/2210.00956}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2210.00956}, doi = {10.48550/ARXIV.2210.00956}, eprinttype = {arXiv}, eprint = {2210.00956}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2210-00956.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2210-02205, author = {Luke Marris and Marc Lanctot and Ian Gemp and Shayegan Omidshafiei and Stephen McAleer and Jerome T. Connor and Karl Tuyls and Thore Graepel}, title = {Game Theoretic Rating in N-player general-sum games with Equilibria}, journal = {CoRR}, volume = {abs/2210.02205}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2210.02205}, doi = {10.48550/ARXIV.2210.02205}, eprinttype = {arXiv}, eprint = {2210.02205}, timestamp = {Fri, 07 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2210-02205.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2210-02343, author = {David Brandfonbrener and Stephen Tu and Avi Singh and Stefan Welker and Chad Boodoo and Nikolai Matni and Jake Varley}, title = {Visual Backtracking Teleoperation: {A} Data Collection Protocol for Offline Image-Based Reinforcement Learning}, journal = {CoRR}, volume = {abs/2210.02343}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2210.02343}, doi = {10.48550/ARXIV.2210.02343}, eprinttype = {arXiv}, eprint = {2210.02343}, timestamp = {Fri, 07 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2210-02343.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2212-00186, author = {Thomas T. C. K. Zhang and Katie Kang and Bruce D. Lee and Claire J. Tomlin and Sergey Levine and Stephen Tu and Nikolai Matni}, title = {Multi-Task Imitation Learning for Linear Dynamical Systems}, journal = {CoRR}, volume = {abs/2212.00186}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2212.00186}, doi = {10.48550/ARXIV.2212.00186}, eprinttype = {arXiv}, eprint = {2212.00186}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2212-00186.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2212-00613, author = {Ziyan Wang and Giljoo Nam and Tuur Stuyck and Stephen Lombardi and Chen Cao and Jason M. Saragih and Michael Zollh{\"{o}}fer and Jessica K. Hodgins and Christoph Lassner}, title = {NeuWigs: {A} Neural Dynamic Model for Volumetric Hair Capture and Animation}, journal = {CoRR}, volume = {abs/2212.00613}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2212.00613}, doi = {10.48550/ARXIV.2212.00613}, eprinttype = {arXiv}, eprint = {2212.00613}, timestamp = {Thu, 08 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2212-00613.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2212-13138, author = {Karan Singhal and Shekoofeh Azizi and Tao Tu and S. Sara Mahdavi and Jason Wei and Hyung Won Chung and Nathan Scales and Ajay Kumar Tanwani and Heather Cole{-}Lewis and Stephen Pfohl and Perry Payne and Martin Seneviratne and Paul Gamble and Chris Kelly and Nathaneal Sch{\"{a}}rli and Aakanksha Chowdhery and Philip Andrew Mansfield and Blaise Ag{\"{u}}era y Arcas and Dale R. Webster and Gregory S. Corrado and Yossi Matias and Katherine Chou and Juraj Gottweis and Nenad Tomasev and Yun Liu and Alvin Rajkomar and Joelle K. Barral and Christopher Semturs and Alan Karthikesalingam and Vivek Natarajan}, title = {Large Language Models Encode Clinical Knowledge}, journal = {CoRR}, volume = {abs/2212.13138}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2212.13138}, doi = {10.48550/ARXIV.2212.13138}, eprinttype = {arXiv}, eprint = {2212.13138}, timestamp = {Wed, 06 Nov 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2212-13138.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2212-13289, author = {M. I. Sitnov and G. K. Stephens and V. G. Merkin and C.{-}P. Wang and D. Turner and K. Genestreti and M. Argall and T. Y. Chen and A. Y. Ukhorskiy and S. Wing and Y.{-}H. Liu}, title = {Artificial Intelligence to Enhance Mission Science Output for In-situ Observations: Dealing with the Sparse Data Challenge}, journal = {CoRR}, volume = {abs/2212.13289}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2212.13289}, doi = {10.48550/ARXIV.2212.13289}, eprinttype = {arXiv}, eprint = {2212.13289}, timestamp = {Mon, 02 Jan 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2212-13289.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bib/DoranALBTUBM21, author = {Stephen Doran and Muhammad Arif and Simon Lam and Abdulahad Bayraktar and Hasan Turkez and Mathias Uhlen and Jan Boren and Adil Mardinoglu}, title = {Multi-omics approaches for revealing the complexity of cardiovascular disease}, journal = {Briefings Bioinform.}, volume = {22}, number = {5}, year = {2021}, url = {https://doi.org/10.1093/bib/bbab061}, doi = {10.1093/BIB/BBAB061}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bib/DoranALBTUBM21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bib/LamDYATNBUM21, author = {Simon Lam and Stephen Doran and Hatice Hilal Yuksel and Ozlem Altay and Hasan Turkez and Jens Nielsen and Jan Boren and Mathias Uhlen and Adil Mardinoglu}, title = {Addressing the heterogeneity in liver diseases using biological networks}, journal = {Briefings Bioinform.}, volume = {22}, number = {2}, pages = {1751--1766}, year = {2021}, url = {https://doi.org/10.1093/bib/bbaa002}, doi = {10.1093/BIB/BBAA002}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bib/LamDYATNBUM21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bioinformatics/YangGLBMWWJO21, author = {Jeremy J. Yang and Dhouha Grissa and Christophe G. Lambert and Cristian Bologa and Stephen L. Mathias and Anna Waller and David J. Wild and Lars Juhl Jensen and Tudor I. Oprea}, title = {{TIGA:} target illumination {GWAS} analytics}, journal = {Bioinform.}, volume = {37}, number = {21}, pages = {3865--3873}, year = {2021}, url = {https://doi.org/10.1093/bioinformatics/btab427}, doi = {10.1093/BIOINFORMATICS/BTAB427}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bioinformatics/YangGLBMWWJO21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cce/GangadharanSTFC21, author = {Nishanthi Gangadharan and David Sewell and Richard Turner and Ray Field and Matthew Cheeks and Stephen G. Oliver and Nigel K. H. Slater and Duygu Dikicioglu}, title = {Data intelligence for process performance prediction in biologics manufacturing}, journal = {Comput. Chem. Eng.}, volume = {146}, pages = {107226}, year = {2021}, url = {https://doi.org/10.1016/j.compchemeng.2021.107226}, doi = {10.1016/J.COMPCHEMENG.2021.107226}, timestamp = {Tue, 02 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cce/GangadharanSTFC21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ci/YousefiSASCT21, author = {Leila Yousefi and Stephen Swift and Mahir Arzoky and Lucia Saachi and Luca Chiovato and Allan Tucker}, title = {Opening the black box: Personalizing type 2 diabetes patients based on their latent phenotype and temporal associated complication rules}, journal = {Comput. Intell.}, volume = {37}, number = {4}, pages = {1460--1498}, year = {2021}, url = {https://doi.org/10.1111/coin.12313}, doi = {10.1111/COIN.12313}, timestamp = {Tue, 12 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ci/YousefiSASCT21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cmpb/FarnellRGZPHHMC21, author = {Damian J. J. Farnell and Stephen Richmond and Jennifer Galloway and Alexei I. Zhurov and Pertti Pirttiniemi and Tuomo H. Heikkinen and Virpi Harila and Harold S. Matthews and Peter Claes}, title = {An exploration of adolescent facial shape changes with age via multilevel partial least squares regression}, journal = {Comput. Methods Programs Biomed.}, volume = {200}, pages = {105935}, year = {2021}, url = {https://doi.org/10.1016/j.cmpb.2021.105935}, doi = {10.1016/J.CMPB.2021.105935}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cmpb/FarnellRGZPHHMC21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/concurrency/MullerFABJRTR21, author = {Juliane M{\"{u}}ller and Boris Faybishenko and Deborah A. Agarwal and Stephen Bailey and Chongya Jiang and Youngryel Ryu and Craig Tull and Lavanya Ramakrishnan}, title = {Assessing data change in scientific datasets}, journal = {Concurr. Comput. Pract. Exp.}, volume = {33}, number = {16}, year = {2021}, url = {https://doi.org/10.1002/cpe.6245}, doi = {10.1002/CPE.6245}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/concurrency/MullerFABJRTR21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jamia/AtwoliBBBGHHLMN21, author = {Lukoye Atwoli and Abdullah H. Baqui and Thomas Benfield and Raffaella Bosurgi and Fiona Godlee and Stephen Hancocks and Richard Horton and Laurie Laybourn{-}Langton and Carlos Augusto Monteiro and Ian Norman and Kirsten Patrick and Nigel Praities and Marcel G. M. Olde Rikkert and Eric J. Rubin and Peush Sahni and Richard Smith and Nick Talley and Sue Turale and Dami{\'{a}}n V{\'{a}}zquez}, title = {Call for emergency action to limit global temperature increases, restore biodiversity, and protect health}, journal = {J. Am. Medical Informatics Assoc.}, volume = {28}, number = {10}, pages = {2069--2071}, year = {2021}, url = {https://doi.org/10.1093/jamia/ocab178}, doi = {10.1093/JAMIA/OCAB178}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jamia/AtwoliBBBGHHLMN21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jimaging/EtxegaraiTTVKH21, author = {Maddi Etxegarai and Erika Tudisco and Alessandro Tengattini and Gioacchino Viggiani and Nikolay Kardjilov and Stephen A. Hall}, title = {Characterisation of Single-Phase Fluid-Flow Heterogeneity Due to Localised Deformation in a Porous Rock Using Rapid Neutron Tomography}, journal = {J. Imaging}, volume = {7}, number = {12}, pages = {275}, year = {2021}, url = {https://doi.org/10.3390/jimaging7120275}, doi = {10.3390/JIMAGING7120275}, timestamp = {Sat, 08 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jimaging/EtxegaraiTTVKH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jmlr/TuckBB21, author = {Jonathan Tuck and Shane T. Barratt and Stephen P. Boyd}, title = {A Distributed Method for Fitting Laplacian Regularized Stratified Models}, journal = {J. Mach. Learn. Res.}, volume = {22}, pages = {60:1--60:37}, year = {2021}, url = {https://jmlr.org/papers/v22/19-345.html}, timestamp = {Wed, 11 Sep 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jmlr/TuckBB21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/CarbonDGUHMBCDH21, author = {Seth Carbon and Eric Douglass and Benjamin M. Good and Deepak R. Unni and Nomi L. Harris and Christopher J. Mungall and Siddartha Basu and Rex L. Chisholm and Robert J. Dodson and Eric Hartline and Petra Fey and Paul D. Thomas and Laurent{-}Philippe Albou and Dustin Ebert and Michael J. Kesling and Huaiyu Mi and Anushya Muruganujan and Xiaosong Huang and Tremayne Mushayahama and Sandra A. LaBonte and Deborah A. Siegele and Giulia Antonazzo and Helen Attrill and Nick H. Brown and Phani V. Garapati and Steven J. Marygold and Vitor Trovisco and Gilberto dos Santos and Kathleen Falls and Christopher J. Tabone and Pinglei Zhou and Joshua L. Goodman and Victor B. Strelets and Jim Thurmond and Penelope Garmiri and Rizwan Ishtiaq and Milagros Rodr{\'{\i}}guez{-}L{\'{o}}pez and Marcio Luis Acencio and Martin Kuiper and Astrid L{\ae}greid and Colin Logie and Ruth C. Lovering and Barbara Kramarz and Shirin C. C. Saverimuttu and Sandra M. Pinheiro and Heather Gunn and Renzhi Su and Katherine E. Thurlow and Marcus C. Chibucos and Michelle G. Giglio and Suvarna Nadendla and James B. Munro and Rebecca C. Jackson and Margaret J. Duesbury and Noemi del{-}Toro and Birgit H. M. Meldal and Kalpana Paneerselvam and Livia Perfetto and Pablo Porras and Sandra E. Orchard and Anjali Shrivastava and Hsin{-}Yu Chang and Robert D. Finn and Alex L. Mitchell and Neil D. Rawlings and Lorna J. Richardson and Amaia Sangrador{-}Vegas and Judith A. Blake and Karen R. Christie and Mary E. Dolan and Harold J. Drabkin and David P. Hill and Li Ni and Dmitry M. Sitnikov and Midori A. Harris and Stephen G. Oliver and Kim Rutherford and Valerie Wood and Jaqueline Hayles and J{\"{u}}rg B{\"{a}}hler and Elizabeth R. Bolton and Jeffrey DePons and Melinda R. Dwinell and G. Thomas Hayman and Mary L. Kaldunski and Anne E. Kwitek and Stanley J. F. Laulederkind and Cody Plasterer and Marek Tutaj and Mahima Vedi and Shur{-}Jen Wang and Peter D'Eustachio and Lisa Matthews and James P. Balhoff and Suzi A. Aleksander and Michael J. Alexander and J. Michael Cherry and Stacia R. Engel and Felix Gondwe and Kalpana Karra and Stuart R. Miyasato and Robert S. Nash and Matt Simison and Marek S. Skrzypek and Shuai Weng and Edith D. Wong and Marc Feuermann and Pascale Gaudet and Anne Morgat and Erica Bakker and Tanya Z. Berardini and Leonore Reiser and Shabari Subramaniam and Eva Huala and Cecilia N. Arighi and Andrea H. Auchincloss and Kristian B. Axelsen and Ghislaine Argoud{-}Puy and Alex Bateman and Marie{-}Claude Blatter and Emmanuel Boutet and Emily Bowler and Lionel Breuza and Alan J. Bridge and Ramona Britto and Hema Bye{-}A{-}Jee and Cristina Casals{-}Casas and Elisabeth Coudert and Paul Denny and Anne Estreicher and Maria Livia Famiglietti and George E. Georghiou and Arnaud Gos and Nadine Gruaz{-}Gumowski and Emma Hatton{-}Ellis and Chantal Hulo and Alexandr Ignatchenko and Florence Jungo and Kati Laiho and Philippe Le Mercier and Damien Lieberherr and Antonia Lock and Yvonne Lussi and Alistair MacDougall and Michele Magrane and Maria Jesus Martin and Patrick Masson and Darren A. Natale and Nevila Hyka{-}Nouspikel and Ivo Pedruzzi and Lucille Pourcel and Sylvain Poux and Sangya Pundir and Catherine Rivoire and Elena Speretta and Shyamala Sundaram and Nidhi Tyagi and Kate Warner and Rossana Zaru and Cathy H. Wu and Alexander D. Diehl and Juancarlos Chan and Christian A. Grove and Raymond Y. N. Lee and Hans{-}Michael M{\"{u}}ller and Daniela Raciti and Kimberly Van Auken and Paul W. Sternberg and Matthew Berriman and Michael Paulini and Kevin L. Howe and Sibyl Gao and Adam Wright and Lincoln Stein and Douglas G. Howe and Sabrina Toro and Monte Westerfield and Pankaj Jaiswal and Laurel Cooper and Justin Elser}, title = {The Gene Ontology resource: enriching a GOld mine}, journal = {Nucleic Acids Res.}, volume = {49}, number = {Database-Issue}, pages = {D325--D334}, year = {2021}, url = {https://doi.org/10.1093/nar/gkaa1113}, doi = {10.1093/NAR/GKAA1113}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/CarbonDGUHMBCDH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/HoweAAAAAAABBBB21, author = {Kevin L. Howe and Premanand Achuthan and James E. Allen and Jamie Allen and Jorge {\'{A}}lvarez{-}Jarreta and M. Ridwan Amode and Irina M. Armean and Andrey G. Azov and Ruth Bennett and Jyothish Bhai and Konstantinos Billis and Sanjay Boddu and Mehrnaz Charkhchi and Carla A. Cummins and Luca Da Rin Fioretto and Claire Davidson and Kamalkumar Jayantilal Dodiya and Bilal El Houdaigui and Reham Fatima and Astrid Gall and Carlos Garc{\'{\i}}a{-}Gir{\'{o}}n and Tiago Grego and Cristina Guijarro{-}Clarke and Leanne Haggerty and Anmol Hemrom and Thibaut Hourlier and Osagie G. Izuogu and Thomas Juettemann and Vinay Kaikala and Mike P. Kay and Ilias Lavidas and Tuan Le and Diana Lemos and Jose Gonzalez Martinez and Jos{\'{e}} Carlos Marug{\'{a}}n and Thomas Maurel and Aoife C. McMahon and Shamika Mohanan and Benjamin Moore and Matthieu Muffato and Denye N. Oheh and Dimitrios Paraschas and Anne Parker and Andrew Parton and Irina Prosovetskaia and Manoj Pandian Sakthivel and Ahamed Imran Abdul Salam and Bianca M. Schmitt and Helen Schuilenburg and Dan Sheppard and Emily Steed and Michal Szpak and Marek Szuba and Kieron R. Taylor and Anja Thormann and Glen Threadgold and Brandon Walts and Andrea Winterbottom and Marc Chakiachvili and Ameya Chaubal and Nishadi De Silva and Bethany Flint and Adam Frankish and Sarah E. Hunt and Garth IIsley and Nick Langridge and Jane E. Loveland and Fergal J. Martin and Jonathan M. Mudge and Joannella Morales and Emily Perry and Magali Ruffier and John G. Tate and David Thybert and Stephen J. Trevanion and Fiona Cunningham and Andrew D. Yates and Daniel R. Zerbino and Paul Flicek}, title = {Ensembl 2021}, journal = {Nucleic Acids Res.}, volume = {49}, number = {Database-Issue}, pages = {D884--D891}, year = {2021}, url = {https://doi.org/10.1093/nar/gkaa942}, doi = {10.1093/NAR/GKAA942}, timestamp = {Tue, 01 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/HoweAAAAAAABBBB21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/SheilsMKSNBJVKS21, author = {Timothy Sheils and Stephen L. Mathias and Keith J. Kelleher and Vishal B. Siramshetty and Dac{-}Trung Nguyen and Cristian Bologa and Lars Juhl Jensen and Dusica Vidovic and Amar Koleti and Stephan C. Sch{\"{u}}rer and Anna Waller and Jeremy J. Yang and Jayme Holmes and Giovanni Bocci and Noel Southall and Poorva Dharkar and Ewy A. Math{\'{e}} and Anton Simeonov and Tudor I. Oprea}, title = {{TCRD} and Pharos 2021: mining the human proteome for disease biology}, journal = {Nucleic Acids Res.}, volume = {49}, number = {Database-Issue}, pages = {D1334--D1346}, year = {2021}, url = {https://doi.org/10.1093/nar/gkaa993}, doi = {10.1093/NAR/GKAA993}, timestamp = {Tue, 08 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/SheilsMKSNBJVKS21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/neuroimage/HuiMZAABBBBBBBB21, author = {Steve C. N. Hui and Mark Mikkelsen and Helge J. Z{\"{o}}llner and Vishwadeep Ahluwalia and Sarael Alcauter and Laima Baltusis and Deborah A. Barany and Laura R. Barlow and Robert Becker and Jeffrey I. Berman and Adam Berrington and Pallab K. Bhattacharyya and Jakob Udby Blicher and Wolfgang Bogner and Mark S. Brown and Vince D. Calhoun and Ryan Castillo and Kim M. Cecil and Richard A. E. Edden and Yeo Bi Choi and Winnie C. W. Chu and William T. Clarke and Alexander R. Craven and Koen Cuypers and Michael Dacko and Camilo de la Fuente{-}Sandoval and Patricia Desmond and Aleksandra Domagalik and Julien Dumont and Niall W. Duncan and Ulrike Dydak and Katherine Dyke and David A. Edmondson and Gabriele Ende and Lars Ersland and C. John Evans and Alan S. R. Fermin and Antonio Ferretti and Ariane Fillmer and Tao Gong and Ian Greenhouse and James T. Grist and Meng Gu and Ashley D. Harris and Katarzyna Hat and Stefanie Heba and Eva Heckova and John P. Hegarty and Kirstin{-}Friederike Heise and Shiori Honda and Aaron Jacobson and Jacobus F. A. Jansen and Christopher W. Jenkins and Stephen J. Johnston and Christoph Juchem and Alayar Kangarlu and Adam B. Kerr and Karl Landheer and Thomas Lange and Phil Lee and Swati Rane Levendovszky and Catherine Limperopoulos and Feng Liu and William Lloyd and David J. Lythgoe and Maro G. Machizawa and Erin L. MacMillan and Richard J. Maddock and Andrei V. Manzhurtsev and Mar{\'{\i}}a L. Martinez{-}Gudino and Jack J. Miller and Heline Mirzakhanian and Marta Moreno{-}Ortega and Paul G. Mullins and Shinichiro Nakajima and Jamie Near and Ralph Noeske and Wibeke Nordh{\o}y and Georg Oeltzschner and Raul Osorio{-}Duran and Mar{\'{\i}}a Concepci{\'{o}}n Garc{\'{\i}}a Otaduy and Erick H. Pasaye and Ronald Peeters and Scott J. Peltier and Ulrich Pilatus and Nenad Polomac and Eric C. Porges and Subechhya Pradhan and James Joseph Prisciandaro and Nicolaas A. Puts and Caroline D. Rae and Francisco Reyes{-}Madrigal and Timothy P. L. Roberts and Caroline E. Robertson and Jens T. Rosenberg and Diana{-}Georgiana Rotaru and Ruth L. O'Gorman Tuura and Muhammad G. Saleh and Kristian Sandberg and Ryan Sangill and Keith Schembri and Anouk Schrantee and Natalia A. Semenova and Debra Singel and Rouslan Sitnikov and Jolinda Smith and Yulu Song and Craig E. L. Stark and Diederick Stoffers and Stephan P. Swinnen and Rongwen Tain and Costin Tanase and Sofie Tapper and Martin Tegenthoff and Thomas Thiel and Marc Thioux and Peter Truong and Pim van Dijk and Nolan Vella and Rishma Vidyasagar and Andrej Vovk and Guangbin Wang and Lars T. Westlye and Timothy K. Wilbur and William R. Willoughby and Martin Wilson and Hans{-}J{\"{o}}rg Wittsack and Adam J. Woods and Yen{-}Chien Wu and Junqian Xu and Maria Yanez Lopez and David Ka Wai Yeung and Qun Zhao and Xiaopeng Zhou and Gasper Zupan}, title = {Frequency drift in {MR} spectroscopy at 3T}, journal = {NeuroImage}, volume = {241}, pages = {118430}, year = {2021}, url = {https://doi.org/10.1016/j.neuroimage.2021.118430}, doi = {10.1016/J.NEUROIMAGE.2021.118430}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/neuroimage/HuiMZAABBBBBBBB21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/npjdm/FehrKOGSGSBMMHK21, author = {Jana Fehr and Stefan Konigorski and Stephen Olivier and Resign Gunda and Ashmika Surujdeen and Dickman Gareta and Theresa Smit and Kathy Baisley and Sashen Moodley and Yumna Moosa and Willem Hanekom and Olivier Koole and Thumbi Ndung'u and Deenan Pillay and Alison D. Grant and Mark J. Siedner and Christoph Lippert and Emily B. Wong and Anand Ramnanan and Anele Mkhwanazi and Antony Rapulana and Anupa Singh and Ashentha Govender and Ayanda Zungu and Boitsholo Mfolo and Bongani Magwaza and Bongumenzi Ndlovu and Clive Mavimbela and Costa Criticos and Day Munatsi and Dilip Kalyan and Doctar Mlambo and Fezeka Mfeka and Freddy Mabetlela and Gregory Ording{-}Jespersen and Hannah Keal and Hlengiwe Dlamini and Hlengiwe Khathi and Hlobisile Chonco and Hlobisile Gumede and Hlolisile Khumalo and Hloniphile Ngubane and Hollis Shen and Hosea Kambonde and Innocentia Mpofana and Jabu Kwinda and Jaco Dreyer and Jade Cousins and Jaikrishna Kalideen and Janet Seeley and Kandaseelan Chetty and Kayleen Brien and Kennedy Nyamande and Kgaugelo Moropane and Khabonina Malomane and Khadija Khan and Khanyisani Buthelezi and Kimeshree Perumal and Kobus Herbst and Lindani Mthembu and Logan Pillay and Mandisi Dlamini and Mandlakayise Zikhali and Mbali Mbuyisa and Mbuti Mofokeng and Melusi Sibiya and Mlungisi Dube and Mosa Suleman and Mpumelelo Steto and Mzamo Buthelezi and Nagavelli Padayachi and Nceba Gqaleni and Ngcebo Mhlongo and Nokukhanya Ntshakala and Nomathamsanqa Majozi and Nombuyiselo Zondi and Nomfundo Luthuli and Nomfundo Ngema and Nompilo Buthelezi and Nonceba Mfeka and Nondumiso Khuluse and Nondumiso Mabaso and Nondumiso Zitha and Nonhlanhla Mfekayi and Nonhlanhla Mzimela and Nozipho Mbonambi and Ntombiyenhlanhla Mkhwanazi and Ntombiyenkosi Ntombela and Pamela Ramkalawon and Pfarelo Tshivase and Phakamani Mkhwanazi and Philippa Mathews and Phumelele Mthethwa and Phumla Ngcobo and Ramesh Jackpersad and Raynold Zondo and Rochelle Singh and Rose Myeni and Sanah Bucibo and Sandile Mthembu and Sashin Harilall and Senamile Makhari and Seneme Mchunu and Senzeni Mkhwanazi and Sibahle Gumbi and Siboniso Nene and Sibusiso Mhlongo and Sibusiso Mkhwanazi and Sibusiso Nsibande and Simphiwe Ntshangase and Siphephelo Dlamini and Sithembile Ngcobo and Siyabonga Nsibande and Siyabonga Nxumalo and Sizwe Ndlela and Skhumbuzo Mthombeni and Smangaliso Zulu and Sphiwe Clement Mthembu and Sphiwe Ntuli and Talente Ntimbane and Thabile Zondi and Thandeka Khoza and Thengokwakhe Nkosi and Thokozani Bhengu and Thokozani Simelane and Tshwaraganang Modise and Tumi Madolo and Velile Vellem and Welcome Petros Mthembu and Xolani Mkhize and Zamashandu Mbatha and Zinhle Buthelezi and Zinhle Mthembu and Zizile Sikhosana}, title = {Computer-aided interpretation of chest radiography reveals the spectrum of tuberculosis in rural South Africa}, journal = {npj Digit. Medicine}, volume = {4}, year = {2021}, url = {https://doi.org/10.1038/s41746-021-00471-y}, doi = {10.1038/S41746-021-00471-Y}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/npjdm/FehrKOGSGSBMMHK21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/npjdm/FehrKOGSGSBMMHK21a, author = {Jana Fehr and Stefan Konigorski and Stephen Olivier and Resign Gunda and Ashmika Surujdeen and Dickman Gareta and Theresa Smit and Kathy Baisley and Sashen Moodley and Yumna Moosa and Willem Hanekom and Olivier Koole and Thumbi Ndung'u and Deenan Pillay and Alison D. Grant and Mark J. Siedner and Christoph Lippert and Emily B. Wong and Anand Ramnanan and Anele Mkhwanazi and Antony Rapulana and Anupa Singh and Ashentha Govender and Ayanda Zungu and Boitsholo Mfolo and Bongani Magwaza and Bongumenzi Ndlovu and Clive Mavimbela and Costa Criticos and Day Munatsi and Dilip Kalyan and Doctar Mlambo and Fezeka Mfeka and Freddy Mabetlela and Gregory Ording{-}Jespersen and Hannah Keal and Hlengiwe Dlamini and Hlengiwe Khathi and Hlobisile Chonco and Hlobisile Gumede and Hlolisile Khumalo and Hloniphile Ngubane and Hollis Shen and Hosea Kambonde and Innocentia Mpofana and Jabu Kwinda and Jaco Dreyer and Jade Cousins and Jaikrishna Kalideen and Janet Seeley and Kandaseelan Chetty and Kayleen Brien and Kennedy Nyamande and Kgaugelo Moropane and Khabonina Malomane and Khadija Khan and Khanyisani Buthelezi and Kimeshree Perumal and Kobus Herbst and Lindani Mthembu and Logan Pillay and Mandisi Dlamini and Mandlakayise Zikhali and Mbali Mbuyisa and Mbuti Mofokeng and Melusi Sibiya and Mlungisi Dube and Mosa Suleman and Mpumelelo Steto and Mzamo Buthelezi and Nagavelli Padayachi and Nceba Gqaleni and Ngcebo Mhlongo and Nokukhanya Ntshakala and Nomathamsanqa Majozi and Nombuyiselo Zondi and Nomfundo Luthuli and Nomfundo Ngema and Nompilo Buthelezi and Nonceba Mfeka and Nondumiso Khuluse and Nondumiso Mabaso and Nondumiso Zitha and Nonhlanhla Mfekayi and Nonhlanhla Mzimela and Nozipho Mbonambi and Ntombiyenhlanhla Mkhwanazi and Ntombiyenkosi Ntombela and Pamela Ramkalawon and Pfarelo Tshivase and Phakamani Mkhwanazi and Philippa Mathews and Phumelele Mthethwa and Phumla Ngcobo and Ramesh Jackpersad and Raynold Zondo and Rochelle Singh and Rose Myeni and Sanah Bucibo and Sandile Mthembu and Sashin Harilall and Senamile Makhari and Seneme Mchunu and Senzeni Mkhwanazi and Sibahle Gumbi and Siboniso Nene and Sibusiso Mhlongo and Sibusiso Mkhwanazi and Sibusiso Nsibande and Simphiwe Ntshangase and Siphephelo Dlamini and Sithembile Ngcobo and Siyabonga Nsibande and Siyabonga Nxumalo and Sizwe Ndlela and Skhumbuzo Mthombeni and Smangaliso Zulu and Sphiwe Clement Mthembu and Sphiwe Ntuli and Talente Ntimbane and Thabile Zondi and Thandeka Khoza and Thengokwakhe Nkosi and Thokozani Bhengu and Thokozani Simelane and Tshwaraganang Modise and Tumi Madolo and Velile Vellem and Welcome Petros Mthembu and Xolani Mkhize and Zamashandu Mbatha and Zinhle Buthelezi and Zinhle Mthembu and Zizile Sikhosana}, title = {Publisher Correction: Computer-aided interpretation of chest radiography reveals the spectrum of tuberculosis in rural South Africa}, journal = {npj Digit. Medicine}, volume = {4}, year = {2021}, url = {https://doi.org/10.1038/s41746-021-00485-6}, doi = {10.1038/S41746-021-00485-6}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/npjdm/FehrKOGSGSBMMHK21a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tgrs/TunaTDRZM21, author = {Suha Tuna and Beh{\c{c}}et Ugur T{\"{o}}reyin and Metin Demiralp and Jinchang Ren and Huimin Zhao and Stephen Marshall}, title = {Iterative Enhanced Multivariance Products Representation for Effective Compression of Hyperspectral Images}, journal = {{IEEE} Trans. Geosci. Remote. Sens.}, volume = {59}, number = {11}, pages = {9569--9584}, year = {2021}, url = {https://doi.org/10.1109/TGRS.2020.3031016}, doi = {10.1109/TGRS.2020.3031016}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tgrs/TunaTDRZM21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tkde/LiCLCG21, author = {Dongsheng Li and Chao Chen and Tun Lu and Stephen M. Chu and Ning Gu}, title = {Mixture Matrix Approximation for Collaborative Filtering}, journal = {{IEEE} Trans. Knowl. Data Eng.}, volume = {33}, number = {6}, pages = {2640--2653}, year = {2021}, url = {https://doi.org/10.1109/TKDE.2019.2955100}, doi = {10.1109/TKDE.2019.2955100}, timestamp = {Tue, 01 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tkde/LiCLCG21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/adhs/RobeyLTM21, author = {Alexander Robey and Lars Lindemann and Stephen Tu and Nikolai Matni}, editor = {Rapha{\"{e}}l M. Jungers and Necmiye Ozay and Alessandro Abate}, title = {Learning Robust Hybrid Control Barrier Functions for Uncertain Systems}, booktitle = {7th {IFAC} Conference on Analysis and Design of Hybrid Systems, {ADHS} 2021, Brussels, Belgium, July 7-9, 2021}, series = {IFAC-PapersOnLine}, volume = {54}, number = {5}, pages = {1--6}, publisher = {Elsevier}, year = {2021}, url = {https://doi.org/10.1016/j.ifacol.2021.08.465}, doi = {10.1016/J.IFACOL.2021.08.465}, timestamp = {Tue, 14 Sep 2021 14:28:35 +0200}, biburl = {https://dblp.org/rec/conf/adhs/RobeyLTM21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aime/GhoshalGST21, author = {Bhargab Ghoshal and Biraja Ghoshal and Stephen Swift and Allan Tucker}, editor = {Allan Tucker and Pedro Henriques Abreu and Jaime S. Cardoso and Pedro Pereira Rodrigues and David Ria{\~{n}}o}, title = {Uncertainty Estimation in SARS-CoV-2 B-Cell Epitope Prediction for Vaccine Development}, booktitle = {Artificial Intelligence in Medicine - 19th International Conference on Artificial Intelligence in Medicine, {AIME} 2021, Virtual Event, June 15-18, 2021, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {12721}, pages = {361--366}, publisher = {Springer}, year = {2021}, url = {https://doi.org/10.1007/978-3-030-77211-6\_41}, doi = {10.1007/978-3-030-77211-6\_41}, timestamp = {Thu, 10 Jun 2021 07:59:32 +0200}, biburl = {https://dblp.org/rec/conf/aime/GhoshalGST21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aime/GhoshalST21, author = {Biraja Ghoshal and Stephen Swift and Allan Tucker}, editor = {Allan Tucker and Pedro Henriques Abreu and Jaime S. Cardoso and Pedro Pereira Rodrigues and David Ria{\~{n}}o}, title = {Bayesian Deep Active Learning for Medical Image Analysis}, booktitle = {Artificial Intelligence in Medicine - 19th International Conference on Artificial Intelligence in Medicine, {AIME} 2021, Virtual Event, June 15-18, 2021, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {12721}, pages = {36--42}, publisher = {Springer}, year = {2021}, url = {https://doi.org/10.1007/978-3-030-77211-6\_4}, doi = {10.1007/978-3-030-77211-6\_4}, timestamp = {Wed, 09 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aime/GhoshalST21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amia/OSullivanWWTMAC21, author = {Dympna O'Sullivan and William Van Woensel and Szymon Wilk and Samson W. Tu and Wojtek Michalowski and Samina Abidi and Marc Carrier and Ruth Edry and Irit Hochberg and Stephen P. Kingwell and Alexandra Kogan and Martin Michalowski and Hugh O'Sullivan and Mor Peleg}, title = {Towards a framework for comparing functionalities of multimorbidity clinical decision support: {A} literature-based feature set and benchmark cases}, booktitle = {{AMIA} 2021, American Medical Informatics Association Annual Symposium, San Diego, CA, USA, October 30, 2021 - November 3, 2021}, publisher = {{AMIA}}, year = {2021}, url = {https://knowledge.amia.org/74229-amia-1.4622266/t003-1.4626466/t003-1.4626467/3576930-1.4626582/3572901-1.4626579}, timestamp = {Wed, 17 Apr 2024 11:46:53 +0200}, biburl = {https://dblp.org/rec/conf/amia/OSullivanWWTMAC21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/asscc/MehtaTTTGG21, author = {Nandish Mehta and Stephen G. Tell and Walker J. Turner and Lamar Tatro and Giant Goh and C. Thomas Gray}, title = {A 77 MHz Relaxation Oscillator in 5nm FinFET with 3ns {TIE} over 10K cycles and {\(\pm\)}0.3{\%} Thermal Stability using Frequency-Error Feedback Loop}, booktitle = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2021, Busan, Korea, Republic of, November 7-10, 2021}, pages = {1--3}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/A-SSCC53895.2021.9634712}, doi = {10.1109/A-SSCC53895.2021.9634712}, timestamp = {Tue, 21 Dec 2021 17:54:16 +0100}, biburl = {https://dblp.org/rec/conf/asscc/MehtaTTTGG21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cdc/BoffiTS21, author = {Nicholas M. Boffi and Stephen Tu and Jean{-}Jacques E. Slotine}, title = {Nonparametric Adaptive Control and Prediction: Theory and Randomized Algorithms}, booktitle = {2021 60th {IEEE} Conference on Decision and Control (CDC), Austin, TX, USA, December 14-17, 2021}, pages = {2935--2942}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/CDC45484.2021.9682907}, doi = {10.1109/CDC45484.2021.9682907}, timestamp = {Tue, 17 May 2022 15:53:17 +0200}, biburl = {https://dblp.org/rec/conf/cdc/BoffiTS21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/csci/AllisonTK21, author = {Mark Allison and Stephen W. Turner and Molly Kwasny}, title = {Assessing Cognitive Load for Junior Software Engineers: {A} Mixed-Method Study}, booktitle = {International Conference on Computational Science and Computational Intelligence, {CSCI} 2021, Las Vegas, NV, USA, December 15-17, 2021}, pages = {883--888}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/CSCI54926.2021.00206}, doi = {10.1109/CSCI54926.2021.00206}, timestamp = {Sat, 27 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/csci/AllisonTK21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/esscirc/MaiDKTBGCBSK21, author = {Dawei Mai and Yann Donnelly and Michael Peter Kennedy and Stefano Tulisi and James Breslin and Patrick Griffin and Michael Connor and Stephen Brookes and Brian Shelly and Michael Keaveney}, title = {Experimental Verification of Wandering Spur Suppression Technique in a 4.9 GHz Fractional-N Frequency Synthesizer}, booktitle = {47th {ESSCIRC} 2021 - European Solid State Circuits Conference, {ESSCIR} 2021, Grenoble, France, September 13-22, 2021}, pages = {439--442}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/ESSCIRC53450.2021.9567841}, doi = {10.1109/ESSCIRC53450.2021.9567841}, timestamp = {Thu, 28 Oct 2021 16:11:37 +0200}, biburl = {https://dblp.org/rec/conf/esscirc/MaiDKTBGCBSK21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hicss/TurnerMU21, author = {Adam Brian Turner and Stephen McCombie and Allon J. Uhlmann}, title = {Follow the money: Revealing risky nodes in a Ransomware-Bitcoin network}, booktitle = {54th Hawaii International Conference on System Sciences, {HICSS} 2021, Kauai, Hawaii, USA, January 5, 2021}, pages = {1--13}, publisher = {ScholarSpace}, year = {2021}, url = {https://hdl.handle.net/10125/70801}, timestamp = {Wed, 04 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/hicss/TurnerMU21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/ArslanDVARLALTA21, author = {Ali Nadir Arslan and Katarzyna Dabrowska{-}Zielinska and Vesselin Vassilev and Jos{\'{e}} Manuel {\'{A}}lvarez{-}Mart{\'{\i}}nez and Kameliya Radeva and Stanislaw Lewinski and Iida Autio and Hannakaisa Lindqvist and Maria Tenkanen and Tuula Aalto and Markus T{\"{o}}rm{\"{a}} and Lachezar Filchev and Michal Krupinski and Stephen Barry and Tarja Tuomainen and Premysl Stych and Abad Chabbi}, title = {Developing Support for Monitoring and Reporting of {GHG} Emissions and Removals from Land Use, Land Change and Forestry}, booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS} 2021, Brussels, Belgium, July 11-16, 2021}, pages = {6536--6539}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/IGARSS47720.2021.9553360}, doi = {10.1109/IGARSS47720.2021.9553360}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/igarss/ArslanDVARLALTA21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/l4dc/AhmadiCST21, author = {Amir Ali Ahmadi and Abraar Chaudhry and Vikas Sindhwani and Stephen Tu}, editor = {Ali Jadbabaie and John Lygeros and George J. Pappas and Pablo A. Parrilo and Benjamin Recht and Claire J. Tomlin and Melanie N. Zeilinger}, title = {Safely Learning Dynamical Systems from Short Trajectories}, booktitle = {Proceedings of the 3rd Annual Conference on Learning for Dynamics and Control, {L4DC} 2021, 7-8 June 2021, Virtual Event, Switzerland}, series = {Proceedings of Machine Learning Research}, volume = {144}, pages = {498--509}, publisher = {{PMLR}}, year = {2021}, url = {http://proceedings.mlr.press/v144/ahmadi21a.html}, timestamp = {Mon, 14 Jun 2021 08:02:30 +0200}, biburl = {https://dblp.org/rec/conf/l4dc/AhmadiCST21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/l4dc/BoffiTS21, author = {Nicholas M. Boffi and Stephen Tu and Jean{-}Jacques E. Slotine}, editor = {Ali Jadbabaie and John Lygeros and George J. Pappas and Pablo A. Parrilo and Benjamin Recht and Claire J. Tomlin and Melanie N. Zeilinger}, title = {Regret Bounds for Adaptive Nonlinear Control}, booktitle = {Proceedings of the 3rd Annual Conference on Learning for Dynamics and Control, {L4DC} 2021, 7-8 June 2021, Virtual Event, Switzerland}, series = {Proceedings of Machine Learning Research}, volume = {144}, pages = {471--483}, publisher = {{PMLR}}, year = {2021}, url = {http://proceedings.mlr.press/v144/boffi21a.html}, timestamp = {Mon, 14 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/l4dc/BoffiTS21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/miua/TuMCM21, author = {Shihfan Jack Tu and Jules Morel and Minsi Chen and Stephen J. Mellon}, editor = {Bartlomiej W. Papiez and Mohammad Yaqub and Jianbo Jiao and Ana I. L. Namburete and J. Alison Noble}, title = {Fast Automatic Bone Surface Segmentation in Ultrasound Images Without Machine Learning}, booktitle = {Medical Image Understanding and Analysis - 25th Annual Conference, {MIUA} 2021, Oxford, United Kingdom, July 12-14, 2021, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {12722}, pages = {250--264}, publisher = {Springer}, year = {2021}, url = {https://doi.org/10.1007/978-3-030-80432-9\_20}, doi = {10.1007/978-3-030-80432-9\_20}, timestamp = {Thu, 23 Jun 2022 19:58:26 +0200}, biburl = {https://dblp.org/rec/conf/miua/TuMCM21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/AnanthaVTLPC21, author = {Raviteja Anantha and Svitlana Vakulenko and Zhucheng Tu and Shayne Longpre and Stephen Pulman and Srinivas Chappidi}, editor = {Kristina Toutanova and Anna Rumshisky and Luke Zettlemoyer and Dilek Hakkani{-}T{\"{u}}r and Iz Beltagy and Steven Bethard and Ryan Cotterell and Tanmoy Chakraborty and Yichao Zhou}, title = {Open-Domain Question Answering Goes Conversational via Question Rewriting}, booktitle = {Proceedings of the 2021 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies, {NAACL-HLT} 2021, Online, June 6-11, 2021}, pages = {520--534}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.naacl-main.44}, doi = {10.18653/V1/2021.NAACL-MAIN.44}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/AnanthaVTLPC21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/works-ws/Al-SaadiABCCHHJ21, author = {Aymen Al{-}Saadi and Dong H. Ahn and Yadu N. Babuji and Kyle Chard and James Corbett and Mihael Hategan and Stephen Herbein and Shantenu Jha and Daniel E. Laney and Andr{\'{e}} Merzky and Todd S. Munson and Michael Salim and Mikhail Titov and Matteo Turilli and Thomas D. Uram and Justin M. Wozniak}, title = {ExaWorks: Workflows for Exascale}, booktitle = {2021 {IEEE} Workshop on Workflows in Support of Large-Scale Science (WORKS), St. Louis, MO, USA, November 15, 2021}, pages = {50--57}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/WORKS54523.2021.00012}, doi = {10.1109/WORKS54523.2021.00012}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/works-ws/Al-SaadiABCCHHJ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/coin-ws/2020, editor = {Andrea Aler Tubella and Stephen Cranefield and Christopher Frantz and Felipe Meneguzzi and Wamberto Vasconcelos}, title = {Coordination, Organizations, Institutions, Norms, and Ethics for Governance of Multi-Agent Systems {XIII} - International Workshops {COIN} 2017 and {COINE} 2020, Sao Paulo, Brazil, May 8-9, 2017 and Virtual Event, May 9, 2020, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {12298}, publisher = {Springer}, year = {2021}, url = {https://doi.org/10.1007/978-3-030-72376-7}, doi = {10.1007/978-3-030-72376-7}, isbn = {978-3-030-72375-0}, timestamp = {Thu, 15 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coin-ws/2020.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2101-06492, author = {Alexander Robey and Lars Lindemann and Stephen Tu and Nikolai Matni}, title = {Learning Robust Hybrid Control Barrier Functions for Uncertain Systems}, journal = {CoRR}, volume = {abs/2101.06492}, year = {2021}, url = {https://arxiv.org/abs/2101.06492}, eprinttype = {arXiv}, eprint = {2101.06492}, timestamp = {Fri, 22 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2101-06492.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2101-12383, author = {Jil Kl{\"{u}}nder and Regina Hebig and Paolo Tell and Marco Kuhrmann and Joyce Nakatumba{-}Nabende and Rogardt Heldal and Stephan Krusche and Masud Fazal{-}Baqaie and Michael Felderer and Marcela Fabiana Genero Bocco and Steffen K{\"{u}}pper and Sherlock A. Licorish and Gustavo L{\'{o}}pez and Fergal McCaffery and {\"{O}}zden {\"{O}}zcan Top and Christian R. Prause and Rafael Prikladnicki and Eray T{\"{u}}z{\"{u}}n and Dietmar Pfahl and Kurt Schneider and Stephen G. MacDonell}, title = {Catching up with Method and Process Practice: An Industry-Informed Baseline for Researchers}, journal = {CoRR}, volume = {abs/2101.12383}, year = {2021}, url = {https://arxiv.org/abs/2101.12383}, eprinttype = {arXiv}, eprint = {2101.12383}, timestamp = {Tue, 02 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2101-12383.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2102-09161, author = {Stephen Tu and Alexander Robey and Nikolai Matni}, title = {Closing the Closed-Loop Distribution Shift in Safe Imitation Learning}, journal = {CoRR}, volume = {abs/2102.09161}, year = {2021}, url = {https://arxiv.org/abs/2102.09161}, eprinttype = {arXiv}, eprint = {2102.09161}, timestamp = {Wed, 24 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2102-09161.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2102-09284, author = {Ross Drummond and Matthew C. Turner and Stephen R. Duncan}, title = {Reduced-Order Neural Network Synthesis with Robustness Guarantees}, journal = {CoRR}, volume = {abs/2102.09284}, year = {2021}, url = {https://arxiv.org/abs/2102.09284}, eprinttype = {arXiv}, eprint = {2102.09284}, timestamp = {Wed, 24 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2102-09284.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2103-02561, author = {Cher Bass and Mariana da Silva and Carole H. Sudre and Logan Z. J. Williams and Petru{-}Daniel Tudosiu and Fidel Alfaro{-}Almagro and Sean P. Fitzgibbon and Matthew F. Glasser and Stephen M. Smith and Emma C. Robinson}, title = {ICAM-reg: Interpretable Classification and Regression with Feature Attribution for Mapping Neurological Phenotypes in Individual Scans}, journal = {CoRR}, volume = {abs/2103.02561}, year = {2021}, url = {https://arxiv.org/abs/2103.02561}, eprinttype = {arXiv}, eprint = {2103.02561}, timestamp = {Mon, 22 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2103-02561.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2103-11214, author = {Bhargab Ghoshal and Biraja Ghoshal and Stephen Swift and Allan Tucker}, title = {Uncertainty Estimation in SARS-CoV-2 B-cell Epitope Prediction for Vaccine Development}, journal = {CoRR}, volume = {abs/2103.11214}, year = {2021}, url = {https://arxiv.org/abs/2103.11214}, eprinttype = {arXiv}, eprint = {2103.11214}, timestamp = {Wed, 24 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2103-11214.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2106-03589, author = {Nicholas M. Boffi and Stephen Tu and Jean{-}Jacques E. Slotine}, title = {Random features for adaptive nonlinear control and prediction}, journal = {CoRR}, volume = {abs/2106.03589}, year = {2021}, url = {https://arxiv.org/abs/2106.03589}, eprinttype = {arXiv}, eprint = {2106.03589}, timestamp = {Fri, 11 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2106-03589.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2107-01295, author = {Stephen Chang and Michael Ballantyne and Milo Turner and William J. Bowman}, title = {Dependent Type Systems as Macros}, journal = {CoRR}, volume = {abs/2107.01295}, year = {2021}, url = {https://arxiv.org/abs/2107.01295}, eprinttype = {arXiv}, eprint = {2107.01295}, timestamp = {Wed, 07 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2107-01295.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2108-08368, author = {Abu Reyan Ahmed and Md Asadullah Turja and Faryad Darabi Sahneh and Mithun Ghosh and Keaton Hamm and Stephen G. Kobourov}, title = {Computing Steiner Trees using Graph Neural Networks}, journal = {CoRR}, volume = {abs/2108.08368}, year = {2021}, url = {https://arxiv.org/abs/2108.08368}, eprinttype = {arXiv}, eprint = {2108.08368}, timestamp = {Mon, 23 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2108-08368.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2108-13521, author = {Aymen Al{-}Saadi and Dong H. Ahn and Yadu N. Babuji and Kyle Chard and James Corbett and Mihael Hategan and Stephen Herbein and Shantenu Jha and Daniel E. Laney and Andr{\'{e}} Merzky and Todd S. Munson and Michael Salim and Mikhail Titov and Matteo Turilli and Justin M. Wozniak}, title = {ExaWorks: Workflows for Exascale}, journal = {CoRR}, volume = {abs/2108.13521}, year = {2021}, url = {https://arxiv.org/abs/2108.13521}, eprinttype = {arXiv}, eprint = {2108.13521}, timestamp = {Sun, 20 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2108-13521.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2109-11435, author = {Marco Kuhrmann and Paolo Tell and Regina Hebig and Jil Kl{\"{u}}nder and J{\"{u}}rgen M{\"{u}}nch and Oliver Linssen and Dietmar Pfahl and Michael Felderer and Christian R. Prause and Stephen G. MacDonell and Joyce Nakatumba{-}Nabende and David Raffo and Sarah Beecham and Eray T{\"{u}}z{\"{u}}n and Gustavo L{\'{o}}pez and Nicol{\'{a}}s Paez and Diego Fontdevila and Sherlock A. Licorish and Steffen K{\"{u}}pper and G{\"{u}}nther Ruhe and Eric Knauss and {\"{O}}zden {\"{O}}zcan{-}Top and Paul M. Clarke and Fergal McCaffery and Marcela Genero and Aurora Vizca{\'{\i}}no and Mario Piattini and Marcos Kalinowski and Tayana Conte and Rafael Prikladnicki and Stephan Krusche and Ahmet Coskun{\c{c}}ay and Ezequiel Scott and Fabio Calefato and Svetlana Pimonova and Rolf{-}Helge Pfeiffer and Ulrik Pagh Schultz and Rogardt Heldal and Masud Fazal{-}Baqaie and Craig Anslow and Maleknaz Nayebi and Kurt Schneider and Stefan Sauer and Dietmar Winkler and Stefan Biffl and Mar{\'{\i}}a Cecilia Bastarrica and Ita Richardson}, title = {What Makes Agile Software Development Agile?}, journal = {CoRR}, volume = {abs/2109.11435}, year = {2021}, url = {https://arxiv.org/abs/2109.11435}, eprinttype = {arXiv}, eprint = {2109.11435}, timestamp = {Mon, 09 Jan 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2109-11435.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2109-11576, author = {Tim Hsu and Nathan Keilbart and Stephen Weitzner and James Chapman and Penghao Xiao and Tuan Anh Pham and S. Roger Qiu and Xiao Chen and Brandon C. Wood}, title = {Efficient, Interpretable Atomistic Graph Neural Network Representation for Angle-dependent Properties and its Application to Optical Spectroscopy Prediction}, journal = {CoRR}, volume = {abs/2109.11576}, year = {2021}, url = {https://arxiv.org/abs/2109.11576}, eprinttype = {arXiv}, eprint = {2109.11576}, timestamp = {Fri, 29 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2109-11576.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2111-09971, author = {Lars Lindemann and Alexander Robey and Lejun Jiang and Stephen Tu and Nikolai Matni}, title = {Learning Robust Output Control Barrier Functions from Safe Expert Demonstrations}, journal = {CoRR}, volume = {abs/2111.09971}, year = {2021}, url = {https://arxiv.org/abs/2111.09971}, eprinttype = {arXiv}, eprint = {2111.09971}, timestamp = {Mon, 22 Nov 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2111-09971.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2112-06904, author = {Ziyan Wang and Giljoo Nam and Tuur Stuyck and Stephen Lombardi and Michael Zollh{\"{o}}fer and Jessica K. Hodgins and Christoph Lassner}, title = {{HVH:} Learning a Hybrid Neural Volumetric Representation for Dynamic Hair Performance Capture}, journal = {CoRR}, volume = {abs/2112.06904}, year = {2021}, url = {https://arxiv.org/abs/2112.06904}, eprinttype = {arXiv}, eprint = {2112.06904}, timestamp = {Fri, 21 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2112-06904.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2112-10690, author = {Thomas T. C. K. Zhang and Stephen Tu and Nicholas M. Boffi and Jean{-}Jacques E. Slotine and Nikolai Matni}, title = {Adversarially Robust Stability Certificates can be Sample-Efficient}, journal = {CoRR}, volume = {abs/2112.10690}, year = {2021}, url = {https://arxiv.org/abs/2112.10690}, eprinttype = {arXiv}, eprint = {2112.10690}, timestamp = {Tue, 04 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2112-10690.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cmpb/FarnellRGZPHHMC20, author = {Damian J. J. Farnell and Stephen Richmond and Jennifer Galloway and Alexei I. Zhurov and Pertti Pirttiniemi and Tuomo H. Heikkinen and Virpi Harila and Harold S. Matthews and Peter Claes}, title = {Multilevel principal components analysis of three-dimensional facial growth in adolescents}, journal = {Comput. Methods Programs Biomed.}, volume = {188}, pages = {105272}, year = {2020}, url = {https://doi.org/10.1016/j.cmpb.2019.105272}, doi = {10.1016/J.CMPB.2019.105272}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cmpb/FarnellRGZPHHMC20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/complexity/ShangCKTFK20, author = {Ke Shang and Felix T. S. Chan and Stephen Karungaru and Kenji Terada and Zuren Feng and Liangjun Ke}, title = {Two-Stage Robust Optimization for the Orienteering Problem with Stochastic Weights}, journal = {Complex.}, volume = {2020}, pages = {5649821:1--5649821:15}, year = {2020}, url = {https://doi.org/10.1155/2020/5649821}, doi = {10.1155/2020/5649821}, timestamp = {Tue, 15 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/complexity/ShangCKTFK20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fcomp/TurnerMU20, author = {Adam Brian Turner and Stephen McCombie and Allon J. Uhlmann}, title = {Analysis Techniques for Illicit Bitcoin Transactions}, journal = {Frontiers Comput. Sci.}, volume = {2}, pages = {600596}, year = {2020}, url = {https://doi.org/10.3389/fcomp.2020.600596}, doi = {10.3389/FCOMP.2020.600596}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/fcomp/TurnerMU20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/focm/DeanMMRT20, author = {Sarah Dean and Horia Mania and Nikolai Matni and Benjamin Recht and Stephen Tu}, title = {On the Sample Complexity of the Linear Quadratic Regulator}, journal = {Found. Comput. Math.}, volume = {20}, number = {4}, pages = {633--679}, year = {2020}, url = {https://doi.org/10.1007/s10208-019-09426-y}, doi = {10.1007/S10208-019-09426-Y}, timestamp = {Fri, 07 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/focm/DeanMMRT20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/itcon/LeJGC20, author = {Tuyen Le and H. David Jeong and Stephen B. Gilbert and Evgeny Chukharev{-}Hudilainen}, title = {Generating partial civil information model views using a semantic information retrieval approach}, journal = {J. Inf. Technol. Constr.}, volume = {25}, pages = {41--54}, year = {2020}, url = {https://www.itcon.org/paper/2020/2}, timestamp = {Thu, 24 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/itcon/LeJGC20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/micro/PellegriniTJWKS20, author = {Andrea Pellegrini and Ashok Kumar Tummala and Jamshed Jalal and Mark Werkheiser and Anitha Kona and Nigel Stephens and Magnus Bruce and Yasuo Ishii and Joseph Pusdesris and Abhishek Raja and Chris Abernathy and Jinson Koppanalil and Tushar Ringe}, title = {The Arm Neoverse {N1} Platform: Building Blocks for the Next-Gen Cloud-to-Edge Infrastructure SoC}, journal = {{IEEE} Micro}, volume = {40}, number = {2}, pages = {53--62}, year = {2020}, url = {https://doi.org/10.1109/MM.2020.2972222}, doi = {10.1109/MM.2020.2972222}, timestamp = {Thu, 09 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/micro/PellegriniTJWKS20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/YatesAAAAAAAABB20, author = {Andrew D. Yates and Premanand Achuthan and Wasiu A. Akanni and James E. Allen and Jamie Allen and Jorge {\'{A}}lvarez{-}Jarreta and M. Ridwan Amode and Irina M. Armean and Andrey G. Azov and Ruth Bennett and Jyothish Bhai and Konstantinos Billis and Sanjay Boddu and Jos{\'{e}} Carlos Marug{\'{a}}n and Carla A. Cummins and Claire Davidson and Kamalkumar Jayantilal Dodiya and Reham Fatima and Astrid Gall and Carlos Garc{\'{\i}}a{-}Gir{\'{o}}n and Laurent Gil and Tiago Grego and Leanne Haggerty and Erin Haskell and Thibaut Hourlier and Osagie G. Izuogu and Sophie H. Janacek and Thomas Juettemann and Mike P. Kay and Ilias Lavidas and Tuan Le and Diana Lemos and Jose Gonzalez Martinez and Thomas Maurel and Mark D. McDowall and Aoife McMahon and Shamika Mohanan and Benjamin Moore and Michael Nuhn and Denye N. Oheh and Anne Parker and Andrew Parton and Mateus Patricio and Manoj Pandian Sakthivel and Ahamed Imran Abdul Salam and Bianca M. Schmitt and Helen Schuilenburg and Dan Sheppard and Mira Sycheva and Marek Szuba and Kieron R. Taylor and Anja Thormann and Glen Threadgold and Alessandro Vullo and Brandon Walts and Andrea Winterbottom and Amonida Zadissa and Marc Chakiachvili and Bethany Flint and Adam Frankish and Sarah E. Hunt and Garth IIsley and Myrto Kostadima and Nick Langridge and Jane E. Loveland and Fergal J. Martin and Joannella Morales and Jonathan M. Mudge and Matthieu Muffato and Emily Perry and Magali Ruffier and Stephen J. Trevanion and Fiona Cunningham and Kevin L. Howe and Daniel R. Zerbino and Paul Flicek}, title = {Ensembl 2020}, journal = {Nucleic Acids Res.}, volume = {48}, number = {Database-Issue}, pages = {D682--D688}, year = {2020}, url = {https://doi.org/10.1093/nar/gkz966}, doi = {10.1093/NAR/GKZ966}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/nar/YatesAAAAAAAABB20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nature/CollinsBKZAFKLG20, author = {Ryan L. Collins and Harrison Brand and Konrad J. Karczewski and Xuefang Zhao and Jessica Alf{\"{o}}ldi and Laurent C. Francioli and Amit V. Khera and Chelsea Lowther and Laura D. Gauthier and Harold Wang and Nicholas A. Watts and Matthew Solomonson and Alexander Baumann and Ruchi Munshi and Mark Walker and Christopher W. Whelan and Yongqing Huang and Ted Brookings and Ted Sharpe and Matthew R. Stone and Elise Valkanas and Jack Fu and Grace Tiao and Kristen M. Laricchia and Valent{\'{\i}}n Ruano{-}Rubio and Christine Stevens and Namrata Gupta and Caroline Cusick and Lauren Margolin and Irina M. Armean and Eric Banks and Louis Bergelson and Kristian Cibulskis and Kristen M. Connolly and Miguel Covarrubias and Beryl B. Cummings and Mark J. Daly and Stacey Donnelly and Yossi Farjoun and Steven Ferriera and Stacey Gabriel and Jeff Gentry and Thibault Jeandet and Diane Kaplan and Christopher Llanwarne and Eric V. Minikel and Benjamin M. Neale and Sam Novod and Anne H. O'Donnell{-}Luria and Nikelle Petrillo and Timothy Poterba and David Roazen and Andrea Saltzman and Kaitlin E. Samocha and Molly Schleicher and Cotton Seed and Jos{\'{e}} Soto and Kathleen Tibbetts and Charlotte Tolonen and Christopher Vittal and Gordon Wade and Arcturus Wang and Qingbo Wang and James S. Ware and Ben Weisburd and Nicola Whiffin and Carlos A. Aguilar Salinas and Tariq Ahmad and Christine M. Albert and Diego Ardissino and Gil Atzmon and John Barnard and Laurent Beaugerie and Emelia J. Benjamin and Michael Boehnke and Lori L. Bonnycastle and Erwin P. Bottinger and Donald W. Bowden and Matthew J. Bown and John C. Chambers and Juliana C. Chan and Daniel Chasman and Judy Cho and Mina K. Chung and Bruce Cohen and Adolfo Correa and Dana Dabelea and Dawood Darbar and Ravindranath Duggirala and Jos{\'{e}}e Dupuis and Patrick T. Ellinor and Roberto Elosua and Jeanette Erdmann and T{\~{o}}nu Esko and Martti F{\"{a}}rkkil{\"{a}} and Jose Florez and Andre Franke and Gad Getz and Benjamin Glaser and Stephen J. Glatt and David Goldstein and Clicerio Gonzalez and Leif Groop and Christopher A. Haiman and Craig Hanis and Matthew Harms and Mikko Hiltunen and Matti M. Holi and Christina M. Hultman and Mikko Kallela and Jaakko Kaprio and Sekar Kathiresan and Bong{-}Jo Kim and Young Jin Kim and George Kirov and Jaspal Kooner and Seppo Koskinen and Harlan M. Krumholz and Subra Kugathasan and Soo Heon Kwak and Markku Laakso and Terho Lehtim{\"{a}}ki and Ruth J. F. Loos and Steven A. Lubitz and Ronald C. W. Ma and Daniel G. MacArthur and Jaume Marrugat and Kari M. Mattila and Steven A. McCarroll and Mark I. McCarthy and Dermot McGovern and Ruth McPherson and James B. Meigs and Olle Melander and Andres Metspalu and Peter M. Nilsson and Michael C. O'Donovan and Dost {\"{O}}ng{\"{u}}r and Lorena Orozco and Michael J. Owen and Colin N. A. Palmer and Aarno Palotie and Kyong Soo Park and Carlos Pato and Ann E. Pulver and Nazneen Rahman and Anne M. Remes and John D. Rioux and Samuli Ripatti and Dan M. Roden and Danish Saleheen and Veikko Salomaa and Nilesh J. Samani and Jeremiah Scharf and Heribert Schunkert and Moore B. Shoemaker and Pamela Sklar and Hilkka Soininen and Harry Sokol and Tim Spector and Patrick F. Sullivan and Jaana Suvisaari and E. Shyong Tai and Yik Ying Teo and Tuomi Tiinamaija and Ming Tsuang and Dan Turner and Teresa Tusie{-}Luna and Erkki Vartiainen and Hugh Watkins and Rinse K. Weersma and Maija Wessman and James G. Wilson and Ramnik J. Xavier and Kent D. Taylor and Henry J. Lin and Stephen S. Rich and Wendy S. Post and Yii{-}Der Ida Chen and Jerome I. Rotter and Chad Nusbaum and Anthony A. Philippakis and Eric S. Lander and Michael E. Talkowski}, title = {A structural variation reference for medical and population genetics}, journal = {Nat.}, volume = {581}, number = {7809}, pages = {444--451}, year = {2020}, url = {https://doi.org/10.1038/s41586-020-2287-8}, doi = {10.1038/S41586-020-2287-8}, timestamp = {Wed, 16 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nature/CollinsBKZAFKLG20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nature/TurroAMGGSASFTS20, author = {Ernest Turro and William J. Astle and Karyn Megy and Stefan Gr{\"{a}}f and Daniel Greene and Olga Shamardina and Hana Lango Allen and Alba Sanchis{-}Juan and Mattia Frontini and Chantal Thys and Jonathan Stephens and Rutendo Mapeta and Oliver S. Burren and Kate Downes and Matthias Haimel and Salih Tuna and Sri V. V. Deevi and Timothy J. Aitman and David L. H. Bennett and Paul Calleja and Keren Carss and Mark J. Caulfield and Patrick F. Chinnery and Peter H. Dixon and Daniel P. Gale and Roger James and Ania Koziell and Michael A. Laffan and Adam P. Levine and Eamonn R. Maher and Hugh S. Markus and Joannella Morales and Nicholas W. Morrell and Andrew D. Mumford and Elizabeth Ormondroyd and Stuart Rankin and Augusto Rendon and Sylvia Richardson and Irene Roberts and Noemi B. A. Roy and Moin A. Saleem and Kenneth G. C. Smith and Hannah Stark and Rhea Y. Y. Tan and Andreas C. Themistocleous and Adrian J. Thrasher and Hugh Watkins and Andrew R. Webster and Martin R. Wilkins and Catherine Williamson and James Whitworth and Sean Humphray and David R. Bentley and Stephen Abbs and Lara Abulhoul and Julian Adlard and Munaza Ahmed and Hana Alachkar and David J. Allsup and Jeff Almeida{-}King and Philip Ancliff and Richard Antrobus and Ruth Armstrong and Gavin Arno and Sofie Ashford and Anthony Attwood and Paul Aurora and Christian Babbs and Chiara Bacchelli and Tamam Bakchoul and Siddharth Banka and Tadbir Bariana and Julian Barwell and Joana Batista and Helen E. Baxendale and Phil L. Beales and Agnieszka Bierzynska and Tina Biss and Maria A. K. Bitner{-}Glindzicz and Graeme C. M. Black and Marta Bleda and Iulia Blesneac and Detlef Bockenhauer and Harm Bogaard and Christian J. Bourne and Sara Boyce and John R. Bradley and Eugene Bragin and Gerome Breen and Paul Brennan and Carole Brewer and Matthew Brown and Andrew C. Browning and Michael J. Browning and Rachel J. Buchan and Matthew S. Buckland and Teofila Bueser and Carmen Bugarin Diz and John Burn and Siobhan O. Burns and Nigel Burrows and Carolyn Campbell and Gerald Carr{-}White and Ruth Casey and Jenny Chambers and John Chambers and Melanie M. Y. Chan and Calvin Cheah and Floria Cheng and Manali Chitre and Martin T. Christian and Colin Church and Jill Clayton{-}Smith and Maureen Cleary and Naomi Clements Brod and Gerry Coghlan and Elizabeth Colby and Trevor R. P. Cole and Janine Collins and Peter W. Collins and Camilla Colombo and Cecilia J. Compton and Robin Condliffe and Stuart A. Cook and H. Terence Cook and Nichola Cooper and Paul A. Corris and Abigail Furnell and Fiona Cunningham and Nicola S. Curry and Antony J. Cutler and Matthew J. Daniels and Mehul Dattani and Louise C. Daugherty and John Davis and Anthony De Soyza and Timothy Dent and Charu Deshpande and Eleanor F. Dewhurst and Sofia Douzgou and Anna M. Drazyk and Elizabeth Drewe and Daniel Duarte and Tina Dutt and J. David M. Edgar and Karen Edwards and William Egner and Melanie N. Ekani and Perry Elliott and Wendy N. Erber and Marie Erwood and Maria C. Estiu and Dafydd Gareth Evans and Gillian Evans and Tamara Everington and M{\'{e}}lanie Eyries and Hiva Fassihi and Remi Favier and Jack Findhammer and Debra Fletcher and Frances A. Flinter and R. Andres Floto and Tom Fowler and James Fox and Amy J. Frary and Courtney E. French and Kathleen Freson and Henning Gall and Vijeya Ganesan and Michael Gattens and Claire Geoghegan and Terence S. A. Gerighty and Ali G. Gharavi and Stefano Ghio and Hossein{-}Ardeschir Ghofrani and J. Simon R. Gibbs and Kate Gibson and Kimberly C. Gilmour and Barbara Girerd and Nicholas S. Gleadall and Sarah Goddard and David B. Goldstein and Keith Gomez and Pavels Gordins and David Gosal and Jodie Graham and Luigi Grassi and Lynn Greenhalgh and Andreas Greinacher and Paolo Gresele and Philip Griffiths and Sofia Grigoriadou and Russell J. Grocock and Detelina Grozeva and Mark Gurnell and Scott Hackett and Charaka Hadinnapola and William M. Hague and Rosie Hague and Matthew Hall and Helen L. Hanson and Eshika Haque and Kirsty Harkness and Andrew R. Harper and Claire L. Harris and Daniel Hart and Ahamad Hassan and Grant Hayman and Alex Henderson and Archana Herwadkar and Jonathan Hoffman and Simon Holden and Rita Horvath and Henry Houlden and Arjan C. Houweling and Luke S. G. E. Howard and Fengyuan Hu and Gavin Hudson and Joseph Hughes and Aarnoud P. Huissoon and Marc Humbert and Sarah Hunter and Matthew E. Hurles and Melita Irving and Louise Izatt and Sally A. Johnson and Stephen Jolles and Jennifer Jolley and Dragana Josifova and Neringa Jurkute and Tim Karten and Johannes Karten and Mary A. Kasanicki and Hanadi Kazkaz and Rashid Kazmi and Peter Kelleher and Anne M. Kelly and Wilf Kelsall and Carly Kempster and David G. Kiely and Nathalie Kingston and Robert Klima and Nils Koelling and Myrto Kostadima and Gabor Kovacs and Roman Kreuzhuber and Taco W. Kuijpers and Ajith Kumar and Dinakantha Kumararatne and Manju A. Kurian and Fiona Lalloo and Michele Lambert and Allan Lawrie and D. Mark Layton and Nick Lench and Claire Lentaigne and Tracy Lester and Rachel Linger and Hilary Longhurst and Lorena E. Lorenzo and Eleni Louka and Paul A. Lyons and Rajiv D. Machado and Robert V. MacKenzie Ross and Bella Madan and Jesmeen Maimaris and Samantha Malka and Sarah Mangles and Kevin J. Marchbank and Stephen Marks and Hanns{-}Ulrich Marschall and Andrew G. Marshall and Jennifer Martin and Mary Mathias and Emma Matthews and Heather Maxwell and Paul McAlinden and Mark I. McCarthy and Harriet McKinney and Aoife McMahon and Stuart Meacham and Adam J. Mead and Ignacio Medina Castello and Sarju G. Mehta and Michel Michaelides and Carolyn Millar and Shehla N. Mohammed and Shahin Moledina and David Montani and Anthony T. Moore and Monika Mozere and Keith W. Muir and Andrea H. Nemeth and William G. Newman and Michael Newnham and Sadia Noorani and Paquita Nurden and Jennifer O'Sullivan and Samya Obaji and Chris Odhams and Steven Okoli and Andrea Olschewski and Horst Olschewski and Kai Ren Ong and S. Helen Oram and Willem H. Ouwehand and Claire Palles and Sofia Papadia and Soo{-}Mi Park and David Parry and Smita Patel and Joan Paterson and Andrew Peacock and Simon H. Pearce and John Peden and Kathelijne Peerlinck and Christopher J. Penkett and Joanna Pepke{-}Zaba and Romina Petersen and Clarissa Pilkington and Kenneth E. S. Poole and Radhika Prathalingam and Bethan Psaila and Angela Pyle and Richard Quinton and Shamima Rahman and Anupama Rao and F. Lucy Raymond and Paula J. Rayner{-}Matthews and Christine Rees and Tara Renton and Christopher J. Rhodes and Andrew S. C. Rice and Alex Richter and Leema Robert and Anthony Rogers and Sarah J. Rose and Robert Ross{-}Russell and Catherine Roughley and Deborah M. Ruddy and Omid Sadeghi{-}Alavijeh and Nilesh J. Samani and Crina Samarghitean and Ravishankar B. Sargur and Robert N. Sarkany and Simon Satchell and Sinisa Savic and John A. Sayer and Genevieve Sayer and Laura Scelsi and Andrew M. Schaefer and Sol Schulman and Richard Scott and Marie Scully and Claire Searle and Werner Seeger and Arjune Sen and W. A. Carrock Sewell and Denis Seyres and Neil Shah and Susan E. Shapiro and Adam C. Shaw and Patrick J. Short and Keith Sibson and Lucy Side and Ilenia Simeoni and Michael A. Simpson and Matthew C. Sims and Suthesh Sivapalaratnam and Damian Smedley and Katherine R. Smith and Katie Snape and Nicole Soranzo and Florent Soubrier and Laura Southgate and Olivera Spasic{-}Boskovic and Simon Staines and Emily Staples and Charles A. Steward and Kathleen E. Stirrups and Alex Stuckey and Jay Suntharalingam and Emilia M. Swietlik and Petros Syrris and R. Campbell Tait and Kate Talks and Katie Tate and John M. Taylor and Jenny C. Taylor and James E. Thaventhiran and Ellen Thomas and David Thomas and Moira J. Thomas and Patrick Thomas and Kate Thomson and Glen Threadgold and Tobias Tilly and Marc Tischkowitz and Catherine Titterton and John A. Todd and Cheng{-}Hock Toh and Bas Tolhuis and Ian P. Tomlinson and Mark Toshner and Matthew Traylor and Carmen Treacy and Paul Treadaway and Richard Trembath and Wojciech Turek and Philip Twiss and Tom Vale and Chris Van Geet and Natalie van Zuydam and Maarten Vandekuilen and Anthony M. Vandersteen and Marta Vazquez{-}Lopez and Julie von Ziegenweidt and Anton Vonk{-}Noordegraaf and Annette Wagner and Quinten Waisfisz and Suellen M. Walker and Neil Walker and Klaudia Walter and James S. Ware and Christopher Watt and Lucy Wedderburn and Wei Wei and Steven B. Welch and Julie Wessels and Sarah K. Westbury and John{-}Paul Westwood and John Wharton and Deborah Whitehorn and Andrew O. M. Wilkie and Brian T. Wilson and Edwin K. S. Wong and Nicholas W. Wood and Yvette Wood and Christopher Geoffrey Woods and Emma R. Woodward and Stephen J. Wort and Austen Worth and Michael Wright and Katherine Yates and Patrick F. K. Yong and Timothy Young and Ping Yu and Patrick Yu{-}Wai{-}Man and Eliska Zlamalova}, title = {Whole-genome sequencing of patients with rare diseases in a national health system}, journal = {Nat.}, volume = {583}, number = {7814}, pages = {96--102}, year = {2020}, url = {https://doi.org/10.1038/s41586-020-2434-2}, doi = {10.1038/S41586-020-2434-2}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nature/TurroAMGGSASFTS20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pacmpl/ChangBTB20, author = {Stephen Chang and Michael Ballantyne and Milo Turner and William J. Bowman}, title = {Dependent type systems as macros}, journal = {Proc. {ACM} Program. Lang.}, volume = {4}, number = {{POPL}}, pages = {3:1--3:29}, year = {2020}, url = {https://doi.org/10.1145/3371071}, doi = {10.1145/3371071}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pacmpl/ChangBTB20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/AngelTPMLM20, author = {Yoseline Angel and Darren Turner and Stephen Parkes and Yoann Malb{\'{e}}teau and Arko Lucieer and Matthew F. McCabe}, title = {Automated Georectification and Mosaicking of UAV-Based Hyperspectral Imagery from Push-Broom Sensors}, journal = {Remote. Sens.}, volume = {12}, number = {1}, pages = {34}, year = {2020}, url = {https://doi.org/10.3390/rs12010034}, doi = {10.3390/RS12010034}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/AngelTPMLM20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/AragonJPMAAATLM20, author = {Bruno Aragon and Kasper Johansen and Stephen Parkes and Yoann Malb{\'{e}}teau and Samer Al{-}Mashharawi and Talal Al{-}Amoudi and Cristhian F. Andrade and Darren Turner and Arko Lucieer and Matthew F. McCabe}, title = {A Calibration Procedure for Field and UAV-Based Uncooled Thermal Infrared Instruments}, journal = {Sensors}, volume = {20}, number = {11}, pages = {3316}, year = {2020}, url = {https://doi.org/10.3390/s20113316}, doi = {10.3390/S20113316}, timestamp = {Thu, 04 Jul 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sensors/AragonJPMAAATLM20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/BaniAABBBBBBBBC20, author = {Lukas B{\"{a}}ni and Andreas Alexopoulos and Marina Artuso and Felix Bachmair and Marcin Bartosik and Helge Beck and Vincenzo Bellini and Vladimir Belyaev and Benjamin Bentele and Alexandre Bes and Jean{-}Marie Brom and Gabriele Chiodini and Dominik Chren and Vladimir Cindro and Gilles Claus and Johann Collot and John Cumalat and S{\'{e}}bastien Curtoni and Anne Dabrowski and Raffaello D'Alessandro and Denis Dauvergne and Wim de Boer and Christian Dorfer and Marc D{\"{u}}nser and Gerald Eigen and Vladimir Eremin and Jacopo Forneris and Laurent Gallin{-}Martel and Marie{-}Laure Gallin{-}Martel and Kock Gan and Martin Gastal and Abderrahman Ghimouz and Mathieu Goffe and Joel Goldstein and Alexander Golubev and Andrej Gorisek and Eugene Grigoriev and J{\"{o}}rn Grosse{-}Knetter and Aidan Grummer and Bojan Hiti and Dmitry Hits and Martin Hoeferkamp and J{\'{e}}r{\^{o}}me Hosselet and Fabian H{\"{u}}gging and Chris Hutson and Jens Janssen and Harris Kagan and Keida Kanxheri and Richard Kass and Mladen Kis and Gregor Kramberger and Sergey Kuleshov and Ana Lacoste and Stefano Lagomarsino and Alessandro Lo Giudice and Ivan L{\'{o}}pez Paz and Eric Lukosi and Chaker Maazouzi and Igor Mandic and Sara Marcatili and Alysia Marino and C{\'{e}}dric Mathieu and Mauro Menichelli and Marko Mikuz and Arianna Morozzi and Francesco Moscatelli and Joshua Moss and Raymond Mountain and Alexander Oh and Paolo Olivero and Daniele Passeri and Heinz Pernegger and Roberto Perrino and Federico Picollo and Michal Pomorski and Renato Potenza and Arnulf Quadt and Fatah Rarbi and Alessandro Re and Michael Reichmann and Shaun Roe and Olivier Rossetto and Diego Sanz Becerra and Christian J. Schmidt and Stephen Schnetzer and Silvio Sciortino and Andrea Scorzoni and Sally Seidel and Leonello Servoli and Dale Smith and Bruno Sopko and Vit Sopko and Stefania Spagnolo and Stefan Spanier and Kevin Stenson and Robert Stone and Bjarne Stugu and Concetta Sutera and Michael Tr{\"{a}}ger and William Trischuk and Marco Truccato and Cristina Tuv{\`{e}} and Jaap Velthuis and Stephen Wagner and Rainer Wallny and Jianchun Wang and Norbert Wermes and Jayashani Wickramasinghe and Mahfoud Yamouni and Justas Zalieckas and Marko Zavrtanik and Kazuhiko Hara and Yoichi Ikegami and Osamu Jinnouchi and Takashi Kohriki and Shingo Mitsui and Ryo Nagai and Susumu Terada and Yoshinobu Unno}, title = {A Study of the Radiation Tolerance of {CVD} Diamond to 70 MeV Protons, Fast Neutrons and 200 MeV Pions}, journal = {Sensors}, volume = {20}, number = {22}, pages = {6648}, year = {2020}, url = {https://doi.org/10.3390/s20226648}, doi = {10.3390/S20226648}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sensors/BaniAABBBBBBBBC20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/LiTNWBTY20, author = {Menglong Li and Russel N. Torah and Helga Nunes{-}Matos and Yang Wei and Stephen P. Beeby and John Tudor and Kai Yang}, title = {Integration and Testing of a Three-Axis Accelerometer in a Woven E-Textile Sleeve for Wearable Movement Monitoring}, journal = {Sensors}, volume = {20}, number = {18}, pages = {5033}, year = {2020}, url = {https://doi.org/10.3390/s20185033}, doi = {10.3390/S20185033}, timestamp = {Tue, 18 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sensors/LiTNWBTY20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbe/RahamanMLJMAASM20, author = {Md Abdur Rahaman and Daniel H. Mathalon and Hyo Jong Lee and Wenhao Jiang and Bryon A. Mueller and Ole A. Andreassen and Ingrid Agartz and Scott R. Sponheim and Andrew R. Mayer and Julia M. Stephen and Rex E. Jung and Jessica A. Turner and Jos{\'{e}} M. Ca{\~{n}}ive and Juan R. Bustillo and Vince D. Calhoun and Cota Navin Gupta and Srinivas Rachakonda and Jiayu Chen and Jingyu Liu and Theo G. M. van Erp and Steven G. Potkin and Judith M. Ford}, title = {N-BiC: {A} Method for Multi-Component and Symptom Biclustering of Structural {MRI} Data: Application to Schizophrenia}, journal = {{IEEE} Trans. Biomed. Eng.}, volume = {67}, number = {1}, pages = {110--121}, year = {2020}, url = {https://doi.org/10.1109/TBME.2019.2908815}, doi = {10.1109/TBME.2019.2908815}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tbe/RahamanMLJMAASM20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcst/Narvaez-ArocheM20, author = {Octavio Narvaez{-}Aroche and Pierre{-}Jean Meyer and Stephen Tu and Andrew K. Packard and Murat Arcak}, title = {Robust Control of the Sit-to-Stand Movement for a Powered Lower Limb Orthosis}, journal = {{IEEE} Trans. Control. Syst. Technol.}, volume = {28}, number = {6}, pages = {2390--2403}, year = {2020}, url = {https://doi.org/10.1109/TCST.2019.2945908}, doi = {10.1109/TCST.2019.2945908}, timestamp = {Fri, 30 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcst/Narvaez-ArocheM20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/FuXLWBMAL20, author = {Huazhu Fu and Yanwu Xu and Stephen Lin and Damon Wing Kee Wong and Mani Baskaran and Meenakshi Mahesh and Tin Aung and Jiang Liu}, title = {Angle-Closure Detection in Anterior Segment {OCT} Based on Multilevel Deep Network}, journal = {{IEEE} Trans. Cybern.}, volume = {50}, number = {7}, pages = {3358--3366}, year = {2020}, url = {https://doi.org/10.1109/TCYB.2019.2897162}, doi = {10.1109/TCYB.2019.2897162}, timestamp = {Thu, 19 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcyb/FuXLWBMAL20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tgrs/RocadenboschBFW20, author = {Francesc Rocadenbosch and Rub{\'{e}}n Barrag{\'{a}}n and Stephen J. Frasier and Joseph Waldinger and David D. Turner and Robin Tanamachi and Daniel T. Dawson}, title = {Ceilometer-Based Rain-Rate Estimation: {A} Case-Study Comparison With S-Band Radar and Disdrometer Retrievals in the Context of {VORTEX-SE}}, journal = {{IEEE} Trans. Geosci. Remote. Sens.}, volume = {58}, number = {12}, pages = {8268--8284}, year = {2020}, url = {https://doi.org/10.1109/TGRS.2020.2984458}, doi = {10.1109/TGRS.2020.2984458}, timestamp = {Thu, 27 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tgrs/RocadenboschBFW20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmbmc/McGuinessGTM20, author = {Daniel Tun{\c{c}} McGuiness and Stamatios Giannoukos and Stephen Taylor and Alan Marshall}, title = {Analysis of Multi-Chemical Transmission in the Macro-Scale}, journal = {{IEEE} Trans. Mol. Biol. Multi Scale Commun.}, volume = {6}, number = {2}, pages = {93--106}, year = {2020}, url = {https://doi.org/10.1109/TMBMC.2020.3012874}, doi = {10.1109/TMBMC.2020.3012874}, timestamp = {Thu, 16 Sep 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tmbmc/McGuinessGTM20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acis/Lam0020, author = {Yuk Tung Tonnie Lam and Peter Busch and Stephen Smith}, title = {Australia's Embrace of a Cashless Society}, booktitle = {Australasian Conference on Information Systems, {ACIS} 2020, Wellington, New Zealand, December 1-4, 2020}, pages = {70}, year = {2020}, url = {https://aisel.aisnet.org/acis2020/70}, timestamp = {Thu, 16 May 2024 17:06:12 +0200}, biburl = {https://dblp.org/rec/conf/acis/Lam0020.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aicv2/AbdulrasoolT20, author = {Fatema Abdulrasool and Stephen Turnbull}, editor = {Aboul Ella Hassanien and Ahmad Taher Azar and Tarek Gaber and Diego Oliva and Mohamed Fahmy Tolba}, title = {The Role of {IT} Governance in Enhancing the Performance of Smart Universities}, booktitle = {Proceedings of the International Conference on Artificial Intelligence and Computer Vision, {AICV} 2020, Cairo, Egypt, 8-10 April, 2020}, series = {Advances in Intelligent Systems and Computing}, volume = {1153}, pages = {708--720}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-3-030-44289-7\_66}, doi = {10.1007/978-3-030-44289-7\_66}, timestamp = {Wed, 25 Mar 2020 12:15:32 +0100}, biburl = {https://dblp.org/rec/conf/aicv2/AbdulrasoolT20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cdc/RobeyHLZDTM20, author = {Alexander Robey and Haimin Hu and Lars Lindemann and Hanwen Zhang and Dimos V. Dimarogonas and Stephen Tu and Nikolai Matni}, title = {Learning Control Barrier Functions from Expert Demonstrations}, booktitle = {59th {IEEE} Conference on Decision and Control, {CDC} 2020, Jeju Island, South Korea, December 14-18, 2020}, pages = {3717--3724}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/CDC42340.2020.9303785}, doi = {10.1109/CDC42340.2020.9303785}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cdc/RobeyHLZDTM20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/BoffiTMSS20, author = {Nicholas M. Boffi and Stephen Tu and Nikolai Matni and Jean{-}Jacques E. Slotine and Vikas Sindhwani}, editor = {Jens Kober and Fabio Ramos and Claire J. Tomlin}, title = {Learning Stability Certificates from Data}, booktitle = {4th Conference on Robot Learning, CoRL 2020, 16-18 November 2020, Virtual Event / Cambridge, MA, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {155}, pages = {1341--1350}, publisher = {{PMLR}}, year = {2020}, url = {https://proceedings.mlr.press/v155/boffi21a.html}, timestamp = {Tue, 18 Oct 2022 08:35:37 +0200}, biburl = {https://dblp.org/rec/conf/corl/BoffiTMSS20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/corl/LindemannHRZDTM20, author = {Lars Lindemann and Haimin Hu and Alexander Robey and Hanwen Zhang and Dimos V. Dimarogonas and Stephen Tu and Nikolai Matni}, editor = {Jens Kober and Fabio Ramos and Claire J. Tomlin}, title = {Learning Hybrid Control Barrier Functions from Data}, booktitle = {4th Conference on Robot Learning, CoRL 2020, 16-18 November 2020, Virtual Event / Cambridge, MA, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {155}, pages = {1351--1370}, publisher = {{PMLR}}, year = {2020}, url = {https://proceedings.mlr.press/v155/lindemann21a.html}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/corl/LindemannHRZDTM20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ease/CapiluppiAAACDM20, author = {Andrea Capiluppi and Nemitari Ajienka and Nour Ali and Mahir Arzoky and Steve Counsell and Giuseppe Destefanis and Alina Dana Miron and Bhaveet Nagaria and Rumyana Neykova and Martin J. Shepperd and Stephen Swift and Allan Tucker}, editor = {Jingyue Li and Letizia Jaccheri and Torgeir Dings{\o}yr and Ruzanna Chitchyan}, title = {Using the Lexicon from Source Code to Determine Application Domain}, booktitle = {{EASE} '20: Evaluation and Assessment in Software Engineering, Trondheim, Norway, April 15-17, 2020}, pages = {110--119}, publisher = {{ACM}}, year = {2020}, url = {https://doi.org/10.1145/3383219.3383231}, doi = {10.1145/3383219.3383231}, timestamp = {Wed, 16 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ease/CapiluppiAAACDM20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ecai/BellaEDPTRG20, author = {G{\'{a}}bor Bella and Liz Elliot and Subhashis Das and Stephen Pavis and Ettore Turra and David Robertson and Fausto Giunchiglia}, editor = {Giuseppe De Giacomo and Alejandro Catal{\'{a}} and Bistra Dilkina and Michela Milano and Sen{\'{e}}n Barro and Alberto Bugar{\'{\i}}n and J{\'{e}}r{\^{o}}me Lang}, title = {Cross-Border Medical Research Using Multi-Layered and Distributed Knowledge}, booktitle = {{ECAI} 2020 - 24th European Conference on Artificial Intelligence, 29 August-8 September 2020, Santiago de Compostela, Spain, August 29 - September 8, 2020 - Including 10th Conference on Prestigious Applications of Artificial Intelligence {(PAIS} 2020)}, series = {Frontiers in Artificial Intelligence and Applications}, volume = {325}, pages = {2956--2963}, publisher = {{IOS} Press}, year = {2020}, url = {https://doi.org/10.3233/FAIA200469}, doi = {10.3233/FAIA200469}, timestamp = {Thu, 12 Jan 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ecai/BellaEDPTRG20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccS/DoPTSCWETD20, author = {Tu Mai Anh Do and Lo{\"{\i}}c Pottier and Stephen Thomas and Rafael Ferreira da Silva and Michel A. Cuendet and Harel Weinstein and Trilce Estrada and Michela Taufer and Ewa Deelman}, editor = {Valeria V. Krzhizhanovskaya and G{\'{a}}bor Z{\'{a}}vodszky and Michael Harold Lees and Jack J. Dongarra and Peter M. A. Sloot and S{\'{e}}rgio Brissos and Jo{\~{a}}o Teixeira}, title = {A Novel Metric to Evaluate In Situ Workflows}, booktitle = {Computational Science - {ICCS} 2020 - 20th International Conference, Amsterdam, The Netherlands, June 3-5, 2020, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {12137}, pages = {538--553}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-3-030-50371-0\_40}, doi = {10.1007/978-3-030-50371-0\_40}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iccS/DoPTSCWETD20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/SongJTDN20, author = {Xingyou Song and Yiding Jiang and Stephen Tu and Yilun Du and Behnam Neyshabur}, title = {Observational Overfitting in Reinforcement Learning}, booktitle = {8th International Conference on Learning Representations, {ICLR} 2020, Addis Ababa, Ethiopia, April 26-30, 2020}, publisher = {OpenReview.net}, year = {2020}, url = {https://openreview.net/forum?id=HJli2hNKDH}, timestamp = {Thu, 07 May 2020 17:11:47 +0200}, biburl = {https://dblp.org/rec/conf/iclr/SongJTDN20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/MajumdarKMMT20, author = {Somdeb Majumdar and Shauharda Khadka and Santiago Miret and Stephen McAleer and Kagan Tumer}, title = {Evolutionary Reinforcement Learning for Sample-Efficient Multiagent Coordination}, booktitle = {Proceedings of the 37th International Conference on Machine Learning, {ICML} 2020, 13-18 July 2020, Virtual Event}, series = {Proceedings of Machine Learning Research}, volume = {119}, pages = {6651--6660}, publisher = {{PMLR}}, year = {2020}, url = {http://proceedings.mlr.press/v119/majumdar20a.html}, timestamp = {Tue, 15 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icml/MajumdarKMMT20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icse/0001NOST20, author = {Simon Foster and Yakoub Nemouchi and Colin O'Halloran and Karen Stephenson and Nick Tudor}, editor = {Kyungmin Bae and Domenico Bianculli and Stefania Gnesi and Nico Plat}, title = {Formal Model-Based Assurance Cases in Isabelle/SACM: An Autonomous Underwater Vehicle Case Study}, booktitle = {FormaliSE@ICSE 2020: 8th International Conference on Formal Methods in Software Engineering, Seoul, Republic of Korea, July 13, 2020}, pages = {11--21}, publisher = {{ACM}}, year = {2020}, url = {https://doi.org/10.1145/3372020.3391559}, doi = {10.1145/3372020.3391559}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icse/0001NOST20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isscc/0033NTKZGPST0G20, author = {Xi Chen and Nikola Nedovic and Stephen G. Tell and Sudhir S. Kudva and Brian Zimmer and Thomas H. Greer and John W. Poulton and Sanquan Song and Walker J. Turner and John M. Wilson and C. Thomas Gray}, title = {6.6 Reference-Noise Compensation Scheme for Single-Ended Package-to-Package Links}, booktitle = {2020 {IEEE} International Solid- State Circuits Conference, {ISSCC} 2020, San Francisco, CA, USA, February 16-20, 2020}, pages = {126--128}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/ISSCC19947.2020.9063140}, doi = {10.1109/ISSCC19947.2020.9063140}, timestamp = {Sat, 18 Apr 2020 17:41:44 +0200}, biburl = {https://dblp.org/rec/conf/isscc/0033NTKZGPST0G20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/BassSSTSR20, author = {Cher Bass and Mariana da Silva and Carole H. Sudre and Petru{-}Daniel Tudosiu and Stephen M. Smith and Emma C. Robinson}, editor = {Hugo Larochelle and Marc'Aurelio Ranzato and Raia Hadsell and Maria{-}Florina Balcan and Hsuan{-}Tien Lin}, title = {{ICAM:} Interpretable Classification via Disentangled Representations and Feature Attribution Mapping}, booktitle = {Advances in Neural Information Processing Systems 33: Annual Conference on Neural Information Processing Systems 2020, NeurIPS 2020, December 6-12, 2020, virtual}, year = {2020}, url = {https://proceedings.neurips.cc/paper/2020/hash/56f9f88906aebf4ad985aaec7fa01313-Abstract.html}, timestamp = {Mon, 22 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/nips/BassSSTSR20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ofc/LedentsovSKLCTH30, author = {Nikolay N. Ledentsov and V. A. Shchukin and Vladimir P. Kalosha and Nikolay Ledentsov Jr. and Lukasz Chorchos and Jaroslaw P. Turkiewicz and Urs Hecht and Patrick Kurth and Friedel Gerfers and Justin Lavrencik and Siddharth Varughese and Stephen E. Ralph}, title = {Optical Interconnects using Single-Mode and Multi-Mode {VCSEL} and Multi-Mode Fiber}, booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2020, San Diego, CA, USA, March 8-12, 2020}, pages = {1--3}, publisher = {{IEEE}}, year = {2020}, url = {https://ieeexplore.ieee.org/document/9083589}, timestamp = {Tue, 11 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ofc/LedentsovSKLCTH30.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/plans/TurnerWEK20, author = {Michael Turner and Stephen Wimbush and Christoph Enneking and Andriy Konovaltsev}, title = {Spoofing Detection by Distortion of the Correlation Function}, booktitle = {{IEEE/ION} Position, Location and Navigation Symposium, {PLANS} 2020, Portland, OR, USA, April 20-23, 2020}, pages = {566--574}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/PLANS46316.2020.9110173}, doi = {10.1109/PLANS46316.2020.9110173}, timestamp = {Tue, 16 Jun 2020 12:24:43 +0200}, biburl = {https://dblp.org/rec/conf/plans/TurnerWEK20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:series/hci/FrostDGTLB20, author = {Dennis Frost and Suzanne Dillon and Stephen Grady and Jeffrey Thurlow and Tuck Wah Leong and Jeanette Bell}, editor = {Rens Brankaert and Gail Kenning}, title = {Approaches for Authentic Engagement: Younger Onset Dementia}, booktitle = {{HCI} and Design in the Context of Dementia}, series = {Human-Computer Interaction Series}, pages = {77--93}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-3-030-32835-1\_6}, doi = {10.1007/978-3-030-32835-1\_6}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/series/hci/FrostDGTLB20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/miccai/2020asmus, editor = {Yipeng Hu and Roxane Licandro and J. Alison Noble and Jana Hutter and Stephen R. Aylward and Andrew Melbourne and Esra Abaci Turk and Jordina Torrents{-}Barrena}, title = {Medical Ultrasound, and Preterm, Perinatal and Paediatric Image Analysis - First International Workshop, {ASMUS} 2020, and 5th International Workshop, {PIPPI} 2020, Held in Conjunction with {MICCAI} 2020, Lima, Peru, October 4-8, 2020, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {12437}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-3-030-60334-2}, doi = {10.1007/978-3-030-60334-2}, isbn = {978-3-030-60333-5}, timestamp = {Tue, 06 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miccai/2020asmus.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2001-10389, author = {Jonathan Tuck and Stephen P. Boyd}, title = {Eigen-Stratified Models}, journal = {CoRR}, volume = {abs/2001.10389}, year = {2020}, url = {https://arxiv.org/abs/2001.10389}, eprinttype = {arXiv}, eprint = {2001.10389}, timestamp = {Thu, 30 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2001-10389.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2004-03315, author = {Alexander Robey and Haimin Hu and Lars Lindemann and Hanwen Zhang and Dimos V. Dimarogonas and Stephen Tu and Nikolai Matni}, title = {Learning Control Barrier Functions from Expert Demonstrations}, journal = {CoRR}, volume = {abs/2004.03315}, year = {2020}, url = {https://arxiv.org/abs/2004.03315}, eprinttype = {arXiv}, eprint = {2004.03315}, timestamp = {Wed, 08 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2004-03315.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2005-01752, author = {Jonathan Tuck and Stephen P. Boyd}, title = {Fitting Laplacian Regularized Stratified Gaussian Models}, journal = {CoRR}, volume = {abs/2005.01752}, year = {2020}, url = {https://arxiv.org/abs/2005.01752}, eprinttype = {arXiv}, eprint = {2005.01752}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2005-01752.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2005-13095, author = {Nilufer Tuptuk and Stephen Hailes}, title = {Identifying Vulnerabilities of Industrial Control Systems using Evolutionary Multiobjective Optimisation}, journal = {CoRR}, volume = {abs/2005.13095}, year = {2020}, url = {https://arxiv.org/abs/2005.13095}, eprinttype = {arXiv}, eprint = {2005.13095}, timestamp = {Thu, 28 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2005-13095.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2006-08287, author = {Cher Bass and Mariana da Silva and Carole H. Sudre and Petru{-}Daniel Tudosiu and Stephen M. Smith and Emma C. Robinson}, title = {{ICAM:} Interpretable Classification via Disentangled Representations and Feature Attribution Mapping}, journal = {CoRR}, volume = {abs/2006.08287}, year = {2020}, url = {https://arxiv.org/abs/2006.08287}, eprinttype = {arXiv}, eprint = {2006.08287}, timestamp = {Mon, 22 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2006-08287.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2008-05952, author = {Nicholas M. Boffi and Stephen Tu and Nikolai Matni and Jean{-}Jacques E. Slotine and Vikas Sindhwani}, title = {Learning Stability Certificates from Data}, journal = {CoRR}, volume = {abs/2008.05952}, year = {2020}, url = {https://arxiv.org/abs/2008.05952}, eprinttype = {arXiv}, eprint = {2008.05952}, timestamp = {Mon, 17 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2008-05952.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2010-04898, author = {Raviteja Anantha and Svitlana Vakulenko and Zhucheng Tu and Shayne Longpre and Stephen Pulman and Srinivas Chappidi}, title = {Open-Domain Question Answering Goes Conversational via Question Rewriting}, journal = {CoRR}, volume = {abs/2010.04898}, year = {2020}, url = {https://arxiv.org/abs/2010.04898}, eprinttype = {arXiv}, eprint = {2010.04898}, timestamp = {Tue, 20 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2010-04898.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2011-04112, author = {Lars Lindemann and Haimin Hu and Alexander Robey and Hanwen Zhang and Dimos V. Dimarogonas and Stephen Tu and Nikolai Matni}, title = {Learning Hybrid Control Barrier Functions from Data}, journal = {CoRR}, volume = {abs/2011.04112}, year = {2020}, url = {https://arxiv.org/abs/2011.04112}, eprinttype = {arXiv}, eprint = {2011.04112}, timestamp = {Thu, 12 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2011-04112.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2011-12257, author = {Amir Ali Ahmadi and Abraar Chaudhry and Vikas Sindhwani and Stephen Tu}, title = {Safely Learning Dynamical Systems from Short Trajectories}, journal = {CoRR}, volume = {abs/2011.12257}, year = {2020}, url = {https://arxiv.org/abs/2011.12257}, eprinttype = {arXiv}, eprint = {2011.12257}, timestamp = {Thu, 26 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2011-12257.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2011-13101, author = {Nicholas M. Boffi and Stephen Tu and Jean{-}Jacques E. Slotine}, title = {Regret Bounds for Adaptive Nonlinear Control}, journal = {CoRR}, volume = {abs/2011.13101}, year = {2020}, url = {https://arxiv.org/abs/2011.13101}, eprinttype = {arXiv}, eprint = {2011.13101}, timestamp = {Tue, 01 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2011-13101.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@phdthesis{DBLP:phd/us/Tu19, author = {Stephen Tu}, title = {Sample Complexity Bounds for the Linear Quadratic Regulator}, school = {University of California, Berkeley, {USA}}, year = {2019}, url = {https://www.escholarship.org/uc/item/4zw591fq}, timestamp = {Wed, 22 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/phd/us/Tu19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/McGuinessGMT19, author = {Daniel Tunc McGuiness and Stamatios Giannoukos and Alan Marshall and Stephen Taylor}, title = {Modulation Analysis in Macro-Molecular Communications}, journal = {{IEEE} Access}, volume = {7}, pages = {11049--11065}, year = {2019}, url = {https://doi.org/10.1109/ACCESS.2019.2892850}, doi = {10.1109/ACCESS.2019.2892850}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/McGuinessGMT19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cphysics/HawkesVPKCT19, author = {James Nicholas Hawkes and Guilherme Vaz and Alexander B. Phillips and Christiaan M. Klaij and S. J. Cox and Stephen R. Turnock}, title = {Chaotic multigrid methods for the solution of elliptic equations}, journal = {Comput. Phys. Commun.}, volume = {237}, pages = {26--36}, year = {2019}, url = {https://doi.org/10.1016/j.cpc.2018.10.031}, doi = {10.1016/J.CPC.2018.10.031}, timestamp = {Mon, 15 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cphysics/HawkesVPKCT19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/heuristics/JilaniTS19, author = {Mohd Zairul Mazwan Bin Jilani and Allan Tucker and Stephen Swift}, title = {An application of generalised simulated annealing towards the simultaneous modelling and clustering of glaucoma}, journal = {J. Heuristics}, volume = {25}, number = {6}, pages = {933--957}, year = {2019}, url = {https://doi.org/10.1007/s10732-019-09415-y}, doi = {10.1007/S10732-019-09415-Y}, timestamp = {Thu, 07 Nov 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/heuristics/JilaniTS19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ieeejas/TuckHB19, author = {Jonathan Tuck and David Hallac and Stephen P. Boyd}, title = {Distributed majorization-minimization for Laplacian regularized problems}, journal = {{IEEE} {CAA} J. Autom. Sinica}, volume = {6}, number = {1}, pages = {45--52}, year = {2019}, url = {https://doi.org/10.1109/JAS.2019.1911321}, doi = {10.1109/JAS.2019.1911321}, timestamp = {Fri, 18 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ieeejas/TuckHB19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcphy/ZengTBW19, author = {Fanhai Zeng and Ian W. Turner and Kevin Burrage and Stephen J. Wright}, title = {A discrete least squares collocation method for two-dimensional nonlinear time-dependent partial differential equations}, journal = {J. Comput. Phys.}, volume = {394}, pages = {177--199}, year = {2019}, url = {https://doi.org/10.1016/j.jcp.2019.05.044}, doi = {10.1016/J.JCP.2019.05.044}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jcphy/ZengTBW19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jfr/SchillaiTRP19, author = {Sophia M. Schillai and Stephen R. Turnock and Eric Rogers and Alexander B. Phillips}, title = {Experimental analysis of low-altitude terrain following for hover-capable flight-style autonomous underwater vehicles}, journal = {J. Field Robotics}, volume = {36}, number = {8}, pages = {1399--1421}, year = {2019}, url = {https://doi.org/10.1002/rob.21910}, doi = {10.1002/ROB.21910}, timestamp = {Tue, 26 Nov 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jfr/SchillaiTRP19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jossw/Brummel-SmithBB19, author = {Corey Brummel{-}Smith and Greg Bryan and Iryna Butsky and Lauren Corlies and Andrew Emerick and John Forbes and Yusuke Fujimoto and Nathan J. Goldbaum and Philipp Grete and Cameron Hummels and Ji{-}hoon Kim and Daegene Koh and Miao Li and Yuan Li and Xinyu Li and Brian W. O'Shea and Molly Peeples and John Regan and Munier Salem and Wolfram Schmidt and Christine Simpson and Britton Smith and Jason Tumlinson and Matthew J. Turk and John H. Wise and Tom Abel and James Bordner and Renyue Cen and David Collins and Brian Crosby and Philipp V. F. Edelmann and Oliver Hahn and Robert Harkness and Elizabeth Harper{-}Clark and Shuo Kong and Alexei G. Kritsuk and Michael Kuhlen and James Larrue and Eve Lee and Greg Meece and Michael L. Norman and Jeffrey S. Oishi and Pascal Paschos and Carolyn Peruta and Alex Razoumov and Daniel R. Reynolds and Devin Silvia and Samuel W. Skillman and Stephen Skory and Geoffrey So and Elizabeth J. Tasker and Rick Wagner and Peng Wang and Hao Xu and Fen Zhao}, title = {{ENZO:} An Adaptive Mesh Refinement Code for Astrophysics (Version 2.6)}, journal = {J. Open Source Softw.}, volume = {4}, number = {42}, pages = {1636}, year = {2019}, url = {https://doi.org/10.21105/joss.01636}, doi = {10.21105/JOSS.01636}, timestamp = {Thu, 31 Oct 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jossw/Brummel-SmithBB19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jssc/PoultonWTZCKSTN19, author = {John W. Poulton and John M. Wilson and Walker J. Turner and Brian Zimmer and Xi Chen and Sudhir S. Kudva and Sanquan Song and Stephen G. Tell and Nikola Nedovic and Wenxu Zhao and Sunil R. Sudhakaran and C. Thomas Gray and William J. Dally}, title = {A 1.17-pJ/b, 25-Gb/s/pin Ground-Referenced Single-Ended Serial Link for Off- and On-Package Communication Using a Process- and Temperature-Adaptive Voltage Regulator}, journal = {{IEEE} J. Solid State Circuits}, volume = {54}, number = {1}, pages = {43--54}, year = {2019}, url = {https://doi.org/10.1109/JSSC.2018.2875092}, doi = {10.1109/JSSC.2018.2875092}, timestamp = {Sun, 30 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jssc/PoultonWTZCKSTN19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/UrsuHBYMSNSO19, author = {Oleg Ursu and Jayme Holmes and Cristian Bologa and Jeremy J. Yang and Stephen L. Mathias and Vasileios Stathias and Dac{-}Trung Nguyen and Stephan C. Sch{\"{u}}rer and Tudor I. Oprea}, title = {DrugCentral 2018: an update}, journal = {Nucleic Acids Res.}, volume = {47}, number = {Database-Issue}, pages = {D963--D970}, year = {2019}, url = {https://doi.org/10.1093/nar/gky963}, doi = {10.1093/NAR/GKY963}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/UrsuHBYMSNSO19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/npjdm/ChitnisGGHSSDPT19, author = {Tanuja Chitnis and Bonnie I. Glanz and Cindy Gonzalez and Brian C. Healy and Taylor J. Saraceno and Neda Sattarnezhad and Camilo Diaz{-}Cruz and Mariann Polgar{-}Turcsanyi and Subhash Tummala and Rohit Bakshi and Vikram Bajaj and David Ben Shimol and Nikhil Bikhchandani and Alexander W. Blocker and Joshua Burkart and Raphael Cendrillon and Michael P. Cusack and Emre Demiralp and Sarel Kobus Jooste and Alaa Kharbouch and Amy A. Lee and Joseph Lehar and Manway Liu and Swaminathan Mahadevan and Mark Murphy and Linda C. Norton and Tushar Anil Parlikar and Anupam Pathak and Ali Shoeb and Erin Soderberg and Philip Stephens and Aaron H. Stoertz and Florence Thng and Kashyap R. Tumkur and Hongsheng Wang and Jane Rhodes and Richard A. Rudick and Richard M. Ransohoff and Glenn A. Phillips and Effie Bruzik and William J. Marks and Howard L. Weiner and Thomas M. Snyder}, title = {Quantifying neurologic disease using biosensor measurements in-clinic and in free-living settings in multiple sclerosis}, journal = {npj Digit. Medicine}, volume = {2}, year = {2019}, url = {https://doi.org/10.1038/s41746-019-0197-7}, doi = {10.1038/S41746-019-0197-7}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/npjdm/ChitnisGGHSSDPT19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/npjdm/NetoPPTSBTFMO19, author = {Elias Chaibub Neto and Abhishek Pratap and Thanneer M. Perumal and Meghasyam Tummalacherla and Phil Snyder and Brian M. Bot and Andrew D. Trister and Stephen H. Friend and Lara M. Mangravite and Larsson Omberg}, title = {Detecting the impact of subject characteristics on machine learning-based diagnostic applications}, journal = {npj Digit. Medicine}, volume = {2}, year = {2019}, url = {https://doi.org/10.1038/s41746-019-0178-x}, doi = {10.1038/S41746-019-0178-X}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/npjdm/NetoPPTSBTFMO19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/TurkPAJWFLHFCKN19, author = {F. Joseph Turk and Ramon Padull{\'{e}}s and Chi O. Ao and Manuel de la Torre Ju{\'{a}}rez and Kuo{-}Nung Wang and Garth W. Franklin and Stephen T. Lowe and Svetla M. Hristova{-}Veleva and Eric J. Fetzer and Estel Cardellach and Yi{-}Hung Kuo and J. David Neelin}, title = {Benefits of a Closely-Spaced Satellite Constellation of Atmospheric Polarimetric Radio Occultation Measurements}, journal = {Remote. Sens.}, volume = {11}, number = {20}, pages = {2399}, year = {2019}, url = {https://doi.org/10.3390/rs11202399}, doi = {10.3390/RS11202399}, timestamp = {Wed, 15 Feb 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/remotesensing/TurkPAJWFLHFCKN19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbe/TurnerH19, author = {Alexander P. Turner and Stephen Hayes}, title = {The Classification of Minor Gait Alterations Using Wearable Sensors and Deep Learning}, journal = {{IEEE} Trans. Biomed. Eng.}, volume = {66}, number = {11}, pages = {3136--3145}, year = {2019}, url = {https://doi.org/10.1109/TBME.2019.2900863}, doi = {10.1109/TBME.2019.2900863}, timestamp = {Mon, 26 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tbe/TurnerH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmbmc/McGuinessGTM19, author = {Daniel Tun{\c{c}} McGuiness and Stamatios Giannoukos and Stephen Taylor and Alan Marshall}, title = {Experimental and Analytical Analysis of Macro-Scale Molecular Communications Within Closed Boundaries}, journal = {{IEEE} Trans. Mol. Biol. Multi Scale Commun.}, volume = {5}, number = {1}, pages = {44--55}, year = {2019}, url = {https://doi.org/10.1109/TMBMC.2019.2955094}, doi = {10.1109/TMBMC.2019.2955094}, timestamp = {Tue, 08 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tmbmc/McGuinessGTM19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tvcg/NovotnyTTGDFL19, author = {Johannes Novotny and Joshua Tveite and Morgan L. Turner and Stephen M. Gatesy and Fritz Drury and Peter Falkingham and David H. Laidlaw}, title = {Developing Virtual Reality Visualizations for Unsteady Flow Analysis of Dinosaur Track Formation using Scientific Sketching}, journal = {{IEEE} Trans. Vis. Comput. Graph.}, volume = {25}, number = {5}, pages = {2145--2154}, year = {2019}, url = {https://doi.org/10.1109/TVCG.2019.2898796}, doi = {10.1109/TVCG.2019.2898796}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tvcg/NovotnyTTGDFL19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aied/Al-LuhaybiYSCT19, author = {Mashael Al{-}Luhaybi and Leila Yousefi and Stephen Swift and Steve Counsell and Allan Tucker}, editor = {Seiji Isotani and Eva Mill{\'{a}}n and Amy Ogan and Peter M. Hastings and Bruce M. McLaren and Rose Luckin}, title = {Predicting Academic Performance: {A} Bootstrapping Approach for Learning Dynamic Bayesian Networks}, booktitle = {Artificial Intelligence in Education - 20th International Conference, {AIED} 2019, Chicago, IL, USA, June 25-29, 2019, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {11625}, pages = {26--36}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-23204-7\_3}, doi = {10.1007/978-3-030-23204-7\_3}, timestamp = {Mon, 15 Jun 2020 17:12:49 +0200}, biburl = {https://dblp.org/rec/conf/aied/Al-LuhaybiYSCT19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amcc/DeanTMR19, author = {Sarah Dean and Stephen Tu and Nikolai Matni and Benjamin Recht}, title = {Safely Learning to Control the Constrained Linear Quadratic Regulator}, booktitle = {2019 American Control Conference, {ACC} 2019, Philadelphia, PA, USA, July 10-12, 2019}, pages = {5582--5588}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.23919/ACC.2019.8814865}, doi = {10.23919/ACC.2019.8814865}, timestamp = {Sun, 08 Aug 2021 01:40:57 +0200}, biburl = {https://dblp.org/rec/conf/amcc/DeanTMR19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amcc/DrummondTD19, author = {Ross Drummond and Matthew C. Turner and Stephen R. Duncan}, title = {External Positivity of Linear Systems by Weak Majorisation}, booktitle = {2019 American Control Conference, {ACC} 2019, Philadelphia, PA, USA, July 10-12, 2019}, pages = {5191--5196}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.23919/ACC.2019.8814408}, doi = {10.23919/ACC.2019.8814408}, timestamp = {Sun, 08 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amcc/DrummondTD19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amcc/TuBR19, author = {Stephen Tu and Ross Boczar and Benjamin Recht}, title = {Minimax Lower Bounds for H{\(\infty\)}-Norm Estimation}, booktitle = {2019 American Control Conference, {ACC} 2019, Philadelphia, PA, USA, July 10-12, 2019}, pages = {3538--3543}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.23919/ACC.2019.8814311}, doi = {10.23919/ACC.2019.8814311}, timestamp = {Sun, 08 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amcc/TuBR19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/YousefiSASCT19, author = {Leila Yousefi and Stephen Swift and Mahir Arzoky and Lucia Sacchi and Luca Chiovato and Allan Tucker}, title = {Opening the Black Box: Exploring Temporal Pattern of Type 2 Diabetes Complications in Patient Clustering Using Association Rules and Hidden Variable Discovery}, booktitle = {32nd {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2019, Cordoba, Spain, June 5-7, 2019}, pages = {198--203}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/CBMS.2019.00048}, doi = {10.1109/CBMS.2019.00048}, timestamp = {Fri, 27 Dec 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/YousefiSASCT19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cdc/MatniPRT19, author = {Nikolai Matni and Alexandre Prouti{\`{e}}re and Anders Rantzer and Stephen Tu}, title = {From self-tuning regulators to reinforcement learning and back again}, booktitle = {58th {IEEE} Conference on Decision and Control, {CDC} 2019, Nice, France, December 11-13, 2019}, pages = {3724--3740}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/CDC40024.2019.9029916}, doi = {10.1109/CDC40024.2019.9029916}, timestamp = {Fri, 04 Mar 2022 13:30:46 +0100}, biburl = {https://dblp.org/rec/conf/cdc/MatniPRT19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cdc/MatniT19, author = {Nikolai Matni and Stephen Tu}, title = {A Tutorial on Concentration Bounds for System Identification}, booktitle = {58th {IEEE} Conference on Decision and Control, {CDC} 2019, Nice, France, December 11-13, 2019}, pages = {3741--3749}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/CDC40024.2019.9029621}, doi = {10.1109/CDC40024.2019.9029621}, timestamp = {Mon, 27 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cdc/MatniT19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cicc/SongP0ZTTKNWGD19, author = {Sanquan Song and John Poulton and Xi Chen and Brian Zimmer and Stephen G. Tell and Walker J. Turner and Sudhir S. Kudva and Nikola Nedovic and John M. Wilson and C. Thomas Gray and William J. Dally}, title = {A 2-to-20 GHz Multi-Phase Clock Generator with Phase Interpolators Using Injection-Locked Oscillation Buffers for High-Speed IOs in 16nm FinFET}, booktitle = {{IEEE} Custom Integrated Circuits Conference, {CICC} 2019, Austin, TX, USA, April 14-17, 2019}, pages = {1--4}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/CICC.2019.8780177}, doi = {10.1109/CICC.2019.8780177}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/cicc/SongP0ZTTKNWGD19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/colt/TuR19, author = {Stephen Tu and Benjamin Recht}, editor = {Alina Beygelzimer and Daniel Hsu}, title = {The Gap Between Model-Based and Model-Free Methods on the Linear Quadratic Regulator: An Asymptotic Viewpoint}, booktitle = {Conference on Learning Theory, {COLT} 2019, 25-28 June 2019, Phoenix, AZ, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {99}, pages = {3036--3083}, publisher = {{PMLR}}, year = {2019}, url = {http://proceedings.mlr.press/v99/tu19a.html}, timestamp = {Mon, 08 Jul 2019 16:13:41 +0200}, biburl = {https://dblp.org/rec/conf/colt/TuR19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eScience/TauferDTWDPSWCE19, author = {Michela Taufer and Ewa Deelman and Stephen Thomas and Michael R. Wyatt II and Tu Mai Anh Do and Lo{\"{\i}}c Pottier and Rafael Ferreira da Silva and Harel Weinstein and Michel A. Cuendet and Trilce Estrada}, title = {Characterizing In Situ and In Transit Analytics of Molecular Dynamics Simulations for Next-Generation Supercomputers}, booktitle = {15th International Conference on eScience, eScience 2019, San Diego, CA, USA, September 24-27, 2019}, pages = {188--198}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/eScience.2019.00027}, doi = {10.1109/ESCIENCE.2019.00027}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eScience/TauferDTWDPSWCE19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/BraunPTW19, author = {G{\'{a}}bor Braun and Sebastian Pokutta and Dan Tu and Stephen J. Wright}, editor = {Kamalika Chaudhuri and Ruslan Salakhutdinov}, title = {Blended Conditonal Gradients}, booktitle = {Proceedings of the 36th International Conference on Machine Learning, {ICML} 2019, 9-15 June 2019, Long Beach, California, {USA}}, series = {Proceedings of Machine Learning Research}, volume = {97}, pages = {735--743}, publisher = {{PMLR}}, year = {2019}, url = {http://proceedings.mlr.press/v97/braun19a.html}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icml/BraunPTW19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icse/KlunderHTKNHKFF19, author = {Jil Kl{\"{u}}nder and Regina Hebig and Paolo Tell and Marco Kuhrmann and Joyce Nakatumba{-}Nabende and Rogardt Heldal and Stephan Krusche and Masud Fazal{-}Baqaie and Michael Felderer and Marcela Fabiana Genero Bocco and Steffen K{\"{u}}pper and Sherlock A. Licorish and Gustavo L{\'{o}}pez and Fergal McCaffery and {\"{O}}zden {\"{O}}zcan Top and Christian R. Prause and Rafael Prikladnicki and Eray T{\"{u}}z{\"{u}}n and Dietmar Pfahl and Kurt Schneider and Stephen G. MacDonell}, editor = {Helen Sharp and Mike Whalen}, title = {Catching up with method and process practice: an industry-informed baseline for researchers}, booktitle = {Proceedings of the 41st International Conference on Software Engineering: Software Engineering in Practice, {ICSE} {(SEIP)} 2019, Montreal, QC, Canada, May 25-31, 2019}, pages = {255--264}, publisher = {{IEEE} / {ACM}}, year = {2019}, url = {https://doi.org/10.1109/ICSE-SEIP.2019.00036}, doi = {10.1109/ICSE-SEIP.2019.00036}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icse/KlunderHTKNHKFF19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ideal/ShepperdGLACCDS19, author = {Martin J. Shepperd and Yuchen Guo and Ning Li and Mahir Arzoky and Andrea Capiluppi and Steve Counsell and Giuseppe Destefanis and Stephen Swift and Allan Tucker and Leila Yousefi}, editor = {Hujun Yin and David Camacho and Peter Ti{\~{n}}o and Antonio J. Tall{\'{o}}n{-}Ballesteros and Ronaldo Menezes and Richard Allmendinger}, title = {The Prevalence of Errors in Machine Learning Experiments}, booktitle = {Intelligent Data Engineering and Automated Learning - {IDEAL} 2019 - 20th International Conference, Manchester, UK, November 14-16, 2019, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {11871}, pages = {102--109}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-33607-3\_12}, doi = {10.1007/978-3-030-33607-3\_12}, timestamp = {Thu, 08 Oct 2020 17:51:06 +0200}, biburl = {https://dblp.org/rec/conf/ideal/ShepperdGLACCDS19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isscc/KennedyDBTPCBSG19, author = {Michael Peter Kennedy and Yann Donnelly and James Breslin and Stefano Tulisi and Sanganagouda Patil and Ciaran Curtin and Stephen Brookes and Brian Shelly and Patrick Griffin and Michael Keaveney}, title = {4.48GHz 0.18{\(\mu\)}m SiGe BiCMOS Exact-Frequency Fractional-N Frequency Synthesizer with Spurious-Tone Suppression Yielding a -80dBc In-Band Fractional Spur}, booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2019, San Francisco, CA, USA, February 17-21, 2019}, pages = {272--274}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/ISSCC.2019.8662327}, doi = {10.1109/ISSCC.2019.8662327}, timestamp = {Wed, 16 Oct 2019 14:14:55 +0200}, biburl = {https://dblp.org/rec/conf/isscc/KennedyDBTPCBSG19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nanocom/McGuinessGTM19, author = {Daniel Tun{\c{c}} McGuiness and Stamatios Giannoukos and Stephen Taylor and Alan Marshall}, title = {Experimental Study of the Flush Dynamics of Macro-Scale Molecular Communications}, booktitle = {Proceedings of the Sixth Annual {ACM} International Conference on Nanoscale Computing and Communication, {NANOCOM} 2019, Dublin, Ireland, September 25-27, 2019}, pages = {35:1--35:2}, publisher = {{ACM}}, year = {2019}, url = {https://doi.org/10.1145/3345312.3345489}, doi = {10.1145/3345312.3345489}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/nanocom/McGuinessGTM19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/KrauthTR19, author = {Karl Krauth and Stephen Tu and Benjamin Recht}, editor = {Hanna M. Wallach and Hugo Larochelle and Alina Beygelzimer and Florence d'Alch{\'{e}}{-}Buc and Emily B. Fox and Roman Garnett}, title = {Finite-time Analysis of Approximate Policy Iteration for the Linear Quadratic Regulator}, booktitle = {Advances in Neural Information Processing Systems 32: Annual Conference on Neural Information Processing Systems 2019, NeurIPS 2019, December 8-14, 2019, Vancouver, BC, Canada}, pages = {8512--8522}, year = {2019}, url = {https://proceedings.neurips.cc/paper/2019/hash/aaebdb8bb6b0e73f6c3c54a0ab0c6415-Abstract.html}, timestamp = {Mon, 16 May 2022 15:41:51 +0200}, biburl = {https://dblp.org/rec/conf/nips/KrauthTR19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/ManiaTR19, author = {Horia Mania and Stephen Tu and Benjamin Recht}, editor = {Hanna M. Wallach and Hugo Larochelle and Alina Beygelzimer and Florence d'Alch{\'{e}}{-}Buc and Emily B. Fox and Roman Garnett}, title = {Certainty Equivalence is Efficient for Linear Quadratic Control}, booktitle = {Advances in Neural Information Processing Systems 32: Annual Conference on Neural Information Processing Systems 2019, NeurIPS 2019, December 8-14, 2019, Vancouver, BC, Canada}, pages = {10154--10164}, year = {2019}, url = {https://proceedings.neurips.cc/paper/2019/hash/5dbc8390f17e019d300d5a162c3ce3bc-Abstract.html}, timestamp = {Thu, 21 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/nips/ManiaTR19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rfidta/TurkiZHBPYBH19, author = {Badredin Turki and M. Ali Ziai and Aaron J. R. Hillier and Kate Belsey and Adam Parry and Stephen G. Yeates and John C. Batchelor and Simon J. Holder}, title = {Chemical Vapor Detecting Passive {RFID} Tag}, booktitle = {{IEEE} International Conference on {RFID} Technology and Applications, {RFID-TA} 2019, Pisa, Italy, September 25-27, 2019}, pages = {113--115}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/RFID-TA.2019.8892161}, doi = {10.1109/RFID-TA.2019.8892161}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/rfidta/TurkiZHBPYBH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sdm/LiCGLCG19, author = {Dongsheng Li and Chao Chen and Zhilin Gong and Tun Lu and Stephen M. Chu and Ning Gu}, editor = {Tanya Y. Berger{-}Wolf and Nitesh V. Chawla}, title = {Collaborative Filtering with Noisy Ratings}, booktitle = {Proceedings of the 2019 {SIAM} International Conference on Data Mining, {SDM} 2019, Calgary, Alberta, Canada, May 2-4, 2019}, pages = {747--755}, publisher = {{SIAM}}, year = {2019}, url = {https://doi.org/10.1137/1.9781611975673.84}, doi = {10.1137/1.9781611975673.84}, timestamp = {Sat, 21 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sdm/LiCGLCG19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1902-03585, author = {Huazhu Fu and Yanwu Xu and Stephen Lin and Damon Wing Kee Wong and Mani Baskaran and Meenakshi Mahesh and Tin Aung and Jiang Liu}, title = {Angle-Closure Detection in Anterior Segment {OCT} based on Multi-Level Deep Network}, journal = {CoRR}, volume = {abs/1902.03585}, year = {2019}, url = {http://arxiv.org/abs/1902.03585}, eprinttype = {arXiv}, eprint = {1902.03585}, timestamp = {Thu, 19 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1902-03585.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1902-04820, author = {Nicolas S. Holliman and Manu Antony and James Charlton and Stephen Dowsland and Philip James and Mark Turner}, title = {Petascale Cloud Supercomputing for Terapixel Visualization of a Digital Twin}, journal = {CoRR}, volume = {abs/1902.04820}, year = {2019}, url = {http://arxiv.org/abs/1902.04820}, eprinttype = {arXiv}, eprint = {1902.04820}, timestamp = {Thu, 20 May 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1902-04820.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1902-07826, author = {Horia Mania and Stephen Tu and Benjamin Recht}, title = {Certainty Equivalent Control of {LQR} is Efficient}, journal = {CoRR}, volume = {abs/1902.07826}, year = {2019}, url = {http://arxiv.org/abs/1902.07826}, eprinttype = {arXiv}, eprint = {1902.07826}, timestamp = {Tue, 21 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1902-07826.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1903-11441, author = {Daniel Ahlin and Boris Bauermeister and Jan Conrad and Robert W. Gardner and Luca Grandi and Benedikt Riedel and Evan Shockley and Judith Stephen and Ragnar Sundblad and Suchandra Thapa and Christopher D. Tunnell}, title = {The {XENON1T} Data Distribution and Processing Scheme}, journal = {CoRR}, volume = {abs/1903.11441}, year = {2019}, url = {http://arxiv.org/abs/1903.11441}, eprinttype = {arXiv}, eprint = {1903.11441}, timestamp = {Fri, 13 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1903-11441.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1904-12017, author = {Jonathan Tuck and Shane T. Barratt and Stephen P. Boyd}, title = {A Distributed Method for Fitting Laplacian Regularized Stratified Models}, journal = {CoRR}, volume = {abs/1904.12017}, year = {2019}, url = {http://arxiv.org/abs/1904.12017}, eprinttype = {arXiv}, eprint = {1904.12017}, timestamp = {Mon, 09 Sep 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1904-12017.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1905-12842, author = {Karl Krauth and Stephen Tu and Benjamin Recht}, title = {Finite-time Analysis of Approximate Policy Iteration for the Linear Quadratic Regulator}, journal = {CoRR}, volume = {abs/1905.12842}, year = {2019}, url = {http://arxiv.org/abs/1905.12842}, eprinttype = {arXiv}, eprint = {1905.12842}, timestamp = {Mon, 03 Jun 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1905-12842.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1906-11392, author = {Nikolai Matni and Alexandre Prouti{\`{e}}re and Anders Rantzer and Stephen Tu}, title = {From self-tuning regulators to reinforcement learning and back again}, journal = {CoRR}, volume = {abs/1906.11392}, year = {2019}, url = {http://arxiv.org/abs/1906.11392}, eprinttype = {arXiv}, eprint = {1906.11392}, timestamp = {Mon, 01 Jul 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1906-11392.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1906-11395, author = {Nikolai Matni and Stephen Tu}, title = {A Tutorial on Concentration Bounds for System Identification}, journal = {CoRR}, volume = {abs/1906.11395}, year = {2019}, url = {http://arxiv.org/abs/1906.11395}, eprinttype = {arXiv}, eprint = {1906.11395}, timestamp = {Mon, 01 Jul 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1906-11395.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1909-04436, author = {Martin J. Shepperd and Yuchen Guo and Ning Li and Mahir Arzoky and Andrea Capiluppi and Steve Counsell and Giuseppe Destefanis and Stephen Swift and Allan Tucker and Leila Yousefi}, title = {The Prevalence of Errors in Machine Learning Experiments}, journal = {CoRR}, volume = {abs/1909.04436}, year = {2019}, url = {http://arxiv.org/abs/1909.04436}, eprinttype = {arXiv}, eprint = {1909.04436}, timestamp = {Thu, 01 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1909-04436.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1909-12474, author = {Yossi Bokor and Daniel Grixti{-}Cheng and Markus Hegland and Stephen G. Roberts and Katharine Turner}, title = {Stratified Space Learning: Reconstructing Embedded Graphs}, journal = {CoRR}, volume = {abs/1909.12474}, year = {2019}, url = {http://arxiv.org/abs/1909.12474}, eprinttype = {arXiv}, eprint = {1909.12474}, timestamp = {Sat, 23 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1909-12474.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1911-07929, author = {Jessica Velasco and Cherry Pascion and Jean Wilmar Alberio and Jonathan Apuang and John Stephen Cruz and Mark Angelo Gomez and Benjamin Molina Jr. and Lyndon Tuala and August Thio{-}ac and Romeo Jorda Jr.}, title = {A Smartphone-Based Skin Disease Classification Using MobileNet {CNN}}, journal = {CoRR}, volume = {abs/1911.07929}, year = {2019}, url = {http://arxiv.org/abs/1911.07929}, eprinttype = {arXiv}, eprint = {1911.07929}, timestamp = {Mon, 02 Dec 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1911-07929.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1912-02975, author = {Xingyou Song and Yiding Jiang and Stephen Tu and Yilun Du and Behnam Neyshabur}, title = {Observational Overfitting in Reinforcement Learning}, journal = {CoRR}, volume = {abs/1912.02975}, year = {2019}, url = {http://arxiv.org/abs/1912.02975}, eprinttype = {arXiv}, eprint = {1912.02975}, timestamp = {Thu, 02 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1912-02975.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/McGuinessGMT18, author = {Daniel Tunc McGuiness and Stamatios Giannoukos and Alan Marshall and Stephen Taylor}, title = {Parameter Analysis in Macro-Scale Molecular Communications Using Advection-Diffusion}, journal = {{IEEE} Access}, volume = {6}, pages = {46706--46717}, year = {2018}, url = {https://doi.org/10.1109/ACCESS.2018.2866679}, doi = {10.1109/ACCESS.2018.2866679}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/McGuinessGMT18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aim/AmatoBCKKKLRO0T18, author = {Christopher Amato and Haitham Bou{-}Ammar and Elizabeth F. Churchill and Erez Karpas and Takashi Kido and Mike Kuniavsky and William F. Lawless and Francesca Rossi and Frans A. Oliehoek and Stephen Russell and Keiki Takadama and Siddharth Srivastava and Karl Tuyls and Philip van Allen and Kristen Brent Venable and Peter Vrancx and Shiqi Zhang}, title = {Reports on the 2018 {AAAI} Spring Symposium Series}, journal = {{AI} Mag.}, volume = {39}, number = {4}, pages = {29--35}, year = {2018}, url = {https://doi.org/10.1609/aimag.v39i4.2824}, doi = {10.1609/AIMAG.V39I4.2824}, timestamp = {Tue, 23 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/aim/AmatoBCKKKLRO0T18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bioinformatics/LinHCTSPEEKOBMG18, author = {Hui{-}Yi Lin and Po{-}Yu Huang and Dung{-}Tsa Chen and Heng{-}Yuan Tung and Thomas A. Sellers and Julio M. Pow{-}Sang and Rosalind A. Eeles and Doug Easton and Zsofia Kote{-}Jarai and Ali Amin Al Olama and Sara Benlloch and Kenneth Muir and Graham G. Giles and Fredrik Wiklund and Henrik Gronberg and Christopher A. Haiman and Johanna Schleutker and B{\o}rge G. Nordestgaard and Ruth C. Travis and Freddie Hamdy and David E. Neal and Nora Pashayan and Kay{-}Tee Khaw and Janet L. Stanford and William J. Blot and Stephen N. Thibodeau and Christiane Maier and Adam S. Kibel and Cezary Cybulski and Lisa A. Cannon{-}Albright and Hermann Brenner and Radka Kaneva and Jyotsna Batra and Manuel R. Teixeira and Hardev Pandha and Yong{-}Jie Lu and The PRACTICAL Consortium and Jong Y. Park}, title = {AA9int: {SNP} interaction pattern search using non-hierarchical additive model set}, journal = {Bioinform.}, volume = {34}, number = {24}, pages = {4141--4150}, year = {2018}, url = {https://doi.org/10.1093/bioinformatics/bty461}, doi = {10.1093/BIOINFORMATICS/BTY461}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bioinformatics/LinHCTSPEEKOBMG18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cce/BankoleJBTZ18, author = {Temitayo Bankole and Dustin Jones and Debangsu Bhattacharyya and Richard Turton and Stephen E. Zitney}, title = {Optimal scheduling and its Lyapunov stability for advanced load-following energy plants with CO\({}_{\mbox{2}}\) capture}, journal = {Comput. Chem. Eng.}, volume = {109}, pages = {30--47}, year = {2018}, url = {https://doi.org/10.1016/j.compchemeng.2017.10.025}, doi = {10.1016/J.COMPCHEMENG.2017.10.025}, timestamp = {Mon, 18 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cce/BankoleJBTZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cgf/ZhaoCT18, author = {Mingbi Zhao and Wentong Cai and Stephen John Turner}, title = {{CLUST:} Simulating Realistic Crowd Behaviour by Mining Pattern from Crowd Videos}, journal = {Comput. Graph. Forum}, volume = {37}, number = {1}, pages = {184--201}, year = {2018}, url = {https://doi.org/10.1111/cgf.13259}, doi = {10.1111/CGF.13259}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cgf/ZhaoCT18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/data/MakoninWT18, author = {Stephen Makonin and Z. Jane Wang and Chris Tumpach}, title = {{RAE:} The Rainforest Automation Energy Dataset for Smart Grid Meter Data Analysis}, journal = {Data}, volume = {3}, number = {1}, pages = {8}, year = {2018}, url = {https://doi.org/10.3390/data3010008}, doi = {10.3390/DATA3010008}, timestamp = {Wed, 27 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/data/MakoninWT18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/icl/McGuinessGMT18, author = {Daniel Tunc McGuiness and Stamatios Giannoukos and Alan Marshall and Stephen Taylor}, title = {Experimental Results on the Open-Air Transmission of Macro-Molecular Communication Using Membrane Inlet Mass Spectrometry}, journal = {{IEEE} Commun. Lett.}, volume = {22}, number = {12}, pages = {2567--2570}, year = {2018}, url = {https://doi.org/10.1109/LCOMM.2018.2875445}, doi = {10.1109/LCOMM.2018.2875445}, timestamp = {Thu, 20 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/icl/McGuinessGMT18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jamia/ValentaBBDEFGGJ18, author = {Annette L. Valenta and Eta S. Berner and Suzanne Austin Boren and Gloria J. Deckard and Christina Eldredge and Douglas B. Fridsma and Cynthia S. Gadd and Yang Gong and Todd R. Johnson and Josette Jones and E. LaVerne Manos and Kirk T. Phillips and Nancy K. Roderer and Douglas Rosendale and Anne M. Turner and G{\"{u}}nter Tusch and Jeffrey J. Williamson and Stephen B. Johnson}, title = {{AMIA} Board White Paper: {AMIA} 2017 core competencies for applied health informatics education at the master's degree level}, journal = {J. Am. Medical Informatics Assoc.}, volume = {25}, number = {12}, pages = {1657--1668}, year = {2018}, url = {https://doi.org/10.1093/jamia/ocy132}, doi = {10.1093/JAMIA/OCY132}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jamia/ValentaBBDEFGGJ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jeric/TurnerPE18, author = {Scott Alexander Turner and Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and Stephen H. Edwards}, title = {Peer Review in {CS2:} Conceptual Learning and High-Level Thinking}, journal = {{ACM} Trans. Comput. Educ.}, volume = {18}, number = {3}, pages = {13:1--13:37}, year = {2018}, url = {https://doi.org/10.1145/3152715}, doi = {10.1145/3152715}, timestamp = {Fri, 06 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jeric/TurnerPE18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jfr/TanakitkornWTP18, author = {Kantapon Tanakitkorn and Philip A. Wilson and Stephen R. Turnock and Alexander B. Phillips}, title = {Sliding mode heading control of an overactuated, hover-capable autonomous underwater vehicle with experimental verification}, journal = {J. Field Robotics}, volume = {35}, number = {3}, pages = {396--415}, year = {2018}, url = {https://doi.org/10.1002/rob.21766}, doi = {10.1002/ROB.21766}, timestamp = {Sun, 02 Jun 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jfr/TanakitkornWTP18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jossw/Turner18, author = {Stephen D. Turner}, title = {qqman: an {R} package for visualizing {GWAS} results using {Q-Q} and manhattan plots}, journal = {J. Open Source Softw.}, volume = {3}, number = {25}, pages = {731}, year = {2018}, url = {https://doi.org/10.21105/joss.00731}, doi = {10.21105/JOSS.00731}, timestamp = {Tue, 16 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jossw/Turner18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/neco/VerziRPQMVJA18, author = {Stephen J. Verzi and Fredrick H. Rothganger and Ojas Parekh and Tu{-}Thach Quach and Nadine E. Miner and Craig M. Vineyard and Conrad D. James and James B. Aimone}, title = {Computing with Spikes: The Advantage of Fine-Grained Timing}, journal = {Neural Comput.}, volume = {30}, number = {10}, year = {2018}, url = {https://doi.org/10.1162/neco\_a\_01113}, doi = {10.1162/NECO\_A\_01113}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/neco/VerziRPQMVJA18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/neuroimage/AllozaCCRWRMHTL18, author = {Clara Alloza and Simon R. Cox and Manuel Blesa Cabez and Paul Redmond and Heather Whalley and Stuart J. Ritchie and Susana Mu{\~{n}}oz Maniega and Maria del C. Vald{\'{e}}s Hern{\'{a}}ndez and Elliot Tucker{-}Drob and Stephen M. Lawrie and Joanna M. Wardlaw and Ian J. Deary and Mark E. Bastin}, title = {Polygenic risk score for schizophrenia and structural brain connectivity in older age: {A} longitudinal connectome and tractography study}, journal = {NeuroImage}, volume = {183}, pages = {884--896}, year = {2018}, url = {https://doi.org/10.1016/j.neuroimage.2018.08.075}, doi = {10.1016/J.NEUROIMAGE.2018.08.075}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/neuroimage/AllozaCCRWRMHTL18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/neuroimage/RobinsonGGCCMBW18, author = {Emma C. Robinson and Kara Garcia and Matthew F. Glasser and Zhengdao Chen and Timothy S. Coalson and Antonios Makropoulos and Jelena Bozek and Robert Wright and Andreas Schuh and Matthew A. Webster and Jana Hutter and Anthony Price and Lucilio Cordero{-}Grande and Emer J. Hughes and Nora Tusor and Philip V. Bayly and David C. Van Essen and Stephen M. Smith and Daniel Rueckert}, title = {Multimodal surface matching with higher-order smoothness constraints}, journal = {NeuroImage}, volume = {167}, pages = {453--465}, year = {2018}, url = {https://doi.org/10.1016/j.neuroimage.2017.10.037}, doi = {10.1016/J.NEUROIMAGE.2017.10.037}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/neuroimage/RobinsonGGCCMBW18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/YangMFGHWTGBT18, author = {Kai Yang and Katie L. Meadmore and Chris T. Freeman and Neil J. Grabham and Ann{-}Marie Hughes and Yang Wei and Russel N. Torah and Monika Glanc{-}Gostkiewicz and Steve P. Beeby and John Tudor}, title = {Development of User-Friendly Wearable Electronic Textiles for Healthcare Applications}, journal = {Sensors}, volume = {18}, number = {8}, pages = {2410}, year = {2018}, url = {https://doi.org/10.3390/s18082410}, doi = {10.3390/S18082410}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sensors/YangMFGHWTGBT18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tci/EldalyAPKCDM18, author = {Ahmed Karam Eldaly and Yoann Altmann and Antonios Perperidis and Nikola Krstajic and Tushar Choudhary and Kevin Dhaliwal and Steve McLaughlin}, title = {Deconvolution and Restoration of Optical Endomicroscopy Images}, journal = {{IEEE} Trans. Computational Imaging}, volume = {4}, number = {2}, pages = {194--205}, year = {2018}, url = {https://doi.org/10.1109/TCI.2018.2811939}, doi = {10.1109/TCI.2018.2811939}, timestamp = {Tue, 16 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tci/EldalyAPKCDM18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmi/TuSVEWHPPYWP18, author = {Liyun Tu and Martin Styner and Jared Vicory and Shireen Y. Elhabian and Rui Wang and Jun{-}Pyo Hong and Beatriz Paniagua and Juan{-}Carlos Prieto and Dan Yang and Ross T. Whitaker and Stephen M. Pizer}, title = {Skeletal Shape Correspondence Through Entropy}, journal = {{IEEE} Trans. Medical Imaging}, volume = {37}, number = {1}, pages = {1--11}, year = {2018}, url = {https://doi.org/10.1109/TMI.2017.2755550}, doi = {10.1109/TMI.2017.2755550}, timestamp = {Thu, 06 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tmi/TuSVEWHPPYWP18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amcc/TuBR18, author = {Stephen Tu and Ross Boczar and Benjamin Recht}, title = {On the Approximation of Toeplitz Operators for Nonparametric H\({}_{\mbox{{\(\infty\)}}}\)-norm Estimation}, booktitle = {2018 Annual American Control Conference, {ACC} 2018, Milwaukee, WI, USA, June 27-29, 2018}, pages = {1867--1872}, publisher = {{IEEE}}, year = {2018}, url = {https://doi.org/10.23919/ACC.2018.8431846}, doi = {10.23919/ACC.2018.8431846}, timestamp = {Sun, 08 Aug 2021 01:40:57 +0200}, biburl = {https://dblp.org/rec/conf/amcc/TuBR18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/atal/AlanLSPRWTR18, author = {Alper Turan Alan and Chang Liu and Elliot Salisbury and Stephen D. Prior and Sarvapali D. Ramchurn and Feng Wu and Kerry Tatlock and Gareth Rees}, editor = {Elisabeth Andr{\'{e}} and Sven Koenig and Mehdi Dastani and Gita Sukthankar}, title = {Human-UAV Teaming in Dynamic and Uncertain Environments}, booktitle = {Proceedings of the 17th International Conference on Autonomous Agents and MultiAgent Systems, {AAMAS} 2018, Stockholm, Sweden, July 10-15, 2018}, pages = {1791--1793}, publisher = {International Foundation for Autonomous Agents and Multiagent Systems Richland, SC, {USA} / {ACM}}, year = {2018}, url = {http://dl.acm.org/citation.cfm?id=3237979}, timestamp = {Sat, 30 Sep 2023 09:34:53 +0200}, biburl = {https://dblp.org/rec/conf/atal/AlanLSPRWTR18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bibm/YousefiSASCT18, author = {Leila Yousefi and Stephen Swift and Mahir Arzoky and Lucia Sacchi and Luca Chiovato and Allan Tucker}, editor = {Huiru Jane Zheng and Zoraida Callejas and David Griol and Haiying Wang and Xiaohua Hu and Harald H. H. W. Schmidt and Jan Baumbach and Julie Dickerson and Le Zhang}, title = {Opening the Black Box: Discovering and Explaining Hidden Variables in Type 2 Diabetic Patient Modelling}, booktitle = {{IEEE} International Conference on Bioinformatics and Biomedicine, {BIBM} 2018, Madrid, Spain, December 3-6, 2018}, pages = {1040--1044}, publisher = {{IEEE} Computer Society}, year = {2018}, url = {https://doi.ieeecomputersociety.org/10.1109/BIBM.2018.8621484}, doi = {10.1109/BIBM.2018.8621484}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/bibm/YousefiSASCT18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ccece/CatafordGTB18, author = {Andrew Cataford and S. Andrew Gadsden and Kevin Turpie and Mohammad Biglarbegian}, title = {Air-LUSI: Estimation, Filtering, and {PID} Tracking Simulation}, booktitle = {2018 {IEEE} Canadian Conference on Electrical {\&} Computer Engineering, {CCECE} 2018, Quebec, QC, Canada, May 13-16, 2018}, pages = {1--6}, publisher = {{IEEE}}, year = {2018}, url = {https://doi.org/10.1109/CCECE.2018.8447850}, doi = {10.1109/CCECE.2018.8447850}, timestamp = {Wed, 16 Oct 2019 14:14:49 +0200}, biburl = {https://dblp.org/rec/conf/ccece/CatafordGTB18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cicc/TurnerP0CTFGZSN18, author = {Walker J. Turner and John W. Poulton and John M. Wilson and Xi Chen and Stephen G. Tell and Matthew Fojtik and Thomas H. Greer and Brian Zimmer and Sanquan Song and Nikola Nedovic and Sudhir S. Kudva and Sunil R. Sudhakaran and Rizwan Bashirullah and Wenxu Zhao and William J. Dally and C. Thomas Gray}, title = {Ground-referenced signaling for intra-chip and short-reach chip-to-chip interconnects}, booktitle = {2018 {IEEE} Custom Integrated Circuits Conference, {CICC} 2018, San Diego, CA, USA, April 8-11, 2018}, pages = {1--8}, publisher = {{IEEE}}, year = {2018}, url = {https://doi.org/10.1109/CICC.2018.8357077}, doi = {10.1109/CICC.2018.8357077}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/cicc/TurnerP0CTFGZSN18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/colt/SimchowitzMTJR18, author = {Max Simchowitz and Horia Mania and Stephen Tu and Michael I. Jordan and Benjamin Recht}, editor = {S{\'{e}}bastien Bubeck and Vianney Perchet and Philippe Rigollet}, title = {Learning Without Mixing: Towards {A} Sharp Analysis of Linear System Identification}, booktitle = {Conference On Learning Theory, {COLT} 2018, Stockholm, Sweden, 6-9 July 2018}, series = {Proceedings of Machine Learning Research}, volume = {75}, pages = {439--473}, publisher = {{PMLR}}, year = {2018}, url = {http://proceedings.mlr.press/v75/simchowitz18a.html}, timestamp = {Wed, 03 Apr 2019 18:17:23 +0200}, biburl = {https://dblp.org/rec/conf/colt/SimchowitzMTJR18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/CaoLLLTC18, author = {Kris Cao and Angeliki Lazaridou and Marc Lanctot and Joel Z. Leibo and Karl Tuyls and Stephen Clark}, title = {Emergent Communication through Negotiation}, booktitle = {6th International Conference on Learning Representations, {ICLR} 2018, Vancouver, BC, Canada, April 30 - May 3, 2018, Conference Track Proceedings}, publisher = {OpenReview.net}, year = {2018}, url = {https://openreview.net/forum?id=Hk6WhagRW}, timestamp = {Thu, 25 Jul 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iclr/CaoLLLTC18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/LazaridouHTC18, author = {Angeliki Lazaridou and Karl Moritz Hermann and Karl Tuyls and Stephen Clark}, title = {Emergence of Linguistic Communication from Referential Games with Symbolic and Pixel Input}, booktitle = {6th International Conference on Learning Representations, {ICLR} 2018, Vancouver, BC, Canada, April 30 - May 3, 2018, Conference Track Proceedings}, publisher = {OpenReview.net}, year = {2018}, url = {https://openreview.net/forum?id=HJGv1Z-AW}, timestamp = {Thu, 04 Apr 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iclr/LazaridouHTC18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/TuR18, author = {Stephen Tu and Benjamin Recht}, editor = {Jennifer G. Dy and Andreas Krause}, title = {Least-Squares Temporal Difference Learning for the Linear Quadratic Regulator}, booktitle = {Proceedings of the 35th International Conference on Machine Learning, {ICML} 2018, Stockholmsm{\"{a}}ssan, Stockholm, Sweden, July 10-15, 2018}, series = {Proceedings of Machine Learning Research}, volume = {80}, pages = {5012--5021}, publisher = {{PMLR}}, year = {2018}, url = {http://proceedings.mlr.press/v80/tu18a.html}, timestamp = {Wed, 03 Apr 2019 18:17:30 +0200}, biburl = {https://dblp.org/rec/conf/icml/TuR18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iecon/TomaBRG18, author = {Tudor Toma and Kaustav Basu and Wilder Rodrigues and Stephen J. Galsworthy}, title = {A Deep Learning Based Method for Heat Pump Dryer User Classification}, booktitle = {{IECON} 2018 - 44th Annual Conference of the {IEEE} Industrial Electronics Society, Washington, DC, USA, October 21-23, 2018}, pages = {3455--3460}, publisher = {{IEEE}}, year = {2018}, url = {https://doi.org/10.1109/IECON.2018.8591328}, doi = {10.1109/IECON.2018.8591328}, timestamp = {Sun, 25 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iecon/TomaBRG18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/intellisys/AyedASCT18, author = {Samy Ayed and Mahir Arzoky and Stephen Swift and Steve Counsell and Allan Tucker}, editor = {Kohei Arai and Supriya Kapoor and Rahul Bhatia}, title = {An Exploratory Study of the Inputs for Ensemble Clustering Technique as a Subset Selection Problem}, booktitle = {Intelligent Systems and Applications - Proceedings of the 2018 Intelligent Systems Conference, IntelliSys 2018, London, UK, September 6-7, 2018, Volume 1}, series = {Advances in Intelligent Systems and Computing}, volume = {868}, pages = {1041--1055}, publisher = {Springer}, year = {2018}, url = {https://doi.org/10.1007/978-3-030-01054-6\_72}, doi = {10.1007/978-3-030-01054-6\_72}, timestamp = {Mon, 18 Feb 2019 09:18:28 +0100}, biburl = {https://dblp.org/rec/conf/intellisys/AyedASCT18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isscc/0002TPZCKSTNZSG18, author = {John M. Wilson and Walker J. Turner and John W. Poulton and Brian Zimmer and Xi Chen and Sudhir S. Kudva and Sanquan Song and Stephen G. Tell and Nikola Nedovic and Wenxu Zhao and Sunil R. Sudhakaran and C. Thomas Gray and William J. Dally}, title = {A 1.17pJ/b 25Gb/s/pin ground-referenced single-ended serial link for off- and on-package communication in 16nm {CMOS} using a process- and temperature-adaptive voltage regulator}, booktitle = {2018 {IEEE} International Solid-State Circuits Conference, {ISSCC} 2018, San Francisco, CA, USA, February 11-15, 2018}, pages = {276--278}, publisher = {{IEEE}}, year = {2018}, url = {https://doi.org/10.1109/ISSCC.2018.8310291}, doi = {10.1109/ISSCC.2018.8310291}, timestamp = {Wed, 16 Oct 2019 14:14:55 +0200}, biburl = {https://dblp.org/rec/conf/isscc/0002TPZCKSTNZSG18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/miccai/FuXLWBMAL18, author = {Huazhu Fu and Yanwu Xu and Stephen Lin and Damon Wing Kee Wong and Mani Baskaran and Meenakshi Mahesh and Tin Aung and Jiang Liu}, editor = {Alejandro F. Frangi and Julia A. Schnabel and Christos Davatzikos and Carlos Alberola{-}L{\'{o}}pez and Gabor Fichtinger}, title = {Multi-context Deep Network for Angle-Closure Glaucoma Screening in Anterior Segment {OCT}}, booktitle = {Medical Image Computing and Computer Assisted Intervention - {MICCAI} 2018 - 21st International Conference, Granada, Spain, September 16-20, 2018, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {11071}, pages = {356--363}, publisher = {Springer}, year = {2018}, url = {https://doi.org/10.1007/978-3-030-00934-2\_40}, doi = {10.1007/978-3-030-00934-2\_40}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miccai/FuXLWBMAL18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nanocom/McGuinessMTG18, author = {Daniel Tunc McGuiness and Alan Marshall and Stephen Taylor and Stamatios Giannoukos}, editor = {J{\'{o}}n Atli Benediktsson and Falko Dressler}, title = {Asymmetrical inter-symbol interference in macro-scale molecular communications}, booktitle = {Proceedings of the 5th {ACM} International Conference on Nanoscale Computing and Communication, {NANOCOM} 2018, Reykjavik, Iceland, September 05-07, 2018}, pages = {13:1--13:6}, publisher = {{ACM}}, year = {2018}, url = {https://doi.org/10.1145/3233188.3233194}, doi = {10.1145/3233188.3233194}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/nanocom/McGuinessMTG18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/DeanMMRT18, author = {Sarah Dean and Horia Mania and Nikolai Matni and Benjamin Recht and Stephen Tu}, editor = {Samy Bengio and Hanna M. Wallach and Hugo Larochelle and Kristen Grauman and Nicol{\`{o}} Cesa{-}Bianchi and Roman Garnett}, title = {Regret Bounds for Robust Adaptive Control of the Linear Quadratic Regulator}, booktitle = {Advances in Neural Information Processing Systems 31: Annual Conference on Neural Information Processing Systems 2018, NeurIPS 2018, December 3-8, 2018, Montr{\'{e}}al, Canada}, pages = {4192--4201}, year = {2018}, url = {https://proceedings.neurips.cc/paper/2018/hash/0ae3f79a30234b6c45a6f7d298ba1310-Abstract.html}, timestamp = {Mon, 16 May 2022 15:41:51 +0200}, biburl = {https://dblp.org/rec/conf/nips/DeanMMRT18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/www/LiCLGLSGC18, author = {Dongsheng Li and Chao Chen and Qin Lv and Hansu Gu and Tun Lu and Li Shang and Ning Gu and Stephen M. Chu}, editor = {Pierre{-}Antoine Champin and Fabien Gandon and Mounia Lalmas and Panagiotis G. Ipeirotis}, title = {AdaError: An Adaptive Learning Rate Method for Matrix Approximation-based Collaborative Filtering}, booktitle = {Proceedings of the 2018 World Wide Web Conference on World Wide Web, {WWW} 2018, Lyon, France, April 23-27, 2018}, pages = {741--751}, publisher = {{ACM}}, year = {2018}, url = {https://doi.org/10.1145/3178876.3186155}, doi = {10.1145/3178876.3186155}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/www/LiCLGLSGC18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/xsede/Ananthakrishnan18, author = {Rachana Ananthakrishnan and Ben Blaiszik and Kyle Chard and Ryan Chard and Brendan McCollam and Jim Pruyne and Stephen Rosen and Steven Tuecke and Ian T. Foster}, editor = {Sergiu Sanielevici}, title = {Globus Platform Services for Data Publication}, booktitle = {Proceedings of the Practice and Experience on Advanced Research Computing, {PEARC} 2018, Pittsburgh, PA, USA, July 22-26, 2018}, pages = {14:1--14:7}, publisher = {{ACM}}, year = {2018}, url = {https://doi.org/10.1145/3219104.3219127}, doi = {10.1145/3219104.3219127}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/xsede/Ananthakrishnan18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/xsede/RiedelBBCPGGLRS18, author = {Benedikt Riedel and Boris Bauermeister and Lincoln Bryant and Jan Conrad and Patrick de Perio and Robert W. Gardner and Luca Grandi and Francesco Lombardi and Alfio Rizzo and Gabriella Sartorelli and Marco Selvi and Evan Shockley and Judith Stephen and Suchandra Thapa and Christopher D. Tunnell}, editor = {Sergiu Sanielevici}, title = {Distributed Data and Job Management for the {XENON1T} Experiment}, booktitle = {Proceedings of the Practice and Experience on Advanced Research Computing, {PEARC} 2018, Pittsburgh, PA, USA, July 22-26, 2018}, pages = {9:1--9:8}, publisher = {{ACM}}, year = {2018}, url = {https://doi.org/10.1145/3219104.3219155}, doi = {10.1145/3219104.3219155}, timestamp = {Fri, 13 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/xsede/RiedelBBCPGGLRS18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/isvc/2018, editor = {George Bebis and Richard Boyle and Bahram Parvin and Darko Koracin and Matt Turek and Srikumar Ramalingam and Kai Xu and Stephen Lin and Bilal Alsallakh and Jing Yang and Eduardo Cuervo and Jonathan Ventura}, title = {Advances in Visual Computing - 13th International Symposium, {ISVC} 2018, Las Vegas, NV, USA, November 19-21, 2018, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {11241}, publisher = {Springer}, year = {2018}, url = {https://doi.org/10.1007/978-3-030-03801-4}, doi = {10.1007/978-3-030-03801-4}, isbn = {978-3-030-03800-7}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/isvc/2018.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1802-08334, author = {Max Simchowitz and Horia Mania and Stephen Tu and Michael I. Jordan and Benjamin Recht}, title = {Learning Without Mixing: Towards {A} Sharp Analysis of Linear System Identification}, journal = {CoRR}, volume = {abs/1802.08334}, year = {2018}, url = {http://arxiv.org/abs/1802.08334}, eprinttype = {arXiv}, eprint = {1802.08334}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1802-08334.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1803-09166, author = {Phil Weir and Roland Ellerweg and Stephen J. Payne and Dominic Reuter and Tuomas Alhonnoro and Philip Voglreiter and Panchatcharam Mariappan and Mika Pollari and Chang{-}Sub Park and Peter Voigt and Tim van Oostenbrugge and Sebastian Fischer and Peter Kalmar and Jurgen J. F{\"{u}}tterer and Philipp Stiegler and Stephan Zangos and Ronan Flanagan and Michael Moche and Marina Kolesnik}, title = {Go-Smart: Open-Ended, Web-Based Modelling of Minimally Invasive Cancer Treatments via a Clinical Domain Approach}, journal = {CoRR}, volume = {abs/1803.09166}, year = {2018}, url = {http://arxiv.org/abs/1803.09166}, eprinttype = {arXiv}, eprint = {1803.09166}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1803-09166.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1804-03980, author = {Kris Cao and Angeliki Lazaridou and Marc Lanctot and Joel Z. Leibo and Karl Tuyls and Stephen Clark}, title = {Emergent Communication through Negotiation}, journal = {CoRR}, volume = {abs/1804.03980}, year = {2018}, url = {http://arxiv.org/abs/1804.03980}, eprinttype = {arXiv}, eprint = {1804.03980}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1804-03980.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1804-03984, author = {Angeliki Lazaridou and Karl Moritz Hermann and Karl Tuyls and Stephen Clark}, title = {Emergence of Linguistic Communication from Referential Games with Symbolic and Pixel Input}, journal = {CoRR}, volume = {abs/1804.03984}, year = {2018}, url = {http://arxiv.org/abs/1804.03984}, eprinttype = {arXiv}, eprint = {1804.03984}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1804-03984.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1804-04878, author = {Vikas Sindhwani and Stephen Tu and Mohi Khansari}, title = {Learning Contracting Vector Fields For Stable Imitation Learning}, journal = {CoRR}, volume = {abs/1804.04878}, year = {2018}, url = {http://arxiv.org/abs/1804.04878}, eprinttype = {arXiv}, eprint = {1804.04878}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1804-04878.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1805-07311, author = {G{\'{a}}bor Braun and Sebastian Pokutta and Dan Tu and Stephen J. Wright}, title = {Blended Conditional Gradients: the unconditioning of conditional gradients}, journal = {CoRR}, volume = {abs/1805.07311}, year = {2018}, url = {http://arxiv.org/abs/1805.07311}, eprinttype = {arXiv}, eprint = {1805.07311}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1805-07311.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1805-09388, author = {Sarah Dean and Horia Mania and Nikolai Matni and Benjamin Recht and Stephen Tu}, title = {Regret Bounds for Robust Adaptive Control of the Linear Quadratic Regulator}, journal = {CoRR}, volume = {abs/1805.09388}, year = {2018}, url = {http://arxiv.org/abs/1805.09388}, eprinttype = {arXiv}, eprint = {1805.09388}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1805-09388.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1809-03239, author = {Huazhu Fu and Yanwu Xu and Stephen Lin and Damon Wing Kee Wong and Mani Baskaran and Meenakshi Mahesh and Tin Aung and Jiang Liu}, title = {Multi-Context Deep Network for Angle-Closure Glaucoma Screening in Anterior Segment {OCT}}, journal = {CoRR}, volume = {abs/1809.03239}, year = {2018}, url = {http://arxiv.org/abs/1809.03239}, eprinttype = {arXiv}, eprint = {1809.03239}, timestamp = {Thu, 19 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1809-03239.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1809-10121, author = {Sarah Dean and Stephen Tu and Nikolai Matni and Benjamin Recht}, title = {Safely Learning to Control the Constrained Linear Quadratic Regulator}, journal = {CoRR}, volume = {abs/1809.10121}, year = {2018}, url = {http://arxiv.org/abs/1809.10121}, eprinttype = {arXiv}, eprint = {1809.10121}, timestamp = {Fri, 05 Oct 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1809-10121.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1809-10855, author = {Stephen Tu and Ross Boczar and Benjamin Recht}, title = {Minimax Lower Bounds for {\(\mathscr{H}\)}\({}_{\mbox{{\(\infty\)}}}\)-Norm Estimation}, journal = {CoRR}, volume = {abs/1809.10855}, year = {2018}, url = {http://arxiv.org/abs/1809.10855}, eprinttype = {arXiv}, eprint = {1809.10855}, timestamp = {Fri, 05 Oct 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1809-10855.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1811-07011, author = {Octavio Narvaez{-}Aroche and Pierre{-}Jean Meyer and Stephen Tu and Andrew K. Packard and Murat Arcak}, title = {Robust Control of the Sit-to-Stand Movement for a Powered Lower Limb Orthosis}, journal = {CoRR}, volume = {abs/1811.07011}, year = {2018}, url = {http://arxiv.org/abs/1811.07011}, eprinttype = {arXiv}, eprint = {1811.07011}, timestamp = {Fri, 30 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1811-07011.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1812-03565, author = {Stephen Tu and Benjamin Recht}, title = {The Gap Between Model-Based and Model-Free Methods on the Linear Quadratic Regulator: An Asymptotic Viewpoint}, journal = {CoRR}, volume = {abs/1812.03565}, year = {2018}, url = {http://arxiv.org/abs/1812.03565}, eprinttype = {arXiv}, eprint = {1812.03565}, timestamp = {Tue, 01 Jan 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1812-03565.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aci/MalmasiSHGST17, author = {Shervin Malmasi and Nicolae L. Sandor and Naoshi Hosomura and Matt Goldberg and Stephen Skentzos and Alexander Turchin}, title = {Canary: An {NLP} Platform for Clinicians and Researchers}, journal = {Appl. Clin. Inform.}, volume = {08}, number = {02}, pages = {447--453}, year = {2017}, url = {https://doi.org/10.4338/aci-2017-01-ie-0018}, doi = {10.4338/ACI-2017-01-IE-0018}, timestamp = {Tue, 01 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/aci/MalmasiSHGST17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bioinformatics/CannonYMUMWSJSB17, author = {Daniel Cannon and Jeremy J. Yang and Stephen L. Mathias and Oleg Ursu and Subramani Mani and Anna Waller and Stephan C. Sch{\"{u}}rer and Lars Juhl Jensen and Larry A. Sklar and Cristian Bologa and Tudor I. Oprea}, title = {{TIN-X:} target importance and novelty explorer}, journal = {Bioinform.}, volume = {33}, number = {16}, pages = {2601--2603}, year = {2017}, url = {https://doi.org/10.1093/bioinformatics/btx200}, doi = {10.1093/BIOINFORMATICS/BTX200}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bioinformatics/CannonYMUMWSJSB17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/biomedsem/LinMKTVFKNJGMUS17, author = {Yu Lin and Saurabh Mehta and Hande K{\"{u}}{\c{c}}{\"{u}}k{-}McGinty and John Paul Turner and Dusica Vidovic and Michele Forlin and Amar Koleti and Dac{-}Trung Nguyen and Lars Juhl Jensen and Rajarshi Guha and Stephen L. Mathias and Oleg Ursu and Vasileios Stathias and Jianbin Duan and Nooshin Nabizadeh and Caty Chung and Christopher Mader and Ubbo Visser and Jeremy J. Yang and Cristian Bologa and Tudor I. Oprea and Stephan C. Sch{\"{u}}rer}, title = {Drug target ontology to classify and integrate drug discovery data}, journal = {J. Biomed. Semant.}, volume = {8}, number = {1}, pages = {50:1--50:16}, year = {2017}, url = {https://doi.org/10.1186/s13326-017-0161-x}, doi = {10.1186/S13326-017-0161-X}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/biomedsem/LinMKTVFKNJGMUS17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bmcsb/AquinoHJLHCEHJS17, author = {Patricia Aquino and Brent Honda and Suma Jaini and Anna Lyubetskaya and Krutika Hosur and Joanna G. Chiu and Iriny Ekladious and Dongjian Hu and Lin Jin and Marianna K. Sayeg and Arion Stettner and Julia Wang and Brandon G. Wong and Winnie S. Wong and Stephen L. Alexander and Cong Ba and Seth I. Bensussen and David B. Bernstein and Dana Braff and Susie Cha and Daniel I. Cheng and Jang{-}Hwan Cho and Kenny Chou and James Chuang and Daniel E. Gastler and Daniel J. Grasso and John S. Greifenberger and Chen Guo and Anna K. Hawes and Divya V. Israni and Saloni R. Jain and Jessica Kim and Junyu Lei and Hao Li and David Li and Qian Li and Christopher P. Mancuso and Ning Mao and Salwa F. Masud and Cari L. Meisel and Jing Mi and Christine S. Nykyforchyn and Minhee Park and Hannah M. Peterson and Alfred K. Ramirez and Daniel S. Reynolds and Nae Gyune Rim and Jared C. Saffie and Hang Su and Wendell R. Su and Yaqing Su and Meng Sun and Meghan M. Thommes and Tao Tu and Nitinun Varongchayakul and Tyler E. Wagner and Benjamin H. Weinberg and Rouhui Yang and Anastasia Yaroslavsky and Christine Yoon and Yanyu Zhao and Alicia J. Zollinger and Anne M. Stringer and John W. Foster and Joseph Wade and Sahadaven Raman and Natasha Broude and Wilson W. Wong and James E. Galagan}, title = {Coordinated regulation of acid resistance in Escherichia coli}, journal = {{BMC} Syst. Biol.}, volume = {11}, number = {1}, pages = {1:1--1:15}, year = {2017}, url = {https://doi.org/10.1186/s12918-016-0376-y}, doi = {10.1186/S12918-016-0376-Y}, timestamp = {Wed, 06 Nov 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/bmcsb/AquinoHJLHCEHJS17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/braininf/HighsmithWTSE17, author = {Jonathan M. Highsmith and Karl L. Wuensch and Tuan Tran and Alexandra J. Stephenson and Daniel E. Everhart}, title = {It's not what you expect: feedback negativity is independent of reward expectation and affective responsivity in a non-probabilistic task}, journal = {Brain Informatics}, volume = {4}, number = {1}, pages = {51--63}, year = {2017}, url = {https://doi.org/10.1007/s40708-016-0050-6}, doi = {10.1007/S40708-016-0050-6}, timestamp = {Wed, 13 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/braininf/HighsmithWTSE17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bspc/NapoliGWTO17, author = {Alessandro Napoli and Stephen M. Glassd and Christian R. Ward and Carole A. Tucker and Iyad Obeid}, title = {Performance analysis of a generalized motion capture system using microsoft kinect 2.0}, journal = {Biomed. Signal Process. Control.}, volume = {38}, pages = {265--280}, year = {2017}, url = {https://doi.org/10.1016/j.bspc.2017.06.006}, doi = {10.1016/J.BSPC.2017.06.006}, timestamp = {Fri, 26 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/bspc/NapoliGWTO17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/iet-wss/MrugalaTH17, author = {Kinga Mrugala and Nilufer Tuptuk and Stephen Hailes}, title = {Evolving attackers against wireless sensor networks using genetic programming}, journal = {{IET} Wirel. Sens. Syst.}, volume = {7}, number = {4}, pages = {113--122}, year = {2017}, url = {https://doi.org/10.1049/iet-wss.2016.0090}, doi = {10.1049/IET-WSS.2016.0090}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/iet-wss/MrugalaTH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jamia/NelsonOUBZHYMMT17, author = {Stuart J. Nelson and Tudor I. Oprea and Oleg Ursu and Cristian Bologa and Amrapali Zaveri and Jayme Holmes and Jeremy J. Yang and Stephen L. Mathias and Subramani Mani and Mark S. Tuttle and Michel Dumontier}, title = {Formalizing drug indications on the road to therapeutic intent}, journal = {J. Am. Medical Informatics Assoc.}, volume = {24}, number = {6}, pages = {1169--1172}, year = {2017}, url = {https://doi.org/10.1093/jamia/ocx064}, doi = {10.1093/JAMIA/OCX064}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jamia/NelsonOUBZHYMMT17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jamia/TunnecliffWGKM17, author = {Jacqueline Tunnecliff and John Weiner and James E. Gaida and Jennifer L. Keating and Prue Morgan and Dragan Ilic and Lyn Clearihan and David Davies and Sivalal Sadasivan and Patitapaban Mohanty and Shankar Ganesh and John Reynolds and Stephen Maloney}, title = {Translating evidence to practice in the health professions: a randomized trial of Twitter vs Facebook}, journal = {J. Am. Medical Informatics Assoc.}, volume = {24}, number = {2}, pages = {403--408}, year = {2017}, url = {https://doi.org/10.1093/jamia/ocw085}, doi = {10.1093/JAMIA/OCW085}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jamia/TunnecliffWGKM17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jamia/WongBKGTW17, author = {David Wong and Timothy Bonnici and Julia Knight and Stephen Gerry and James Turton and Peter J. Watkinson}, title = {A ward-based time study of paper and electronic documentation for recording vital sign observations}, journal = {J. Am. Medical Informatics Assoc.}, volume = {24}, number = {4}, pages = {717--721}, year = {2017}, url = {https://doi.org/10.1093/jamia/ocw186}, doi = {10.1093/JAMIA/OCW186}, timestamp = {Mon, 26 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jamia/WongBKGTW17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jbi/ManiCOOMBUB17, author = {Subramani Mani and Daniel Cannon and Robin Ohls and Tudor I. Oprea and Stephen L. Mathias and Karri Ballard and Oleg Ursu and Cristian Bologa}, title = {Protein biomarker druggability profiling}, journal = {J. Biomed. Informatics}, volume = {66}, pages = {241--247}, year = {2017}, url = {https://doi.org/10.1016/j.jbi.2017.01.014}, doi = {10.1016/J.JBI.2017.01.014}, timestamp = {Tue, 16 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jbi/ManiCOOMBUB17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jms/LonesACDJNTS17, author = {Michael A. Lones and Jane E. Alty and Jeremy Cosgrove and Philippa Duggan{-}Carter and Stuart Jamieson and Rebecca F. Naylor and Andrew James Turner and Stephen L. Smith}, title = {A New Evolutionary Algorithm-Based Home Monitoring Device for Parkinson's Dyskinesia}, journal = {J. Medical Syst.}, volume = {41}, number = {11}, pages = {176:1--176:8}, year = {2017}, url = {https://doi.org/10.1007/s10916-017-0811-7}, doi = {10.1007/S10916-017-0811-7}, timestamp = {Tue, 12 Jul 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jms/LonesACDJNTS17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/NguyenMBBFGHHJK17, author = {Dac{-}Trung Nguyen and Stephen L. Mathias and Cristian Bologa and S{\o}ren Brunak and Nicolas F. Fernandez and Anna Gaulton and Anne Hersey and Jayme Holmes and Lars Juhl Jensen and Anneli Karlsson and Guixia Liu and Avi Ma'ayan and Geetha Mandava and Subramani Mani and Saurabh Mehta and John P. Overington and Juhee Patel and Andrew D. Rouillard and Stephan C. Sch{\"{u}}rer and Timothy Sheils and Anton Simeonov and Larry A. Sklar and Noel Southall and Oleg Ursu and Dusica Vidovic and Anna Waller and Jeremy J. Yang and Ajit Jadhav and Tudor I. Oprea and Rajarshi Guha}, title = {Pharos: Collating protein information to shed light on the druggable genome}, journal = {Nucleic Acids Res.}, volume = {45}, number = {Database-Issue}, pages = {D995--D1002}, year = {2017}, url = {https://doi.org/10.1093/nar/gkw1072}, doi = {10.1093/NAR/GKW1072}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/NguyenMBBFGHHJK17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/UrsuHKBYMNO17, author = {Oleg Ursu and Jayme Holmes and Jeffrey Knockel and Cristian Bologa and Jeremy J. Yang and Stephen L. Mathias and Stuart J. Nelson and Tudor I. Oprea}, title = {DrugCentral: online drug compendium}, journal = {Nucleic Acids Res.}, volume = {45}, number = {Database-Issue}, pages = {D932--D939}, year = {2017}, url = {https://doi.org/10.1093/nar/gkw993}, doi = {10.1093/NAR/GKW993}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/UrsuHKBYMNO17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nature/LiKTDDCHZSSLGBM17, author = {Xin Li and Yungil Kim and Emily K. Tsang and Joe R. Davis and Farhan N. Damani and Colby Chiang and Gaelen T. Hess and Zachary Zappala and Benjamin J. Strober and Alexandra J. Scott and Amy Li and Andrea Ganna and Michael C. Bassik and Jason D. Merker and Fran{\c{c}}ois Aguet and Kristin G. Ardlie and Beryl B. Cummings and Ellen T. Gelfand and Gad Getz and Kane Hadley and Robert E. Handsaker and Katherine H. Huang and Seva Kashin and Konrad J. Karczewski and Monkol Lek and Xiao Li and Daniel G. MacArthur and Jared L. Nedzel and Duyen T. Nguyen and Michael S. Noble and Ayellet V. Segr{\`{e}} and Casandra A. Trowbridge and Taru Tukiainen and Nathan S. Abell and Brunilda Balliu and Ruth Barshir and Omer Basha and Alexis J. Battle and Gireesh K. Bogu and Andrew Brown and Christopher D. Brown and Stephane E. Castel and Lin S. Chen and Donald F. Conrad and Nancy J. Cox and Olivier Delaneau and Emmanouil T. Dermitzakis and Barbara E. Engelhardt and Eleazar Eskin and Pedro G. Ferreira and Laure Fr{\'{e}}sard and Eric R. Gamazon and Diego Garrido{-}Mart{\'{\i}}n and Ariel D. H. Gewirtz and Genna Gliner and Michael J. Gloudemans and Roderic Guig{\'{o}} and Ira M. Hall and Buhm Han and Yuan He and Farhad Hormozdiari and Cedric Howald and Hae Kyung Im and Brian Jo and Eun Yong Kang and Sarah Kim{-}Hellmuth and Tuuli Lappalainen and Gen Li and Boxiang Liu and Serghei Mangul and Mark I. McCarthy and Ian C. McDowell and Pejman Mohammadi and Jean Monlong and Stephen B. Montgomery}, title = {The impact of rare variation on gene expression across tissues}, journal = {Nat.}, volume = {550}, number = {7675}, pages = {239--243}, year = {2017}, url = {https://doi.org/10.1038/nature24267}, doi = {10.1038/NATURE24267}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nature/LiKTDDCHZSSLGBM17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ni/AineBBCCGHHJLLM17, author = {C. J. Aine and Henry Jeremy Bockholt and Juan R. Bustillo and Jos{\'{e}} M. Ca{\~{n}}ive and Arvind Caprihan and Charles Gasparovic and Faith M. Hanlon and Jon M. Houck and Rex E. Jung and John Lauriello and Jingyu Liu and Andy R. Mayer and Nora I. Perrone{-}Bizzozero and Stefan Posse and Julia M. Stephen and Jessica A. Turner and Vincent P. Clark and Vince D. Calhoun}, title = {Multimodal Neuroimaging in Schizophrenia: Description and Dissemination}, journal = {Neuroinformatics}, volume = {15}, number = {4}, pages = {343--364}, year = {2017}, url = {https://doi.org/10.1007/s12021-017-9338-9}, doi = {10.1007/S12021-017-9338-9}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ni/AineBBCCGHHJLLM17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/softx/TudiscoACH17, author = {Erika Tudisco and Edward And{\`{o}} and R{\'{e}}mi Cailletaud and Stephen A. Hall}, title = {TomoWarp2: {A} local digital volume correlation code}, journal = {SoftwareX}, volume = {6}, pages = {267--270}, year = {2017}, url = {https://doi.org/10.1016/j.softx.2017.10.002}, doi = {10.1016/J.SOFTX.2017.10.002}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/softx/TudiscoACH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmi/FuXLZWLFBA17, author = {Huazhu Fu and Yanwu Xu and Stephen Lin and Xiaoqin Zhang and Damon Wing Kee Wong and Jiang Liu and Alejandro F. Frangi and Mani Baskaran and Tin Aung}, title = {Segmentation and Quantification for Angle-Closure Glaucoma Assessment in Anterior Segment {OCT}}, journal = {{IEEE} Trans. Medical Imaging}, volume = {36}, number = {9}, pages = {1930--1938}, year = {2017}, url = {https://doi.org/10.1109/TMI.2017.2703147}, doi = {10.1109/TMI.2017.2703147}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tmi/FuXLZWLFBA17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tomacs/LiCT17, author = {Xiaosong Li and Wentong Cai and Stephen John Turner}, title = {Cloning Agent-Based Simulation}, journal = {{ACM} Trans. Model. Comput. Simul.}, volume = {27}, number = {2}, pages = {15}, year = {2017}, url = {https://doi.org/10.1145/3013529}, doi = {10.1145/3013529}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tomacs/LiCT17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amia/MalmasiHCBST17, author = {Shervin Malmasi and Naoshi Hosomura and Lee{-}Shing Chang and C. J. Brown and Stephen Skentzos and Alexander Turchin}, title = {Extracting Healthcare Quality Information from Unstructured Data}, booktitle = {{AMIA} 2017, American Medical Informatics Association Annual Symposium, Washington, DC, USA, November 4-8, 2017}, publisher = {{AMIA}}, year = {2017}, url = {https://knowledge.amia.org/65881-amiab-1.4254737/t003-1.4258387/f003-1.4258388/2732186-1.4258608/2732196-1.4258605}, timestamp = {Wed, 17 Apr 2024 11:47:24 +0200}, biburl = {https://dblp.org/rec/conf/amia/MalmasiHCBST17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amia/MalmasiSHGST17, author = {Shervin Malmasi and Nicolae L. Sandor and Naoshi Hosomura and Matt Goldberg and Stephen Skentzos and Alexander Turchin}, title = {Canary: An Information Extraction Platform for Clinical Researchers}, booktitle = {{AMIA} 2017, American Medical Informatics Association Annual Symposium, Washington, DC, USA, November 4-8, 2017}, publisher = {{AMIA}}, year = {2017}, url = {https://knowledge.amia.org/65881-amiab-1.4254737/t006-1.4257302/f006-1.4257303/2728680-1.4257334/2730400-1.4257331}, timestamp = {Wed, 17 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amia/MalmasiSHGST17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/CounsellST17, author = {Steve Counsell and Stephen Swift and Allan Tucker}, editor = {Panagiotis D. Bamidis and Stathis Th. Konstantinidis and Pedro Pereira Rodrigues}, title = {A Deconstructed Replication of a Time of Test Study Using the {AGIS} Metric}, booktitle = {30th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2017, Thessaloniki, Greece, June 22-24, 2017}, pages = {103--104}, publisher = {{IEEE} Computer Society}, year = {2017}, url = {https://doi.org/10.1109/CBMS.2017.60}, doi = {10.1109/CBMS.2017.60}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/CounsellST17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eScience/SimpsonWHSDTH017, author = {Mike Simpson and Simon Woodman and Hugo Hiden and Sebastian Stein and Stephen Dowsland and Mark Turner and Vicki L. Hanson and Paul Watson}, title = {A Platform for the Analysis of Qualitative and Quantitative Data about the Built Environment and Its Users}, booktitle = {13th {IEEE} International Conference on e-Science, e-Science 2017, Auckland, New Zealand, October 24-27, 2017}, pages = {228--237}, publisher = {{IEEE} Computer Society}, year = {2017}, url = {https://doi.org/10.1109/eScience.2017.36}, doi = {10.1109/ESCIENCE.2017.36}, timestamp = {Tue, 15 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eScience/SimpsonWHSDTH017.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ei-sda/Holliman0DCP17, author = {Nicolas S. Holliman and Mark Turner and Stephen Dowsland and Richard Cloete and Thomas Picton}, editor = {Andrew J. Woods and Gregg E. Favalora and Nicolas S. Holliman and Takashi Kawai}, title = {Designing a Cloud-based 3D Visualization Engine for Smart Cities}, booktitle = {Stereoscopic Displays and Applications XXVIII, Burlingame, CA, USA, January 29 - February 2, 2017}, pages = {173--178}, publisher = {Society for Imaging Science and Technology}, year = {2017}, url = {https://doi.org/10.2352/ISSN.2470-1173.2017.5.SDA-105}, doi = {10.2352/ISSN.2470-1173.2017.5.SDA-105}, timestamp = {Wed, 26 Jul 2023 17:17:16 +0200}, biburl = {https://dblp.org/rec/conf/ei-sda/Holliman0DCP17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/TuVWGJR17, author = {Stephen Tu and Shivaram Venkataraman and Ashia C. Wilson and Alex Gittens and Michael I. Jordan and Benjamin Recht}, editor = {Doina Precup and Yee Whye Teh}, title = {Breaking Locality Accelerates Block Gauss-Seidel}, booktitle = {Proceedings of the 34th International Conference on Machine Learning, {ICML} 2017, Sydney, NSW, Australia, 6-11 August 2017}, series = {Proceedings of Machine Learning Research}, volume = {70}, pages = {3482--3491}, publisher = {{PMLR}}, year = {2017}, url = {http://proceedings.mlr.press/v70/tu17a.html}, timestamp = {Wed, 29 May 2019 08:41:45 +0200}, biburl = {https://dblp.org/rec/conf/icml/TuVWGJR17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/MannucciLDYFMEA17, author = {Anthony J. Mannucci and Stephen T. Lowe and Jeffrey Dickson and Larry E. Young and Garth W. Franklin and Thomas K. Meehan and Stephan Esterhuizen and Chi O. Ao and Panagiotis Vergados and Clara C. Chew and Son V. Kim and Son V. Nghiem and F. Joseph Turk and Cinzia Zuffada and Rashmi Shah and Attila Komjathy}, title = {High-value remote sensing for the geosciences: Opportunistic use of navigation satellite signals}, booktitle = {2017 {IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS} 2017, Fort Worth, TX, USA, July 23-28, 2017}, pages = {2686--2689}, publisher = {{IEEE}}, year = {2017}, url = {https://doi.org/10.1109/IGARSS.2017.8127549}, doi = {10.1109/IGARSS.2017.8127549}, timestamp = {Wed, 16 Oct 2019 14:14:53 +0200}, biburl = {https://dblp.org/rec/conf/igarss/MannucciLDYFMEA17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/medinfo/GraySTWMTTGSHNM17, author = {Kathleen Gray and Remya Stephen and Bronwyn Terrill and Brenda Wilson and Anna Middleton and Rigan Tytherleigh and Erin Turbitt and Clara Gaff and Jacqueline Savard and Chriselle Hickerton and Ainsley J. Newson and Sylvia Metcalfe}, editor = {Adi V. Gundlapalli and Marie{-}Christine Jaulent and Dongsheng Zhao}, title = {Consumer Health Informatics Aspects of Direct-to-Consumer Personal Genomic Testing}, booktitle = {{MEDINFO} 2017: Precision Healthcare through Informatics - Proceedings of the 16th World Congress on Medical and Health Informatics, Hangzhou, China, 21-25 August 2017}, series = {Studies in Health Technology and Informatics}, volume = {245}, pages = {89--93}, publisher = {{IOS} Press}, year = {2017}, url = {https://doi.org/10.3233/978-1-61499-830-3-89}, doi = {10.3233/978-1-61499-830-3-89}, timestamp = {Fri, 26 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/medinfo/GraySTWMTTGSHNM17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/LiCLLGC17, author = {Dongsheng Li and Chao Chen and Wei Liu and Tun Lu and Ning Gu and Stephen M. Chu}, editor = {Isabelle Guyon and Ulrike von Luxburg and Samy Bengio and Hanna M. Wallach and Rob Fergus and S. V. N. Vishwanathan and Roman Garnett}, title = {Mixture-Rank Matrix Approximation for Collaborative Filtering}, booktitle = {Advances in Neural Information Processing Systems 30: Annual Conference on Neural Information Processing Systems 2017, December 4-9, 2017, Long Beach, CA, {USA}}, pages = {477--485}, year = {2017}, url = {https://proceedings.neurips.cc/paper/2017/hash/3dd48ab31d016ffcbf3314df2b3cb9ce-Abstract.html}, timestamp = {Thu, 21 Jan 2021 13:58:27 +0100}, biburl = {https://dblp.org/rec/conf/nips/LiCLLGC17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/synasc/2017, editor = {Tudor Jebelean and Viorel Negru and Dana Petcu and Daniela Zaharie and Tetsuo Ida and Stephen M. Watt}, title = {19th International Symposium on Symbolic and Numeric Algorithms for Scientific Computing, {SYNASC} 2017, Timisoara, Romania, September 21-24, 2017}, publisher = {{IEEE} Computer Society}, year = {2017}, url = {https://ieeexplore.ieee.org/xpl/conhome/8528958/proceeding}, isbn = {978-1-5386-2626-9}, timestamp = {Wed, 16 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/synasc/2017.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/EldalyAPKCD017, author = {Ahmed Karam Eldaly and Yoann Altmann and Antonios Perperidis and Nikola Krstajic and Tushar Choudhary and Kevin Dhaliwal and Stephen McLaughlin}, title = {Deconvolution and Restoration of Optical Endomicroscopy Images}, journal = {CoRR}, volume = {abs/1701.08107}, year = {2017}, url = {http://arxiv.org/abs/1701.08107}, eprinttype = {arXiv}, eprint = {1701.08107}, timestamp = {Fri, 25 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/EldalyAPKCD017.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/MakoninWT17, author = {Stephen Makonin and Z. Jane Wang and Chris Tumpach}, title = {{RAE:} The Rainforest Automation Energy Dataset for Smart Grid Meter Data Analysis}, journal = {CoRR}, volume = {abs/1705.05767}, year = {2017}, url = {http://arxiv.org/abs/1705.05767}, eprinttype = {arXiv}, eprint = {1705.05767}, timestamp = {Wed, 27 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/MakoninWT17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/TuBPR17, author = {Stephen Tu and Ross Boczar and Andrew K. Packard and Benjamin Recht}, title = {Non-Asymptotic Analysis of Robust Control from Coarse-Grained Identification}, journal = {CoRR}, volume = {abs/1707.04791}, year = {2017}, url = {http://arxiv.org/abs/1707.04791}, eprinttype = {arXiv}, eprint = {1707.04791}, timestamp = {Fri, 30 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/TuBPR17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1709-10203, author = {Stephen Tu and Ross Boczar and Benjamin Recht}, title = {On the Approximation of Toeplitz Operators for Nonparametric {\textdollar}{\textbackslash}mathcal\{H\}{\_}{\textbackslash}infty{\textdollar}-norm Estimation}, journal = {CoRR}, volume = {abs/1709.10203}, year = {2017}, url = {http://arxiv.org/abs/1709.10203}, eprinttype = {arXiv}, eprint = {1709.10203}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1709-10203.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1710-01688, author = {Sarah Dean and Horia Mania and Nikolai Matni and Benjamin Recht and Stephen Tu}, title = {On the Sample Complexity of the Linear Quadratic Regulator}, journal = {CoRR}, volume = {abs/1710.01688}, year = {2017}, url = {http://arxiv.org/abs/1710.01688}, eprinttype = {arXiv}, eprint = {1710.01688}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1710-01688.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1712-08642, author = {Stephen Tu and Benjamin Recht}, title = {Least-Squares Temporal Difference Learning for the Linear Quadratic Regulator}, journal = {CoRR}, volume = {abs/1712.08642}, year = {2017}, url = {http://arxiv.org/abs/1712.08642}, eprinttype = {arXiv}, eprint = {1712.08642}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1712-08642.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rfc/rfc8209, author = {Mark C. Reynolds and Sean Turner and Stephen T. Kent}, title = {A Profile for BGPsec Router Certificates, Certificate Revocation Lists, and Certification Requests}, journal = {{RFC}}, volume = {8209}, pages = {1--15}, year = {2017}, url = {https://doi.org/10.17487/RFC8209}, doi = {10.17487/RFC8209}, timestamp = {Thu, 15 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/rfc/rfc8209.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bioinformatics/SuzukiKTTTQIYYT16, author = {Yuta Suzuki and Jonas Korlach and Stephen W. Turner and Tatsuya Tsukahara and Junko Taniguchi and Wei Qu and Kazuki Ichikawa and Jun Yoshimura and Hideaki Yurino and Yuji Takahashi and Jun Mitsui and Hiroyuki Ishiura and Shoji Tsuji and Hiroyuki Takeda and Shinichi Morishita}, title = {AgIn: measuring the landscape of CpG methylation of individual repetitive elements}, journal = {Bioinform.}, volume = {32}, number = {19}, pages = {2911--2919}, year = {2016}, url = {https://doi.org/10.1093/bioinformatics/btw360}, doi = {10.1093/BIOINFORMATICS/BTW360}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bioinformatics/SuzukiKTTTQIYYT16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/biomedsem/CheungKRSRSAGGA16, author = {Kei{-}Hoi Cheung and Shivakumar Keerthikumar and Paola Roncaglia and Sai Lakshmi Subramanian and Matthew E. Roth and Monisha Samuel and Sushma Anand and Lahiru Gangoda and Stephen Gould and Roger Alexander and David Galas and Mark B. Gerstein and Andrew F. Hill and Robert R. Kitchen and Jan L{\"{o}}tvall and Tushar Patel}, title = {Extending gene ontology in the context of extracellular {RNA} and vesicle communication}, journal = {J. Biomed. Semant.}, volume = {7}, pages = {19}, year = {2016}, url = {https://doi.org/10.1186/s13326-016-0061-5}, doi = {10.1186/S13326-016-0061-5}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/biomedsem/CheungKRSRSAGGA16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/biosystems/TurnerLTSJACT16, author = {Alexander P. Turner and Michael A. Lones and Martin A. Trefzer and Stephen L. Smith and Stuart Jamieson and Jane E. Alty and Jeremy Cosgrove and Andy M. Tyrrell}, title = {Using epigenetic networks for the analysis of movement associated with levodopa therapy for Parkinson's disease}, journal = {Biosyst.}, volume = {146}, pages = {35--42}, year = {2016}, url = {https://doi.org/10.1016/j.biosystems.2016.05.005}, doi = {10.1016/J.BIOSYSTEMS.2016.05.005}, timestamp = {Thu, 23 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/biosystems/TurnerLTSJACT16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cais/PetersMBHMSTVWD16, author = {Christoph Peters and Paul P. Maglio and Ralph Badinelli and Robert R. Harmon and Roger S. Maull and James C. Spohrer and Tuure Tuunanen and Stephen L. Vargo and Jeffrey J. Welser and Haluk Demirkan and Terri L. Griffith and Yassi Moghaddam}, title = {Emerging Digital Frontiers for Service Innovation}, journal = {Commun. Assoc. Inf. Syst.}, volume = {39}, pages = {8}, year = {2016}, url = {https://doi.org/10.17705/1cais.03908}, doi = {10.17705/1CAIS.03908}, timestamp = {Tue, 16 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cais/PetersMBHMSTVWD16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cce/PaulBTZ16, author = {Prokash Paul and Debangsu Bhattacharyya and Richard Turton and Stephen E. Zitney}, title = {Dynamic model-based sensor network design algorithm for system efficiency maximization}, journal = {Comput. Chem. Eng.}, volume = {89}, pages = {27--40}, year = {2016}, url = {https://doi.org/10.1016/j.compchemeng.2016.01.018}, doi = {10.1016/J.COMPCHEMENG.2016.01.018}, timestamp = {Mon, 18 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cce/PaulBTZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/chb/WattsMTBSWBAMJ16, author = {Christina M. Watts and Patricia S. Moyer{-}Packenham and Stephen I. Tucker and Emma P. Bullock and Jessica F. Shumway and Arla Westenskow and Jennifer Boyer{-}Thurgood and Katie Anderson{-}Pence and Salif Mahamane and Kerry Jordan}, title = {An examination of children's learning progression shifts while using touch screen virtual manipulative mathematics apps}, journal = {Comput. Hum. Behav.}, volume = {64}, pages = {814--828}, year = {2016}, url = {https://doi.org/10.1016/j.chb.2016.07.029}, doi = {10.1016/J.CHB.2016.07.029}, timestamp = {Tue, 18 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/chb/WattsMTBSWBAMJ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/compsec/FlowerdayT16, author = {Stephen V. Flowerday and Tite Tuyikeze}, title = {Information security policy development and implementation: The what, how and who}, journal = {Comput. Secur.}, volume = {61}, pages = {169--183}, year = {2016}, url = {https://doi.org/10.1016/j.cose.2016.06.002}, doi = {10.1016/J.COSE.2016.06.002}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/compsec/FlowerdayT16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/concurrency/LiCT16, author = {Xiaosong Li and Wentong Cai and Stephen John Turner}, title = {Supporting efficient execution of continuous space agent-based simulation on {GPU}}, journal = {Concurr. Comput. Pract. Exp.}, volume = {28}, number = {12}, pages = {3313--3332}, year = {2016}, url = {https://doi.org/10.1002/cpe.3808}, doi = {10.1002/CPE.3808}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/concurrency/LiCT16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cviu/TuVEPPDWSP16, author = {Liyun Tu and Jared Vicory and Shireen Y. Elhabian and Beatriz Paniagua and Juan{-}Carlos Prieto and James N. Damon and Ross T. Whitaker and Martin Styner and Stephen M. Pizer}, title = {Entropy-based correspondence improvement of interpolated skeletal models}, journal = {Comput. Vis. Image Underst.}, volume = {151}, pages = {72--79}, year = {2016}, url = {https://doi.org/10.1016/j.cviu.2015.11.002}, doi = {10.1016/J.CVIU.2015.11.002}, timestamp = {Thu, 06 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cviu/TuVEPPDWSP16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/envsoft/BoothQCSCKLMST16, author = {Eric G. Booth and Jiangxiao Qiu and Stephen R. Carpenter and Jason Schatz and Xi Chen and Christopher J. Kucharik and Steven P. Loheide II and Melissa M. Motew and Jenny M. Seifert and Monica G. Turner}, title = {From qualitative to quantitative environmental scenarios: Translating storylines into biophysical modeling inputs at the watershed scale}, journal = {Environ. Model. Softw.}, volume = {85}, pages = {80--97}, year = {2016}, url = {https://doi.org/10.1016/j.envsoft.2016.08.008}, doi = {10.1016/J.ENVSOFT.2016.08.008}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/envsoft/BoothQCSCKLMST16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/envsoft/FrancoHSNT16, author = {Chiara Franco and Leanne Appleby Hepburn and David J. Smith and Stephen Nimrod and Allan Tucker}, title = {A Bayesian Belief Network to assess rate of changes in coral reef ecosystems}, journal = {Environ. Model. Softw.}, volume = {80}, pages = {132--142}, year = {2016}, url = {https://doi.org/10.1016/j.envsoft.2016.02.029}, doi = {10.1016/J.ENVSOFT.2016.02.029}, timestamp = {Wed, 19 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/envsoft/FrancoHSNT16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/ShakeriLTL16, author = {Mojtaba Shakeri and Malcolm Yoke Hean Low and Stephen John Turner and Eng Wah Lee}, title = {An efficient incremental evaluation function for optimizing truck scheduling in a resource-constrained crossdock using metaheuristics}, journal = {Expert Syst. Appl.}, volume = {45}, pages = {172--184}, year = {2016}, url = {https://doi.org/10.1016/j.eswa.2015.09.041}, doi = {10.1016/J.ESWA.2015.09.041}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eswa/ShakeriLTL16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/siamsc/TuminaroPTSP16, author = {Ray S. Tuminaro and Mauro Perego and Irina K. Tezaur and Andrew G. Salinger and Stephen F. Price}, title = {A Matrix Dependent/Algebraic Multigrid Approach for Extruded Meshes with Applications to Ice Sheet Modeling}, journal = {{SIAM} J. Sci. Comput.}, volume = {38}, number = {5}, year = {2016}, url = {https://doi.org/10.1137/15M1040839}, doi = {10.1137/15M1040839}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/siamsc/TuminaroPTSP16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/simpra/LiCTQG16, author = {Zengxiang Li and Wentong Cai and Stephen John Turner and Zheng Qin and Rick Siow Mong Goh}, title = {Transparent three-phase Byzantine fault tolerance for parallel and distributed simulations}, journal = {Simul. Model. Pract. Theory}, volume = {60}, pages = {90--107}, year = {2016}, url = {https://doi.org/10.1016/j.simpat.2015.09.012}, doi = {10.1016/J.SIMPAT.2015.09.012}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/simpra/LiCTQG16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/synthese/OlenT16, author = {Peter Olen and Stephen P. Turner}, title = {Was Sellars an error theorist?}, journal = {Synth.}, volume = {193}, number = {7}, pages = {2053--2075}, year = {2016}, url = {https://doi.org/10.1007/s11229-015-0829-7}, doi = {10.1007/S11229-015-0829-7}, timestamp = {Thu, 09 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/synthese/OlenT16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbe/TullyC16, author = {Stephen Tully and Howie Choset}, title = {A Filtering Approach for Image-Guided Surgery With a Highly Articulated Surgical Snake Robot}, journal = {{IEEE} Trans. Biomed. Eng.}, volume = {63}, number = {2}, pages = {392--402}, year = {2016}, url = {https://doi.org/10.1109/TBME.2015.2461531}, doi = {10.1109/TBME.2015.2461531}, timestamp = {Wed, 02 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tbe/TullyC16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tkl/TuckerMWJ16, author = {Stephen I. Tucker and Patricia S. Moyer{-}Packenham and Arla Westenskow and Kerry Jordan}, title = {The Complexity of the Affordance-Ability Relationship When Second-Grade Children Interact with Mathematics Virtual Manipulative Apps}, journal = {Technol. Knowl. Learn.}, volume = {21}, number = {3}, pages = {341--360}, year = {2016}, url = {https://doi.org/10.1007/s10758-016-9276-x}, doi = {10.1007/S10758-016-9276-X}, timestamp = {Tue, 10 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tkl/TuckerMWJ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ACMicec/TumibayLYS16, author = {Gilbert M. Tumibay and Fernand T. Layug and Daisy S. Yap and Mar Stephen M. Sembrano}, editor = {Toru Ishida and Norman M. Sadeh and Jae Kyu Lee and Federico Casalegno and Wooju Kim and Sohyeong Kim and Sung{-}Byung Yang}, title = {Increasing the value of farm products: connecting farmers and consumers through an E-commerce system}, booktitle = {Proceedings of the 18th Annual International Conference on Electronic Commerce - e-Commerce in Smart connected World, {ICEC} '16, Suwon, Republic of Korea, August 17-19, 2016}, pages = {5:1--5:5}, publisher = {{ACM}}, year = {2016}, url = {https://doi.org/10.1145/2971603.2971608}, doi = {10.1145/2971603.2971608}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ACMicec/TumibayLYS16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/CounsellST16, author = {Steve Counsell and Stephen Swift and Allan Tucker}, title = {The {AGIS} Metric and Time of Test: {A} Replication Study}, booktitle = {29th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2016, Belfast, {UK} and Dublin, Ireland, June 20-24, 2016}, pages = {269--270}, publisher = {{IEEE} Computer Society}, year = {2016}, url = {https://doi.org/10.1109/CBMS.2016.80}, doi = {10.1109/CBMS.2016.80}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/CounsellST16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/JilaniTS16, author = {Mohd Zairul Mazwan Bin Jilani and Allan Tucker and Stephen Swift}, title = {Simultaneous Modelling and Clustering of Visual Field Data}, booktitle = {29th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2016, Belfast, {UK} and Dublin, Ireland, June 20-24, 2016}, pages = {213--218}, publisher = {{IEEE} Computer Society}, year = {2016}, url = {https://doi.org/10.1109/CBMS.2016.66}, doi = {10.1109/CBMS.2016.66}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/JilaniTS16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eScience/TueckeACLMRF16, author = {Steven Tuecke and Rachana Ananthakrishnan and Kyle Chard and Mattias Lidman and Brendan McCollam and Stephen Rosen and Ian T. Foster}, title = {Globus auth: {A} research identity and access management platform}, booktitle = {12th {IEEE} International Conference on e-Science, e-Science 2016, Baltimore, MD, USA, October 23-27, 2016}, pages = {203--212}, publisher = {{IEEE} Computer Society}, year = {2016}, url = {https://doi.org/10.1109/eScience.2016.7870901}, doi = {10.1109/ESCIENCE.2016.7870901}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/eScience/TueckeACLMRF16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/embc/NapoliWGTO16, author = {Alessandro Napoli and Christian R. Ward and Stephen M. Glassd and Carole A. Tucker and Iyad Obeid}, title = {Automated assessment of postural stability system}, booktitle = {38th Annual International Conference of the {IEEE} Engineering in Medicine and Biology Society, {EMBC} 2016, Orlando, FL, USA, August 16-20, 2016}, pages = {6090--6093}, publisher = {{IEEE}}, year = {2016}, url = {https://doi.org/10.1109/EMBC.2016.7592118}, doi = {10.1109/EMBC.2016.7592118}, timestamp = {Fri, 26 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/embc/NapoliWGTO16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/gecco/MrugalaTH16, author = {Kinga Mrugala and Nilufer Tuptuk and Stephen Hailes}, editor = {Tobias Friedrich and Frank Neumann and Andrew M. Sutton}, title = {Evolving Attackers against Wireless Sensor Networks}, booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2016, Denver, CO, USA, July 20-24, 2016, Companion Material Proceedings}, pages = {107--108}, publisher = {{ACM}}, year = {2016}, url = {https://doi.org/10.1145/2908961.2908974}, doi = {10.1145/2908961.2908974}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/gecco/MrugalaTH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icbo/UtechtJBCORRAHB16, author = {Joseph Utecht and John Judkins and Mathias Brochhausen and Terra Colvin Jr. and J. Neil Otte and Nicholas Rogers and Robert Rose and Maria Alvi and Amanda Hicks and Jane Ball and Stephen M. Bowman and Robert T. Maxson and Rosemary Nabaweesi and Rohit Pradhan and Nels D. Sanddal and M. Eduard Tudoreanu and Robert J. Winchell}, editor = {Pankaj Jaiswal and Robert Hoehndorf and Cecilia N. Arighi and Austin Meier}, title = {{OOSTT:} a Resource for Analyzing the Organizational Structures of Trauma Centers and Trauma Systems}, booktitle = {Proceedings of the Joint International Conference on Biological Ontology and BioCreative, Corvallis, Oregon, United States, August 1-4, 2016}, series = {{CEUR} Workshop Proceedings}, volume = {1747}, publisher = {CEUR-WS.org}, year = {2016}, url = {https://ceur-ws.org/Vol-1747/IT504\_ICBO2016.pdf}, timestamp = {Fri, 10 Mar 2023 16:22:23 +0100}, biburl = {https://dblp.org/rec/conf/icbo/UtechtJBCORRAHB16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icml/TuBSSR16, author = {Stephen Tu and Ross Boczar and Max Simchowitz and Mahdi Soltanolkotabi and Ben Recht}, editor = {Maria{-}Florina Balcan and Kilian Q. Weinberger}, title = {Low-rank Solutions of Linear Matrix Equations via Procrustes Flow}, booktitle = {Proceedings of the 33nd International Conference on Machine Learning, {ICML} 2016, New York City, NY, USA, June 19-24, 2016}, series = {{JMLR} Workshop and Conference Proceedings}, volume = {48}, pages = {964--973}, publisher = {JMLR.org}, year = {2016}, url = {http://proceedings.mlr.press/v48/tu16.html}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icml/TuBSSR16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/noms/TurnerU16, author = {Stephen W. Turner and Suleyman Uludag}, editor = {Sema Oktug and Mehmet Ulema and Cicek Cavdar and Lisandro Zambenedetti Granville and Carlos Raniery Paula dos Santos}, title = {Intelligent transportation as the key enabler of smart cities}, booktitle = {2016 {IEEE/IFIP} Network Operations and Management Symposium, {NOMS} 2016, Istanbul, Turkey, April 25-29, 2016}, pages = {1261--1264}, publisher = {{IEEE}}, year = {2016}, url = {https://doi.org/10.1109/NOMS.2016.7502999}, doi = {10.1109/NOMS.2016.7502999}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/noms/TurnerU16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/xpu/McCaldenTB16, author = {Stephen McCalden and Mark Tumilty and David W. Bustard}, editor = {Helen Sharp and Tracy Hall}, title = {Smoothing the Transition from Agile Software Development to Agile Software Maintenance}, booktitle = {Agile Processes, in Software Engineering, and Extreme Programming - 17th International Conference, {XP} 2016, Edinburgh, UK, May 24-27, 2016, Proceedings}, series = {Lecture Notes in Business Information Processing}, volume = {251}, pages = {209--216}, publisher = {Springer}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-33515-5\_18}, doi = {10.1007/978-3-319-33515-5\_18}, timestamp = {Tue, 26 Jun 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/xpu/McCaldenTB16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/synasc/2016, editor = {James H. Davenport and Viorel Negru and Tetsuo Ida and Tudor Jebelean and Dana Petcu and Stephen M. Watt and Daniela Zaharie}, title = {18th International Symposium on Symbolic and Numeric Algorithms for Scientific Computing, {SYNASC} 2016, Timisoara, Romania, September 24-27, 2016}, publisher = {{IEEE}}, year = {2016}, url = {https://ieeexplore.ieee.org/xpl/conhome/7827704/proceeding}, isbn = {978-1-5090-5707-8}, timestamp = {Wed, 16 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/synasc/2016.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/PanLTPZJRRR16, author = {Xinghao Pan and Maximilian Lam and Stephen Tu and Dimitris S. Papailiopoulos and Ce Zhang and Michael I. Jordan and Kannan Ramchandran and Christopher R{\'{e}} and Benjamin Recht}, title = {{CYCLADES:} Conflict-free Asynchronous Machine Learning}, journal = {CoRR}, volume = {abs/1605.09721}, year = {2016}, url = {http://arxiv.org/abs/1605.09721}, eprinttype = {arXiv}, eprint = {1605.09721}, timestamp = {Tue, 12 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/PanLTPZJRRR16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/TuRVR16, author = {Stephen Tu and Rebecca Roelofs and Shivaram Venkataraman and Benjamin Recht}, title = {Large Scale Kernel Learning using Block Coordinate Descent}, journal = {CoRR}, volume = {abs/1602.05310}, year = {2016}, url = {http://arxiv.org/abs/1602.05310}, eprinttype = {arXiv}, eprint = {1602.05310}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/TuRVR16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcsc/KusetogullariSL15, author = {Huseyin Kusetogullari and Md. Haidar Sharif and Mark S. Leeson and Turgay {\c{C}}elik}, title = {A Reduced Uncertainty-Based Hybrid Evolutionary Algorithm for Solving Dynamic Shortest-Path Routing Problem}, journal = {J. Circuits Syst. Comput.}, volume = {24}, number = {5}, pages = {1550067:1--1550067:42}, year = {2015}, url = {https://doi.org/10.1142/S021812661550067X}, doi = {10.1142/S021812661550067X}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jcsc/KusetogullariSL15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jocnet/ZhuPLMWPCTFWWE15, author = {Jiannan Zhu and Stephan Pachnicke and Mirko Lawin and Stephen Mayne and Adrian Wonfor and Richard V. Penty and Rosie Cush and Richard Turner and Paul Firth and Mike J. Wale and Ian H. White and J{\"{o}}rg{-}Peter Elbers}, title = {First Demonstration of a {WDM-PON} System Using Full C-band Tunable {SFP+} Transceiver Modules [Invited]}, journal = {{JOCN}}, volume = {7}, number = {1}, pages = {A28--A36}, year = {2015}, url = {https://doi.org/10.1364/jocn.7.000a28}, doi = {10.1364/JOCN.7.000A28}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jocnet/ZhuPLMWPCTFWWE15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/midm/WilsonFTGCYZ15, author = {Carlene Wilson and Ingrid H. K. Flight and Deborah Turnbull and Tess Gregory and Stephen R. Cole and Graeme P. Young and Ian T. Zajac}, title = {A randomised controlled trial of personalised decision support delivered via the internet for bowel cancer screening with a faecal occult blood test: the effects of tailoring of messages according to social cognitive variables on participation}, journal = {{BMC} Medical Informatics Decis. Mak.}, volume = {15}, pages = {25}, year = {2015}, url = {https://doi.org/10.1186/s12911-015-0147-5}, doi = {10.1186/S12911-015-0147-5}, timestamp = {Mon, 26 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/midm/WilsonFTGCYZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/ChiuYZMPNTR15, author = {Tsu{-}Pei Chiu and Lin Yang and Tianyin Zhou and Bradley J. Main and Stephen C. J. Parker and Sergey V. Nuzhdin and Thomas D. Tullius and Remo Rohs}, title = {GBshape: a genome browser database for {DNA} shape annotations}, journal = {Nucleic Acids Res.}, volume = {43}, number = {Database-Issue}, pages = {103--109}, year = {2015}, url = {https://doi.org/10.1093/nar/gku977}, doi = {10.1093/NAR/GKU977}, timestamp = {Sun, 17 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/ChiuYZMPNTR15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/neuroimage/EichnerCCMTSW15, author = {Cornelius Eichner and Stephen F. Cauley and Julien Cohen{-}Adad and Harald E. M{\"{o}}ller and Robert Turner and Kawin Setsompop and Lawrence L. Wald}, title = {Real diffusion-weighted {MRI} enabling true signal averaging and increased diffusion contrast}, journal = {NeuroImage}, volume = {122}, pages = {373--384}, year = {2015}, url = {https://doi.org/10.1016/j.neuroimage.2015.07.074}, doi = {10.1016/J.NEUROIMAGE.2015.07.074}, timestamp = {Wed, 19 May 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/neuroimage/EichnerCCMTSW15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/spl/TuYVZPS15, author = {Liyun Tu and Dan Yang and Jared Vicory and Xiaohong Zhang and Stephen M. Pizer and Martin Andreas Styner}, title = {Fitting Skeletal Object Models Using Spherical Harmonics Based Template Warping}, journal = {{IEEE} Signal Process. Lett.}, volume = {22}, number = {12}, pages = {2269--2273}, year = {2015}, url = {https://doi.org/10.1109/LSP.2015.2476366}, doi = {10.1109/LSP.2015.2476366}, timestamp = {Sat, 30 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/spl/TuYVZPS15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/te/ScottCLSTSG15, author = {Michael James Scott and Steve Counsell and Stanislao Lauria and Stephen Swift and Allan Tucker and Martin J. Shepperd and Gheorghita Ghinea}, title = {Enhancing Practice and Achievement in Introductory Programming With a Robot Olympics}, journal = {{IEEE} Trans. Educ.}, volume = {58}, number = {4}, pages = {249--254}, year = {2015}, url = {https://doi.org/10.1109/TE.2014.2382567}, doi = {10.1109/TE.2014.2382567}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/te/ScottCLSTSG15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmi/MenzeJBKFKBPSWL15, author = {Bjoern H. Menze and Andr{\'{a}}s Jakab and Stefan Bauer and Jayashree Kalpathy{-}Cramer and Keyvan Farahani and Justin S. Kirby and Yuliya Burren and Nicole Porz and Johannes Slotboom and Roland Wiest and Levente Lanczi and Elizabeth R. Gerstner and Marc{-}Andr{\'{e}} Weber and Tal Arbel and Brian B. Avants and Nicholas Ayache and Patricia Buendia and D. Louis Collins and Nicolas Cordier and Jason J. Corso and Antonio Criminisi and Tilak Das and Herve Delingette and {\c{C}}agatay Demiralp and Christopher R. Durst and Michel Dojat and Senan Doyle and Joana Festa and Florence Forbes and Ezequiel Geremia and Ben Glocker and Polina Golland and Xiaotao Guo and Andac Hamamci and Khan M. Iftekharuddin and Raj Jena and Nigel M. John and Ender Konukoglu and Danial Lashkari and Jos{\'{e}} Antonio Mariz and Raphael Meier and S{\'{e}}rgio Pereira and Doina Precup and Stephen J. Price and Tammy Riklin Raviv and Syed M. S. Reza and Michael T. Ryan and Duygu Sarikaya and Lawrence H. Schwartz and Hoo{-}Chang Shin and Jamie Shotton and Carlos A. Silva and Nuno J. Sousa and Nagesh K. Subbanna and G{\'{a}}bor Sz{\'{e}}kely and Thomas J. Taylor and Owen M. Thomas and Nicholas J. Tustison and G{\"{o}}zde B. {\"{U}}nal and Flor Vasseur and Max Wintermark and Dong Hye Ye and Liang Zhao and Binsheng Zhao and Darko Zikic and Marcel Prastawa and Mauricio Reyes and Koen Van Leemput}, title = {The Multimodal Brain Tumor Image Segmentation Benchmark {(BRATS)}}, journal = {{IEEE} Trans. Medical Imaging}, volume = {34}, number = {10}, pages = {1993--2024}, year = {2015}, url = {https://doi.org/10.1109/TMI.2014.2377694}, doi = {10.1109/TMI.2014.2377694}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tmi/MenzeJBKFKBPSWL15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tocs/PellauerPAAACFG15, author = {Michael Pellauer and Angshuman Parashar and Michael Adler and Bushra Ahsan and Randy L. Allmon and Neal Clayton Crago and Kermin Fleming and Mohit Gambhir and Aamer Jaleel and Tushar Krishna and Daniel Lustig and Stephen Maresh and Vladimir Pavlov and Rachid Rayess and Antonia Zhai and Joel S. Emer}, title = {Efficient Control and Communication Paradigms for Coarse-Grained Spatial Architectures}, journal = {{ACM} Trans. Comput. Syst.}, volume = {33}, number = {3}, pages = {10:1--10:32}, year = {2015}, url = {https://doi.org/10.1145/2754930}, doi = {10.1145/2754930}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tocs/PellauerPAAACFG15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tomacs/LiCTLDG15, author = {Zengxiang Li and Wentong Cai and Stephen John Turner and Xiaorong Li and Ta Nguyen Binh Duong and Rick Siow Mong Goh}, title = {Adaptive Resource Provisioning Mechanism in VEEs for Improving Performance of HLA-Based Simulations}, journal = {{ACM} Trans. Model. Comput. Simul.}, volume = {26}, number = {1}, pages = {1:1--1:25}, year = {2015}, url = {https://doi.org/10.1145/2717309}, doi = {10.1145/2717309}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tomacs/LiCTLDG15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tpds/TanTGTW15, author = {Wen Jun Tan and Wai Teng Tang and Rick Siow Mong Goh and Stephen John Turner and Weng{-}Fai Wong}, title = {A Code Generation Framework for Targeting Optimized Library Calls for Multiple Platforms}, journal = {{IEEE} Trans. Parallel Distributed Syst.}, volume = {26}, number = {7}, pages = {1789--1799}, year = {2015}, url = {https://doi.org/10.1109/TPDS.2014.2329494}, doi = {10.1109/TPDS.2014.2329494}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tpds/TanTGTW15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tpds/TangTGTW15, author = {Wai Teng Tang and Wen Jun Tan and Rick Siow Mong Goh and Stephen John Turner and Weng{-}Fai Wong}, title = {A Family of Bit-Representation-Optimized Formats for Fast Sparse Matrix-Vector Multiplication on the {GPU}}, journal = {{IEEE} Trans. Parallel Distributed Syst.}, volume = {26}, number = {9}, pages = {2373--2385}, year = {2015}, url = {https://doi.org/10.1109/TPDS.2014.2357437}, doi = {10.1109/TPDS.2014.2357437}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tpds/TangTGTW15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/adaEurope/PinhoMMT15, author = {Lu{\'{\i}}s Miguel Pinho and Brad Moore and Stephen Michell and S. Tucker Taft}, editor = {Juan Antonio de la Puente and Tullio Vardanega}, title = {An Execution Model for Fine-Grained Parallelism in Ada}, booktitle = {Reliable Software Technologies - Ada-Europe 2015 - 20th Ada-Europe International Conference on Reliable Software Technologies, Madrid Spain, June 22-26, 2015, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {9111}, pages = {196--211}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-319-19584-1\_13}, doi = {10.1007/978-3-319-19584-1\_13}, timestamp = {Tue, 14 May 2019 10:00:50 +0200}, biburl = {https://dblp.org/rec/conf/adaEurope/PinhoMMT15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amia/ManiCOMUB15, author = {Subramani Mani and Daniel Cannon and Tudor I. Oprea and Stephen L. Mathias and Oleg Ursu and Cristian Bologa}, title = {Protein Drug Target Prioritization for Illumination}, booktitle = {{AMIA} 2015, American Medical Informatics Association Annual Symposium, San Francisco, CA, USA, November 14-18, 2015}, publisher = {{AMIA}}, year = {2015}, url = {https://knowledge.amia.org/59310-amia-1.2741865/t001-1.2745946/f001-1.2745947/2247351-1.2746059/2248806-1.2746056}, timestamp = {Wed, 17 Apr 2024 11:47:40 +0200}, biburl = {https://dblp.org/rec/conf/amia/ManiCOMUB15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amia/SandorST15, author = {Nicolae L. Sandor and Stephen Skentzos and Alexander Turchin}, title = {Canary - a Graphic User Interface to a Heuristic {NLP} Engine}, booktitle = {{AMIA} 2015, American Medical Informatics Association Annual Symposium, San Francisco, CA, USA, November 14-18, 2015}, publisher = {{AMIA}}, year = {2015}, url = {https://knowledge.amia.org/59310-amia-1.2741865/t005-1.2744350/f005-1.2744351/2248348-1.2744622/2244203-1.2744619}, timestamp = {Wed, 17 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amia/SandorST15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amia/TuluALOEP15, author = {Bengisu Tulu and Emmanuel Agu and Stephenie C. Lemon and Jessica Oleski and Martinus Evans and Sherry Pagoto}, title = {Smart Coach: {A} Problem-Solving Mobile App to Support Weight Loss Management}, booktitle = {{AMIA} 2015, American Medical Informatics Association Annual Symposium, San Francisco, CA, USA, November 14-18, 2015}, publisher = {{AMIA}}, year = {2015}, url = {https://knowledge.amia.org/59310-amia-1.2741865/t005-1.2744350/f005-1.2744351/2247766-1.2744472/2247987-1.2744469}, timestamp = {Wed, 17 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amia/TuluALOEP15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amia/WarrenJBST15, author = {Judith J. Warren and Stephen B. Johnson and Suzanne Austin Boren and Stuart M. Speedie and G{\"{u}}nter Tusch}, title = {Health Informatics Graduate Program Accreditation: {CAHIIM} Process and Standards Update}, booktitle = {{AMIA} 2015, American Medical Informatics Association Annual Symposium, San Francisco, CA, USA, November 14-18, 2015}, publisher = {{AMIA}}, year = {2015}, url = {https://knowledge.amia.org/59310-amia-1.2741865/t003-1.2745834/f003-1.2745835/2248640-1.2745842/2248831-1.2745839}, timestamp = {Wed, 17 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amia/WarrenJBST15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/chi/KonradBCTNDPW15, author = {Artie Konrad and Victoria Bellotti and Nicole Crenshaw and Simon Tucker and Les Nelson and Honglu Du and Peter Pirolli and Steve Whittaker}, editor = {Bo Begole and Jinwoo Kim and Kori Inkpen and Woontack Woo}, title = {Finding the Adaptive Sweet Spot: Balancing Compliance and Achievement in Automated Stress Reduction}, booktitle = {Proceedings of the 33rd Annual {ACM} Conference on Human Factors in Computing Systems, {CHI} 2015, Seoul, Republic of Korea, April 18-23, 2015}, pages = {3829--3838}, publisher = {{ACM}}, year = {2015}, url = {https://doi.org/10.1145/2702123.2702512}, doi = {10.1145/2702123.2702512}, timestamp = {Mon, 11 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/chi/KonradBCTNDPW15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/date/WartelKGBSTQLMB15, author = {Franck Wartel and Leonidas Kosmidis and Adriana Gogonel and Andrea Baldovin and Zo{\"{e}} R. Stephenson and Benoit Triquet and Eduardo Qui{\~{n}}ones and Code Lo and Enrico Mezzetti and Ian Broster and Jaume Abella and Liliana Cucu{-}Grosjean and Tullio Vardanega and Francisco J. Cazorla}, editor = {Wolfgang Nebel and David Atienza}, title = {Timing analysis of an avionics case study on complex hardware/software platforms}, booktitle = {Proceedings of the 2015 Design, Automation {\&} Test in Europe Conference {\&} Exhibition, {DATE} 2015, Grenoble, France, March 9-13, 2015}, pages = {397--402}, publisher = {{ACM}}, year = {2015}, url = {http://dl.acm.org/citation.cfm?id=2755843}, timestamp = {Mon, 09 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/date/WartelKGBSTQLMB15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/ZhaoCT15, author = {Mingbi Zhao and Wentong Cai and Stephen John Turner}, title = {Evaluation of Crowd Models in Low Density Scenarios Using Real-World Crowd Data}, booktitle = {19th {IEEE/ACM} International Symposium on Distributed Simulation and Real Time Applications, {DS-RT} 2015, Chengdu, China, October 14-16, 2015}, pages = {1--9}, publisher = {{IEEE} Computer Society}, year = {2015}, url = {https://doi.org/10.1109/DS-RT.2015.25}, doi = {10.1109/DS-RT.2015.25}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dsrt/ZhaoCT15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eScience/WoodmanHTDW15, author = {Simon Woodman and Hugo Hiden and Mark Turner and Stephen Dowsland and Paul Watson}, title = {Monitoring of Upper Limb Rehabilitation and Recovery after Stroke: An Architecture for a Cloud-Based Therapy Platform}, booktitle = {11th {IEEE} International Conference on e-Science, e-Science 2015, Munich, Germany, August 31 - September 4, 2015}, pages = {381--390}, publisher = {{IEEE} Computer Society}, year = {2015}, url = {https://doi.org/10.1109/eScience.2015.29}, doi = {10.1109/ESCIENCE.2015.29}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/eScience/WoodmanHTDW15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ecoc/EllisPTSMKIPFGL15, author = {Andrew D. Ellis and Ian D. Phillips and Mingming Tan and Marc F. C. Stephens and Mary E. McCarthy and M. A. Z. Al Kahteeb and Md. Asif Iqbal and Andreas Perentos and Simon Fabbri and Vladimir Gordienko and Domani{\c{c}} Lavery and Gabriele Liga and M. G. Saavedra and Robert Maher and Stelios Sygletos and Paul Harper and Nick J. Doran and Polina Bayvel and Sergey K. Turitsyn}, title = {Enhanced superchannel transmission using phase conjugation}, booktitle = {European Conference on Optical Communication, {ECOC} 2015, Valencia, Spain, September 27 - October 1, 2015}, pages = {1--3}, publisher = {{IEEE}}, year = {2015}, url = {https://doi.org/10.1109/ECOC.2015.7341993}, doi = {10.1109/ECOC.2015.7341993}, timestamp = {Mon, 02 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ecoc/EllisPTSMKIPFGL15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/fie/TurnerASF15, author = {Stephen W. Turner and Mark Allison and Zahid A. Syed and Michael Farmer}, title = {Towards a flipped cyber classroom to facilitate active learning strategies}, booktitle = {2015 {IEEE} Frontiers in Education Conference, {FIE} 2015, El Paso, TX, USA, October 21-24, 2015}, pages = {1--4}, publisher = {{IEEE} Computer Society}, year = {2015}, url = {https://doi.org/10.1109/FIE.2015.7344136}, doi = {10.1109/FIE.2015.7344136}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/fie/TurnerASF15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccS/TezaurTPSP15, author = {Irina K. Tezaur and Raymond S. Tuminaro and Mauro Perego and Andrew G. Salinger and Stephen F. Price}, editor = {Slawomir Koziel and Leifur {\TH}. Leifsson and Michael Lees and Valeria V. Krzhizhanovskaya and Jack J. Dongarra and Peter M. A. Sloot}, title = {On the Scalability of the Albany/FELIX first-order Stokes Approximation ice Sheet Solver for Large-Scale Simulations of the Greenland and Antarctic ice Sheets}, booktitle = {Proceedings of the International Conference on Computational Science, {ICCS} 2015, Computational Science at the Gates of Nature, Reykjav{\'{\i}}k, Iceland, 1-3 June, 2015, 2014}, series = {Procedia Computer Science}, volume = {51}, pages = {2026--2035}, publisher = {Elsevier}, year = {2015}, url = {https://doi.org/10.1016/j.procs.2015.05.467}, doi = {10.1016/J.PROCS.2015.05.467}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iccS/TezaurTPSP15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/memsys/JogKKPBCKKD15, author = {Adwait Jog and Onur Kayiran and Tuba Kesten and Ashutosh Pattnaik and Evgeny Bolotin and Niladrish Chatterjee and Stephen W. Keckler and Mahmut T. Kandemir and Chita R. Das}, editor = {Bruce L. Jacob}, title = {Anatomy of {GPU} Memory System for Multi-Application Execution}, booktitle = {Proceedings of the 2015 International Symposium on Memory Systems, {MEMSYS} 2015, Washington DC, DC, USA, October 5-8, 2015}, pages = {223--234}, publisher = {{ACM}}, year = {2015}, url = {https://doi.org/10.1145/2818950.2818979}, doi = {10.1145/2818950.2818979}, timestamp = {Fri, 13 Nov 2020 09:24:44 +0100}, biburl = {https://dblp.org/rec/conf/memsys/JogKKPBCKKD15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/miccai/PaniaguaZOAGNE15, author = {Beatriz Paniagua and Dzenan Zukic and Ricardo Ortiz and Stephen R. Aylward and Brent Golden and Tung Nguyen and Andinet Enquobahrie}, editor = {Cristian A. Linte and Ziv Yaniv and Pascal Fallavollita}, title = {Ultrasound-Guided Navigation System for Orthognathic Surgery}, booktitle = {Augmented Environments for Computer-Assisted Interventions - 10th International Workshop, {AE-CAI} 2015 Held in Conjunction with {MICCAI} 2015, Munich, Germany, October 9, 2015, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {9365}, pages = {1--10}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-319-24601-7\_1}, doi = {10.1007/978-3-319-24601-7\_1}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miccai/PaniaguaZOAGNE15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/miip/TuSVPPYP15, author = {Liyun Tu and Martin Styner and Jared Vicory and Beatriz Paniagua and Juan{-}Carlos Prieto and Dan Yang and Stephen M. Pizer}, editor = {S{\'{e}}bastien Ourselin and Martin Andreas Styner}, title = {Skeletal shape correspondence via entropy minimization}, booktitle = {Medical Imaging 2015: Image Processing, Orlando, Florida, USA, February 24-26, 2015}, series = {{SPIE} Proceedings}, volume = {9413}, pages = {94130U}, publisher = {{SPIE}}, year = {2015}, url = {https://doi.org/10.1117/12.2081245}, doi = {10.1117/12.2081245}, timestamp = {Thu, 06 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miip/TuSVPPYP15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ndss/BostPTG15, author = {Raphael Bost and Raluca Ada Popa and Stephen Tu and Shafi Goldwasser}, title = {Machine Learning Classification over Encrypted Data}, booktitle = {22nd Annual Network and Distributed System Security Symposium, {NDSS} 2015, San Diego, California, USA, February 8-11, 2015}, publisher = {The Internet Society}, year = {2015}, url = {https://www.ndss-symposium.org/ndss2015/machine-learning-classification-over-encrypted-data}, timestamp = {Mon, 01 Feb 2021 08:42:14 +0100}, biburl = {https://dblp.org/rec/conf/ndss/BostPTG15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ofc/PachnickeMQSSZW15, author = {Stephan Pachnicke and Stephen Mayne and B. Quemeneur and D. Sayles and H. Schwuchow and Jiannan Zhu and Adrian Wonfor and P. Marx and Mirko Lawin and M. Fellhofer and Richard Turner and P. Neuber and M. Dietrich and Mike J. Wale and Richard V. Penty and Ian H. White and J{\"{o}}rg{-}Peter Elbers}, title = {Field demonstration of a tunable {WDM-PON} system with novel {SFP+} modules and centralized wavelength control}, booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2015, Los Angeles, CA, USA, March 22-26, 2015}, pages = {1--3}, publisher = {{IEEE}}, year = {2015}, url = {https://doi.org/10.1364/OFC.2015.M2A.6}, doi = {10.1364/OFC.2015.M2A.6}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ofc/PachnickeMQSSZW15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/LiCT15, author = {Xiaosong Li and Wentong Cai and Stephen John Turner}, editor = {Simon J. E. Taylor and Navonil Mustafee and Young{-}Jun Son}, title = {Cloning Agent-based Simulation on {GPU}}, booktitle = {Proceedings of the 3rd {ACM} Conference on SIGSIM-Principles of Advanced Discrete Simulation, London, United Kingdom, June 10 - 12, 2015}, pages = {173--182}, publisher = {{ACM}}, year = {2015}, url = {https://doi.org/10.1145/2769458.2769470}, doi = {10.1145/2769458.2769470}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/LiCT15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/percom/TuptukH15, author = {Nilufer Tuptuk and Stephen Hailes}, title = {Covert channel attacks in pervasive computing}, booktitle = {2015 {IEEE} International Conference on Pervasive Computing and Communications, PerCom 2015, St. Louis, MO, USA, 23-27 March, 2015}, pages = {236--242}, publisher = {{IEEE} Computer Society}, year = {2015}, url = {https://doi.org/10.1109/PERCOM.2015.7146534}, doi = {10.1109/PERCOM.2015.7146534}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/percom/TuptukH15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rtss/PinhoMMT15, author = {Lu{\'{\i}}s Miguel Pinho and Brad Moore and Stephen Michell and S. Tucker Taft}, title = {Real-Time Support in the Proposal for Fine-Grained Parallelism in Ada}, booktitle = {2015 {IEEE} Real-Time Systems Symposium, {RTSS} 2015, San Antonio, Texas, USA, December 1-4, 2015}, pages = {374}, publisher = {{IEEE} Computer Society}, year = {2015}, url = {https://doi.org/10.1109/RTSS.2015.43}, doi = {10.1109/RTSS.2015.43}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/rtss/PinhoMMT15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:books/sp/15/TuckerLCS15, author = {Allan Tucker and Yuanxi Li and Stefano Ceccon and Stephen Swift}, editor = {Arjen Hommersom and Peter J. F. Lucas}, title = {Trajectories Through the Disease Process: Cross Sectional and Longitudinal Studies}, booktitle = {Foundations of Biomedical Knowledge Representation - Methods and Applications}, series = {Lecture Notes in Computer Science}, volume = {9521}, pages = {189--205}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-319-28007-3\_12}, doi = {10.1007/978-3-319-28007-3\_12}, timestamp = {Sat, 30 Sep 2023 09:32:43 +0200}, biburl = {https://dblp.org/rec/books/sp/15/TuckerLCS15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/synasc/2015, editor = {Laura Kov{\'{a}}cs and Viorel Negru and Tetsuo Ida and Tudor Jebelean and Dana Petcu and Stephen M. Watt and Daniela Zaharie}, title = {17th International Symposium on Symbolic and Numeric Algorithms for Scientific Computing, {SYNASC} 2015, Timisoara, Romania, September 21-24, 2015}, publisher = {{IEEE} Computer Society}, year = {2015}, url = {https://ieeexplore.ieee.org/xpl/conhome/7425657/proceeding}, isbn = {978-1-5090-0461-4}, timestamp = {Wed, 16 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/synasc/2015.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/WeirREAPVMFPPSV15, author = {Phil Weir and Dominic Reuter and Roland Ellerweg and Tuomas Alhonnoro and Mika Pollari and Philip Voglreiter and Panchatcharam Mariappan and Ronan Flanagan and Chang{-}Sub Park and Stephen J. Payne and Elmar Staerk and Peter Voigt and Michael Moche and Marina Kolesnik}, title = {Go-Smart: Web-based Computational Modeling of Minimally Invasive Cancer Treatments}, journal = {CoRR}, volume = {abs/1511.03418}, year = {2015}, url = {http://arxiv.org/abs/1511.03418}, eprinttype = {arXiv}, eprint = {1511.03418}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/WeirREAPVMFPPSV15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/artmed/SacchiTCGS14, author = {Lucia Sacchi and Allan Tucker and Steve Counsell and David Garway{-}Heath and Stephen Swift}, title = {Improving predictive models of glaucoma severity by incorporating quality indicators}, journal = {Artif. Intell. Medicine}, volume = {60}, number = {2}, pages = {103--112}, year = {2014}, url = {https://doi.org/10.1016/j.artmed.2013.12.002}, doi = {10.1016/J.ARTMED.2013.12.002}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/artmed/SacchiTCGS14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cce/JonesBTZ14, author = {Dustin Jones and Debangsu Bhattacharyya and Richard Turton and Stephen E. Zitney}, title = {Plant-wide control system design: Primary controlled variable selection}, journal = {Comput. Chem. Eng.}, volume = {71}, pages = {220--234}, year = {2014}, url = {https://doi.org/10.1016/j.compchemeng.2014.08.004}, doi = {10.1016/J.COMPCHEMENG.2014.08.004}, timestamp = {Mon, 18 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cce/JonesBTZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cce/JonesBTZ14a, author = {Dustin Jones and Debangsu Bhattacharyya and Richard Turton and Stephen E. Zitney}, title = {Plant-wide control system design: Secondary controlled variable selection}, journal = {Comput. Chem. Eng.}, volume = {71}, pages = {253--262}, year = {2014}, url = {https://doi.org/10.1016/j.compchemeng.2014.08.007}, doi = {10.1016/J.COMPCHEMENG.2014.08.007}, timestamp = {Mon, 18 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cce/JonesBTZ14a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/dhq/SturmT14, author = {Sean Sturm and Stephen Francis Turner}, title = {Digital Caricature}, journal = {Digit. Humanit. Q.}, volume = {8}, number = {3}, year = {2014}, url = {http://www.digitalhumanities.org/dhq/vol/8/3/000182/000182.html}, timestamp = {Wed, 12 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/dhq/SturmT14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ejc/StephensTZ14, author = {D. Christopher Stephens and Thomas W. Tucker and Xiaoya Zha}, title = {Representativity of Cayley maps}, journal = {Eur. J. Comb.}, volume = {39}, pages = {207--222}, year = {2014}, url = {https://doi.org/10.1016/j.ejc.2013.12.006}, doi = {10.1016/J.EJC.2013.12.006}, timestamp = {Fri, 12 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ejc/StephensTZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/iet-wss/MatikoBT14, author = {Joseph W. Matiko and Stephen P. Beeby and John Tudor}, title = {Real time emotion detection within a wireless sensor network and its impact on power consumption}, journal = {{IET} Wirel. Sens. Syst.}, volume = {4}, number = {4}, pages = {183--190}, year = {2014}, url = {https://doi.org/10.1049/iet-wss.2014.0056}, doi = {10.1049/IET-WSS.2014.0056}, timestamp = {Fri, 18 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/iet-wss/MatikoBT14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijitpm/IskinDNB14, author = {Ibrahim Iskin and Tugrul U. Daim and Stephen Noble and Angie Baltz}, title = {Approaching {IT} Automation Decisions using Analytic Hierarchy Process {(AHP)}}, journal = {Int. J. Inf. Technol. Proj. Manag.}, volume = {5}, number = {1}, pages = {77--89}, year = {2014}, url = {https://doi.org/10.4018/ijitpm.2014010107}, doi = {10.4018/IJITPM.2014010107}, timestamp = {Thu, 01 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijitpm/IskinDNB14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jos/AydtCT14, author = {Heiko Aydt and Wentong Cai and Stephen John Turner}, title = {Dynamic specialization for symbiotic simulation-based operational decision support using the evolutionary computing modelling language {(ECML)}}, journal = {J. Simulation}, volume = {8}, number = {2}, pages = {105--114}, year = {2014}, url = {https://doi.org/10.1057/jos.2013.15}, doi = {10.1057/JOS.2013.15}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jos/AydtCT14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/micro/KecklerT14, author = {Stephen W. Keckler and Dean M. Tullsen}, title = {2014 International Symposium on Computer Architecture Influential Paper Award; 2014 Maurice Wilkes Award Given to Ravi Rajwar}, journal = {{IEEE} Micro}, volume = {34}, number = {6}, pages = {95--97}, year = {2014}, url = {https://doi.org/10.1109/MM.2014.91}, doi = {10.1109/MM.2014.91}, timestamp = {Sat, 20 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/micro/KecklerT14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/WangSZWHCSGB14, author = {Yanli Wang and Tugba O. Suzek and Jian Zhang and Jiyao Wang and Siqian He and Tiejun Cheng and Benjamin A. Shoemaker and Asta Gindulyte and Stephen H. Bryant}, title = {PubChem BioAssay: 2014 update}, journal = {Nucleic Acids Res.}, volume = {42}, number = {Database-Issue}, pages = {1075--1082}, year = {2014}, url = {https://doi.org/10.1093/nar/gkt978}, doi = {10.1093/NAR/GKT978}, timestamp = {Sun, 17 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/WangSZWHCSGB14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nature/HoJLALISMTAPGKR14, author = {Joshua Wing Kei Ho and Youngsook L. Jung and Tao Liu and Burak Han Alver and Soohyun Lee and Kohta Ikegami and Kyung{-}Ah Sohn and Aki Minoda and Michael Y. Tolstorukov and Alex Appert and Stephen C. J. Parker and Tingting Gu and Anshul Kundaje and Nicole C. Riddle and Eric Bishop and Thea A. Egelhofer and Sheng'en Shawn Hu and Artyom A. Alekseyenko and Andreas Rechtsteiner and Dalal Asker and Jason A. Belsky and Sarah K. Bowman and Q. Brent Chen and Ron A.{-}J. Chen and Daniel S. Day and Yan Dong and Andrea C. Dose and Xikun Duan and Charles B. Epstein and Sevinc Ercan and Elise A. Feingold and Francesco Ferrari and Jacob M. Garrigues and Nils Gehlenborg and Peter J. Good and Psalm Haseley and Daniel He and Moritz Herrmann and Michael M. Hoffman and Tess E. Jeffers and Peter V. Kharchenko and Paulina Kolasinska{-}Zwierz and Chitra V. Kotwaliwale and Nischay Kumar and Sasha A. Langley and Erica Larschan and Isabel Latorre and Maxwell W. Libbrecht and Xueqiu Lin and Richard Park and Michael J. Pazin and Hoang N. Pham and Annette Plachetka and Bo Qin and Yuri B. Schwartz and Noam Shoresh and Przemyslaw Stempor and Anne Vielle and Chengyang Wang and Christina M. Whittle and Huiling Xue and Robert E. Kingston and Ju Han Kim and Bradley E. Bernstein and Abby F. Dernburg and Vincenzo Pirrotta and Mitzi I. Kuroda and William S. Noble and Thomas D. Tullius and Manolis Kellis and David M. MacAlpine and Susan Strome and Sarah C. R. Elgin and Xiaole Shirley Liu and Jason D. Lieb and Julie Ahringer and Gary H. Karpen and Peter J. Park}, title = {Comparative analysis of metazoan chromatin organization Open}, journal = {Nat.}, volume = {512}, number = {7515}, pages = {449--452}, year = {2014}, url = {https://doi.org/10.1038/nature13415}, doi = {10.1038/NATURE13415}, timestamp = {Tue, 12 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nature/HoJLALISMTAPGKR14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/simpra/LiCT14, author = {Zengxiang Li and Wentong Cai and Stephen John Turner}, title = {Un-identical federate replication structure for improving performance of HLA-based simulations}, journal = {Simul. Model. Pract. Theory}, volume = {48}, pages = {112--128}, year = {2014}, url = {https://doi.org/10.1016/j.simpat.2014.06.016}, doi = {10.1016/J.SIMPAT.2014.06.016}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/simpra/LiCT14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tec/LonesFTCSST14, author = {Michael A. Lones and Luis A. Fuente and Alexander P. Turner and Leo S. D. Caves and Susan Stepney and Stephen L. Smith and Andy M. Tyrrell}, title = {Artificial Biochemical Networks: Evolving Dynamical Systems to Control Dynamical Systems}, journal = {{IEEE} Trans. Evol. Comput.}, volume = {18}, number = {2}, pages = {145--166}, year = {2014}, url = {https://doi.org/10.1109/TEVC.2013.2243732}, doi = {10.1109/TEVC.2013.2243732}, timestamp = {Thu, 23 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tec/LonesFTCSST14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cgames/AlskheliwiJLPS14, author = {Turki Alskheliwi and Carol Jim and Khalid Lateef and Stephen Penn and Ahmed Salem}, title = {Applying game theory rules to enhance decision support systems in credit and financial applications}, booktitle = {Computer Games: AI, Animation, Mobile, Multimedia, Educational and Serious Games, {CGAMES} 2014, Louisville, KY, USA, July 28-30, 2014}, pages = {1--10}, publisher = {{IEEE} Computer Society}, year = {2014}, url = {https://doi.org/10.1109/CGames.2014.6934138}, doi = {10.1109/CGAMES.2014.6934138}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cgames/AlskheliwiJLPS14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/chi/TurnbullZSHWSMJ14, author = {Douglas R. Turnbull and Justin A. Zupnick and Kristofer B. Stensland and Andrew R. Horwitz and Alexander J. Wolf and Alexander E. Spirgel and Stephen P. Meyerhofer and Thorsten Joachims}, editor = {Matt Jones and Philippe A. Palanque and Albrecht Schmidt and Tovi Grossman}, title = {Using personalized radio to enhance local music discovery}, booktitle = {{CHI} Conference on Human Factors in Computing Systems, CHI'14, Toronto, ON, Canada - April 26 - May 01, 2014, Extended Abstracts}, pages = {2023--2028}, publisher = {{ACM}}, year = {2014}, url = {https://doi.org/10.1145/2559206.2581246}, doi = {10.1145/2559206.2581246}, timestamp = {Mon, 08 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/chi/TurnbullZSHWSMJ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/LiCT14, author = {Xiaosong Li and Wentong Cai and Stephen John Turner}, title = {Efficient Neighbor Searching for Agent-Based Simulation on {GPU}}, booktitle = {18th {IEEE/ACM} International Symposium on Distributed Simulation and Real Time Applications, {DS-RT} 2014, Toulouse, France, October 1-3, 2014}, pages = {87--96}, publisher = {{IEEE} Computer Society}, year = {2014}, url = {https://doi.org/10.1109/DS-RT.2014.19}, doi = {10.1109/DS-RT.2014.19}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dsrt/LiCT14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ecoc/SygletosMFSSPGS14, author = {Stelios Sygletos and Mary E. McCarthy and Simon Fabbri and Mariia Sorokina and Marc F. C. Stephens and Ian D. Phillips and Elias G. Giacoumidis and Naoise Mac Suibhne and Paul Harper and Nick J. Doran and Sergei K. Turitsyn and Andrew D. Ellis}, title = {Multichannel regeneration of dual quadrature signals}, booktitle = {The European Conference on Optical Communication, {ECOC} 2014, Cannes, France, September 21-25, 2014}, pages = {1--3}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/ECOC.2014.6964110}, doi = {10.1109/ECOC.2014.6964110}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ecoc/SygletosMFSSPGS14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/gecco/LonesADTJS14, author = {Michael A. Lones and Jane E. Alty and Philippa Duggan{-}Carter and Andrew James Turner and D. R. Stuart Jamieson and Stephen L. Smith}, editor = {Dirk V. Arnold and Enrique Alba}, title = {Classification and characterisation of movement patterns during levodopa therapy for parkinson's disease}, booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} '14, Vancouver, BC, Canada, July 12-16, 2014, Companion Material Proceedings}, pages = {1321--1328}, publisher = {{ACM}}, year = {2014}, url = {https://doi.org/10.1145/2598394.2609852}, doi = {10.1145/2598394.2609852}, timestamp = {Wed, 13 Jul 2022 16:15:15 +0200}, biburl = {https://dblp.org/rec/conf/gecco/LonesADTJS14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/haisa/TuyikezeF14, author = {Tite Tuyikeze and Stephen Flowerday}, editor = {Nathan L. Clarke and Steven Furnell}, title = {Information Security Policy Development and Implementation: {A} Content Analysis Approach}, booktitle = {Eighth International Symposium on Human Aspects of Information Security {\&} Assurance, {HAISA} 2014 ,Plymouth, UK, July 8-9, 2014. Proceedings}, pages = {11--20}, publisher = {University of Plymouth}, year = {2014}, url = {http://www.cscan.org/openaccess/?paperid=233}, timestamp = {Tue, 06 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/haisa/TuyikezeF14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/MatikoBT14, author = {Joseph W. Matiko and Stephen P. Beeby and John Tudor}, title = {Fuzzy logic based emotion classification}, booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing, {ICASSP} 2014, Florence, Italy, May 4-9, 2014}, pages = {4389--4393}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/ICASSP.2014.6854431}, doi = {10.1109/ICASSP.2014.6854431}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/icassp/MatikoBT14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ida/CounsellTSFP14, author = {Steve Counsell and Allan Tucker and Stephen Swift and Guy Fitzgerald and Jason Peters}, editor = {Hendrik Blockeel and Matthijs van Leeuwen and Veronica Vinciotti}, title = {Comparing Pre-defined Software Engineering Metrics with Free-Text for the Prediction of Code 'Ripples'}, booktitle = {Advances in Intelligent Data Analysis {XIII} - 13th International Symposium, {IDA} 2014, Leuven, Belgium, October 30 - November 1, 2014. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {8819}, pages = {61--71}, publisher = {Springer}, year = {2014}, url = {https://doi.org/10.1007/978-3-319-12571-8\_6}, doi = {10.1007/978-3-319-12571-8\_6}, timestamp = {Mon, 03 Jan 2022 22:18:10 +0100}, biburl = {https://dblp.org/rec/conf/ida/CounsellTSFP14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isbi/KainzVSWMKPKSAHSFBMOPPRSMKSP14, author = {Bernhard Kainz and Philip Voglreiter and Michael Sereinigg and Iris Wiederstein{-}Grasser and Ursula Mayrhauser and Sonja Kostenbauer and Mika Pollari and Rostislav Khlebnikov and Matthias Seise and Tuomas Alhonnoro and Yrj{\"{o}} H{\"{a}}me and Daniel Seider and Ronan Flanagan and Claire Bost and Judith Muehl and David O'Neill and Tingying Peng and Stephen J. Payne and Daniel Rueckert and Dieter Schmalstieg and Michael Moche and Marina Kolesnik and Philipp Stiegler and Rupert H. Portugaller}, title = {High-resolution contrast enhanced multi-phase hepatic Computed Tomography data fromaporcine Radio-Frequency Ablation study}, booktitle = {{IEEE} 11th International Symposium on Biomedical Imaging, {ISBI} 2014, April 29 - May 2, 2014, Beijing, Chin, Beijing, China}, pages = {81--84}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/ISBI.2014.6867814}, doi = {10.1109/ISBI.2014.6867814}, timestamp = {Wed, 04 Oct 2023 17:01:25 +0200}, biburl = {https://dblp.org/rec/conf/isbi/KainzVSWMKPKSAHSFBMOPPRSMKSP14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/issre/TurkayMGC14, author = {Cagatay Turkay and Stephen Mason and Ilir Gashi and Bojan Cukic}, title = {Supporting Decision-Making for Biometric System Deployment through Visual Analysis}, booktitle = {25th {IEEE} International Symposium on Software Reliability Engineering Workshops, {ISSRE} Workshops, Naples, Italy, November 3-6, 2014}, pages = {347--352}, publisher = {{IEEE} Computer Society}, year = {2014}, url = {https://doi.org/10.1109/ISSREW.2014.78}, doi = {10.1109/ISSREW.2014.78}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/issre/TurkayMGC14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/jcdl/RoseT14, author = {Stephen Rose and Sandra Tuppen}, editor = {Ben Fields and Kevin R. Page}, title = {Prospects for a Big Data History of Music}, booktitle = {Proceedings of the 1st International Workshop on Digital Libraries for Musicology, DLfM@JCDL 2014, London, United Kingdom, September 12, 2014}, pages = {1--3}, publisher = {{ACM}}, year = {2014}, url = {https://doi.org/10.1145/2660168.2660177}, doi = {10.1145/2660168.2660177}, timestamp = {Tue, 06 Nov 2018 16:59:02 +0100}, biburl = {https://dblp.org/rec/conf/jcdl/RoseT14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ofc/LeKMGPSTDET14, author = {Son T. Le and Thavamaran Kanesan and Mary E. McCarthy and Elias G. Giacoumidis and Ian D. Phillips and Marc F. C. Stephens and Mingming Tan and Nick J. Doran and Andrew D. Ellis and S. K. Turitsyn}, title = {Experimental demonstration of data-dependent pilot-aided phase noise estimation for {CO-OFDM}}, booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2014, San Francisco, CA, USA, March 9-13, 2014}, pages = {1--3}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1364/OFC.2014.Tu3G.4}, doi = {10.1364/OFC.2014.TU3G.4}, timestamp = {Fri, 14 Apr 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ofc/LeKMGPSTDET14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ofc/PhillipsTSMGSRF14, author = {Ian D. Phillips and Mingming Tan and Marc F. C. Stephens and Mary E. McCarthy and Elias G. Giacoumidis and Stelios Sygletos and Pawel Rosa and Simon Fabbri and Son Thai Le and Thavamaran Kanesan and Sergey K. Turitsyn and Nick J. Doran and Paul Harper and Andrew D. Ellis}, title = {Exceeding the nonlinear-shannon limit using raman laser based amplification and optical phase conjugation}, booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2014, San Francisco, CA, USA, March 9-13, 2014}, pages = {1--3}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1364/OFC.2014.M3C.1}, doi = {10.1364/OFC.2014.M3C.1}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ofc/PhillipsTSMGSRF14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/osdi/ZhengTKL14, author = {Wenting Zheng and Stephen Tu and Eddie Kohler and Barbara Liskov}, editor = {Jason Flinn and Hank Levy}, title = {Fast Databases with Fast Durability and Recovery Through Multicore Parallelism}, booktitle = {11th {USENIX} Symposium on Operating Systems Design and Implementation, {OSDI} '14, Broomfield, CO, USA, October 6-8, 2014}, pages = {465--477}, publisher = {{USENIX} Association}, year = {2014}, url = {https://www.usenix.org/conference/osdi14/technical-sessions/presentation/zheng\_wenting}, timestamp = {Tue, 02 Feb 2021 08:05:58 +0100}, biburl = {https://dblp.org/rec/conf/osdi/ZhengTKL14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rss/SananTBSC14, author = {Siddharth Sanan and Stephen Tully and Andrea Bajo and Nabil Simaan and Howie Choset}, editor = {Dieter Fox and Lydia E. Kavraki and Hanna Kurniawati}, title = {Simultaneous Compliance and Registration Estimation for Robotic Surgery}, booktitle = {Robotics: Science and Systems X, University of California, Berkeley, USA, July 12-16, 2014}, year = {2014}, url = {http://www.roboticsproceedings.org/rss10/p51.html}, doi = {10.15607/RSS.2014.X.051}, timestamp = {Fri, 29 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/rss/SananTBSC14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigada/TaftMPM14, author = {S. Tucker Taft and Brad Moore and Lu{\'{\i}}s Miguel Pinho and Stephen Michell}, editor = {Michael B. Feldman and S. Tucker Taft}, title = {Safe parallel programming in ada with language extensions}, booktitle = {Proceedings of the 2014 {ACM} SIGAda annual conference on High integrity language technology, {HILT} 2014, Portland, Oregon, USA, October 18-21, 2014}, pages = {87--96}, publisher = {{ACM}}, year = {2014}, url = {https://doi.org/10.1145/2663171.2663181}, doi = {10.1145/2663171.2663181}, timestamp = {Fri, 02 Jun 2023 17:16:28 +0200}, biburl = {https://dblp.org/rec/conf/sigada/TaftMPM14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/uist/RetelnyRTLPRDVB14, author = {Daniela Retelny and S{\'{e}}bastien Robaszkiewicz and Alexandra To and Walter S. Lasecki and Jay Patel and Negar Rahmati and Tulsee Doshi and Melissa A. Valentine and Michael S. Bernstein}, editor = {Hrvoje Benko and Mira Dontcheva and Daniel Wigdor}, title = {Expert crowdsourcing with flash teams}, booktitle = {The 27th Annual {ACM} Symposium on User Interface Software and Technology, {UIST} '14, Honolulu, HI, USA, October 5-8, 2014}, pages = {75--85}, publisher = {{ACM}}, year = {2014}, url = {https://doi.org/10.1145/2642918.2647409}, doi = {10.1145/2642918.2647409}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/uist/RetelnyRTLPRDVB14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/asiasim/2014, editor = {Satoshi Tanaka and Kyoko Hasegawa and Rui Xu and Naohisa Sakamoto and Stephen John Turner}, title = {AsiaSim 2014 - 14th International Conference on Systems Simulation, Kitakyushu, Japan, October 26-30, 2014. Proceedings}, series = {Communications in Computer and Information Science}, volume = {474}, publisher = {Springer}, year = {2014}, url = {https://doi.org/10.1007/978-3-662-45289-9}, doi = {10.1007/978-3-662-45289-9}, isbn = {978-3-662-45288-2}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/asiasim/2014.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/synasc/2014, editor = {Franz Winkler and Viorel Negru and Tetsuo Ida and Tudor Jebelean and Dana Petcu and Stephen M. Watt and Daniela Zaharie}, title = {16th International Symposium on Symbolic and Numeric Algorithms for Scientific Computing, {SYNASC} 2014, Timisoara, Romania, September 22-25, 2014}, publisher = {{IEEE} Computer Society}, year = {2014}, url = {https://ieeexplore.ieee.org/xpl/conhome/7031476/proceeding}, isbn = {978-1-4799-8447-3}, timestamp = {Wed, 16 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/synasc/2014.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/iacr/BostPTG14, author = {Raphael Bost and Raluca Ada Popa and Stephen Tu and Shafi Goldwasser}, title = {Machine Learning Classification over Encrypted Data}, journal = {{IACR} Cryptol. ePrint Arch.}, pages = {331}, year = {2014}, url = {http://eprint.iacr.org/2014/331}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/iacr/BostPTG14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/biodb/MathiasHYZBUO13, author = {Stephen L. Mathias and Jarrett Hines{-}Kay and Jeremy J. Yang and Gergely Zahor{\'{a}}nszky{-}K{\"{o}}halmi and Cristian Bologa and Oleg Ursu and Tudor I. Oprea}, title = {The {CARLSBAD} Database: {A} Confederated Database of Chemical Bioactivities}, journal = {Database J. Biol. Databases Curation}, volume = {2013}, year = {2013}, url = {https://doi.org/10.1093/database/bat044}, doi = {10.1093/DATABASE/BAT044}, timestamp = {Thu, 13 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/biodb/MathiasHYZBUO13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cgf/JeongSHLTFHNYLP13, author = {Won{-}Ki Jeong and Jens Schneider and Axel Hansen and Manhee Lee and Stephen G. Turney and Beverly E. Faulkner{-}Jones and Jonathan L. Hecht and R. Najarian and Eric Yee and Jeff W. Lichtman and Hanspeter Pfister}, title = {A Collaborative Digital Pathology System for Multi-Touch Mobile and Desktop Computing Platforms}, journal = {Comput. Graph. Forum}, volume = {32}, number = {6}, pages = {227--242}, year = {2013}, url = {https://doi.org/10.1111/cgf.12137}, doi = {10.1111/CGF.12137}, timestamp = {Thu, 11 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cgf/JeongSHLTFHNYLP13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jamia/NorthCSCET13, author = {Frederick North and Sarah J. Crane and Robert J. Stroebel and Stephen S. Cha and Eric S. Edell and Sidna M. Tulledge{-}Scheitel}, title = {Research and applications: Patient-generated secure messages and eVisits on a patient portal: are patients at risk?}, journal = {J. Am. Medical Informatics Assoc.}, volume = {20}, number = {6}, pages = {1143--1149}, year = {2013}, url = {https://doi.org/10.1136/amiajnl-2012-001208}, doi = {10.1136/AMIAJNL-2012-001208}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jamia/NorthCSCET13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jbi/LiST13, author = {Yuanxi Li and Stephen Swift and Allan Tucker}, title = {Modelling and analysing the dynamics of disease progression from cross-sectional studies}, journal = {J. Biomed. Informatics}, volume = {46}, number = {2}, pages = {266--274}, year = {2013}, url = {https://doi.org/10.1016/j.jbi.2012.11.003}, doi = {10.1016/J.JBI.2012.11.003}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jbi/LiST13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jphonetics/GengTSMHRWPBCDD13, author = {Christian Geng and Alice Turk and James M. Scobbie and Cedric Macmartin and Philip Hoole and Korin Richmond and Alan Wrench and Marianne Pouplier and Ellen Gurman Bard and Ziggy Campbell and Catherine Dickie and Eddie Dubourg and William J. Hardcastle and Evia Kainada and Simon King and Robin J. Lickley and Satsuki Nakai and Steve Renals and Kevin White and Ronny Wiegand}, title = {Recording speech articulation in dialogue: Evaluating a synchronized double electromagnetic articulography setup}, journal = {J. Phonetics}, volume = {41}, number = {6}, pages = {421--431}, year = {2013}, url = {https://doi.org/10.1016/j.wocn.2013.07.002}, doi = {10.1016/J.WOCN.2013.07.002}, timestamp = {Mon, 29 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jphonetics/GengTSMHRWPBCDD13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/mansci/BaliBD13, author = {Turan G. Bali and Stephen J. Brown and K. Ozgur Demirtas}, title = {Do Hedge Funds Outperform Stocks and Bonds?}, journal = {Manag. Sci.}, volume = {59}, number = {8}, pages = {1887--1903}, year = {2013}, url = {https://doi.org/10.1287/mnsc.1120.1689}, doi = {10.1287/MNSC.1120.1689}, timestamp = {Tue, 30 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/mansci/BaliBD13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/neuroimage/BarchBHPSCGCDFNBHFBPSJSE13, author = {Deanna M. Barch and Gregory C. Burgess and Michael P. Harms and Steven E. Petersen and Bradley L. Schlaggar and Maurizio Corbetta and Matthew F. Glasser and Sandra W. Curtiss and Sachin Dixit and Cindy Feldt and Dan Nolan and Edward Bryant and Tucker Hartley and Owen Footer and James M. Bjork and Russell A. Poldrack and Steve M. Smith and Heidi Johansen{-}Berg and Abraham Z. Snyder and David C. Van Essen}, title = {Function in the human connectome: Task-fMRI and individual differences in behavior}, journal = {NeuroImage}, volume = {80}, pages = {169--189}, year = {2013}, url = {https://doi.org/10.1016/j.neuroimage.2013.05.033}, doi = {10.1016/J.NEUROIMAGE.2013.05.033}, timestamp = {Mon, 22 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/neuroimage/BarchBHPSCGCDFNBHFBPSJSE13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pvldb/DeBrabantPTSZ13, author = {Justin A. DeBrabant and Andrew Pavlo and Stephen Tu and Michael Stonebraker and Stanley B. Zdonik}, title = {Anti-Caching: {A} New Approach to Database Management System Architecture}, journal = {Proc. {VLDB} Endow.}, volume = {6}, number = {14}, pages = {1942--1953}, year = {2013}, url = {http://www.vldb.org/pvldb/vol6/p1942-debrabant.pdf}, doi = {10.14778/2556549.2556575}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pvldb/DeBrabantPTSZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pvldb/TuKMZ13, author = {Stephen Tu and M. Frans Kaashoek and Samuel Madden and Nickolai Zeldovich}, title = {Processing Analytical Queries over Encrypted Data}, journal = {Proc. {VLDB} Endow.}, volume = {6}, number = {5}, pages = {289--300}, year = {2013}, url = {http://www.vldb.org/pvldb/vol6/p289-tu.pdf}, doi = {10.14778/2535573.2488336}, timestamp = {Wed, 09 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pvldb/TuKMZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbcas/GuoGLTND13, author = {Liang Guo and Gareth S. Guvanasen and Xi Liu and Christopher Tuthill and T. Richard Nichols and Stephen P. DeWeerth}, title = {A PDMS-Based Integrated Stretchable Microelectrode Array (isMEA) for Neural and Muscular Surface Interfacing}, journal = {{IEEE} Trans. Biomed. Circuits Syst.}, volume = {7}, number = {1}, pages = {1--10}, year = {2013}, url = {https://doi.org/10.1109/TBCAS.2012.2192932}, doi = {10.1109/TBCAS.2012.2192932}, timestamp = {Wed, 17 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tbcas/GuoGLTND13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amcc/JonesBTZ13, author = {Dustin Jones and Debangsu Bhattacharyya and Richard Turton and Stephen E. Zitney}, title = {Optimal selection of primary controlled variables for an acid gas removal unit as part of an {IGCC} plant with {CO2} capture}, booktitle = {American Control Conference, {ACC} 2013, Washington, DC, USA, June 17-19, 2013}, pages = {5035--5040}, publisher = {{IEEE}}, year = {2013}, url = {https://doi.org/10.1109/ACC.2013.6580620}, doi = {10.1109/ACC.2013.6580620}, timestamp = {Sun, 08 Aug 2021 01:40:56 +0200}, biburl = {https://dblp.org/rec/conf/amcc/JonesBTZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amcc/PaulBTZ13, author = {Prokash Paul and Debangsu Bhattacharyya and Richard Turton and Stephen E. Zitney}, title = {Adaptive Kalman filter for estimation of environmental performance variables in an acid gas removal process}, booktitle = {American Control Conference, {ACC} 2013, Washington, DC, USA, June 17-19, 2013}, pages = {2717--2721}, publisher = {{IEEE}}, year = {2013}, url = {https://doi.org/10.1109/ACC.2013.6580245}, doi = {10.1109/ACC.2013.6580245}, timestamp = {Sun, 08 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amcc/PaulBTZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amia/MartinsTMRFLFSDG13, author = {Susana B. Martins and Samson W. Tu and Richard Martinello and Michael Rubin and Philip Foulis and Stephen Luther and Tyler Forbush and Matthew Scotch and Brad Doebbelling and Mary K. Goldstein}, title = {Creating a {MRSA} Ontology to Support Categorization of {MRSA} Infections}, booktitle = {{AMIA} 2013, American Medical Informatics Association Annual Symposium, Washington, DC, USA, November 16-20, 2013}, publisher = {{AMIA}}, year = {2013}, url = {https://knowledge.amia.org/amia-55142-a2013e-1.580047/t-06-1.582200/f-006-1.582201/a-333-1.582989/a-335-1.582983}, timestamp = {Wed, 17 Apr 2024 11:47:55 +0200}, biburl = {https://dblp.org/rec/conf/amia/MartinsTMRFLFSDG13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/JinTLZH13, author = {Jiangming Jin and Stephen John Turner and Bu{-}Sung Lee and Jianlong Zhong and Bingsheng He}, title = {Simulation of Information Propagation over Complex Networks: Performance Studies on Multi-GPU}, booktitle = {17th {IEEE/ACM} International Symposium on Distributed Simulation and Real Time Applications, {DS-RT} 2013, Delft, The Netherlands, October 30 - November 1, 2013}, pages = {179--188}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://doi.org/10.1109/DS-RT.2013.27}, doi = {10.1109/DS-RT.2013.27}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dsrt/JinTLZH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/ZhaoTC13, author = {Mingbi Zhao and Stephen John Turner and Wentong Cai}, title = {A Data-Driven Crowd Simulation Model Based on Clustering and Classification}, booktitle = {17th {IEEE/ACM} International Symposium on Distributed Simulation and Real Time Applications, {DS-RT} 2013, Delft, The Netherlands, October 30 - November 1, 2013}, pages = {125--134}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://doi.org/10.1109/DS-RT.2013.21}, doi = {10.1109/DS-RT.2013.21}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dsrt/ZhaoTC13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ecoop/AnsaloniKZBBT13, author = {Danilo Ansaloni and Stephen Kell and Yudi Zheng and Lubom{\'{\i}}r Bulej and Walter Binder and Petr Tuma}, editor = {Giuseppe Castagna}, title = {Enabling Modularity and Re-use in Dynamic Program Analysis Tools for the Java Virtual Machine}, booktitle = {{ECOOP} 2013 - Object-Oriented Programming - 27th European Conference, Montpellier, France, July 1-5, 2013. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {7920}, pages = {352--377}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-39038-8\_15}, doi = {10.1007/978-3-642-39038-8\_15}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ecoop/AnsaloniKZBBT13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/embc/MatikoBT13, author = {Joseph W. Matiko and Stephen P. Beeby and John Tudor}, title = {Real time eye blink noise removal from {EEG} signals using morphological component analysis}, booktitle = {35th Annual International Conference of the {IEEE} Engineering in Medicine and Biology Society, {EMBC} 2013, Osaka, Japan, July 3-7, 2013}, pages = {13--16}, publisher = {{IEEE}}, year = {2013}, url = {https://doi.org/10.1109/EMBC.2013.6609425}, doi = {10.1109/EMBC.2013.6609425}, timestamp = {Wed, 16 Oct 2019 14:14:50 +0200}, biburl = {https://dblp.org/rec/conf/embc/MatikoBT13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/enase/KamalakarED13, author = {Sunil Kamalakar and Stephen H. Edwards and Tung M. Dao}, editor = {Leszek A. Maciaszek and Joaquim Filipe}, title = {Automatically Generating Tests from Natural Language Descriptions of Software Behavior}, booktitle = {{ENASE} 2013 - Proceedings of the 8th International Conference on Evaluation of Novel Approaches to Software Engineering, Angers, France, 4-6 July, 2013}, pages = {238--245}, publisher = {SciTePress}, year = {2013}, url = {https://doi.org/10.5220/0004566002380245}, doi = {10.5220/0004566002380245}, timestamp = {Fri, 19 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/enase/KamalakarED13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/fie/TurnerU13, author = {Stephen W. Turner and Suleyman Uludag}, editor = {Randa L. Shehab and James J. Sluss and Deborah Anne Trytten}, title = {Student perceptions of cheating in online and traditional classes}, booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2013, Oklahoma City, Oklahoma, USA, October 23-26, 2013}, pages = {1131--1137}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://doi.org/10.1109/FIE.2013.6685007}, doi = {10.1109/FIE.2013.6685007}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/fie/TurnerU13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/gpce/MarekKZBBTASS13, author = {Luk{\'{a}}s Marek and Stephen Kell and Yudi Zheng and Lubom{\'{\i}}r Bulej and Walter Binder and Petr Tuma and Danilo Ansaloni and Aibek Sarimbekov and Andreas Sewe}, editor = {Jaakko J{\"{a}}rvi and Christian K{\"{a}}stner}, title = {ShadowVM: robust and comprehensive dynamic program analysis for the java platform}, booktitle = {Generative Programming: Concepts and Experiences, GPCE'13, Indianapolis, IN, {USA} - October 27 - 28, 2013}, pages = {105--114}, publisher = {{ACM}}, year = {2013}, url = {https://doi.org/10.1145/2517208.2517219}, doi = {10.1145/2517208.2517219}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/gpce/MarekKZBBTASS13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hotcloud/LeeLPTBSS13, author = {Jeongkeun Lee and Myungjin Lee and Lucian Popa and Yoshio Turner and Sujata Banerjee and Puneet Sharma and Bryan Stephenson}, editor = {Dilma Da Silva and George Porter}, title = {CloudMirror: Application-Aware Bandwidth Reservations in the Cloud}, booktitle = {5th {USENIX} Workshop on Hot Topics in Cloud Computing, HotCloud'13, San Jose, CA, USA, June 25-26, 2013}, publisher = {{USENIX} Association}, year = {2013}, url = {https://www.usenix.org/conference/hotcloud13/workshop-program/presentations/lee}, timestamp = {Tue, 09 Feb 2021 08:31:36 +0100}, biburl = {https://dblp.org/rec/conf/hotcloud/LeeLPTBSS13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icaisc/KeithW13, author = {Tureiti Keith and Stephen John Weddell}, editor = {Leszek Rutkowski and Marcin Korytkowski and Rafal Scherer and Ryszard Tadeusiewicz and Lotfi A. Zadeh and Jacek M. Zurada}, title = {The Echo State Network on the Graphics Processing Unit}, booktitle = {Artificial Intelligence and Soft Computing - 12th International Conference, {ICAISC} 2013, Zakopane, Poland, June 9-13, 2013, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {7894}, pages = {96--107}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-38658-9\_9}, doi = {10.1007/978-3-642-38658-9\_9}, timestamp = {Wed, 13 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icaisc/KeithW13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/CharlesAJCTD13, author = {Adam Charles and Ali Ahmed and Aditya Joshi and Stephen Conover and Christopher K. Turnes and Mark A. Davenport}, title = {Cleaning up toxic waste: Removing nefarious contributions to recommendation systems}, booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing, {ICASSP} 2013, Vancouver, BC, Canada, May 26-31, 2013}, pages = {6571--6575}, publisher = {{IEEE}}, year = {2013}, url = {https://doi.org/10.1109/ICASSP.2013.6638932}, doi = {10.1109/ICASSP.2013.6638932}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/icassp/CharlesAJCTD13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccabs/KinserLTRB13, author = {Jason M. Kinser and Stephen J. Lockett and Thomas Turbyville and Karlyne M. Reilly and John Beutler}, title = {Comparing analysis engines for generated micro-patterned, actin images}, booktitle = {{IEEE} 3rd International Conference on Computational Advances in Bio and Medical Sciences, {ICCABS} 2013, New Orleans, LA, USA, June 12-14, 2013}, pages = {1--5}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://doi.org/10.1109/ICCABS.2013.6629198}, doi = {10.1109/ICCABS.2013.6629198}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccabs/KinserLTRB13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/TullyKC13, author = {Stephen Tully and George Kantor and Howie Choset}, title = {Monocular feature-based periodic motion estimation for surgical guidance}, booktitle = {2013 {IEEE} International Conference on Robotics and Automation, Karlsruhe, Germany, May 6-10, 2013}, pages = {4403--4408}, publisher = {{IEEE}}, year = {2013}, url = {https://doi.org/10.1109/ICRA.2013.6631201}, doi = {10.1109/ICRA.2013.6631201}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/icra/TullyKC13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ida/PavlidisSTC13, author = {Stelios Pavlidis and Stephen Swift and Allan Tucker and Steve Counsell}, editor = {Allan Tucker and Frank H{\"{o}}ppner and Arno Siebes and Stephen Swift}, title = {The Modelling of Glaucoma Progression through the Use of Cellular Automata}, booktitle = {Advances in Intelligent Data Analysis {XII} - 12th International Symposium, {IDA} 2013, London, UK, October 17-19, 2013. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {8207}, pages = {322--332}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-41398-8\_28}, doi = {10.1007/978-3-642-41398-8\_28}, timestamp = {Tue, 14 May 2019 10:00:49 +0200}, biburl = {https://dblp.org/rec/conf/ida/PavlidisSTC13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/indin/StephensonAV13, author = {Zo{\"{e}} R. Stephenson and Jaume Abella and Tullio Vardanega}, title = {Supporting industrial use of probabilistic timing analysis with explicit argumentation}, booktitle = {11th {IEEE} International Conference on Industrial Informatics, {INDIN} 2013, Bochum, Germany, July 29-31, 2013}, pages = {734--740}, publisher = {{IEEE}}, year = {2013}, url = {https://doi.org/10.1109/INDIN.2013.6622975}, doi = {10.1109/INDIN.2013.6622975}, timestamp = {Tue, 18 May 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/indin/StephensonAV13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ipps/TangTKWKGTW13, author = {Wai Teng Tang and Wen Jun Tan and Ratna Krishnamoorthy and Yi Wen Wong and Shyh{-}Hao Kuo and Rick Siow Mong Goh and Stephen John Turner and Weng{-}Fai Wong}, title = {Optimizing and Auto-Tuning Iterative Stencil Loops for GPUs with the In-Plane Method}, booktitle = {27th {IEEE} International Symposium on Parallel and Distributed Processing, {IPDPS} 2013, Cambridge, MA, USA, May 20-24, 2013}, pages = {452--462}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://doi.org/10.1109/IPDPS.2013.79}, doi = {10.1109/IPDPS.2013.79}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ipps/TangTKWKGTW13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/LiCT13, author = {Xiaosong Li and Wentong Cai and Stephen John Turner}, editor = {Margaret L. Loper and Gabriel A. Wainer}, title = {{GPU} accelerated three-stage execution model for event-parallel simulation}, booktitle = {{SIGSIM} Principles of Advanced Discrete Simulation, {SIGSIM-PADS} '13, Montreal, QC, Canada, May 19-22, 2013}, pages = {57--66}, publisher = {{ACM}}, year = {2013}, url = {https://doi.org/10.1145/2486092.2486100}, doi = {10.1145/2486092.2486100}, timestamp = {Wed, 10 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/LiCT13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/LiLDCT13, author = {Zengxiang Li and Xiaorong Li and Ta Nguyen Binh Duong and Wentong Cai and Stephen John Turner}, editor = {Margaret L. Loper and Gabriel A. Wainer}, title = {Accelerating optimistic HLA-based simulations in virtual execution environments}, booktitle = {{SIGSIM} Principles of Advanced Discrete Simulation, {SIGSIM-PADS} '13, Montreal, QC, Canada, May 19-22, 2013}, pages = {211--220}, publisher = {{ACM}}, year = {2013}, url = {https://doi.org/10.1145/2486092.2486119}, doi = {10.1145/2486092.2486119}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/LiLDCT13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sc/TangTRWCKGTW13, author = {Wai Teng Tang and Wen Jun Tan and Rajarshi Ray and Yi Wen Wong and Weiguang Chen and Shyh{-}Hao Kuo and Rick Siow Mong Goh and Stephen John Turner and Weng{-}Fai Wong}, editor = {William Gropp and Satoshi Matsuoka}, title = {Accelerating sparse matrix-vector multiplication on GPUs using bit-representation-optimized schemes}, booktitle = {International Conference for High Performance Computing, Networking, Storage and Analysis, SC'13, Denver, CO, {USA} - November 17 - 21, 2013}, pages = {26:1--26:12}, publisher = {{ACM}}, year = {2013}, url = {https://doi.org/10.1145/2503210.2503234}, doi = {10.1145/2503210.2503234}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sc/TangTRWCKGTW13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sosp/TuZKLM13, author = {Stephen Tu and Wenting Zheng and Eddie Kohler and Barbara Liskov and Samuel Madden}, editor = {Michael Kaminsky and Mike Dahlin}, title = {Speedy transactions in multicore in-memory databases}, booktitle = {{ACM} {SIGOPS} 24th Symposium on Operating Systems Principles, {SOSP} '13, Farmington, PA, USA, November 3-6, 2013}, pages = {18--32}, publisher = {{ACM}}, year = {2013}, url = {https://doi.org/10.1145/2517349.2522713}, doi = {10.1145/2517349.2522713}, timestamp = {Wed, 09 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sosp/TuZKLM13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/supercomputer/PattersonPHMTCMB13, author = {Michael K. Patterson and Stephen W. Poole and Chung{-}Hsing Hsu and Don E. Maxwell and William Tschudi and Henry Coles and David J. Martinez and Natalie J. Bates}, editor = {Julian M. Kunkel and Thomas Ludwig and Hans Werner Meuer}, title = {TUE, a New Energy-Efficiency Metric Applied at ORNL's Jaguar}, booktitle = {Supercomputing - 28th International Supercomputing Conference, {ISC} 2013, Leipzig, Germany, June 16-20, 2013. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {7905}, pages = {372--382}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-38750-0\_28}, doi = {10.1007/978-3-642-38750-0\_28}, timestamp = {Tue, 14 May 2019 10:00:40 +0200}, biburl = {https://dblp.org/rec/conf/supercomputer/PattersonPHMTCMB13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/JinTLZH13, author = {Jiangming Jin and Stephen John Turner and Bu{-}Sung Lee and Jianlong Zhong and Bingsheng He}, title = {Simulation studies of viral advertisement diffusion on multi-GPU}, booktitle = {Winter Simulations Conference: Simulation Making Decisions in a Complex World, {WSC} 2013, Washington, DC, USA, December 8-11, 2013}, pages = {1592--1603}, publisher = {{IEEE}}, year = {2013}, url = {https://doi.org/10.1109/WSC.2013.6721542}, doi = {10.1109/WSC.2013.6721542}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/JinTLZH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:conf/dagstuhl/BroersenCEGGLPTTTS13, author = {Jan M. Broersen and Stephen Cranefield and Yehia Elrakaiby and Dov M. Gabbay and Davide Grossi and Emiliano Lorini and Xavier Parent and Leendert W. N. van der Torre and Luca Tummolini and Paolo Turrini and Fran{\c{c}}ois Schwarzentruber}, editor = {Giulia Andrighetto and Guido Governatori and Pablo Noriega and Leendert W. N. van der Torre}, title = {Normative Reasoning and Consequence}, booktitle = {Normative Multi-Agent Systems}, series = {Dagstuhl Follow-Ups}, volume = {4}, pages = {33--70}, publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik}, year = {2013}, url = {https://doi.org/10.4230/DFU.Vol4.12111.33}, doi = {10.4230/DFU.VOL4.12111.33}, timestamp = {Mon, 27 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dagstuhl/BroersenCEGGLPTTTS13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/asiasim/2013, editor = {Gary S. H. Tan and Gee Kin Yeo and Stephen John Turner and Yong Meng Teo}, title = {AsiaSim 2013 - 13th International Conference on Systems Simulation, Singapore, November 6-8, 2013. Proceedings}, series = {Communications in Computer and Information Science}, volume = {402}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-45037-2}, doi = {10.1007/978-3-642-45037-2}, isbn = {978-3-642-45036-5}, timestamp = {Fri, 26 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/asiasim/2013.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ida/2013, editor = {Allan Tucker and Frank H{\"{o}}ppner and Arno Siebes and Stephen Swift}, title = {Advances in Intelligent Data Analysis {XII} - 12th International Symposium, {IDA} 2013, London, UK, October 17-19, 2013. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {8207}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-41398-8}, doi = {10.1007/978-3-642-41398-8}, isbn = {978-3-642-41397-1}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ida/2013.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/synasc/2013, editor = {Nikolaj S. Bj{\o}rner and Viorel Negru and Tetsuo Ida and Tudor Jebelean and Dana Petcu and Stephen M. Watt and Daniela Zaharie}, title = {15th International Symposium on Symbolic and Numeric Algorithms for Scientific Computing, {SYNASC} 2013, Timisoara, Romania, September 23-26, 2013}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://ieeexplore.ieee.org/xpl/conhome/6820820/proceeding}, isbn = {978-1-4799-3035-7}, timestamp = {Thu, 14 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/synasc/2013.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rfc/rfc6916, author = {Roque Gagliano and Stephen T. Kent and Sean Turner}, title = {Algorithm Agility Procedure for the Resource Public Key Infrastructure {(RPKI)}}, journal = {{RFC}}, volume = {6916}, pages = {1--20}, year = {2013}, url = {https://doi.org/10.17487/RFC6916}, doi = {10.17487/RFC6916}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rfc/rfc6916.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rfc/rfc7093, author = {Sean Turner and Stephen T. Kent and James Manger}, title = {Additional Methods for Generating Key Identifiers Values}, journal = {{RFC}}, volume = {7093}, pages = {1--5}, year = {2013}, url = {https://doi.org/10.17487/RFC7093}, doi = {10.17487/RFC7093}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rfc/rfc7093.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@phdthesis{DBLP:phd/basesearch/Sachs12, author = {Stephen Sachs}, title = {Multigrid Methods applied to Fluid-Structure Interaction}, school = {{TU} Darmstadt, Germany}, year = {2012}, url = {http://tuprints.ulb.tu-darmstadt.de/2917/}, timestamp = {Wed, 20 Mar 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/phd/basesearch/Sachs12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/artmed/ZhuGTRD12, author = {Vivienne J. Zhu and Shaun J. Grannis and Wanzhu Tu and Marc B. Rosenman and Stephen M. Downs}, title = {Evaluation of a clinical decision support algorithm for patient-specific childhood immunization}, journal = {Artif. Intell. Medicine}, volume = {56}, number = {1}, pages = {51--57}, year = {2012}, url = {https://doi.org/10.1016/j.artmed.2012.04.004}, doi = {10.1016/J.ARTMED.2012.04.004}, timestamp = {Sun, 25 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/artmed/ZhuGTRD12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cmig/WongSTWMA12, author = {Kelvin Kian Loong Wong and Zhonghua Sun and Jiyuan Tu and Stephen G. Worthley and Jagannath Mazumdar and Derek Abbott}, title = {Medical image diagnostics based on computer-aided flow analysis using magnetic resonance images}, journal = {Comput. Medical Imaging Graph.}, volume = {36}, number = {7}, pages = {527--541}, year = {2012}, url = {https://doi.org/10.1016/j.compmedimag.2012.04.003}, doi = {10.1016/J.COMPMEDIMAG.2012.04.003}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cmig/WongSTWMA12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cor/ShakeriLTL12, author = {Mojtaba Shakeri and Malcolm Yoke Hean Low and Stephen John Turner and Eng Wah Lee}, title = {A robust two-phase heuristic algorithm for the truck scheduling problem in a resource-constrained crossdock}, journal = {Comput. Oper. Res.}, volume = {39}, number = {11}, pages = {2564--2577}, year = {2012}, url = {https://doi.org/10.1016/j.cor.2012.01.002}, doi = {10.1016/J.COR.2012.01.002}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cor/ShakeriLTL12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/esticas/YooTNLBSWGREC12, author = {Juhwan Yoo and Christopher K. Turnes and Eric B. Nakamura and Chi K. Le and Stephen Becker and Emilio A. Sovero and Michael B. Wakin and Michael C. Grant and Justin K. Romberg and Azita Emami{-}Neyestanak and Emmanuel J. Cand{\`{e}}s}, title = {A Compressed Sensing Parameter Extraction Platform for Radar Pulse Signal Acquisition}, journal = {{IEEE} J. Emerg. Sel. Topics Circuits Syst.}, volume = {2}, number = {3}, pages = {626--638}, year = {2012}, url = {https://doi.org/10.1109/JETCAS.2012.2214634}, doi = {10.1109/JETCAS.2012.2214634}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/esticas/YooTNLBSWGREC12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijrr/TullyKC12, author = {Stephen Tully and George Kantor and Howie Choset}, title = {A unified Bayesian framework for global localization and {SLAM} in hybrid metric/topological maps}, journal = {Int. J. Robotics Res.}, volume = {31}, number = {3}, pages = {271--288}, year = {2012}, url = {https://doi.org/10.1177/0278364911433617}, doi = {10.1177/0278364911433617}, timestamp = {Thu, 17 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijrr/TullyKC12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jot/ArzokySTC12, author = {Mahir Arzoky and Stephen Swift and Allan Tucker and James Cain}, title = {A Seeded Search for the Modularisation of Sequential Software Versions}, journal = {J. Object Technol.}, volume = {11}, number = {2}, pages = {6: 1--27}, year = {2012}, url = {https://doi.org/10.5381/jot.2012.11.2.a6}, doi = {10.5381/JOT.2012.11.2.A6}, timestamp = {Wed, 17 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jot/ArzokySTC12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/WangXSZWZHKDSBGB12, author = {Yanli Wang and Jewen Xiao and Tugba O. Suzek and Jian Zhang and Jiyao Wang and Zhigang Zhou and Lianyi Han and Karen Karapetyan and Svetlana Dracheva and Benjamin A. Shoemaker and Evan Bolton and Asta Gindulyte and Stephen H. Bryant}, title = {PubChem's BioAssay Database}, journal = {Nucleic Acids Res.}, volume = {40}, number = {Database-Issue}, pages = {400--412}, year = {2012}, url = {https://doi.org/10.1093/nar/gkr1132}, doi = {10.1093/NAR/GKR1132}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/nar/WangXSZWZHKDSBGB12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/neuroimage/LiGFZCYLDJZHZML12, author = {Kaiming Li and Lei Guo and Carlos Faraco and Dajiang Zhu and Hanbo Chen and Yixuan Yuan and Jinglei Lv and Fan Deng and Xi Jiang and Tuo Zhang and Xintao Hu and Degang Zhang and L. Stephen Miller and Tianming Liu}, title = {Visual analytics of brain networks}, journal = {NeuroImage}, volume = {61}, number = {1}, pages = {82--97}, year = {2012}, url = {https://doi.org/10.1016/j.neuroimage.2012.02.075}, doi = {10.1016/J.NEUROIMAGE.2012.02.075}, timestamp = {Thu, 07 Mar 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/neuroimage/LiGFZCYLDJZHZML12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/TurnerLW12, author = {Darren Turner and Arko Lucieer and Christopher S. Watson}, title = {An Automated Technique for Generating Georectified Mosaics from Ultra-High Resolution Unmanned Aerial Vehicle {(UAV)} Imagery, Based on Structure from Motion (SfM) Point Clouds}, journal = {Remote. Sens.}, volume = {4}, number = {5}, pages = {1392--1410}, year = {2012}, url = {https://doi.org/10.3390/rs4051392}, doi = {10.3390/RS4051392}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/TurnerLW12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/remotesensing/WallaceLWT12, author = {Luke Wallace and Arko Lucieer and Christopher S. Watson and Darren Turner}, title = {Development of a UAV-LiDAR System with Application to Forest Inventory}, journal = {Remote. Sens.}, volume = {4}, number = {6}, pages = {1519--1543}, year = {2012}, url = {https://doi.org/10.3390/rs4061519}, doi = {10.3390/RS4061519}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/remotesensing/WallaceLWT12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/siamam/ShipmanT12, author = {Stephen P. Shipman and Hairui Tu}, title = {Total Resonant Transmission and Reflection by Periodic Structures}, journal = {{SIAM} J. Appl. Math.}, volume = {72}, number = {1}, pages = {216--239}, year = {2012}, url = {https://doi.org/10.1137/110834196}, doi = {10.1137/110834196}, timestamp = {Mon, 26 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/siamam/ShipmanT12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tomacs/TaylorTSM12, author = {Simon J. E. Taylor and Stephen John Turner and Steffen Stra{\ss}burger and Navonil Mustafee}, title = {Bridging the gap: {A} standards-based approach to {OR/MS} distributed simulation}, journal = {{ACM} Trans. Model. Comput. Simul.}, volume = {22}, number = {4}, pages = {18:1--18:23}, year = {2012}, url = {https://doi.org/10.1145/2379810.2379811}, doi = {10.1145/2379810.2379811}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tomacs/TaylorTSM12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/wc/BaykasKCKKPRSS12, author = {Tuncer Baykas and Mika Kasslin and Mark Cummings and Hyunduk Kang and Joe Kwak and Richard Paine and Alex Reznik and Rashid A. Saeed and Stephen J. Shellhammer}, title = {Developing a standard for {TV} white space coexistence: technical challenges and solution approaches}, journal = {{IEEE} Wirel. Commun.}, volume = {19}, number = {1}, pages = {10--22}, year = {2012}, url = {https://doi.org/10.1109/MWC.2012.6155872}, doi = {10.1109/MWC.2012.6155872}, timestamp = {Fri, 09 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/wc/BaykasKCKKPRSS12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/asiasim/TanTA12, author = {Wen Jun Tan and Stephen John Turner and Heiko Aydt}, editor = {Tianyuan Xiao and Lin Zhang and Minrui Fei}, title = {A Comparison of Multi-objective Evolutionary Algorithms for Simulation-Based Optimization}, booktitle = {AsiaSim 2012 - Asia Simulation Conference 2012, Shanghai, China, October 27-30, 2012. Proceedings, Part {III}}, series = {Communications in Computer and Information Science}, volume = {325}, pages = {60--72}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-34387-2\_8}, doi = {10.1007/978-3-642-34387-2\_8}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/asiasim/TanTA12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/europar/WongDTTDGKTW12, author = {Yi Wen Wong and Tomasz Dubrownik and Wai Teng Tang and Wen Jun Tan and Rubing Duan and Rick Siow Mong Goh and Shyh{-}Hao Kuo and Stephen John Turner and Weng{-}Fai Wong}, editor = {Christos Kaklamanis and Theodore S. Papatheodorou and Paul G. Spirakis}, title = {Tulipse: {A} Visualization Framework for User-Guided Parallelization}, booktitle = {Euro-Par 2012 Parallel Processing - 18th International Conference, Euro-Par 2012, Rhodes Island, Greece, August 27-31, 2012. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {7484}, pages = {4--15}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-32820-6\_3}, doi = {10.1007/978-3-642-32820-6\_3}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/europar/WongDTTDGKTW12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ewgdss/TurnerW12, author = {Simon Turner and Stephen Wilmott}, editor = {Jorge E. Hern{\'{a}}ndez and Shaofeng Liu and Boris Delibasic and Pascale Zarat{\'{e}} and F{\'{a}}tima C. C. Dargam and Rita A. Ribeiro}, title = {Decision Analysis in Magnox Limited: Developments in Techniques and Stakeholder Engagement Processes}, booktitle = {Decision Support Systems {II} - Recent Developments Applied to {DSS} Network Environments - Euro Working Group Workshop, {EWG-DSS} 2012, Liverpool, UK, April 12-13, 2012, and Vilnius, Lithuania, July 8-11, 2012, Revised Selected and Extended Papers}, series = {Lecture Notes in Business Information Processing}, volume = {164}, pages = {115--125}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-41077-2\_9}, doi = {10.1007/978-3-642-41077-2\_9}, timestamp = {Wed, 20 Sep 2023 13:32:42 +0200}, biburl = {https://dblp.org/rec/conf/ewgdss/TurnerW12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/fie/UludagKGTK12, author = {Suleyman Uludag and Murat Karakus and Evrim Guler and Stephen W. Turner and Afelete Kita}, editor = {Richard J. LeBlanc and Ann E. K. Sobel}, title = {Assessment of a frugal, virtual and green computing lab infrastructure of the future}, booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2012, Seattle, WA, USA, October 3-6, 2012}, pages = {1--6}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://doi.org/10.1109/FIE.2012.6462470}, doi = {10.1109/FIE.2012.6462470}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/fie/UludagKGTK12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpads/RajaseharanTTTKGW12, author = {Chandrasehar Rajaseharan and Wen Jun Tan and Wai Teng Tang and Stephen John Turner and Shyh{-}Hao Kuo and Rick Siow Mong Goh and Weng{-}Fai Wong}, title = {Automatic Refactoring of Legacy Fortran Code to the Array Slicing Notation}, booktitle = {18th {IEEE} International Conference on Parallel and Distributed Systems, {ICPADS} 2012, Singapore, December 17-19, 2012}, pages = {698--699}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://doi.org/10.1109/ICPADS.2012.101}, doi = {10.1109/ICPADS.2012.101}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icpads/RajaseharanTTTKGW12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/DeganiTZC12, author = {Amir Degani and Stephen Tully and Brett Zubiate and Howie Choset}, title = {Over-tube apparatus for increasing the capabilities of an articulated robotic probe}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2012, 14-18 May, 2012, St. Paul, Minnesota, {USA}}, pages = {3533--3534}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/ICRA.2012.6224668}, doi = {10.1109/ICRA.2012.6224668}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/icra/DeganiTZC12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/GongTKC12, author = {Chaohui Gong and Stephen Tully and George Kantor and Howie Choset}, title = {Multi-agent deterministic graph mapping via robot rendezvous}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2012, 14-18 May, 2012, St. Paul, Minnesota, {USA}}, pages = {1278--1283}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/ICRA.2012.6225274}, doi = {10.1109/ICRA.2012.6225274}, timestamp = {Mon, 22 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icra/GongTKC12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/TullyBKCS12, author = {Stephen Tully and Andrea Bajo and George Kantor and Howie Choset and Nabil Simaan}, title = {Constrained filtering with contact detection data for the localization and registration of continuum robots in flexible environments}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2012, 14-18 May, 2012, St. Paul, Minnesota, {USA}}, pages = {3388--3394}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/ICRA.2012.6225080}, doi = {10.1109/ICRA.2012.6225080}, timestamp = {Mon, 22 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icra/TullyBKCS12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ithet/GulerUKT12, author = {Evrim Guler and Suleyman Uludag and Murat Karakus and Stephen W. Turner}, title = {Virtualized lab infrastructure on a budget for various computing and engineering courses}, booktitle = {2012 International Conference on Information Technology Based Higher Education and Training, {ITHET} 2012, Istanbul, Turkey, June 21-23, 2012}, pages = {1--7}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/ITHET.2012.6246028}, doi = {10.1109/ITHET.2012.6246028}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ithet/GulerUKT12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ithet/KarakusUGTU12, author = {Murat Karakus and Suleyman Uludag and Evrim Guler and Stephen W. Turner and Ahmet Ugur}, title = {Teaching computing and programming fundamentals via App Inventor for Android}, booktitle = {2012 International Conference on Information Technology Based Higher Education and Training, {ITHET} 2012, Istanbul, Turkey, June 21-23, 2012}, pages = {1--8}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/ITHET.2012.6246020}, doi = {10.1109/ITHET.2012.6246020}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ithet/KarakusUGTU12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/miccai/XuLLXCAW12, author = {Yanwu Xu and Jiang Liu and Stephen Lin and Dong Xu and Carol Yim{-}lui Cheung and Tin Aung and Tien Yin Wong}, editor = {Nicholas Ayache and Herv{\'{e}} Delingette and Polina Golland and Kensaku Mori}, title = {Efficient Optic Cup Detection from Intra-image Learning with Retinal Structure Priors}, booktitle = {Medical Image Computing and Computer-Assisted Intervention - {MICCAI} 2012 - 15th International Conference, Nice, France, October 1-5, 2012, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {7510}, pages = {58--65}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-33415-3\_8}, doi = {10.1007/978-3-642-33415-3\_8}, timestamp = {Mon, 01 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miccai/XuLLXCAW12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/oopsla/ZhaoPYQWGOPMET12, author = {Haiping Zhao and Iain Proctor and Minghui Yang and Xin Qi and Mark Williams and Qi Gao and Guilherme Ottoni and Andrew Paroski and Scott MacVicar and Jason Evans and Stephen Tu}, editor = {Gary T. Leavens and Matthew B. Dwyer}, title = {The HipHop compiler for {PHP}}, booktitle = {Proceedings of the 27th Annual {ACM} {SIGPLAN} Conference on Object-Oriented Programming, Systems, Languages, and Applications, {OOPSLA} 2012, part of {SPLASH} 2012, Tucson, AZ, USA, October 21-25, 2012}, pages = {575--586}, publisher = {{ACM}}, year = {2012}, url = {https://doi.org/10.1145/2384616.2384658}, doi = {10.1145/2384616.2384658}, timestamp = {Sat, 21 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/oopsla/ZhaoPYQWGOPMET12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/LiTCT12, author = {Zengxiang Li and Xueyan Tang and Wentong Cai and Stephen John Turner}, title = {Fair and Efficient Dead Reckoning-Based Update Dissemination for Distributed Virtual Environments}, booktitle = {26th {ACM/IEEE/SCS} Workshop on Principles of Advanced and Distributed Simulation, {PADS} 2012, Zhangjiajie, China, July 15-19, 2012}, pages = {13--22}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://doi.org/10.1109/PADS.2012.18}, doi = {10.1109/PADS.2012.18}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/LiTCT12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tpcg/LongshawTF12, author = {Stephen M. Longshaw and Martin J. Turner and Emma Finch}, editor = {Hamish A. Carr and Silvester Czanner}, title = {Visualizing a Spherical Geological Discrete Element Model of Fault Evolution}, booktitle = {Theory and Practice of Computer Graphics, Rutherford, United Kingdom, 2012. Proceedings}, pages = {77--84}, publisher = {Eurographics Association}, year = {2012}, url = {https://doi.org/10.2312/LocalChapterEvents/TPCG/TPCG12/077-084}, doi = {10.2312/LOCALCHAPTEREVENTS/TPCG/TPCG12/077-084}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/tpcg/LongshawTF12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:journals/procedia/JinTLZH12, author = {Jiangming Jin and Stephen John Turner and Bu{-}Sung Lee and Jianlong Zhong and Bingsheng He}, editor = {Hesham H. Ali and Yong Shi and Deepak Khazanchi and Michael Lees and G. Dick van Albada and Jack J. Dongarra and Peter M. A. Sloot}, title = {{HPC} Simulations of Information Propagation Over Social Networks}, booktitle = {Proceedings of the International Conference on Computational Science, {ICCS} 2012, Omaha, Nebraska, USA, 4-6 June, 2012}, series = {Procedia Computer Science}, volume = {9}, pages = {292--301}, publisher = {Elsevier}, year = {2012}, url = {https://doi.org/10.1016/j.procs.2012.04.031}, doi = {10.1016/J.PROCS.2012.04.031}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/procedia/JinTLZH12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/synasc/2012, editor = {Andrei Voronkov and Viorel Negru and Tetsuo Ida and Tudor Jebelean and Dana Petcu and Stephen M. Watt and Daniela Zaharie}, title = {14th International Symposium on Symbolic and Numeric Algorithms for Scientific Computing, {SYNASC} 2012, Timisoara, Romania, September 26-29, 2012}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://ieeexplore.ieee.org/xpl/conhome/6480928/proceeding}, isbn = {978-1-4673-5026-6}, timestamp = {Wed, 16 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/synasc/2012.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/dsp/DavisHTB11, author = {Linda M. Davis and Stephen V. Hanly and Paul Tune and Sibi Raj Bhaskaran}, title = {Channel estimation and user selection in the {MIMO} broadcast channel}, journal = {Digit. Signal Process.}, volume = {21}, number = {5}, pages = {608--618}, year = {2011}, url = {https://doi.org/10.1016/j.dsp.2011.01.003}, doi = {10.1016/J.DSP.2011.01.003}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/dsp/DavisHTB11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijrr/SmithTBR11, author = {Stephen L. Smith and Jana Tumova and Calin Belta and Daniela Rus}, title = {Optimal path planning for surveillance with temporal-logic constraints}, journal = {Int. J. Robotics Res.}, volume = {30}, number = {14}, pages = {1695--1708}, year = {2011}, url = {https://doi.org/10.1177/0278364911417911}, doi = {10.1177/0278364911417911}, timestamp = {Thu, 17 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijrr/SmithTBR11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jocn/LairdFETRMGBSF11, author = {Angela R. Laird and P. Mickle Fox and Simon B. Eickhoff and Jessica A. Turner and Kimberly L. Ray and David Reese McKay and David C. Glahn and Christian F. Beckmann and Stephen M. Smith and Peter T. Fox}, title = {Behavioral Interpretations of Intrinsic Connectivity Networks}, journal = {J. Cogn. Neurosci.}, volume = {23}, number = {12}, pages = {4022--4037}, year = {2011}, url = {https://doi.org/10.1162/jocn\_a\_00077}, doi = {10.1162/JOCN\_A\_00077}, timestamp = {Mon, 22 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jocn/LairdFETRMGBSF11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/neuroimage/MillerSDJSBJCEVJATJM11, author = {Karla L. Miller and Charlotte J. Stagg and Gwena{\"{e}}lle Douaud and Sa{\^{a}}d Jbabdi and Stephen M. Smith and Timothy Edward John Behrens and Mark Jenkinson and Steven A. Chance and Margaret M. Esiri and Natalie L. Voets and Ned Jenkinson and Tipu Z. Aziz and Martin R. Turner and Heidi Johansen{-}Berg and Jennifer A. McNab}, title = {Diffusion imaging of whole, post-mortem human brains on a clinical {MRI} scanner}, journal = {NeuroImage}, volume = {57}, number = {1}, pages = {167--181}, year = {2011}, url = {https://doi.org/10.1016/j.neuroimage.2011.03.070}, doi = {10.1016/J.NEUROIMAGE.2011.03.070}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/neuroimage/MillerSDJSBJCEVJATJM11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ploscb/WilliamsTDWMBHLSHAKLTGVCF11, author = {Tim D. Williams and Nil Turan and Amer M. Diab and Huifeng Wu and Carolynn Mackenzie and Katie L. Bartie and Olga Hrydziuszko and Brett P. Lyons and Grant D. Stentiford and John M. Herbert and Joseph K. Abraham and Ioanna Katsiadaki and Michael J. Leaver and John B. Taggart and Stephen G. George and Mark R. Viant and Kevin J. Chipman and Francesco Falciani}, title = {Towards a System Level Understanding of Non-Model Organisms Sampled from the Environment: {A} Network Biology Approach}, journal = {PLoS Comput. Biol.}, volume = {7}, number = {8}, year = {2011}, url = {https://doi.org/10.1371/journal.pcbi.1002126}, doi = {10.1371/JOURNAL.PCBI.1002126}, timestamp = {Thu, 10 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ploscb/WilliamsTDWMBHLSHAKLTGVCF11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/presence/SmithCDCBPCTBBGHMWC11, author = {Cameron G. Smith and Nigel T. Crook and Simon Dobnik and Daniel Charlton and Johan Boye and Stephen G. Pulman and Ra{\'{u}}l Santos de la C{\'{a}}mara and Markku Turunen and David Benyon and Jay Bradley and Bj{\"{o}}rn Gamb{\"{a}}ck and Preben Hansen and Oli H. Mival and Nick Webb and Marc Cavazza}, title = {Interaction Strategies for an Affective Conversational Agent}, journal = {Presence Teleoperators Virtual Environ.}, volume = {20}, number = {5}, pages = {395--411}, year = {2011}, url = {https://doi.org/10.1162/PRES\_a\_00063}, doi = {10.1162/PRES\_A\_00063}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/presence/SmithCDCBPCTBBGHMWC11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/siamma/GustafsonP11, author = {Stephen Gustafson and Tuoc Van Phan}, title = {Stable Directions for Degenerate Excited States of Nonlinear Schr{\"{o}}dinger Equations}, journal = {{SIAM} J. Math. Anal.}, volume = {43}, number = {4}, pages = {1716--1758}, year = {2011}, url = {https://doi.org/10.1137/10079210X}, doi = {10.1137/10079210X}, timestamp = {Fri, 03 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/siamma/GustafsonP11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/siamsc/TuminaroBCDEFJKKKLMMSW11, author = {Ray Tuminaro and Michele Benzi and Xiao{-}Chuan Cai and Iain Duff and Howard C. Elman and Roland Freund and Kirk E. Jordan and Tim Kelley and David E. Keyes and Misha Elena Kilmer and Sven Leyffer and Tom Manteuffel and Steve F. McCormick and David J. Silvester and Homer F. Walker}, title = {Special Section: 2010 Copper Mountain Conference}, journal = {{SIAM} J. Sci. Comput.}, volume = {33}, number = {5}, pages = {2685}, year = {2011}, url = {https://doi.org/10.1137/SJOCE3000033000005002685000001}, doi = {10.1137/SJOCE3000033000005002685000001}, timestamp = {Mon, 26 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/siamsc/TuminaroBCDEFJKKKLMMSW11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tec/AydtTCLOA11, author = {Heiko Aydt and Stephen John Turner and Wentong Cai and Malcolm Yoke Hean Low and Yew{-}Soon Ong and Rassul Ayani}, title = {Toward an Evolutionary Computing Modeling Language}, journal = {{IEEE} Trans. Evol. Comput.}, volume = {15}, number = {2}, pages = {230--247}, year = {2011}, url = {https://doi.org/10.1109/TEVC.2010.2081368}, doi = {10.1109/TEVC.2010.2081368}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tec/AydtTCLOA11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tomacs/PanTCL11, author = {Ke Pan and Stephen John Turner and Wentong Cai and Zengxiang Li}, title = {A dynamic sort-based {DDM} matching algorithm for {HLA} applications}, journal = {{ACM} Trans. Model. Comput. Simul.}, volume = {21}, number = {3}, pages = {17:1--17:17}, year = {2011}, url = {https://doi.org/10.1145/1921598.1921601}, doi = {10.1145/1921598.1921601}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tomacs/PanTCL11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amcc/TulpuleYWR11, author = {Pinak Tulpule and Stephen Yurkovich and J. Wang and Giorgio Rizzoni}, title = {Hybrid large scale system model for a {DC} microgrid}, booktitle = {American Control Conference, {ACC} 2011, San Francisco, CA, USA, June 29 - July 1, 2011}, pages = {3899--3904}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/ACC.2011.5990841}, doi = {10.1109/ACC.2011.5990841}, timestamp = {Sun, 08 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amcc/TulpuleYWR11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/Turner11, author = {Stephen John Turner}, editor = {David J. Roberts and J. Mark Pullen and Georgios Theodoropoulos and Nick J. Avis}, title = {Symbiotic Simulation and Its Application to Complex Adaptive Systems}, booktitle = {15th {IEEE/ACM} International Symposium on Distributed Simulation and Real Time Applications, {DS-RT} 2011, Salford, United Kingdom, September 4-7, 2011}, pages = {3}, publisher = {{IEEE} Computer Society}, year = {2011}, url = {https://doi.org/10.1109/DS-RT.2011.36}, doi = {10.1109/DS-RT.2011.36}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dsrt/Turner11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hci/SakellariouCGTKC11, author = {Sophia Sakellariou and Vassilis Charissis and Stephen Grant and Janice Turner and Dianne Kelly and Chistodoulos Christomanos}, editor = {Randall Shumaker}, title = {Virtual Reality as Knowledge Enhancement Tool for Musculoskeletal Pathology}, booktitle = {Virtual and Mixed Reality - Systems and Applications - International Conference, Virtual and Mixed Reality 2011, Held as Part of {HCI} International 2011, Orlando, FL, USA, July 9-14, 2011, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {6774}, pages = {54--63}, publisher = {Springer}, year = {2011}, url = {https://doi.org/10.1007/978-3-642-22024-1\_7}, doi = {10.1007/978-3-642-22024-1\_7}, timestamp = {Sun, 25 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/hci/SakellariouCGTKC11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icbo/MungallABCCCCDEEGKILMMTTTTWH11, author = {Chris Mungall and David Anderson and Anita E. Bandrowski and Brian A. Canada and Andrew Chatr{-}aryamontri and Keith C. Cheng and P. Michael Conn and Kara Dolinski and Mark H. Ellisman and Janan T. Eppig and Jeffrey S. Grethe and Joseph W. Kemnitz and Shawn Iadonato and Stephen D. Larson and Charles Magness and Maryann E. Martone and Mike Tyers and Carlo Torniai and Olga G. Troyanskaya and Judith Turner and Monte Westerfield and Melissa A. Haendel}, editor = {Olivier Bodenreider and Maryann E. Martone and Alan Ruttenberg}, title = {An Ontology-Based Approach to Linking Model Organisms and Resources to Human Diseases}, booktitle = {Proceedings of the 2nd International Conference on Biomedical Ontology, Buffalo, NY, USA, July 26-30, 2011}, series = {{CEUR} Workshop Proceedings}, volume = {833}, publisher = {CEUR-WS.org}, year = {2011}, url = {https://ceur-ws.org/Vol-833/paper43.pdf}, timestamp = {Fri, 10 Mar 2023 16:22:24 +0100}, biburl = {https://dblp.org/rec/conf/icbo/MungallABCCCCDEEGKILMMTTTTWH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/TaoTKC11, author = {Tong Tao and Stephen Tully and George Kantor and Howie Choset}, title = {Incremental construction of the saturated-GVG for multi-hypothesis topological {SLAM}}, booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA} 2011, Shanghai, China, 9-13 May 2011}, pages = {3072--3077}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/ICRA.2011.5980524}, doi = {10.1109/ICRA.2011.5980524}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icra/TaoTKC11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icst/ArzokySTC11, author = {Mahir Arzoky and Stephen Swift and Allan Tucker and James Cain}, title = {Munch: An Efficient Modularisation Strategy to Assess the Degree of Refactoring on Sequential Source Code Checkings}, booktitle = {Fourth {IEEE} International Conference on Software Testing, Verification and Validation, {ICST} 2012, Berlin, Germany, 21-25 March, 2011, Workshop Proceedings}, pages = {422--429}, publisher = {{IEEE} Computer Society}, year = {2011}, url = {https://doi.org/10.1109/ICSTW.2011.87}, doi = {10.1109/ICSTW.2011.87}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icst/ArzokySTC11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iros/FuTKC11, author = {Yu Fu and Stephen Tully and George Kantor and Howie Choset}, title = {Monte Carlo Localization using 3D texture maps}, booktitle = {2011 {IEEE/RSJ} International Conference on Intelligent Robots and Systems, {IROS} 2011, San Francisco, CA, USA, September 25-30, 2011}, pages = {482--487}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/IROS.2011.6094843}, doi = {10.1109/IROS.2011.6094843}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/iros/FuTKC11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iros/TullyKC11, author = {Stephen Tully and George Kantor and Howie Choset}, title = {Inequality constrained Kalman filtering for the localization and registration of a surgical robot}, booktitle = {2011 {IEEE/RSJ} International Conference on Intelligent Robots and Systems, {IROS} 2011, San Francisco, CA, USA, September 25-30, 2011}, pages = {5147--5152}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/IROS.2011.6094750}, doi = {10.1109/IROS.2011.6094750}, timestamp = {Mon, 22 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iros/TullyKC11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iros/TullyKZC11, author = {Stephen Tully and George Kantor and Marco A. Zenati and Howie Choset}, title = {Shape estimation for image-guided surgery with a highly articulated snake robot}, booktitle = {2011 {IEEE/RSJ} International Conference on Intelligent Robots and Systems, {IROS} 2011, San Francisco, CA, USA, September 25-30, 2011}, pages = {1353--1358}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/IROS.2011.6094751}, doi = {10.1109/IROS.2011.6094751}, timestamp = {Mon, 22 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iros/TullyKZC11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isqed/TuanLKT11, author = {Tim Tuan and Austin Lesea and Chris Kingsley and Steven Trimberger}, title = {Analysis of within-die process variation in 65nm FPGAs}, booktitle = {Proceedings of the 12th International Symposium on Quality Electronic Design, {ISQED} 2011, Santa Clara, California, USA, 14-16 March 2011}, pages = {716--720}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/ISQED.2011.5770808}, doi = {10.1109/ISQED.2011.5770808}, timestamp = {Wed, 16 Oct 2019 14:14:55 +0200}, biburl = {https://dblp.org/rec/conf/isqed/TuanLKT11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mhci/BrewsterJMNRST11, author = {Stephen A. Brewster and Matt Jones and Roderick Murray{-}Smith and Amit Anil Nanavati and Nitendra Rajput and Albrecht Schmidt and Markku Turunen}, editor = {Markus Bylund and Oskar Juhlin and Ylva Fernaeus}, title = {We need to talk: rediscovering audio for universal access}, booktitle = {Proceedings of the 13th Conference on Human-Computer Interaction with Mobile Devices and Services, Mobile {HCI} 2011, Stockholm, Sweden, August 30 - September 2, 2011}, pages = {715--716}, publisher = {{ACM}}, year = {2011}, url = {https://doi.org/10.1145/2037373.2037494}, doi = {10.1145/2037373.2037494}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/mhci/BrewsterJMNRST11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/miccai/GongLCWYZGM11, author = {Zhaojin Gong and Jianfeng Lu and Jia Chen and Yaping Wang and Yixuan Yuan and Tuo Zhang and Lei Guo and L. Stephen Miller}, editor = {Tianming Liu and Dinggang Shen and Luis Ib{\'{a}}{\~{n}}ez and Xiaodong Tao}, title = {Ventricle Shape Analysis for Centenarians, Elderly Subjects, {MCI} and {AD} Patients}, booktitle = {Multimodal Brain Image Analysis, First International Workshop, {MBIA} 2011, Held in Conjunction with {MICCAI} 2011, Toronto, Canada, September 18, 2011. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {7012}, pages = {84--92}, publisher = {Springer}, year = {2011}, url = {https://doi.org/10.1007/978-3-642-24446-9\_11}, doi = {10.1007/978-3-642-24446-9\_11}, timestamp = {Mon, 19 Feb 2024 14:24:13 +0100}, biburl = {https://dblp.org/rec/conf/miccai/GongLCWYZGM11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/miccai/XuXLLCCAW11, author = {Yanwu Xu and Dong Xu and Stephen Lin and Jiang Liu and Jun Cheng and Carol Yim{-}lui Cheung and Tin Aung and Tien Yin Wong}, editor = {Gabor Fichtinger and Anne L. Martel and Terry M. Peters}, title = {Sliding Window and Regression Based Cup Detection in Digital Fundus Images for Glaucoma Diagnosis}, booktitle = {Medical Image Computing and Computer-Assisted Intervention - {MICCAI} 2011 - 14th International Conference, Toronto, Canada, September 18-22, 2011, Proceedings, Part {III}}, series = {Lecture Notes in Computer Science}, volume = {6893}, pages = {1--8}, publisher = {Springer}, year = {2011}, url = {https://doi.org/10.1007/978-3-642-23626-6\_1}, doi = {10.1007/978-3-642-23626-6\_1}, timestamp = {Mon, 01 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/miccai/XuXLLCCAW11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/psb/TurnerB11, author = {Stephen D. Turner and William S. Bush}, editor = {Russ B. Altman and A. Keith Dunker and Lawrence Hunter and Tiffany Murray and Teri E. Klein}, title = {Multivariate Analysis of Regulatory Snps: Empowering Personal Genomics by Considering Cis-Epistasis and Heterogeneity}, booktitle = {Biocomputing 2011: Proceedings of the Pacific Symposium, Kohala Coast, Hawaii, USA, 3-7 January 2011}, pages = {276--287}, publisher = {World Scientific Publishing}, year = {2011}, url = {http://psb.stanford.edu/psb-online/proceedings/psb11/turner.pdf}, timestamp = {Thu, 12 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/psb/TurnerB11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rivp/BasharatTSBLAP11, author = {Arslan Basharat and Wes Turner and Gillian Stephens and Benjamin Badillo and Rick Lumpkin and Patrick Andre and Amitha Perera}, editor = {Nasser Kehtarnavaz and Matthias F. Carlsohn}, title = {Tracking flow of leukocytes in blood for drug analysis}, booktitle = {Real-Time Image and Video Processing 2011, San Francisco Airport, CA, USA, January 24-25, 2011}, series = {{SPIE} Proceedings}, volume = {7871}, pages = {78710N}, publisher = {{SPIE}}, year = {2011}, url = {https://doi.org/10.1117/12.872509}, doi = {10.1117/12.872509}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/rivp/BasharatTSBLAP11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigcse/TurnerPEC11, author = {Scott A. Turner and Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and Stephen H. Edwards and Joseph Chase}, editor = {Thomas J. Cortina and Ellen Lowenfeld Walker and Laurie A. Smith King and David R. Musicant}, title = {Student attitudes and motivation for peer review in {CS2}}, booktitle = {Proceedings of the 42nd {ACM} technical symposium on Computer science education, {SIGCSE} 2011, Dallas, TX, USA, March 9-12, 2011}, pages = {347--352}, publisher = {{ACM}}, year = {2011}, url = {https://doi.org/10.1145/1953163.1953268}, doi = {10.1145/1953163.1953268}, timestamp = {Wed, 10 Mar 2021 13:17:16 +0100}, biburl = {https://dblp.org/rec/conf/sigcse/TurnerPEC11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigite/UludagKT11, author = {Suleyman Uludag and Murat Karakus and Stephen W. Turner}, editor = {Bryan S. Goda and Edward Sobiesk and Randy W. Connolly}, title = {Implementing {IT0/CS0} with scratch, app inventor forandroid, and lego mindstorms}, booktitle = {SIGITE' 11 {ACM} Special Interest Group for Information Technology Education Conference, West Point, NY, USA, October 20-22, 2011}, pages = {183--190}, publisher = {{ACM}}, year = {2011}, url = {https://doi.org/10.1145/2047594.2047645}, doi = {10.1145/2047594.2047645}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sigite/UludagKT11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/AydtTCG11, author = {Heiko Aydt and Stephen John Turner and Wentong Cai and Boon{-}Ping Gan}, editor = {S. Jain and Roy R. Creasey Jr. and Jan Himmelspach and K. Preston White and Michael C. Fu}, title = {Symbiotic simulation for optimisation of tool operations in semiconductor manufacturing}, booktitle = {Winter Simulation Conference 2011, WSC'11, Phoenix, AZ, USA, December 11-14, 2011}, pages = {2093--2104}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/WSC.2011.6147922}, doi = {10.1109/WSC.2011.6147922}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/AydtTCG11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/TaylorGMTKFKS11, author = {Simon J. E. Taylor and Mohammadmersad Ghorbani and Navonil Mustafee and Stephen John Turner and Tam{\'{a}}s Kiss and Daniel Farkas and Shane Kite and Steffen Stra{\ss}burger}, editor = {S. Jain and Roy R. Creasey Jr. and Jan Himmelspach and K. Preston White and Michael C. Fu}, title = {Distributed computing and modeling {\&} simulation: speeding up simulations and creating large models}, booktitle = {Winter Simulation Conference 2011, WSC'11, Phoenix, AZ, USA, December 11-14, 2011}, pages = {161--175}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/WSC.2011.6147748}, doi = {10.1109/WSC.2011.6147748}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/TaylorGMTKFKS11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/synasc/2011, editor = {Dongming Wang and Viorel Negru and Tetsuo Ida and Tudor Jebelean and Dana Petcu and Stephen M. Watt and Daniela Zaharie}, title = {13th International Symposium on Symbolic and Numeric Algorithms for Scientific Computing, {SYNASC} 2011, Timisoara, Romania, September 26-29, 2011}, publisher = {{IEEE} Computer Society}, year = {2011}, url = {https://ieeexplore.ieee.org/xpl/conhome/6168887/proceeding}, isbn = {978-1-4673-0207-4}, timestamp = {Tue, 19 Nov 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/synasc/2011.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/biodatamining/TurnerDR10, author = {Stephen D. Turner and Scott M. Dudek and Marylyn D. Ritchie}, title = {{ATHENA:} {A} knowledge-based hybrid backpropagation-grammatical evolution neural network algorithm for discovering epistasis among quantitative trait Loci}, journal = {BioData Min.}, volume = {3}, pages = {5}, year = {2010}, url = {https://doi.org/10.1186/1756-0381-3-5}, doi = {10.1186/1756-0381-3-5}, timestamp = {Wed, 01 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/biodatamining/TurnerDR10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ese/KitchenhamBTNLPB10, author = {Barbara A. Kitchenham and Pearl Brereton and Mark Turner and Mahmood Niazi and Stephen G. Linkman and Rialette Pretorius and David Budgen}, title = {Refining the systematic literature review process - two participant-observer case studies}, journal = {Empir. Softw. Eng.}, volume = {15}, number = {6}, pages = {618--653}, year = {2010}, url = {https://doi.org/10.1007/s10664-010-9134-8}, doi = {10.1007/S10664-010-9134-8}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ese/KitchenhamBTNLPB10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/imm/SchmalzelBRMTFF10, author = {John L. Schmalzel and Andrew Bracey and Stephen Rawls and Jon Morris and Mark Turowski and Richard Franzl and Fernando Figueroa}, title = {Smart sensor demonstration payload}, journal = {{IEEE} Instrum. Meas. Mag.}, volume = {13}, number = {5}, pages = {8--15}, year = {2010}, url = {https://doi.org/10.1109/MIM.2010.5585068}, doi = {10.1109/MIM.2010.5585068}, timestamp = {Sat, 19 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/imm/SchmalzelBRMTFF10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/infsof/KitchenhamPBBTNL10, author = {Barbara A. Kitchenham and Rialette Pretorius and David Budgen and Pearl Brereton and Mark Turner and Mahmood Niazi and Stephen G. Linkman}, title = {Systematic literature reviews in software engineering - {A} tertiary study}, journal = {Inf. Softw. Technol.}, volume = {52}, number = {8}, pages = {792--805}, year = {2010}, url = {https://doi.org/10.1016/j.infsof.2010.03.006}, doi = {10.1016/J.INFSOF.2010.03.006}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/infsof/KitchenhamPBBTNL10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcphy/LemieuxTSTTHA10, author = {Jean{-}Fran{\c{c}}ois Lemieux and L. Bruno Tremblay and Jan Sedl{\'{a}}cek and Paul F. Tupper and Stephen Thomas and David Huard and Jean{-}Pierre Auclair}, title = {Improving the numerical convergence of viscous-plastic sea ice models with the Jacobian-free Newton-Krylov method}, journal = {J. Comput. Phys.}, volume = {229}, number = {8}, pages = {2840--2852}, year = {2010}, url = {https://doi.org/10.1016/j.jcp.2009.12.011}, doi = {10.1016/J.JCP.2009.12.011}, timestamp = {Wed, 19 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jcphy/LemieuxTSTTHA10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jpdc/ChenTCTXL10, author = {Dan Chen and Stephen John Turner and Wentong Cai and Georgios K. Theodoropoulos and Muzhou Xiong and Michael Lees}, title = {Synchronization in federation community networks}, journal = {J. Parallel Distributed Comput.}, volume = {70}, number = {2}, pages = {144--159}, year = {2010}, url = {https://doi.org/10.1016/j.jpdc.2009.10.006}, doi = {10.1016/J.JPDC.2009.10.006}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jpdc/ChenTCTXL10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/lht/MutulaK10, author = {Stephen Mutula and Tumelo Kalaote}, title = {Open source software deployment in the public sector: a review of Botswana and South Africa}, journal = {Libr. Hi Tech}, volume = {28}, number = {1}, pages = {63--80}, year = {2010}, url = {https://doi.org/10.1108/07378831011026698}, doi = {10.1108/07378831011026698}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/lht/MutulaK10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/midm/WilsonFZTYCG10, author = {Carlene Wilson and Ingrid H. K. Flight and Ian Zajac and Deborah Turnbull and Graeme P. Young and Stephen R. Cole and Tess Gregory}, title = {Protocol for population testing of an Internet-based Personalised Decision Support system for colorectal cancer screening}, journal = {{BMC} Medical Informatics Decis. Mak.}, volume = {10}, pages = {50}, year = {2010}, url = {https://doi.org/10.1186/1472-6947-10-50}, doi = {10.1186/1472-6947-10-50}, timestamp = {Mon, 26 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/midm/WilsonFZTYCG10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/GrilloTLMLBGHPPP10, author = {Giorgio Grillo and Antonio Turi and Flavio Licciulli and Flavio Mignone and Sabino Liuni and Sandro Banfi and Vincenzo Alessandro Gennarino and David Stephen Horner and Giulio Pavesi and Ernesto Picardi and Graziano Pesole}, title = {UTRdb and UTRsite {(RELEASE} 2010): a collection of sequences and regulatory motifs of the untranslated regions of eukaryotic mRNAs}, journal = {Nucleic Acids Res.}, volume = {38}, number = {Database-Issue}, pages = {75--80}, year = {2010}, url = {https://doi.org/10.1093/nar/gkp902}, doi = {10.1093/NAR/GKP902}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/GrilloTLMLBGHPPP10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/WangBDKSSWXZB10, author = {Yanli Wang and Evan Bolton and Svetlana Dracheva and Karen Karapetyan and Benjamin A. Shoemaker and Tugba O. Suzek and Jiyao Wang and Jewen Xiao and Jian Zhang and Stephen H. Bryant}, title = {An overview of the PubChem BioAssay resource}, journal = {Nucleic Acids Res.}, volume = {38}, number = {Database-Issue}, pages = {255--266}, year = {2010}, url = {https://doi.org/10.1093/nar/gkp965}, doi = {10.1093/NAR/GKP965}, timestamp = {Thu, 23 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/WangBDKSSWXZB10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigops/BarrBDGHNTZ10, author = {Kenneth C. Barr and Prashanth P. Bungale and Stephen Deasy and Viktor Gyuris and Perry Hung and Craig Newell and Harvey Tuch and Bruno Zoppis}, title = {The VMware mobile virtualization platform: is that a hypervisor in your pocket?}, journal = {{ACM} {SIGOPS} Oper. Syst. Rev.}, volume = {44}, number = {4}, pages = {124--135}, year = {2010}, url = {https://doi.org/10.1145/1899928.1899945}, doi = {10.1145/1899928.1899945}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigops/BarrBDGHNTZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tvcg/JeongSTFMWRLP10, author = {Won{-}Ki Jeong and Jens Schneider and Stephen G. Turney and Beverly E. Faulkner{-}Jones and Dominik Meyer and R{\"{u}}diger Westermann and R. Clay Reid and Jeff Lichtman and Hanspeter Pfister}, title = {Interactive Histology of Large-Scale Biomedical Image Stacks}, journal = {{IEEE} Trans. Vis. Comput. Graph.}, volume = {16}, number = {6}, pages = {1386--1395}, year = {2010}, url = {https://doi.org/10.1109/TVCG.2010.168}, doi = {10.1109/TVCG.2010.168}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tvcg/JeongSTFMWRLP10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/TullyKC10, author = {Stephen Tully and George Kantor and Howie Choset}, editor = {Maria Fox and David Poole}, title = {A Single-Step Maximum {A} Posteriori Update for Bearing-Only {SLAM}}, booktitle = {Proceedings of the Twenty-Fourth {AAAI} Conference on Artificial Intelligence, {AAAI} 2010, Atlanta, Georgia, USA, July 11-15, 2010}, pages = {1252--1257}, publisher = {{AAAI} Press}, year = {2010}, url = {https://doi.org/10.1609/aaai.v24i1.7736}, doi = {10.1609/AAAI.V24I1.7736}, timestamp = {Mon, 04 Sep 2023 16:23:45 +0200}, biburl = {https://dblp.org/rec/conf/aaai/TullyKC10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bibe/NguyenFACL10, author = {Tung T. Nguyen and Panagiota T. Foteinou and Ioannis P. Androulakis and Steve E. Calvano and Stephen F. Lowry}, title = {Dynamic Complexity of the Temporal Transcriptional Regulation Program in Human Endotoxemia}, booktitle = {10th {IEEE} International Conference on Bioinformatics and Bioengineering, {BIBE} 2010, Philadelphia, Pennsylvania, USA, May 31-June 3 2010}, pages = {112--117}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/BIBE.2010.27}, doi = {10.1109/BIBE.2010.27}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/bibe/NguyenFACL10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cloud/ArmbrustLTFFP10, author = {Michael Armbrust and Nick Lanham and Stephen Tu and Armando Fox and Michael J. Franklin and David A. Patterson}, editor = {Joseph M. Hellerstein and Surajit Chaudhuri and Mendel Rosenblum}, title = {The case for {PIQL:} a performance insightful query language}, booktitle = {Proceedings of the 1st {ACM} Symposium on Cloud Computing, SoCC 2010, Indianapolis, Indiana, USA, June 10-11, 2010}, pages = {131--136}, publisher = {{ACM}}, year = {2010}, url = {https://doi.org/10.1145/1807128.1807149}, doi = {10.1145/1807128.1807149}, timestamp = {Thu, 13 Apr 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cloud/ArmbrustLTFFP10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cscw/TuckerBRW10, author = {Simon Tucker and Ofer Bergman and Anand Ramamoorthy and Steve Whittaker}, editor = {Kori Inkpen and Carl Gutwin and John C. Tang}, title = {Catchup: a useful application of time-travel in meetings}, booktitle = {Proceedings of the 2010 {ACM} Conference on Computer Supported Cooperative Work, {CSCW} 2010, Savannah, Georgia, USA, February 6-10, 2010}, pages = {99--102}, publisher = {{ACM}}, year = {2010}, url = {https://doi.org/10.1145/1718918.1718937}, doi = {10.1145/1718918.1718937}, timestamp = {Mon, 11 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cscw/TuckerBRW10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/LiCTP10, author = {Zengxiang Li and Wentong Cai and Stephen John Turner and Ke Pan}, editor = {Stephen John Turner and David J. Roberts}, title = {A Three-Phases Byzantine Fault Tolerance Mechanism for HLA-Based Simulation}, booktitle = {{DS-RT} '10 Proceedings of the 2010 {IEEE/ACM} 14th International Symposium on Distributed Simulation and Real Time Applications, Fairfax, Virginia, USA, 17-20 October 2010}, pages = {149--158}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/DS-RT.2010.24}, doi = {10.1109/DS-RT.2010.24}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dsrt/LiCTP10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/evoW/TurnerDR10, author = {Stephen D. Turner and Scott M. Dudek and Marylyn D. Ritchie}, editor = {Clara Pizzuti and Marylyn D. Ritchie and Mario Giacobini}, title = {Grammatical Evolution of Neural Networks for Discovering Epistasis among Quantitative Trait Loci}, booktitle = {Evolutionary Computation, Machine Learning and Data Mining in Bioinformatics, 8th European Conference, EvoBIO 2010, Istanbul, Turkey, April 7-9, 2010. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6023}, pages = {86--97}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-12211-8\_8}, doi = {10.1007/978-3-642-12211-8\_8}, timestamp = {Tue, 14 May 2019 10:00:37 +0200}, biburl = {https://dblp.org/rec/conf/evoW/TurnerDR10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/gecco/HolzingerBDTTR10, author = {Emily Rose Holzinger and Carrie C. Buchanan and Scott M. Dudek and Eric Torstenson and Stephen D. Turner and Marylyn D. Ritchie}, editor = {Martin Pelikan and J{\"{u}}rgen Branke}, title = {Initialization parameter sweep in {ATHENA:} optimizing neural networks for detecting gene-gene interactions in the presence of small main effects}, booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2010, Proceedings, Portland, Oregon, USA, July 7-11, 2010}, pages = {203--210}, publisher = {{ACM}}, year = {2010}, url = {https://doi.org/10.1145/1830483.1830519}, doi = {10.1145/1830483.1830519}, timestamp = {Sat, 30 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/gecco/HolzingerBDTTR10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/grid/JinTLKGH10, author = {Jiangming Jin and Stephen John Turner and Bu{-}Sung Lee and Shyh{-}Hao Kuo and Rick Siow Mong Goh and Terence Hung}, title = {Performance modeling for runtime kernel adaptation: {A} case study on infectious disease simulation}, booktitle = {Proceedings of the 2010 11th {IEEE/ACM} International Conference on Grid Computing, Brussels, Belgium, October 25-29, 2010}, pages = {349--358}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/GRID.2010.5698009}, doi = {10.1109/GRID.2010.5698009}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/grid/JinTLKGH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icann/HuntSSADSBBT10, author = {Stephen P. Hunt and Yi Sun and Alexander V. Shafarenko and Rod Adams and Neil Davey and Brendan Slater and Ranjeet S. Bhamber and Sonia K. Boscolo and Sergei K. Turitsyn}, editor = {Konstantinos I. Diamantaras and Wlodek Duch and Lazaros S. Iliadis}, title = {Correcting Errors in Optical Data Transmission Using Neural Networks}, booktitle = {Artificial Neural Networks - {ICANN} 2010, 20th International Conference, Thessaloniki, Greece, September 15-18, 2010, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {6353}, pages = {448--457}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-15822-3\_55}, doi = {10.1007/978-3-642-15822-3\_55}, timestamp = {Sun, 25 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icann/HuntSSADSBBT10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icc/DavisHTB10, author = {Linda M. Davis and Stephen V. Hanly and Paul Tune and Sibi Raj Bhaskaran}, title = {Multi-Antenna Downlink Broadcast Using Compressed-Sensed Medium Access}, booktitle = {Proceedings of {IEEE} International Conference on Communications, {ICC} 2010, Cape Town, South Africa, 23-27 May 2010}, pages = {1--5}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/ICC.2010.5501819}, doi = {10.1109/ICC.2010.5501819}, timestamp = {Wed, 16 Oct 2019 14:14:50 +0200}, biburl = {https://dblp.org/rec/conf/icc/DavisHTB10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icmi/LiGFZDZJZCHML10, author = {Kaiming Li and Lei Guo and Carlos Faraco and Dajiang Zhu and Fan Deng and Tuo Zhang and Xi Jiang and Degang Zhang and Hanbo Chen and Xintao Hu and L. Stephen Miller and Tianming Liu}, editor = {Wen Gao and Chin{-}Hui Lee and Jie Yang and Xilin Chen and Maxine Esk{\'{e}}nazi and Zhengyou Zhang}, title = {Human-centered attention models for video summarization}, booktitle = {Proceedings of the 12th International Conference on Multimodal Interfaces / 7. International Workshop on Machine Learning for Multimodal Interaction, {ICMI-MLMI} 2010, Beijing, China, November 8-12, 2010}, pages = {27:1--27:8}, publisher = {{ACM}}, year = {2010}, url = {https://doi.org/10.1145/1891903.1891938}, doi = {10.1145/1891903.1891938}, timestamp = {Thu, 07 Mar 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icmi/LiGFZDZJZCHML10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/incdm/TuckerSCKDLT10, author = {Allan Tucker and Stephen Swift and Steve Counsell and Simon Kent and John Dickie and Kenwin Liu and Robert Turner}, editor = {Petra Perner}, title = {Data Mining the Millennium Seedbank at Kew}, booktitle = {Advances in Data Mining. 10th Industrial Conference, {ICDM} 2010, Berlin, Germany, July 2010, Workshop Proceedings}, pages = {85--94}, publisher = {ibai Publishing}, year = {2010}, timestamp = {Tue, 22 Feb 2022 10:29:42 +0100}, biburl = {https://dblp.org/rec/conf/incdm/TuckerSCKDLT10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ipps/PanCTZT10, author = {Ke Pan and Wentong Cai and Xueyan Tang and Suiping Zhou and Stephen John Turner}, title = {A hybrid Interest Management mechanism for peer-to-peer Networked Virtual Environments}, booktitle = {24th {IEEE} International Symposium on Parallel and Distributed Processing, {IPDPS} 2010, Atlanta, Georgia, USA, 19-23 April 2010 - Conference Proceedings}, pages = {1--12}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/IPDPS.2010.5470364}, doi = {10.1109/IPDPS.2010.5470364}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ipps/PanCTZT10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iros/SmithTBR10, author = {Stephen L. Smith and Jana Tumova and Calin Belta and Daniela Rus}, title = {Optimal path planning under temporal logic constraints}, booktitle = {2010 {IEEE/RSJ} International Conference on Intelligent Robots and Systems, October 18-22, 2010, Taipei, Taiwan}, pages = {3288--3293}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/IROS.2010.5650896}, doi = {10.1109/IROS.2010.5650896}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/iros/SmithTBR10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iva/SmithCBCDPCPCT10, author = {Cameron G. Smith and Nigel T. Crook and Johan Boye and Daniel Charlton and Simon Dobnik and David Pizzi and Marc Cavazza and Stephen G. Pulman and Ra{\'{u}}l Santos de la C{\'{a}}mara and Markku Turunen}, editor = {Jan M. Allbeck and Norman I. Badler and Timothy W. Bickmore and Catherine Pelachaud and Alla Safonova}, title = {Interaction Strategies for an Affective Conversational Agent}, booktitle = {Intelligent Virtual Agents, 10th International Conference, {IVA} 2010, Philadelphia, PA, USA, September 20-22, 2010. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6356}, pages = {301--314}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-15892-6\_31}, doi = {10.1007/978-3-642-15892-6\_31}, timestamp = {Fri, 09 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iva/SmithCBCDPCPCT10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mm/HuDLZCJLZFZMHHXMGL10, author = {Xintao Hu and Fan Deng and Kaiming Li and Tuo Zhang and Hanbo Chen and Xi Jiang and Jinglei Lv and Dajiang Zhu and Carlos Faraco and Degang Zhang and Arsham Mesbah and Junwei Han and Xian{-}Sheng Hua and Li Xie and L. Stephen Miller and Lei Guo and Tianming Liu}, editor = {Alberto Del Bimbo and Shih{-}Fu Chang and Arnold W. M. Smeulders}, title = {Bridging low-level features and high-level semantics via fMRI brain imaging for video classification}, booktitle = {Proceedings of the 18th International Conference on Multimedia 2010, Firenze, Italy, October 25-29, 2010}, pages = {451--460}, publisher = {{ACM}}, year = {2010}, url = {https://doi.org/10.1145/1873951.1874016}, doi = {10.1145/1873951.1874016}, timestamp = {Thu, 07 Mar 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/mm/HuDLZCJLZFZMHHXMGL10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/LiGFZDZJZCHML10, author = {Kaiming Li and Lei Guo and Carlos Faraco and Dajiang Zhu and Fan Deng and Tuo Zhang and Xi Jiang and Degang Zhang and Hanbo Chen and Xintao Hu and L. Stephen Miller and Tianming Liu}, editor = {John D. Lafferty and Christopher K. I. Williams and John Shawe{-}Taylor and Richard S. Zemel and Aron Culotta}, title = {Individualized {ROI} Optimization via Maximization of Group-wise Consistency of Structural and Functional Profiles}, booktitle = {Advances in Neural Information Processing Systems 23: 24th Annual Conference on Neural Information Processing Systems 2010. Proceedings of a meeting held 6-9 December 2010, Vancouver, British Columbia, Canada}, pages = {1369--1377}, publisher = {Curran Associates, Inc.}, year = {2010}, url = {https://proceedings.neurips.cc/paper/2010/hash/ccb1d45fb76f7c5a0bf619f979c6cf36-Abstract.html}, timestamp = {Thu, 07 Mar 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/nips/LiGFZDZJZCHML10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/LiCTP10, author = {Zengxiang Li and Wentong Cai and Stephen John Turner and Ke Pan}, editor = {George F. Riley and Richard M. Fujimoto and Rob Simmonds and Francesco Quaglia}, title = {Federate Fault Tolerance in HLA-Based Simulation}, booktitle = {24th {ACM/IEEE/SCS} Workshop on Principles of Advanced and Distributed Simulation, {PADS} 2010, Atlanta, Georgia, USA, May 17-19, 2010}, pages = {3--12}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/PADS.2010.5471663}, doi = {10.1109/PADS.2010.5471663}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/LiCTP10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/persuasive/CavazzaSCCBPMPCT10, author = {Marc Cavazza and Cameron G. Smith and Daniel Charlton and Nigel T. Crook and Johan Boye and Stephen G. Pulman and Karo Moilanen and David Pizzi and Ra{\'{u}}l Santos de la C{\'{a}}mara and Markku Turunen}, editor = {Thomas Ploug and Per F. V. Hasle and Harri Oinas{-}Kukkonen}, title = {Persuasive Dialogue Based on a Narrative Theory: An {ECA} Implementation}, booktitle = {Persuasive Technology, 5th International Conference, {PERSUASIVE} 2010, Copenhagen, Denmark, June 7-10, 2010. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6137}, pages = {250--261}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-13226-1\_25}, doi = {10.1007/978-3-642-13226-1\_25}, timestamp = {Fri, 09 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/persuasive/CavazzaSCCBPMPCT10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ppsn/TurnerDR10, author = {Stephen D. Turner and Scott M. Dudek and Marylyn D. Ritchie}, editor = {Robert Schaefer and Carlos Cotta and Joanna Kolodziej and G{\"{u}}nter Rudolph}, title = {Incorporating Domain Knowledge into Evolutionary Computing for Discovering Gene-Gene Interaction}, booktitle = {Parallel Problem Solving from Nature - {PPSN} XI, 11th International Conference, Krak{\'{o}}w, Poland, September 11-15, 2010, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {6238}, pages = {394--403}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-15844-5\_40}, doi = {10.1007/978-3-642-15844-5\_40}, timestamp = {Wed, 25 Sep 2019 18:08:28 +0200}, biburl = {https://dblp.org/rec/conf/ppsn/TurnerDR10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigcse/TurnerPEC10, author = {Scott A. Turner and Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and Stephen H. Edwards and Joseph Chase}, editor = {Gary Lewandowski and Steven A. Wolfman and Thomas J. Cortina and Ellen Lowenfeld Walker}, title = {Peer review in {CS2:} conceptual learning}, booktitle = {Proceedings of the 41st {ACM} technical symposium on Computer science education, {SIGCSE} 2010, Milwaukee, Wisconsin, USA, March 10-13, 2010}, pages = {331--335}, publisher = {{ACM}}, year = {2010}, url = {https://doi.org/10.1145/1734263.1734379}, doi = {10.1145/1734263.1734379}, timestamp = {Wed, 10 Mar 2021 13:17:16 +0100}, biburl = {https://dblp.org/rec/conf/sigcse/TurnerPEC10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigmod/ArmbrustTFFPLTT10, author = {Michael Armbrust and Stephen Tu and Armando Fox and Michael J. Franklin and David A. Patterson and Nick Lanham and Beth Trushkowsky and Jesse Trutna}, editor = {Ahmed K. Elmagarmid and Divyakant Agrawal}, title = {{PIQL:} a performance insightful query language}, booktitle = {Proceedings of the {ACM} {SIGMOD} International Conference on Management of Data, {SIGMOD} 2010, Indianapolis, Indiana, USA, June 6-10, 2010}, pages = {1207--1210}, publisher = {{ACM}}, year = {2010}, url = {https://doi.org/10.1145/1807167.1807320}, doi = {10.1145/1807167.1807320}, timestamp = {Thu, 13 Apr 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sigmod/ArmbrustTFFPLTT10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/springsim/LiCTP10, author = {Zengxiang Li and Wentong Cai and Stephen John Turner and Ke Pan}, editor = {Robert M. McGraw and Eric S. Imsand and Michael J. Chinni}, title = {A replication structure for efficient and fault-tolerant parallel and distributed simulations}, booktitle = {Proceedings of the 2010 Spring Simulation Multiconference, SpringSim 2010, Orlando, Florida, USA, April 11-15, 2010}, pages = {151}, publisher = {{SCS/ACM}}, year = {2010}, url = {https://doi.org/10.1145/1878537.1878695}, doi = {10.1145/1878537.1878695}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/springsim/LiCTP10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/TaylorMKWTS10, author = {Simon J. E. Taylor and Navonil Mustafee and Shane Kite and Chris Wood and Stephen John Turner and Steffen Stra{\ss}burger}, title = {Improving simulation through advanced computing techniques: Grid computing and simulation interoperability}, booktitle = {Proceedings of the 2010 Winter Simulation Conference, {WSC} 2010, Baltimore, Maryland, USA, 5-8 December 2010}, pages = {216--230}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/WSC.2010.5679162}, doi = {10.1109/WSC.2010.5679162}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/TaylorMKWTS10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:journals/procedia/ShahandTCH10, author = {Shayan Shahand and Stephen John Turner and Wentong Cai and Maryam Khademi Hedayat}, editor = {Peter M. A. Sloot and G. Dick van Albada and Jack J. Dongarra}, title = {DynaSched: a dynamic Web service scheduling and deployment framework for data-intensive Grid workflows}, booktitle = {Proceedings of the International Conference on Computational Science, {ICCS} 2010, University of Amsterdam, The Netherlands, May 31 - June 2, 2010}, series = {Procedia Computer Science}, volume = {1}, number = {1}, pages = {593--602}, publisher = {Elsevier}, year = {2010}, url = {https://doi.org/10.1016/j.procs.2010.04.063}, doi = {10.1016/J.PROCS.2010.04.063}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/procedia/ShahandTCH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/dsrt/2010, editor = {Stephen John Turner and David J. Roberts}, title = {{DS-RT} '10 Proceedings of the 2010 {IEEE/ACM} 14th International Symposium on Distributed Simulation and Real Time Applications, Fairfax, Virginia, USA, 17-20 October 2010}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://ieeexplore.ieee.org/xpl/conhome/5634610/proceeding}, isbn = {978-0-7695-4251-5}, timestamp = {Wed, 16 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dsrt/2010.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/synasc/2010, editor = {Tetsuo Ida and Viorel Negru and Tudor Jebelean and Dana Petcu and Stephen M. Watt and Daniela Zaharie}, title = {12th International Symposium on Symbolic and Numeric Algorithms for Scientific Computing, {SYNASC} 2010, Timisoara, Romania, 23-26 September 2010}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://ieeexplore.ieee.org/xpl/conhome/5714592/proceeding}, isbn = {978-0-7695-4324-6}, timestamp = {Wed, 16 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/synasc/2010.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1007-2212, author = {Stephen L. Smith and Jana Tumova and Calin Belta and Daniela Rus}, title = {Optimal Path Planning under Temporal Logic Constraints}, journal = {CoRR}, volume = {abs/1007.2212}, year = {2010}, url = {http://arxiv.org/abs/1007.2212}, eprinttype = {arXiv}, eprint = {1007.2212}, timestamp = {Mon, 28 Jan 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1007-2212.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ercim/OSullivanD10, author = {Stephen O'Sullivan and Turlough Downes}, title = {Massively Parallel Simulations of Star-Forming Gas Clouds}, journal = {{ERCIM} News}, volume = {2010}, number = {81}, year = {2010}, url = {http://ercim-news.ercim.eu/en81/special/massively-parallel-simulations-of-star-forming-gas-clouds}, timestamp = {Wed, 22 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ercim/OSullivanD10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rfc/rfc5755, author = {Stephen Farrell and Russ Housley and Sean Turner}, title = {An Internet Attribute Certificate Profile for Authorization}, journal = {{RFC}}, volume = {5755}, pages = {1--50}, year = {2010}, url = {https://doi.org/10.17487/RFC5755}, doi = {10.17487/RFC5755}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rfc/rfc5755.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rfc/rfc5990, author = {Randall J. Atkinson and Burt Kaliski and John G. Brainard and Sean Turner}, title = {Use of the {RSA-KEM} Key Transport Algorithm in the Cryptographic Message Syntax {(CMS)}}, journal = {{RFC}}, volume = {5990}, pages = {1--27}, year = {2010}, url = {https://doi.org/10.17487/RFC5990}, doi = {10.17487/RFC5990}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rfc/rfc5990.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bmcbi/ChaiSBTAK09, author = {High{-}Seng Chai and Hugues Sicotte and Kent R. Bailey and Stephen T. Turner and Yan W. Asmann and Jean{-}Pierre A. Kocher}, title = {{GLOSSI:} a method to assess the association of genetic loci-sets with complex diseases}, journal = {{BMC} Bioinform.}, volume = {10}, year = {2009}, url = {https://doi.org/10.1186/1471-2105-10-102}, doi = {10.1186/1471-2105-10-102}, timestamp = {Sun, 15 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/bmcbi/ChaiSBTAK09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bmcbi/JamesonTAKRSGSOWKP09, author = {Daniel Jameson and David A. Turner and John Ankers and Stephnie Kennedy and Sheila Ryan and Neil Swainston and Tony Griffiths and David G. Spiller and Stephen G. Oliver and Michael R. H. White and Douglas B. Kell and Norman W. Paton}, title = {Information management for high content live cell imaging}, journal = {{BMC} Bioinform.}, volume = {10}, year = {2009}, url = {https://doi.org/10.1186/1471-2105-10-226}, doi = {10.1186/1471-2105-10-226}, timestamp = {Sun, 15 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/bmcbi/JamesonTAKRSGSOWKP09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/csda/SunJTBK09, author = {Yan V. Sun and Douglas M. Jacobsen and Stephen T. Turner and Eric Boerwinkle and Sharon L. R. Kardia}, title = {Fast implementation of a scan statistic for identifying chromosomal patterns of genome wide association studies}, journal = {Comput. Stat. Data Anal.}, volume = {53}, number = {5}, pages = {1794--1801}, year = {2009}, url = {https://doi.org/10.1016/j.csda.2008.04.013}, doi = {10.1016/J.CSDA.2008.04.013}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/csda/SunJTBK09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/infsof/KitchenhamBBTBL09, author = {Barbara A. Kitchenham and Pearl Brereton and David Budgen and Mark Turner and John Bailey and Stephen G. Linkman}, title = {Systematic literature reviews in software engineering - {A} systematic literature review}, journal = {Inf. Softw. Technol.}, volume = {51}, number = {1}, pages = {7--15}, year = {2009}, url = {https://doi.org/10.1016/j.infsof.2008.09.009}, doi = {10.1016/J.INFSOF.2008.09.009}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/infsof/KitchenhamBBTBL09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/WangXSZWB09, author = {Yanli Wang and Jewen Xiao and Tugba O. Suzek and Jian Zhang and Jiyao Wang and Stephen H. Bryant}, title = {PubChem: a public information system for analyzing bioactivities of small molecules}, journal = {Nucleic Acids Res.}, volume = {37}, number = {Web-Server-Issue}, pages = {623--633}, year = {2009}, url = {https://doi.org/10.1093/nar/gkp456}, doi = {10.1093/NAR/GKP456}, timestamp = {Sun, 17 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/WangXSZWB09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/YuPZW09, author = {Donggang Yu and Tuan D. Pham and Xiaobo Zhou and Stephen T. C. Wong}, title = {Recognition and analysis of cell nuclear phases for high-content screening based on morphological features}, journal = {Pattern Recognit.}, volume = {42}, number = {4}, pages = {498--508}, year = {2009}, url = {https://doi.org/10.1016/j.patcog.2008.08.003}, doi = {10.1016/J.PATCOG.2008.08.003}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/YuPZW09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/simulation/PanTCL09, author = {Ke Pan and Stephen John Turner and Wentong Cai and Zengxiang Li}, title = {A Hybrid {HLA} Time Management Algorithm Based on Both Conditional and Unconditional Information}, journal = {Simul.}, volume = {85}, number = {9}, pages = {559--573}, year = {2009}, url = {https://doi.org/10.1177/0037549709106328}, doi = {10.1177/0037549709106328}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/simulation/PanTCL09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcas/WangWHLL09, author = {Tunde Wang and Dong Wang and Paul J. Hurst and Bernard C. Levy and Stephen H. Lewis}, title = {A Level-Crossing Analog-to-Digital Converter With Triangular Dither}, journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.}, volume = {56-I}, number = {9}, pages = {2089--2099}, year = {2009}, url = {https://doi.org/10.1109/TCSI.2008.2011586}, doi = {10.1109/TCSI.2008.2011586}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcas/WangWHLL09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aswec/ChartersBTKBL09, author = {Stuart M. Charters and David Budgen and Mark Turner and Barbara A. Kitchenham and Pearl Brereton and Stephen G. Linkman}, title = {Objectivity in Research: Challenges from the Evidence-Based Paradigm}, booktitle = {20th Australian Software Engineering Conference {(ASWEC} 2009), 14-17 April 2009, Gold Cost, Australia}, pages = {73--80}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/ASWEC.2009.25}, doi = {10.1109/ASWEC.2009.25}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/aswec/ChartersBTKBL09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bliss/YanciPA09, author = {Asier Goikoetxea Yanci and Stephen Pickles and Tughrul Arslan}, editor = {Adrian Stoica and Tughrul Arslan and Ahmet T. Erdogan and Tetsuya Higuchi and Ahmed Bouridane and Ahmed O. El{-}Rayis}, title = {Characterization of a Voltage Glitch Attack Detector for Secure Devices}, booktitle = {2009 Symposium on Bio-inspired Learning and Intelligent Systems for Security, {BLISS} 2009, Edingburgh, United Kingdom, August 20-21 2009}, pages = {91--96}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/BLISS.2009.18}, doi = {10.1109/BLISS.2009.18}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/bliss/YanciPA09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/chi/BergmanTBCW09, author = {Ofer Bergman and Simon Tucker and Ruth Beyth{-}Marom and Edward Cutrell and Steve Whittaker}, editor = {Dan R. Olsen Jr. and Richard B. Arthur and Ken Hinckley and Meredith Ringel Morris and Scott E. Hudson and Saul Greenberg}, title = {It's not that important: demoting personal information of low subjective importance using GrayArea}, booktitle = {Proceedings of the 27th International Conference on Human Factors in Computing Systems, {CHI} 2009, Boston, MA, USA, April 4-9, 2009}, pages = {269--278}, publisher = {{ACM}}, year = {2009}, url = {https://doi.org/10.1145/1518701.1518745}, doi = {10.1145/1518701.1518745}, timestamp = {Sun, 04 Aug 2024 19:38:26 +0200}, biburl = {https://dblp.org/rec/conf/chi/BergmanTBCW09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/det/ValenteNNT09, author = {Anna Valente and Aydin Nassehi and Stephen T. Newman and Tullio Tolio}, editor = {George Q. Huang and Kai{-}Ling Mak and Paul G. Maropoulos}, title = {A {STEP} Compliant Knowledge Based Schema for the Manufacture of Composites in the Aerospace Industry}, booktitle = {Proceedings of the 6th CIRP-Sponsored International Conference on Digital Enterprise Technology, {DET} 2009, Hong Kong, China, December 14.16, 2009}, series = {Advances in Intelligent and Soft Computing}, volume = {66}, pages = {1509--1525}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-10430-5\_114}, doi = {10.1007/978-3-642-10430-5\_114}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/det/ValenteNNT09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/FanchaoTA09, author = {Zeng Fanchao and Stephen John Turner and Heiko Aydt}, editor = {Stephen John Turner and David J. Roberts and Wentong Cai and Abdulmotaleb El{-}Saddik}, title = {Symbiotic Simulation Control in Supply Chain of Lubricant Additive Industry}, booktitle = {13th {IEEE/ACM} International Symposium on Distributed Simulation and Real Time Applications, Singapore, 25-28 October 2009}, pages = {165--172}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/DS-RT.2009.17}, doi = {10.1109/DS-RT.2009.17}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dsrt/FanchaoTA09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/PanTCL09, author = {Ke Pan and Stephen John Turner and Wentong Cai and Zengxiang Li}, editor = {Stephen John Turner and David J. Roberts and Wentong Cai and Abdulmotaleb El{-}Saddik}, title = {Multi-user Gaming on the Grid Using a Service Oriented {HLA} {RTI}}, booktitle = {13th {IEEE/ACM} International Symposium on Distributed Simulation and Real Time Applications, Singapore, 25-28 October 2009}, pages = {48--56}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/DS-RT.2009.39}, doi = {10.1109/DS-RT.2009.39}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dsrt/PanTCL09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eann/HuntSSADSBBT09, author = {Stephen P. Hunt and Yi Sun and Alexander V. Shafarenko and Rod Adams and Neil Davey and Brendan Slater and Ranjeet S. Bhamber and Sonia K. Boscolo and Sergei K. Turitsyn}, editor = {Dominic Palmer{-}Brown and Chrisina Draganova and Elias Pimenidis and Haris Mouratidis}, title = {Adaptive Electrical Signal Post-processing with Varying Representations in Optical Communication Systems}, booktitle = {Engineering Applications of Neural Networks - 11th International Conference, {EANN} 2009, London, UK, August 27-29, 2009. Proceedings}, series = {Communications in Computer and Information Science}, volume = {43}, pages = {235--245}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-03969-0\_22}, doi = {10.1007/978-3-642-03969-0\_22}, timestamp = {Sun, 25 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eann/HuntSSADSBBT09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/esem/KitchenhamBTNLPB09, author = {Barbara A. Kitchenham and Pearl Brereton and Mark Turner and Mahmood Niazi and Stephen G. Linkman and Rialette Pretorius and David Budgen}, title = {The impact of limited search procedures for systematic literature reviews {A} participant-observer case study}, booktitle = {Proceedings of the Third International Symposium on Empirical Software Engineering and Measurement, {ESEM} 2009, October 15-16, 2009, Lake Buena Vista, Florida, {USA}}, pages = {336--345}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/ESEM.2009.5314238}, doi = {10.1109/ESEM.2009.5314238}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/esem/KitchenhamBTNLPB09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/evoW/TurnerRB09, author = {Stephen D. Turner and Marylyn D. Ritchie and William S. Bush}, editor = {Clara Pizzuti and Marylyn D. Ritchie and Mario Giacobini}, title = {Conquering the Needle-in-a-Haystack: How Correlated Input Variables Beneficially Alter the Fitness Landscape for Neural Networks}, booktitle = {Evolutionary Computation, Machine Learning and Data Mining in Bioinformatics, 7th European Conference, EvoBIO 2009, T{\"{u}}bingen, Germany, April 15-17, 2009, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5483}, pages = {80--91}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-01184-9\_8}, doi = {10.1007/978-3-642-01184-9\_8}, timestamp = {Wed, 25 Sep 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/evoW/TurnerRB09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/fsr/TullyKC09, author = {Stephen Tully and George Kantor and Howie Choset}, editor = {Andrew Howard and Karl Iagnemma and Alonzo Kelly}, title = {Leap-Frog Path Design for Multi-Robot Cooperative Localization}, booktitle = {Field and Service Robotics, Results of the 7th International Conference, {FSR} 2009, Cambridge, Massachusetts, USA, 14-16 July 2009}, series = {Springer Tracts in Advanced Robotics}, volume = {62}, pages = {307--317}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-13408-1\_28}, doi = {10.1007/978-3-642-13408-1\_28}, timestamp = {Mon, 22 May 2017 17:10:59 +0200}, biburl = {https://dblp.org/rec/conf/fsr/TullyKC09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ida/CainCST09, author = {James Cain and Steve Counsell and Stephen Swift and Allan Tucker}, editor = {Niall M. Adams and C{\'{e}}line Robardet and Arno Siebes and Jean{-}Fran{\c{c}}ois Boulicaut}, title = {An Application of Intelligent Data Analysis Techniques to a Large Software Engineering Dataset}, booktitle = {Advances in Intelligent Data Analysis VIII, 8th International Symposium on Intelligent Data Analysis, {IDA} 2009, Lyon, France, August 31 - September 2, 2009. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5772}, pages = {261--272}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-03915-7\_23}, doi = {10.1007/978-3-642-03915-7\_23}, timestamp = {Tue, 14 May 2019 10:00:49 +0200}, biburl = {https://dblp.org/rec/conf/ida/CainCST09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/interspeech/WrigleyTBW09, author = {Stuart N. Wrigley and Simon Tucker and Guy J. Brown and Steve Whittaker}, title = {Audio spatialisation strategies for multitasking during teleconferences}, booktitle = {10th Annual Conference of the International Speech Communication Association, {INTERSPEECH} 2009, Brighton, United Kingdom, September 6-10, 2009}, pages = {2935--2938}, publisher = {{ISCA}}, year = {2009}, url = {https://doi.org/10.21437/Interspeech.2009-743}, doi = {10.21437/INTERSPEECH.2009-743}, timestamp = {Tue, 11 Jun 2024 16:45:43 +0200}, biburl = {https://dblp.org/rec/conf/interspeech/WrigleyTBW09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iros/TullyKCW09, author = {Stephen Tully and George Kantor and Howie Choset and Felix Werner}, title = {A multi-hypothesis topological {SLAM} approach for loop closing on edge-ordered graphs}, booktitle = {2009 {IEEE/RSJ} International Conference on Intelligent Robots and Systems, October 11-15, 2009, St. Louis, MO, {USA}}, pages = {4943--4948}, publisher = {{IEEE}}, year = {2009}, url = {https://doi.org/10.1109/IROS.2009.5354255}, doi = {10.1109/IROS.2009.5354255}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/iros/TullyKCW09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iros/WernerMSCTK09, author = {Felix Werner and Fr{\'{e}}d{\'{e}}ric Maire and Joaquin Sitte and Howie Choset and Stephen Tully and George Kantor}, title = {Topological {SLAM} using neighbourhood information of places}, booktitle = {2009 {IEEE/RSJ} International Conference on Intelligent Robots and Systems, October 11-15, 2009, St. Louis, MO, {USA}}, pages = {4937--4942}, publisher = {{IEEE}}, year = {2009}, url = {https://doi.org/10.1109/IROS.2009.5354748}, doi = {10.1109/IROS.2009.5354748}, timestamp = {Mon, 22 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iros/WernerMSCTK09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isit/TuneBH09, author = {Paul Tune and Sibi Raj Bhaskaran and Stephen V. Hanly}, title = {Number of measurements in sparse signal recovery}, booktitle = {{IEEE} International Symposium on Information Theory, {ISIT} 2009, June 28 - July 3, 2009, Seoul, Korea, Proceedings}, pages = {16--20}, publisher = {{IEEE}}, year = {2009}, url = {https://doi.org/10.1109/ISIT.2009.5205809}, doi = {10.1109/ISIT.2009.5205809}, timestamp = {Wed, 16 Oct 2019 14:14:48 +0200}, biburl = {https://dblp.org/rec/conf/isit/TuneBH09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ispa/HedayatCTS09, author = {Maryam Khademi Hedayat and Wentong Cai and Stephen John Turner and Shayan Shahand}, title = {Distributed Execution of Workflow Using Parallel Partitioning}, booktitle = {{IEEE} International Symposium on Parallel and Distributed Processing with Applications, {ISPA} 2009, Chengdu, Sichuan, China, 10-12 August 2009}, pages = {106--112}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/ISPA.2009.96}, doi = {10.1109/ISPA.2009.96}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ispa/HedayatCTS09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/itw/BhaskaranDGHT09, author = {Sibi Raj Bhaskaran and Linda M. Davis and Alex J. Grant and Stephen V. Hanly and Paul Tune}, editor = {Bruce E. Hajek and Leandros Tassiulas and Venkat Anantharam and Ioannis Kontoyiannis}, title = {Downlink scheduling using compressed sensing}, booktitle = {2009 {IEEE} Information Theory Workshop, {ITW} 2009, Volos, Greece, June 10-12, 2009}, pages = {201--205}, publisher = {{IEEE}}, year = {2009}, url = {https://doi.org/10.1109/ITWNIT.2009.5158571}, doi = {10.1109/ITWNIT.2009.5158571}, timestamp = {Mon, 09 Aug 2021 14:54:02 +0200}, biburl = {https://dblp.org/rec/conf/itw/BhaskaranDGHT09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iui/TuckerW09, author = {Simon Tucker and Steve Whittaker}, editor = {Cristina Conati and Mathias Bauer and Nuria Oliver and Daniel S. Weld}, title = {Have a say over what you see: evaluating interactive compression techniques}, booktitle = {Proceedings of the 14th International Conference on Intelligent User Interfaces, {IUI} 2009, Sanibel Island, Florida, USA, February 8-11, 2009}, pages = {37--46}, publisher = {{ACM}}, year = {2009}, url = {https://doi.org/10.1145/1502650.1502659}, doi = {10.1145/1502650.1502659}, timestamp = {Mon, 11 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iui/TuckerW09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/AydtTCLA09, author = {Heiko Aydt and Stephen John Turner and Wentong Cai and Malcolm Yoke Hean Low and Rassul Ayani}, title = {Symbiotic Simulation Model Validation for Radiation Detection Applications}, booktitle = {23rd International Workshop on Principles of Advanced and Distributed Simulation, {PADS} 2009, Lake Placid, New York, USA, June 22-25, 2009}, pages = {11--18}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/PADS.2009.20}, doi = {10.1109/PADS.2009.20}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/AydtTCLA09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigcse/RodgerHLQNTLCDS09, author = {Susan H. Rodger and Jenna Hayes and Gaetjens Lezin and Henry Qin and Deborah Nelson and Ruth Tucker and Mercedes Lopez and Stephen Cooper and Wanda P. Dann and Don Slater}, editor = {Sue Fitzgerald and Mark Guzdial and Gary Lewandowski and Steven A. Wolfman}, title = {Engaging middle school teachers and students with alice in a diverse set of subjects}, booktitle = {Proceedings of the 40th {SIGCSE} Technical Symposium on Computer Science Education, {SIGCSE} 2009, Chattanooga, TN, USA, March 4-7, 2009}, pages = {271--275}, publisher = {{ACM}}, year = {2009}, url = {https://doi.org/10.1145/1508865.1508967}, doi = {10.1145/1508865.1508967}, timestamp = {Thu, 10 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sigcse/RodgerHLQNTLCDS09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/siggraph/PalazziSFLAABBC09, author = {Maria Palazzi and Norah Zuniga Shaw and William Forsythe and Matthew R. Lewis and Beth Albright and Michael Andereck and Sucheta Bhatawadekar and Hyowon Ban and Andrew Calhoun and Jane Drozd and Joshua Fry and Melissa S. Quintanilha and Anna Reed and Benjamin Schroeder and Lily Skove and Ashley Thorndike and Mary Twohig and Ola Ahlqvist and Peter Chan and Noel Cressie and Stephen Turk and Jill Johnson and Christopher Roman and Elizabeth Waterhouse and Scott DeLahunta and Patrick Haggard and Alva No{\"{e}}}, editor = {Jacquelyn Martino}, title = {Synchronous Objects for One Flat Thing, reproduced}, booktitle = {International Conference on Computer Graphics and Interactive Techniques, {SIGGRAPH} 2009, New Orleans, Louisiana, USA, August 3-7, 2009, Art Gallery}, pages = {37:1}, publisher = {{ACM}}, year = {2009}, url = {https://doi.org/10.1145/1667265.1667306}, doi = {10.1145/1667265.1667306}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/siggraph/PalazziSFLAABBC09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tpcg/LongshawTFG09, author = {Stephen M. Longshaw and Martin J. Turner and Emma Finch and Robert Gawthorpe}, editor = {Wen Tang and John P. Collomosse}, title = {Discrete Element Modelling Using a Parallelised Physics Engine}, booktitle = {{EG} {UK} Theory and Practice of Computer Graphics, Cardiff University,, United Kingdom, 2009. Proceedings}, pages = {207--214}, publisher = {Eurographics Association}, year = {2009}, url = {https://doi.org/10.2312/LocalChapterEvents/TPCG/TPCG09/207-214}, doi = {10.2312/LOCALCHAPTEREVENTS/TPCG/TPCG09/207-214}, timestamp = {Sun, 25 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/tpcg/LongshawTFG09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/AydtTCL09, author = {Heiko Aydt and Stephen John Turner and Wentong Cai and Malcolm Yoke Hean Low}, editor = {Ann Dunkin and Ricki G. Ingalls and Enver Y{\"{u}}cesan and Manuel D. Rossetti and Ray Hill and Bj{\"{o}}rn Johansson}, title = {Research Issues in Symbiotic Simulation}, booktitle = {Proceedings of the 2009 Winter Simulation Conference, {WSC} 2009, Hilton Austin Hotel, Austin, TX, USA, December 13-16, 2009}, pages = {1213--1222}, publisher = {{IEEE}}, year = {2009}, url = {https://doi.org/10.1109/WSC.2009.5429419}, doi = {10.1109/WSC.2009.5429419}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/AydtTCL09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/PanTCL09, author = {Ke Pan and Stephen John Turner and Wentong Cai and Zengxiang Li}, editor = {Ann Dunkin and Ricki G. Ingalls and Enver Y{\"{u}}cesan and Manuel D. Rossetti and Ray Hill and Bj{\"{o}}rn Johansson}, title = {Implementation of Data Distribution Management Services in a Service Oriented {HLA} {RTI}}, booktitle = {Proceedings of the 2009 Winter Simulation Conference, {WSC} 2009, Hilton Austin Hotel, Austin, TX, USA, December 13-16, 2009}, pages = {1027--1038}, publisher = {{IEEE}}, year = {2009}, url = {https://doi.org/10.1109/WSC.2009.5429557}, doi = {10.1109/WSC.2009.5429557}, timestamp = {Thu, 10 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/PanTCL09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/TaylorMTPS09, author = {Simon J. E. Taylor and Navonil Mustafee and Stephen John Turner and Ke Pan and Steffen Stra{\ss}burger}, editor = {Ann Dunkin and Ricki G. Ingalls and Enver Y{\"{u}}cesan and Manuel D. Rossetti and Ray Hill and Bj{\"{o}}rn Johansson}, title = {Commercial-Off-The-Shelf Simulation Package Interoperability: Issues and Futures}, booktitle = {Proceedings of the 2009 Winter Simulation Conference, {WSC} 2009, Hilton Austin Hotel, Austin, TX, USA, December 13-16, 2009}, pages = {203--215}, publisher = {{IEEE}}, year = {2009}, url = {https://doi.org/10.1109/WSC.2009.5429326}, doi = {10.1109/WSC.2009.5429326}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/TaylorMTPS09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:books/tf/09/TurnerCLA09, author = {Stephen John Turner and Wentong Cai and Malcolm Yoke Hean Low and Heiko Aydt}, editor = {Adelinde M. Uhrmacher and Danny Weyns}, title = {An Agent-Based Generic Framework for Symbiotic Simulation Systems}, booktitle = {Multi-Agent Systems - Simulation and Applications}, series = {Computational Analysis, Synthesis, and Design of Dynamic Systems}, pages = {357--387}, publisher = {{CRC} Press / Taylor {\&} Francis}, year = {2009}, url = {https://doi.org/10.1201/9781420070248.ch12}, doi = {10.1201/9781420070248.CH12}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/books/tf/09/TurnerCLA09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/dsrt/2009, editor = {Stephen John Turner and David J. Roberts and Wentong Cai and Abdulmotaleb El{-}Saddik}, title = {13th {IEEE/ACM} International Symposium on Distributed Simulation and Real Time Applications, Singapore, 25-28 October 2009}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://ieeexplore.ieee.org/xpl/conhome/5361739/proceeding}, isbn = {978-0-7695-3868-6}, timestamp = {Wed, 10 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dsrt/2009.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/synasc/2009, editor = {Stephen M. Watt and Viorel Negru and Tetsuo Ida and Tudor Jebelean and Dana Petcu and Daniela Zaharie}, title = {11th International Symposium on Symbolic and Numeric Algorithms for Scientific Computing, {SYNASC} 2009, Timisoara, Romania, September 26-29, 2009}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://ieeexplore.ieee.org/xpl/conhome/5459479/proceeding}, isbn = {978-1-4244-5910-0}, timestamp = {Wed, 16 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/synasc/2009.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-0904-4525, author = {Paul Tune and Sibiraj Bhaskaran Pillai and Stephen V. Hanly}, title = {Number of Measurements in Sparse Signal Recovery}, journal = {CoRR}, volume = {abs/0904.4525}, year = {2009}, url = {http://arxiv.org/abs/0904.4525}, eprinttype = {arXiv}, eprint = {0904.4525}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-0904-4525.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/csda/FridleyTCRBB08, author = {Brooke L. Fridley and Stephen T. Turner and Arlene B. Chapman and Andrei S. Rodin and Eric Boerwinkle and Kent R. Bailey}, title = {Reproducibility of genotypes as measured by the affymetrix GeneChip\({}^{\mbox{{\textregistered}}}\) 100K Human Mapping Array set}, journal = {Comput. Stat. Data Anal.}, volume = {52}, number = {12}, pages = {5367--5374}, year = {2008}, url = {https://doi.org/10.1016/j.csda.2008.05.020}, doi = {10.1016/J.CSDA.2008.05.020}, timestamp = {Tue, 18 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/csda/FridleyTCRBB08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ese/BudgenKCTBL08, author = {David Budgen and Barbara A. Kitchenham and Stuart M. Charters and Mark Turner and Pearl Brereton and Stephen G. Linkman}, title = {Presenting software engineering results using structured abstracts: a randomised experiment}, journal = {Empir. Softw. Eng.}, volume = {13}, number = {4}, pages = {435--468}, year = {2008}, url = {https://doi.org/10.1007/s10664-008-9075-7}, doi = {10.1007/S10664-008-9075-7}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ese/BudgenKCTBL08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fgcs/ChenTTCMZ08, author = {Dan Chen and Georgios K. Theodoropoulos and Stephen John Turner and Wentong Cai and Rob Minson and Yi Zhang}, title = {Large scale agent-based simulation on the grid}, journal = {Future Gener. Comput. Syst.}, volume = {24}, number = {7}, pages = {658--671}, year = {2008}, url = {https://doi.org/10.1016/j.future.2008.01.004}, doi = {10.1016/J.FUTURE.2008.01.004}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/fgcs/ChenTTCMZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jpdc/ChenTCX08, author = {Dan Chen and Stephen John Turner and Wentong Cai and Muzhou Xiong}, title = {A decoupled federate architecture for high level architecture-based distributed simulation}, journal = {J. Parallel Distributed Comput.}, volume = {68}, number = {11}, pages = {1487--1503}, year = {2008}, url = {https://doi.org/10.1016/j.jpdc.2008.07.010}, doi = {10.1016/J.JPDC.2008.07.010}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jpdc/ChenTCX08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ni/BugAGGFLLRSTM08, author = {William J. Bug and Giorgio A. Ascoli and Jeffrey S. Grethe and Amarnath Gupta and Christine Fennema{-}Notestine and Angela R. Laird and Stephen D. Larson and Daniel L. Rubin and Gordon M. Shepherd and Jessica A. Turner and Maryann E. Martone}, title = {The {NIFSTD} and BIRNLex Vocabularies: Building Comprehensive Ontologies for Neuroscience}, journal = {Neuroinformatics}, volume = {6}, number = {3}, pages = {175--194}, year = {2008}, url = {https://doi.org/10.1007/s12021-008-9032-z}, doi = {10.1007/S12021-008-9032-Z}, timestamp = {Sat, 19 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ni/BugAGGFLLRSTM08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/puc/WhittakerTSL08, author = {Steve Whittaker and Simon Tucker and Kumutha Swampillai and Rachel Laban}, title = {Design and evaluation of systems to support interaction capture and retrieval}, journal = {Pers. Ubiquitous Comput.}, volume = {12}, number = {3}, pages = {197--221}, year = {2008}, url = {https://doi.org/10.1007/s00779-007-0146-3}, doi = {10.1007/S00779-007-0146-3}, timestamp = {Mon, 11 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/puc/WhittakerTSL08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigplan/AllenBBBFFHKKLLLPRRSTW08, author = {Eric Allen and Mark W. Bailey and Rastislav Bod{\'{\i}}k and Kim B. Bruce and Kathleen Fisher and Stephen N. Freund and Robert Harper and Chandra Krintz and Shriram Krishnamurthi and James R. Larus and Doug Lea and Gary T. Leavens and Lori L. Pollock and Stuart Reges and Martin C. Rinard and Mark A. Sheldon and Franklyn A. Turbak and Mitchell Wand}, title = {{SIGPLAN} programming language curriculum workshop: Discussion Summaries and recommendations}, journal = {{ACM} {SIGPLAN} Notices}, volume = {43}, number = {11}, pages = {6--29}, year = {2008}, url = {https://doi.org/10.1145/1480828.1480831}, doi = {10.1145/1480828.1480831}, timestamp = {Tue, 26 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigplan/AllenBBBFFHKKLLLPRRSTW08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/simulation/ChenTC08, author = {Dan Chen and Stephen John Turner and Wentong Cai}, title = {Towards Fault-tolerant HLA-based Distributed Simulations}, journal = {Simul.}, volume = {84}, number = {10-11}, pages = {493--509}, year = {2008}, url = {https://doi.org/10.1177/0037549708095518}, doi = {10.1177/0037549708095518}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/simulation/ChenTC08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/taslp/TuckerW08, author = {Simon Tucker and Steve Whittaker}, title = {Temporal Compression Of Speech: An Evaluation}, journal = {{IEEE} Trans. Speech Audio Process.}, volume = {16}, number = {4}, pages = {790--796}, year = {2008}, url = {https://doi.org/10.1109/TASL.2008.916527}, doi = {10.1109/TASL.2008.916527}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/taslp/TuckerW08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/titb/PhamWZBBHABHLW08, author = {Tuan D. Pham and Honghui Wang and Xiaobo Zhou and Dominik Beck and Miriam Brandl and Gerard Hoehn and Joseph Azok and Marie{-}Luise Brennan and Stanley L. Hazen and King C. Li and Stephen T. C. Wong}, title = {Computational Prediction Models for Early Detection of Risk of Cardiovascular Events Using Mass Spectrometry Data}, journal = {{IEEE} Trans. Inf. Technol. Biomed.}, volume = {12}, number = {5}, pages = {636--643}, year = {2008}, url = {https://doi.org/10.1109/TITB.2007.908756}, doi = {10.1109/TITB.2007.908756}, timestamp = {Wed, 13 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/titb/PhamWZBBHABHLW08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aina/LiTTCH08, author = {Xiaorong Li and Stephen John Turner and Kok Heng Tong and Hoong{-}Maeng Chan and Terence Hung}, title = {Design of an SLA-Driven QoS Management Platform for Provisioning Multimedia Personalized Services}, booktitle = {22nd International Conference on Advanced Information Networking and Applications, {AINA} 2008, Workshops Proceedings, GinoWan, Okinawa, Japan, March 25-28, 2008}, pages = {1405--1409}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/WAINA.2008.256}, doi = {10.1109/WAINA.2008.256}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aina/LiTTCH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/asiams/ChenCTW08, author = {Xinjun Chen and Wentong Cai and Stephen John Turner and Yong Wang}, title = {Shared Variable Management in SOAr-DSGrid}, booktitle = {Second Asia International Conference on Modelling and Simulation, {AMS} 2008, Kuala Lumpur, Malaysia, May 13-15, 2008}, pages = {154--161}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/AMS.2008.161}, doi = {10.1109/AMS.2008.161}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/asiams/ChenCTW08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bliss/YanciPA08, author = {Asier Goikoetxea Yanci and Stephen Pickles and Tughrul Arslan}, editor = {Adrian Stoica and Tughrul Arslan and Daniel Howard and Tetsuya Higuchi and Ahmed O. El{-}Rayis}, title = {Detecting Voltage Glitch Attacks on Secure Devices}, booktitle = {2008 {ECSIS} Symposium on Bio-inspired, Learning, and Intelligent Systems for Security, {BLISS} 2008, Edinburgh, UK, 4-6 August 2008}, pages = {75--80}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/BLISS.2008.26}, doi = {10.1109/BLISS.2008.26}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/bliss/YanciPA08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/Turner08, author = {Stephen John Turner}, editor = {David J. Roberts and Abdulmotaleb El{-}Saddik and Alois Ferscha}, title = {Distributed Simulation on the Grid: Opportunities and Challenges}, booktitle = {12th {IEEE/ACM} International Symposium on Distributed Simulation and Real-Time Applications, 27-29 October 2008, Vancouver, BC, Canada, Proceedings}, pages = {3}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/DS-RT.2008.49}, doi = {10.1109/DS-RT.2008.49}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dsrt/Turner08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/evoW/EdwardsBTDTSMR08, author = {Todd L. Edwards and William S. Bush and Stephen D. Turner and Scott M. Dudek and Eric Torstenson and Mike Schmidt and Eden Martin and Marylyn D. Ritchie}, editor = {Elena Marchiori and Jason H. Moore}, title = {Generating Linkage Disequilibrium Patterns in Data Simulations Using genomeSIMLA}, booktitle = {Evolutionary Computation, Machine Learning and Data Mining in Bioinformatics, 6th European Conference, EvoBIO 2008, Naples, Italy, March 26-28, 2008. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4973}, pages = {24--35}, publisher = {Springer}, year = {2008}, url = {https://doi.org/10.1007/978-3-540-78757-0\_3}, doi = {10.1007/978-3-540-78757-0\_3}, timestamp = {Wed, 25 Sep 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/evoW/EdwardsBTDTSMR08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/fecs/TurnerF08, author = {Stephen W. Turner and Michael Farmer}, editor = {Hamid R. Arabnia and Victor A. Clincy and Nasser Tadayon}, title = {Assessment of Student Performance in an Internet-Based Multimedia Classroom}, booktitle = {Proceedings of the 2008 International Conference on Frontiers in Education: Computer Science {\&} Computer Engineering, {FECS} 2008, July 14-17, 2008, Las Vegas, Nevada, {USA}}, pages = {411--415}, publisher = {{CSREA} Press}, year = {2008}, timestamp = {Mon, 21 Dec 2015 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/fecs/TurnerF08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hoti/FeehrerRSGYPHT08, author = {John R. Feehrer and Paul Rotker and Milton Shih and Paul Gingras and Peter Yakutis and Stephen Phillips and John Heath and Sebastian Turullols}, title = {Coherency Hub Design for Multi-Node Victoria Falls Server Systems}, booktitle = {16th Annual {IEEE} Symposium on High Performance Interconnects {(HOTI} 2008), 26-28 August 2008, Stanford, CA, {USA}}, pages = {43--50}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/HOTI.2008.12}, doi = {10.1109/HOTI.2008.12}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/hoti/FeehrerRSGYPHT08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iadis/FarrierGT08, author = {Stephen Farrier and Patricia Gannon{-}Leary and Chris Turnock}, editor = {Miguel Baptista Nunes and Maggie McPherson}, title = {Risk Managing Your Vle: Strategic Implications For Learning Providers}, booktitle = {{IADIS} International Conference e-Learning 2008, Amsterdam, The Netherlands, July 22-25, 2008. Proceedings}, pages = {33--37}, publisher = {{IADIS}}, year = {2008}, timestamp = {Sun, 01 Mar 2009 21:54:10 +0100}, biburl = {https://dblp.org/rec/conf/iadis/FarrierGT08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccS/AydtTCLLG08, author = {Heiko Aydt and Stephen John Turner and Wentong Cai and Malcolm Yoke Hean Low and Peter Lendermann and Boon{-}Ping Gan}, editor = {Marian Bubak and G. Dick van Albada and Jack J. Dongarra and Peter M. A. Sloot}, title = {Symbiotic Simulation Control in Semiconductor Manufacturing}, booktitle = {Computational Science - {ICCS} 2008, 8th International Conference, Krak{\'{o}}w, Poland, June 23-25, 2008, Proceedings, Part {III}}, series = {Lecture Notes in Computer Science}, volume = {5103}, pages = {26--35}, publisher = {Springer}, year = {2008}, url = {https://doi.org/10.1007/978-3-540-69389-5\_5}, doi = {10.1007/978-3-540-69389-5\_5}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iccS/AydtTCLLG08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/TullyMKC08, author = {Stephen Tully and Hyungpil Moon and George Kantor and Howie Choset}, title = {Iterated filters for bearing-only {SLAM}}, booktitle = {2008 {IEEE} International Conference on Robotics and Automation, {ICRA} 2008, May 19-23, 2008, Pasadena, California, {USA}}, pages = {1442--1448}, publisher = {{IEEE}}, year = {2008}, url = {https://doi.org/10.1109/ROBOT.2008.4543405}, doi = {10.1109/ROBOT.2008.4543405}, timestamp = {Mon, 22 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icra/TullyMKC08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/interspeech/WrigleyTBW08, author = {Stuart N. Wrigley and Simon Tucker and Guy J. Brown and Steve Whittaker}, title = {The influence of audio presentation style on multitasking during teleconferences}, booktitle = {9th Annual Conference of the International Speech Communication Association, {INTERSPEECH} 2008, Brisbane, Australia, September 22-26, 2008}, pages = {801--804}, publisher = {{ISCA}}, year = {2008}, url = {https://doi.org/10.21437/Interspeech.2008-245}, doi = {10.21437/INTERSPEECH.2008-245}, timestamp = {Tue, 11 Jun 2024 16:45:43 +0200}, biburl = {https://dblp.org/rec/conf/interspeech/WrigleyTBW08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ispd/LiAHMQV08, author = {Zhuo Li and Charles J. Alpert and Shiyan Hu and Tuhin Muhmud and Stephen T. Quay and Paul G. Villarrubia}, editor = {David Z. Pan and Gi{-}Joon Nam}, title = {Fast interconnect synthesis with layer assignment}, booktitle = {Proceedings of the 2008 International Symposium on Physical Design, {ISPD} 2008, Portland, Oregon, USA, April 13-16, 2008}, pages = {71--77}, publisher = {{ACM}}, year = {2008}, url = {https://doi.org/10.1145/1353629.1353648}, doi = {10.1145/1353629.1353648}, timestamp = {Tue, 06 Nov 2018 11:07:47 +0100}, biburl = {https://dblp.org/rec/conf/ispd/LiAHMQV08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/massdata/PhamWZBBHABHW08, author = {Tuan D. Pham and Honghui Wang and Xiaobo Zhou and Dominik Beck and Miriam Brandl and Gerard Hoehn and Joseph Azok and Marie{-}Luise Brennan and Stanley L. Hazen and Stephen T. C. Wong}, editor = {Petra Perner and Ovidio Salvetti}, title = {Classification of Mass Spectrometry Based Protein Markers by Kriging Error Matching}, booktitle = {Advances in Mass Data Analysis of Images and Signals in Medicine, Biotechnology, Chemistry and Food Industry, Third International Conference, {MDA} 2008, Leipzig, Germany, July 14, 2008, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5108}, pages = {82--94}, publisher = {Springer}, year = {2008}, url = {https://doi.org/10.1007/978-3-540-70715-8\_8}, doi = {10.1007/978-3-540-70715-8\_8}, timestamp = {Tue, 14 May 2019 10:00:48 +0200}, biburl = {https://dblp.org/rec/conf/massdata/PhamWZBBHABHW08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mlmi/TuckerKW08, author = {Simon Tucker and Nicos Kyprianou and Steve Whittaker}, editor = {Andrei Popescu{-}Belis and Rainer Stiefelhagen}, title = {Time-Compressing Speech: {ASR} Transcripts Are an Effective Way to Support Gist Extraction}, booktitle = {Machine Learning for Multimodal Interaction, 5th International Workshop, {MLMI} 2008, Utrecht, The Netherlands, September 8-10, 2008. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5237}, pages = {226--235}, publisher = {Springer}, year = {2008}, url = {https://doi.org/10.1007/978-3-540-85853-9\_21}, doi = {10.1007/978-3-540-85853-9\_21}, timestamp = {Mon, 11 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mlmi/TuckerKW08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mmvr/TurinskyFTDSSWH08, author = {Andrei L. Turinsky and Elena Fanea and Quang Trinh and Xiaoli Dong and Julie N. Stromer and Xueling Shu and Stephen Wat and Benedikt Hallgr{\'{\i}}msson and Jonathan W. Hill and Carol Edwards and Brenda Grosenick and Masumi Yajima and Christoph W. Sensen}, editor = {James D. Westwood and Randy S. Haluck and Helene M. Hoffman and Greg T. Mogel and Roger Phillips and Richard A. Robb and Kirby G. Vosburgh}, title = {Integration of Genomic and Medical Data into a 3D Atlas of Human Anatomy}, booktitle = {Medicine Meets Virtual Reality 16 - parallel, combinatorial, convergent: NextMed by Design, {MMVR} 2008, Long Beach, CA, USA, January 29, 2008}, series = {Studies in Health Technology and Informatics}, volume = {132}, pages = {526--531}, publisher = {{IOS} Press}, year = {2008}, timestamp = {Tue, 09 Jan 2018 17:48:16 +0100}, biburl = {https://dblp.org/rec/conf/mmvr/TurinskyFTDSSWH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/AydtTCL08, author = {Heiko Aydt and Stephen John Turner and Wentong Cai and Malcolm Yoke Hean Low}, editor = {Francesco Quaglia and Jason Liu}, title = {Symbiotic Simulation Systems: An Extended Definition Motivated by Symbiosis in Biology}, booktitle = {22st International Workshop on Principles of Advanced and Distributed Simulation, {PADS} 2008, Roma, Italy, June 3-6, 2008}, pages = {109--116}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/PADS.2008.17}, doi = {10.1109/PADS.2008.17}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pads/AydtTCL08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/PanTCL08, author = {Ke Pan and Stephen John Turner and Wentong Cai and Zengxiang Li}, editor = {Francesco Quaglia and Jason Liu}, title = {A Hybrid {HLA} Time Management Algorithm Based on Both Conditional and Unconditional Information}, booktitle = {22st International Workshop on Principles of Advanced and Distributed Simulation, {PADS} 2008, Roma, Italy, June 3-6, 2008}, pages = {203--211}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/PADS.2008.11}, doi = {10.1109/PADS.2008.11}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/PanTCL08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/TaylorTS08, author = {Simon J. E. Taylor and Stephen John Turner and Steffen Stra{\ss}burger}, editor = {Francesco Quaglia and Jason Liu}, title = {Clarifying Interoperability: The {SISO} {CSPI} {PDG} Standard for Commercial Off-The-Shelf Simulation Package Interoperability Reference Models}, booktitle = {22st International Workshop on Principles of Advanced and Distributed Simulation, {PADS} 2008, Roma, Italy, June 3-6, 2008}, pages = {153}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/PADS.2008.35}, doi = {10.1109/PADS.2008.35}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pads/TaylorTS08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/scss/ClarkST08, author = {Stephen O. Clark and Steven T. Shorrock and Nic Turley}, editor = {Felix Redmill and Tom Anderson}, title = {Human Factors Safety Assurance for Changing {ATM} Systems}, booktitle = {Improvements in System Safety - Proceedings of the Sixteenth Safety-Critical Systems Symposium, Brighton, UK, February 5-7, 2008}, pages = {155--173}, publisher = {Springer}, year = {2008}, url = {https://doi.org/10.1007/978-1-84800-100-8\_10}, doi = {10.1007/978-1-84800-100-8\_10}, timestamp = {Fri, 15 May 2020 12:05:38 +0200}, biburl = {https://dblp.org/rec/conf/scss/ClarkST08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigcse/TurnerQPE08, author = {Scott A. Turner and Ricardo Quintana{-}Castillo and Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and Stephen H. Edwards}, editor = {J. D. Dougherty and Susan H. Rodger and Sue Fitzgerald and Mark Guzdial}, title = {Misunderstandings about object-oriented design: experiences using code reviews}, booktitle = {Proceedings of the 39th {SIGCSE} Technical Symposium on Computer Science Education, {SIGCSE} 2008, Portland, OR, USA, March 12-15, 2008}, pages = {97--101}, publisher = {{ACM}}, year = {2008}, url = {https://doi.org/10.1145/1352135.1352169}, doi = {10.1145/1352135.1352169}, timestamp = {Wed, 10 Mar 2021 13:17:16 +0100}, biburl = {https://dblp.org/rec/conf/sigcse/TurnerQPE08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tpcg/LongshawTH08, author = {Stephen M. Longshaw and Martin J. Turner and W. Terry Hewitt}, editor = {Ik Soo Lim and Wen Tang}, title = {Interactive Grid Based Binning for Information Visualization}, booktitle = {{EG} {UK} Theory and Practice of Computer Graphics, Manchester, United Kingdom, 2008. Proceedings}, pages = {35--42}, publisher = {Eurographics Association}, year = {2008}, url = {https://doi.org/10.2312/LocalChapterEvents/TPCG/TPCG08/035-042}, doi = {10.2312/LOCALCHAPTEREVENTS/TPCG/TPCG08/035-042}, timestamp = {Sat, 16 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/tpcg/LongshawTH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/AydtTCLLGA08, author = {Heiko Aydt and Stephen John Turner and Wentong Cai and Malcolm Yoke Hean Low and Peter Lendermann and Boon{-}Ping Gan and Rassul Ayani}, editor = {Scott J. Mason and Raymond R. Hill and Lars M{\"{o}}nch and Oliver Rose and Thomas Jefferson and John W. Fowler}, title = {Preventive what-if analysis in symbiotic simulation}, booktitle = {Proceedings of the 2008 Winter Simulation Conference, Global Gateway to Discovery, {WSC} 2008, InterContinental Hotel, Miami, Florida, USA, December 7-10, 2008}, pages = {750--758}, publisher = {{WSC}}, year = {2008}, url = {https://doi.org/10.1109/WSC.2008.4736137}, doi = {10.1109/WSC.2008.4736137}, timestamp = {Thu, 10 Jun 2021 22:19:17 +0200}, biburl = {https://dblp.org/rec/conf/wsc/AydtTCLLGA08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/LiCTP08, author = {Zengxiang Li and Wentong Cai and Stephen John Turner and Ke Pan}, editor = {Scott J. Mason and Raymond R. Hill and Lars M{\"{o}}nch and Oliver Rose and Thomas Jefferson and John W. Fowler}, title = {Improving performance by replicating simulations with alternative synchronization approaches}, booktitle = {Proceedings of the 2008 Winter Simulation Conference, Global Gateway to Discovery, {WSC} 2008, InterContinental Hotel, Miami, Florida, USA, December 7-10, 2008}, pages = {1112--1120}, publisher = {{WSC}}, year = {2008}, url = {https://doi.org/10.1109/WSC.2008.4736180}, doi = {10.1109/WSC.2008.4736180}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/LiCTP08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/LiangTG08, author = {Yuanxi Liang and Stephen John Turner and Boon{-}Ping Gan}, editor = {Scott J. Mason and Raymond R. Hill and Lars M{\"{o}}nch and Oliver Rose and Thomas Jefferson and John W. Fowler}, title = {Predictive-conservative synchronization for commercial simulation package interoperability}, booktitle = {Proceedings of the 2008 Winter Simulation Conference, Global Gateway to Discovery, {WSC} 2008, InterContinental Hotel, Miami, Florida, USA, December 7-10, 2008}, pages = {1103--1111}, publisher = {{WSC}}, year = {2008}, url = {https://doi.org/10.1109/WSC.2008.4736179}, doi = {10.1109/WSC.2008.4736179}, timestamp = {Thu, 10 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/LiangTG08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/TaylorTS08, author = {Simon J. E. Taylor and Stephen John Turner and Steffen Stra{\ss}burger}, editor = {Scott J. Mason and Raymond R. Hill and Lars M{\"{o}}nch and Oliver Rose and Thomas Jefferson and John W. Fowler}, title = {Guidelines for commercial off-the-shelf Simulation Package interoperability}, booktitle = {Proceedings of the 2008 Winter Simulation Conference, Global Gateway to Discovery, {WSC} 2008, InterContinental Hotel, Miami, Florida, USA, December 7-10, 2008}, pages = {193--204}, publisher = {{WSC}}, year = {2008}, url = {https://doi.org/10.1109/WSC.2008.4736068}, doi = {10.1109/WSC.2008.4736068}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/TaylorTS08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:series/sci/FuLWOT08, author = {Xiuju Fu and Xiaorong Li and Lipo Wang and David Ong and Stephen John Turner}, editor = {John Fulcher and Lakhmi C. Jain}, title = {Data Mining in QoS-Aware Media Grids}, booktitle = {Computational Intelligence: {A} Compendium}, series = {Studies in Computational Intelligence}, volume = {115}, pages = {689--714}, publisher = {Springer}, year = {2008}, url = {https://doi.org/10.1007/978-3-540-78293-3\_16}, doi = {10.1007/978-3-540-78293-3\_16}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/series/sci/FuLWOT08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ease/2008, editor = {Giuseppe Visaggio and Maria Teresa Baldassarre and Stephen G. Linkman and Mark Turner}, title = {12th International Conference on Evaluation and Assessment in Software Engineering, {EASE} 2008, University of Bari, Italy, 26-27 June 2008}, series = {Workshops in Computing}, publisher = {{BCS}}, year = {2008}, url = {http://ewic.bcs.org/category/16334}, timestamp = {Tue, 15 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ease/2008.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-0802-3047, author = {C. Saha and Terence O'Donnell and J. Godsell and L. Carlioz and Ningning Wang and Paul McCloskey and Stephen P. Beeby and M.{-}J. Tudor and Russel N. Torah}, title = {Step-up converter for electromagnetic vibrational energy scavenger}, journal = {CoRR}, volume = {abs/0802.3047}, year = {2008}, url = {http://arxiv.org/abs/0802.3047}, eprinttype = {arXiv}, eprint = {0802.3047}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-0802-3047.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/iasc/BowmanLTCN07, author = {Catherine D. D. Bowman and Stephenie H. Lievense and Edward W. Tunstel and Eugene C. Chalfant and Jeffrey S. Norris}, title = {{NASA} Robotics Education: Inspiring the Next Generation of Explorers}, journal = {Intell. Autom. Soft Comput.}, volume = {13}, number = {1}, pages = {69--80}, year = {2007}, url = {https://doi.org/10.1080/10798587.2007.10642951}, doi = {10.1080/10798587.2007.10642951}, timestamp = {Fri, 26 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/iasc/BowmanLTCN07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/iee/KitchenhamBBTCL07, author = {Barbara A. Kitchenham and David Budgen and Pearl Brereton and Mark Turner and Stuart M. Charters and Stephen G. Linkman}, title = {Large-scale software engineering questions expert opinion or empirical evidence?}, journal = {{IET} Softw.}, volume = {1}, number = {5}, pages = {161--171}, year = {2007}, url = {https://doi.org/10.1049/iet-sen:20060052}, doi = {10.1049/IET-SEN:20060052}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/iee/KitchenhamBBTCL07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jos/LendermannTLGJC07, author = {Peter Lendermann and Stephen John Turner and Malcolm Y. H. Low and Boon Ping Gan and Nirupam Julka and Lai Peng Chan and Wentong Cai and Loo Hay Lee and Ek Peng Chew and Suyan Teng and Leon F. McGinnis}, title = {An integrated and adaptive decision-support framework for high-tech manufacturing and service networks}, journal = {J. Simulation}, volume = {1}, number = {2}, pages = {69--79}, year = {2007}, url = {https://doi.org/10.1057/palgrave.jos.4250016}, doi = {10.1057/PALGRAVE.JOS.4250016}, timestamp = {Sat, 19 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jos/LendermannTLGJC07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jssc/BehzadCC0PLLLAK07, author = {Arya Behzad and Keith A. Carter and Hung{-}Ming Chien and Stephen Wu and Meng{-}An Pan and C. Paul Lee and Qiang (Tom) Li and John C. Leete and Stephen Au and Michael S. Kappes and Zhimin Zhou and Dayo Ojo and Lijun Zhang and Alireza Zolfaghari and Jesse Castaneda and Hooman Darabi and Benson Yeung and Ahmadreza Rofougaran and Maryam Rofougaran and Jason Trachewsky and Tushar Moorti and Rohit V. Gaikwad and Amit Bagchi and Joachim S. Hammerschmidt and Jay Pattin and Jacob J. Rael and Bojko Marholev}, title = {A Fully Integrated {MIMO} Multiband Direct Conversion {CMOS} Transceiver for {WLAN} Applications (802.11n)}, journal = {{IEEE} J. Solid State Circuits}, volume = {42}, number = {12}, pages = {2795--2808}, year = {2007}, url = {https://doi.org/10.1109/JSSC.2007.908667}, doi = {10.1109/JSSC.2007.908667}, timestamp = {Wed, 02 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jssc/BehzadCC0PLLLAK07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/lre/MostefaMCPCTCTCTPMTBSBR07, author = {Djamel Mostefa and Nicolas Moreau and Khalid Choukri and Gerasimos Potamianos and Stephen M. Chu and Ambrish Tyagi and Josep R. Casas and Jordi Turmo and Luca Cristoforetti and Francesco Tobia and Aristodemos Pnevmatikakis and Vasileios Mylonakis and Fotios Talantzis and Susanne Burger and Rainer Stiefelhagen and Keni Bernardin and Cedrick Rochet}, title = {The {CHIL} audiovisual corpus for lecture and meeting analysis inside smart rooms}, journal = {Lang. Resour. Evaluation}, volume = {41}, number = {3-4}, pages = {389--407}, year = {2007}, url = {https://doi.org/10.1007/s10579-007-9054-4}, doi = {10.1007/S10579-007-9054-4}, timestamp = {Sun, 25 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/lre/MostefaMCPCTCTCTPMTBSBR07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/neuroimage/ShiTZRTDT07, author = {Yonggang Shi and Paul M. Thompson and Greig I. de Zubicaray and Stephen E. Rose and Zhuowen Tu and Ivo D. Dinov and Arthur W. Toga}, title = {Direct mapping of hippocampal surfaces with intrinsic shape context}, journal = {NeuroImage}, volume = {37}, number = {3}, pages = {792--807}, year = {2007}, url = {https://doi.org/10.1016/j.neuroimage.2007.05.016}, doi = {10.1016/J.NEUROIMAGE.2007.05.016}, timestamp = {Fri, 30 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/neuroimage/ShiTZRTDT07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/simulation/ZhouCTWZ07, author = {Suiping Zhou and Wentong Cai and Stephen John Turner and Junhu Wei and Wenbo Zong}, title = {Flexible State Update Mechanism for Large-Scale Distributed Wargame Simulations}, journal = {Simul.}, volume = {83}, number = {10}, pages = {707--719}, year = {2007}, url = {https://doi.org/10.1177/0037549707085541}, doi = {10.1177/0037549707085541}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/simulation/ZhouCTWZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcad/TuanRDTK07, author = {Tim Tuan and Arifur Rahman and Satyaki Das and Steven Trimberger and Sean Kao}, title = {A 90-nm Low-Power {FPGA} for Battery-Powered Applications}, journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.}, volume = {26}, number = {2}, pages = {296--300}, year = {2007}, url = {https://doi.org/10.1109/TCAD.2006.885731}, doi = {10.1109/TCAD.2006.885731}, timestamp = {Thu, 24 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcad/TuanRDTK07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tkde/TuckerMSS07, author = {Peter A. Tucker and David Maier and Tim Sheard and Paul Stephens}, title = {Using Punctuation Schemes to Characterize Strategies for Querying over Data Streams}, journal = {{IEEE} Trans. Knowl. Data Eng.}, volume = {19}, number = {9}, pages = {1227--1240}, year = {2007}, url = {https://doi.org/10.1109/TKDE.2007.1052}, doi = {10.1109/TKDE.2007.1052}, timestamp = {Tue, 07 Nov 2017 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tkde/TuckerMSS07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmm/ZengTLHPRL07, author = {Zhihong Zeng and Jilin Tu and Ming Liu and Thomas S. Huang and Brian Pianfetti and Dan Roth and Stephen E. Levinson}, title = {Audio-Visual Affect Recognition}, journal = {{IEEE} Trans. Multim.}, volume = {9}, number = {2}, pages = {424--428}, year = {2007}, url = {https://doi.org/10.1109/TMM.2006.886310}, doi = {10.1109/TMM.2006.886310}, timestamp = {Thu, 01 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tmm/ZengTLHPRL07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tomccap/ZhouCTLW07, author = {Suiping Zhou and Wentong Cai and Stephen John Turner and Bu{-}Sung Lee and Junhu Wei}, title = {Critical causal order of events in distributed virtual environments}, journal = {{ACM} Trans. Multim. Comput. Commun. Appl.}, volume = {3}, number = {3}, pages = {15}, year = {2007}, url = {https://doi.org/10.1145/1236471.1236474}, doi = {10.1145/1236471.1236474}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tomccap/ZhouCTLW07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ccgrid/TavaresTKFNMCHOLS07, author = {Tulio Tavares and George Teodoro and Tahsin M. Kur{\c{c}} and Renato Ferreira and Dorgival Olavo Guedes Neto and Wagner Meira Jr. and {\"{U}}mit V. {\c{C}}ataly{\"{u}}rek and Shannon Hastings and Scott Oster and Stephen Langella and Joel H. Saltz}, title = {An Efficient and Reliable Scientific Workflow System}, booktitle = {Seventh {IEEE} International Symposium on Cluster Computing and the Grid (CCGrid 2007), 14-17 May 2007, Rio de Janeiro, Brazil}, pages = {445--452}, publisher = {{IEEE} Computer Society}, year = {2007}, url = {https://doi.org/10.1109/CCGRID.2007.20}, doi = {10.1109/CCGRID.2007.20}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ccgrid/TavaresTKFNMCHOLS07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ccnc/LiJFCHHOTV07, author = {Xiaorong Li and Wei Jie and Xiuju Fu and Hoong{-}Maeng Chan and Quoc{-}Thuan Ho and Terence Hung and David Ong and Stephen John Turner and Bharadwaj Veeravalli}, title = {A Multi-Agent Method for Streaming Quality Monitoring and Analysis over Media Grid}, booktitle = {4th {IEEE} Consumer Communications and Networking Conference, {CCNC} 2007, Las Vegas, NV, USA, January 11-13, 2007}, pages = {327--331}, publisher = {{IEEE}}, year = {2007}, url = {https://doi.org/10.1109/CCNC.2007.71}, doi = {10.1109/CCNC.2007.71}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ccnc/LiJFCHHOTV07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cicc/TuanST07, author = {Tim Tuan and Tom Strader and Steve Trimberger}, title = {Analysis of Data Remanence in a 90nm {FPGA}}, booktitle = {Proceedings of the {IEEE} 2007 Custom Integrated Circuits Conference, {CICC} 2007, DoubleTree Hotel, San Jose, California, USA, September 16-19, 2007}, pages = {93--96}, publisher = {{IEEE}}, year = {2007}, url = {https://doi.org/10.1109/CICC.2007.4405689}, doi = {10.1109/CICC.2007.4405689}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/cicc/TuanST07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/LiCTP07, author = {Zengxiang Li and Wentong Cai and Stephen John Turner and Ke Pan}, editor = {David J. Roberts and Georgios Theodoropoulos and Abdulmotaleb El{-}Saddik}, title = {Federate Migration in a Service Oriented {HLA} {RTI}}, booktitle = {11th {IEEE} International Symposium on Distributed Simulation and Real-Time Applications, {DS-RT} 2007, Chania, Greece, 22-24 October 2007}, pages = {113--121}, publisher = {{IEEE} Computer Society}, year = {2007}, url = {https://doi.org/10.1109/DS-RT.2007.31}, doi = {10.1109/DS-RT.2007.31}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dsrt/LiCTP07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ease/BudgenKCTBL07, author = {David Budgen and Barbara A. Kitchenham and Stuart M. Charters and Mark Turner and Pearl Brereton and Stephen G. Linkman}, editor = {Barbara A. Kitchenham and Pearl Brereton and Mark Turner}, title = {Preliminary results of a study of the completeness and clarity of structured abstracts}, booktitle = {11th International Conference on Evaluation and Assessment in Software Engineering, {EASE} 2007, Keele University, UK, 2-3 April 2007}, series = {Workshops in Computing}, publisher = {{BCS}}, year = {2007}, url = {http://ewic.bcs.org/content/ConWebDoc/10676}, timestamp = {Mon, 14 Sep 2020 16:49:35 +0200}, biburl = {https://dblp.org/rec/conf/ease/BudgenKCTBL07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/esem/BaileyBTKBL07, author = {John Bailey and David Budgen and Mark Turner and Barbara A. Kitchenham and Pearl Brereton and Stephen G. Linkman}, title = {Evidence relating to Object-Oriented software design: {A} survey}, booktitle = {Proceedings of the First International Symposium on Empirical Software Engineering and Measurement, {ESEM} 2007, September 20-21, 2007, Madrid, Spain}, pages = {482--484}, publisher = {{ACM} / {IEEE} Computer Society}, year = {2007}, url = {https://doi.org/10.1109/ESEM.2007.58}, doi = {10.1109/ESEM.2007.58}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/esem/BaileyBTKBL07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/gecco/SwiftTCG07, author = {Stephen Swift and Allan Tucker and Jason Crampton and David Garway{-}Heath}, editor = {Hod Lipson}, title = {An improved restricted growth function genetic algorithm for the consensus clustering of retinal nerve fibre data}, booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2007, Proceedings, London, England, UK, July 7-11, 2007}, pages = {2174--2181}, publisher = {{ACM}}, year = {2007}, url = {https://doi.org/10.1145/1276958.1277376}, doi = {10.1145/1276958.1277376}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/gecco/SwiftTCG07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/gecco/TuckerSC07, author = {Allan Tucker and Stephen Swift and Jason Crampton}, editor = {Hod Lipson}, title = {Efficiency updates for the restricted growth function {GA} for grouping problems}, booktitle = {Genetic and Evolutionary Computation Conference, {GECCO} 2007, Proceedings, London, England, UK, July 7-11, 2007}, pages = {1536}, publisher = {{ACM}}, year = {2007}, url = {https://doi.org/10.1145/1276958.1277265}, doi = {10.1145/1276958.1277265}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/gecco/TuckerSC07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icwn/Turner07, author = {Stephen Turner}, editor = {Hamid R. Arabnia and Victor A. Clincy and Laurence Tianruo Yang}, title = {Dynamic Simple Channel Assignment Strategies for Multiple-Channel Ad Hoc Networks}, booktitle = {Proceedings of the 2007 International Conference on Wireless Networks, June 25-28, 2007, Las Vegas, Nevada, {USA}}, pages = {146--152}, publisher = {{CSREA} Press}, year = {2007}, timestamp = {Mon, 09 Feb 2009 10:38:02 +0100}, biburl = {https://dblp.org/rec/conf/icwn/Turner07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icws/PanTCL07, author = {Ke Pan and Stephen John Turner and Wentong Cai and Zengxiang Li}, title = {A Service Oriented {HLA} {RTI} on the Grid}, booktitle = {2007 {IEEE} International Conference on Web Services {(ICWS} 2007), July 9-13, 2007, Salt Lake City, Utah, {USA}}, pages = {984--992}, publisher = {{IEEE} Computer Society}, year = {2007}, url = {https://doi.org/10.1109/ICWS.2007.20}, doi = {10.1109/ICWS.2007.20}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icws/PanTCL07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/PedeltyDMBPTRJVPNJSLPP07, author = {Jeffrey A. Pedelty and Sadashiva Devadiga and Edward J. Masuoka and Molly E. Brown and Jorge E. Pinz{\'{o}}n and Compton J. Tucker and David P. Roy and Junchang Ju and Eric F. Vermote and Stephen D. Prince and Jyoteshwar R. Nagol and Christopher Justice and Crystal Schaaf and Jicheng Liu and Jeffrey L. Privette and Ana C. T. Pinheiro}, title = {Generating a long-term land data record from the {AVHRR} and {MODIS} Instruments}, booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium, {IGARSS} 2007, July 23-28, 2007, Barcelona, Spain, Proceedings}, pages = {1021--1025}, publisher = {{IEEE}}, year = {2007}, url = {https://doi.org/10.1109/IGARSS.2007.4422974}, doi = {10.1109/IGARSS.2007.4422974}, timestamp = {Wed, 16 Oct 2019 14:14:53 +0200}, biburl = {https://dblp.org/rec/conf/igarss/PedeltyDMBPTRJVPNJSLPP07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iros/TullyMMKC07, author = {Stephen Tully and Hyungpil Moon and Deryck Morales and George Kantor and Howie Choset}, title = {Hybrid localization using the hierarchical atlas}, booktitle = {2007 {IEEE/RSJ} International Conference on Intelligent Robots and Systems, October 29 - November 2, 2007, Sheraton Hotel and Marina, San Diego, California, {USA}}, pages = {2857--2864}, publisher = {{IEEE}}, year = {2007}, url = {https://doi.org/10.1109/IROS.2007.4399553}, doi = {10.1109/IROS.2007.4399553}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/iros/TullyMMKC07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isscc/BehzadCCWPLLLAKZOZZCDYRRTMGBRM07, author = {Arya Behzad and Keith A. Carter and Ed Chien and Steve Wu and Michael Pan and C. Paul Lee and Tom Li and John C. Leete and Stephen Au and Michael S. Kappes and Zhimin Zhou and Dayo Ojo and Lijun Zhang and Alireza Zolfaghari and Jesse Castaneda and Hooman Darabi and Benson Yeung and Reza Rofougaran and Maryam Rofougaran and Jason Trachewsky and Tushar Moorti and Rohit V. Gaikwad and Amit Bagchi and Jacob J. Rael and Bojko Marholev}, title = {A Fully Integrated {MIMO} Multi-Band Direct-Conversion {CMOS} Transceiver for {WLAN} Applications (802.11n)}, booktitle = {2007 {IEEE} International Solid-State Circuits Conference, {ISSCC} 2007, Digest of Technical Papers, San Francisco, CA, USA, February 11-15, 2007}, pages = {560--622}, publisher = {{IEEE}}, year = {2007}, url = {https://doi.org/10.1109/ISSCC.2007.373543}, doi = {10.1109/ISSCC.2007.373543}, timestamp = {Wed, 02 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/isscc/BehzadCCWPLLLAKZOZZCDYRRTMGBRM07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lcn/DinhHSCOB07, author = {Tuan Le Dinh and Wen Hu and Pavan Sikka and Peter I. Corke and Leslie Overs and Stephen Brosnan}, title = {Design and Deployment of a Remote Robust Sensor Network: Experiences from an Outdoor Water Quality Monitoring Network}, booktitle = {32nd Annual {IEEE} Conference on Local Computer Networks {(LCN} 2007), 15-18 October 2007, Clontarf Castle, Dublin, Ireland, Proceedings}, pages = {799--806}, publisher = {{IEEE} Computer Society}, year = {2007}, url = {https://doi.org/10.1109/LCN.2007.39}, doi = {10.1109/LCN.2007.39}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/lcn/DinhHSCOB07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/MurrayHTKCMR07, author = {Gabriel Murray and Pei{-}Yun Hsueh and Simon Tucker and Jonathan Kilgour and Jean Carletta and Johanna D. Moore and Steve Renals}, editor = {Candace L. Sidner and Tanja Schultz and Matthew Stone and ChengXiang Zhai}, title = {Automatic Segmentation and Summarization of Meeting Speech}, booktitle = {Human Language Technology Conference of the North American Chapter of the Association of Computational Linguistics, Proceedings, April 22-27, 2007, Rochester, New York, {USA}}, pages = {9--10}, publisher = {The Association for Computational Linguistics}, year = {2007}, url = {https://aclanthology.org/N07-4005/}, timestamp = {Wed, 07 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/MurrayHTKCMR07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/PanTCL07, author = {Ke Pan and Stephen John Turner and Wentong Cai and Zengxiang Li}, title = {An Efficient Sort-Based {DDM} Matching Algorithm for {HLA} Applications with a Large Spatial Environment}, booktitle = {21st International Workshop on Principles of Advanced and Distributed Simulation, PADS'07, San Diego, California, USA, June 12-15, 2007}, pages = {70--82}, publisher = {{IEEE} Computer Society}, year = {2007}, url = {https://doi.org/10.1109/PADS.2007.14}, doi = {10.1109/PADS.2007.14}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/PanTCL07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/scsc/WangTCC07, author = {Yong Wang and Stephen John Turner and Wentong Cai and Xinjun Chen}, editor = {Gabriel A. Wainer}, title = {Time management in a service-oriented architecture for distributed simulation on the grid}, booktitle = {Proceedings of the 2007 Summer Computer Simulation Conference, {SCSC} 2007, San Diego, California, USA, July 16-19, 2007}, pages = {392--399}, publisher = {Simulation Councils, Inc.}, year = {2007}, url = {https://dl.acm.org/citation.cfm?id=1357972}, timestamp = {Wed, 10 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/scsc/WangTCC07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tpcg/GobeawanXT07, author = {Like Gobeawan and Shuhong Xu and Stephen John Turner}, editor = {Ik Soo Lim and David Duce}, title = {Seamless Mesh Stitching Using Curve Approximation}, booktitle = {{EG} {UK} Theory and Practice of Computer Graphics, Bangor, United Kingdom, June 13-15, 2007}, pages = {165--172}, publisher = {Eurographics Association}, year = {2007}, url = {https://doi.org/10.2312/LocalChapterEvents/TPCG/TPCG07/165-172}, doi = {10.2312/LOCALCHAPTEREVENTS/TPCG/TPCG07/165-172}, timestamp = {Mon, 22 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/tpcg/GobeawanXT07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/LowTLPCLB07, author = {Malcolm Y. H. Low and Stephen John Turner and Ding Ling and Hai L. Peng and Lai Peng Chan and Peter Lendermann and Stephen J. Buckley}, editor = {Shane G. Henderson and Bahar Biller and Ming{-}Hua Hsieh and John Shortle and Jeffrey D. Tew and Russell R. Barton}, title = {Symbiotic simulation for business process re-engineering in high-tech manufacturing and service networks}, booktitle = {Proceedings of the Winter Simulation Conference, {WSC} 2007, Washington, DC, USA, December 9-12, 2007}, pages = {568--576}, publisher = {{WSC}}, year = {2007}, url = {https://doi.org/10.1109/WSC.2007.4419649}, doi = {10.1109/WSC.2007.4419649}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/LowTLPCLB07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/TaylorMSTLL07, author = {Simon J. E. Taylor and Navonil Mustafee and Steffen Stra{\ss}burger and Stephen John Turner and Malcolm Y. H. Low and John Ladbrook}, editor = {Shane G. Henderson and Bahar Biller and Ming{-}Hua Hsieh and John Shortle and Jeffrey D. Tew and Russell R. Barton}, title = {The {SISO} {CSPI} {PDG} standard for commercial off-the-shelf simulation package interoperability reference models}, booktitle = {Proceedings of the Winter Simulation Conference, {WSC} 2007, Washington, DC, USA, December 9-12, 2007}, pages = {594--602}, publisher = {{WSC}}, year = {2007}, url = {https://doi.org/10.1109/WSC.2007.4419652}, doi = {10.1109/WSC.2007.4419652}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/TaylorMSTLL07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-0711-3314, author = {Stephen P. Beeby and M.{-}J. Tudor and Russel N. Torah and E. Koukharenko and S. Roberts and Terence O'Donnell and S. Roy}, title = {Macro and Micro Scale Electromagnetic Kinetic Energy Harvesting Generators}, journal = {CoRR}, volume = {abs/0711.3314}, year = {2007}, url = {http://arxiv.org/abs/0711.3314}, eprinttype = {arXiv}, eprint = {0711.3314}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-0711-3314.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-0711-3316, author = {Terence O'Donnell and C. Saha and Stephen P. Beeby and M.{-}J. Tudor}, title = {Scaling Effects for Electromagnetic Vibrational Power Generators}, journal = {CoRR}, volume = {abs/0711.3316}, year = {2007}, url = {http://arxiv.org/abs/0711.3316}, eprinttype = {arXiv}, eprint = {0711.3316}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-0711-3316.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bmcbi/PattonSSXLDST06, author = {G. W. Patton and Robert M. Stephens and I. A. Sidorov and X. Xiao and Richard A. Lempicki and Dimiter S. Dimitrov and Robert H. Shoemaker and G. Tudor}, title = {Transcriptomic response to differentiation induction}, journal = {{BMC} Bioinform.}, volume = {7}, pages = {81}, year = {2006}, url = {https://doi.org/10.1186/1471-2105-7-81}, doi = {10.1186/1471-2105-7-81}, timestamp = {Wed, 17 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bmcbi/PattonSSXLDST06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ecra/ChauT06, author = {Stephen B. Chau and Paul Turner}, title = {Utilisation of mobile handheld devices for care management at an Australian aged care facility}, journal = {Electron. Commer. Res. Appl.}, volume = {5}, number = {4}, pages = {305--312}, year = {2006}, url = {https://doi.org/10.1016/j.elerap.2006.04.005}, doi = {10.1016/J.ELERAP.2006.04.005}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ecra/ChauT06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/gandc/ClevisTLDGL06, author = {Quintijn Clevis and Gregory E. Tucker and Stephen T. Lancaster and Arnaud Desitter and Nicole Gasparini and Gary Lock}, title = {A simple algorithm for the mapping of {TIN} data onto a static grid: Applied to the stratigraphic simulation of river meander deposits}, journal = {Comput. Geosci.}, volume = {32}, number = {6}, pages = {749--766}, year = {2006}, url = {https://doi.org/10.1016/j.cageo.2005.05.012}, doi = {10.1016/J.CAGEO.2005.05.012}, timestamp = {Fri, 21 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/gandc/ClevisTLDGL06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijcia/PhamTZW06, author = {Tuan D. Pham and Dat Tran and Xiaobo Zhou and Stephen T. C. Wong}, title = {Integrated Algorithms for Image Analysis and Classification of Nuclear Division for High-Content Cell-Cycle Screening}, journal = {Int. J. Comput. Intell. Appl.}, volume = {6}, number = {1}, pages = {21--43}, year = {2006}, url = {https://doi.org/10.1142/S1469026806001769}, doi = {10.1142/S1469026806001769}, timestamp = {Wed, 01 Dec 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijcia/PhamTZW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/WheelerBBBCCCDEFGHKKKLMMOPSSSSSSSSTTWY06, author = {David L. Wheeler and Tanya Barrett and Dennis A. Benson and Stephen H. Bryant and Kathi Canese and Vyacheslav Chetvernin and Deanna M. Church and Michael DiCuccio and Ron Edgar and Scott Federhen and Lewis Y. Geer and Wolfgang Helmberg and Yuri Kapustin and David L. Kenton and Oleg Khovayko and David J. Lipman and Thomas L. Madden and Donna R. Maglott and James Ostell and Kim D. Pruitt and Gregory D. Schuler and Lynn M. Schriml and Edwin Sequeira and Stephen T. Sherry and Karl Sirotkin and Alexandre Souvorov and Grigory Starchenko and Tugba O. Suzek and Roman L. Tatusov and Tatiana A. Tatusova and Lukas Wagner and Eugene Yaschenko}, title = {Database resources of the National Center for Biotechnology Information}, journal = {Nucleic Acids Res.}, volume = {34}, number = {Database-Issue}, pages = {173--180}, year = {2006}, url = {https://doi.org/10.1093/nar/gkj158}, doi = {10.1093/NAR/GKJ158}, timestamp = {Tue, 18 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/WheelerBBBCCCDEFGHKKKLMMOPSSSSSSSSTTWY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pieee/BalchDFGIKPSW06, author = {Tucker R. Balch and Frank Dellaert and Adam Feldman and Andrew Guillory and Charles Lee Isbell Jr. and Zia Khan and Stephen C. Pratt and Andrew N. Stein and Hank Wilde}, title = {How Multirobot Systems Research will Accelerate our Understanding of Social Animal Behavior}, journal = {Proc. {IEEE}}, volume = {94}, number = {7}, pages = {1445--1463}, year = {2006}, url = {https://doi.org/10.1109/JPROC.2006.876969}, doi = {10.1109/JPROC.2006.876969}, timestamp = {Tue, 25 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pieee/BalchDFGIKPSW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigsoft/CounsellSTM06, author = {Steve Counsell and Stephen Swift and Allan Tucker and Emilia Mendes}, title = {Object-oriented cohesion subjectivity amongst experienced and novice developers: an empirical study}, journal = {{ACM} {SIGSOFT} Softw. Eng. Notes}, volume = {31}, number = {5}, pages = {1--10}, year = {2006}, url = {https://doi.org/10.1145/1163514.1163530}, doi = {10.1145/1163514.1163530}, timestamp = {Thu, 17 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigsoft/CounsellSTM06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/simulation/LowGWWTC06, author = {Malcolm Yoke Hean Low and Boon{-}Ping Gan and Junhu Wei and Xiaoguang Wang and Stephen John Turner and Wentong Cai}, title = {Shared State Synchronization for HLA-Based Distributed Simulation}, journal = {Simul.}, volume = {82}, number = {8}, pages = {511--521}, year = {2006}, url = {https://doi.org/10.1177/0037549706069342}, doi = {10.1177/0037549706069342}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/simulation/LowGWWTC06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/TaylorWTL06, author = {Simon J. E. Taylor and Xiaoguang Wang and Stephen John Turner and Malcolm Y. H. Low}, title = {Integrating Heterogeneous Distributed {COTS} Discrete-Event Simulation Packages: An Emerging Standards-Based Approach}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {A}}, volume = {36}, number = {1}, pages = {109--122}, year = {2006}, url = {https://doi.org/10.1109/TSMCA.2005.859167}, doi = {10.1109/TSMCA.2005.859167}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/TaylorWTL06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aspdac/PhamABBGHHJKKKLLNPPPPRVWWW06, author = {Dac C. Pham and Hans{-}Werner Anderson and Erwin Behnen and Mark Bolliger and Sanjay Gupta and H. Peter Hofstee and Paul E. Harvey and Charles R. Johns and James A. Kahle and Atsushi Kameyama and John M. Keaty and Bob Le and Sang Lee and Tuyen V. Nguyen and John G. Petrovick and Mydung Pham and Juergen Pille and Stephen D. Posluszny and Mack W. Riley and Joseph Verock and James D. Warnock and Steve Weitzel and Dieter F. Wendel}, editor = {Fumiyasu Hirose}, title = {Key features of the design methodology enabling a multi-core SoC implementation of a first-generation {CELL} processor}, booktitle = {Proceedings of the 2006 Conference on Asia South Pacific Design Automation: {ASP-DAC} 2006, Yokohama, Japan, January 24-27, 2006}, pages = {871--878}, publisher = {{IEEE}}, year = {2006}, url = {https://doi.org/10.1109/ASPDAC.2006.1594796}, doi = {10.1109/ASPDAC.2006.1594796}, timestamp = {Fri, 15 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aspdac/PhamABBGHHJKKKLLNPPPPRVWWW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ccgrid/JieHTC06, author = {Wei Jie and Terence Hung and Stephen John Turner and Wentong Cai}, title = {Architecture Model for Information Service in Large Scale Grid Environments}, booktitle = {Sixth {IEEE} International Symposium on Cluster Computing and the Grid (CCGrid 2006), 16-19 May 2006, Singapore}, pages = {107--114}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/CCGRID.2006.19}, doi = {10.1109/CCGRID.2006.19}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ccgrid/JieHTC06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ccgrid/TheodoropoulosZCMTCXL06, author = {Georgios Theodoropoulos and Yi Zhang and Dan Chen and Rob Minson and Stephen John Turner and Wentong Cai and Yong Xie and Brian Logan}, title = {Large Scale Distributed Simulation on the Grid}, booktitle = {Sixth {IEEE} International Symposium on Cluster Computing and the Grid (CCGrid 2006), 16-19 May 2006, Singapore}, pages = {63}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.ieeecomputersociety.org/10.1109/CCGRID.2006.151}, doi = {10.1109/CCGRID.2006.151}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ccgrid/TheodoropoulosZCMTCXL06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/chi/TuckerW06, author = {Simon Tucker and Steve Whittaker}, editor = {Rebecca E. Grinter and Tom Rodden and Paul M. Aoki and Edward Cutrell and Robin Jeffries and Gary M. Olson}, title = {Time is of the essence: an evaluation of temporal compression algorithms}, booktitle = {Proceedings of the 2006 Conference on Human Factors in Computing Systems, {CHI} 2006, Montr{\'{e}}al, Qu{\'{e}}bec, Canada, April 22-27, 2006}, pages = {329--338}, publisher = {{ACM}}, year = {2006}, url = {https://doi.org/10.1145/1124772.1124822}, doi = {10.1145/1124772.1124822}, timestamp = {Mon, 11 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/chi/TuckerW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cicc/RahmanDTT06, author = {Arifur Rahman and Satyaki Das and Tim Tuan and Steven Trimberger}, title = {Determination of Power Gating Granularity for {FPGA} Fabric}, booktitle = {Proceedings of the {IEEE} 2006 Custom Integrated Circuits Conference, {CICC} 2006, DoubleTree Hotel, San Jose, California, USA, September 10-13, 2006}, pages = {9--12}, publisher = {{IEEE}}, year = {2006}, url = {https://doi.org/10.1109/CICC.2006.320938}, doi = {10.1109/CICC.2006.320938}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/cicc/RahmanDTT06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/complife/HirschTSMOKL06, author = {Michael Hirsch and Allan Tucker and Stephen Swift and Nigel J. Martin and Christine A. Orengo and Paul Kellam and Xiaohui Liu}, editor = {Michael R. Berthold and Robert C. Glen and Ingrid Fischer}, title = {Improved Robustness in Time Series Analysis of Gene Expression Data by Polynomial Model Based Clustering}, booktitle = {Computational Life Sciences II, Second International Symposium, CompLife 2006, Cambridge, UK, September 27-29, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4216}, pages = {1--10}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11875741\_1}, doi = {10.1007/11875741\_1}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/complife/HirschTSMOKL06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/fpga/TuanKRDT06, author = {Tim Tuan and Sean Kao and Arifur Rahman and Satyaki Das and Steven Trimberger}, editor = {Steven J. E. Wilton and Andr{\'{e}} DeHon}, title = {A 90nm low-power {FPGA} for battery-powered applications}, booktitle = {Proceedings of the {ACM/SIGDA} 14th International Symposium on Field Programmable Gate Arrays, {FPGA} 2006, Monterey, California, USA, February 22-24, 2006}, pages = {3--11}, publisher = {{ACM}}, year = {2006}, url = {https://doi.org/10.1145/1117201.1117203}, doi = {10.1145/1117201.1117203}, timestamp = {Tue, 06 Nov 2018 16:58:23 +0100}, biburl = {https://dblp.org/rec/conf/fpga/TuanKRDT06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icdm/PhamCZW06, author = {Tuan D. Pham and Vikram Chandramohan and Xiaobo Zhou and Stephen T. C. Wong}, title = {Robust Feature Extraction and Reduction of Mass Spectrometry Data for Cancer Classification}, booktitle = {Workshops Proceedings of the 6th {IEEE} International Conference on Data Mining {(ICDM} 2006), 18-22 December 2006, Hong Kong, China}, pages = {202--206}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/ICDMW.2006.143}, doi = {10.1109/ICDMW.2006.143}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icdm/PhamCZW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icmcs/ZhangyPCTH06, author = {ZhenQiu Zhang and Gerasimos Potamianos and Stephen M. Chu and Jilin Tu and Thomas S. Huang}, title = {Person Tracking in Smart Rooms using Dynamic Programming and Adaptive Subspace Learning}, booktitle = {Proceedings of the 2006 {IEEE} International Conference on Multimedia and Expo, {ICME} 2006, July 9-12 2006, Toronto, Ontario, Canada}, pages = {2061--2064}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/ICME.2006.262620}, doi = {10.1109/ICME.2006.262620}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icmcs/ZhangyPCTH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iconip/TanNQK06, author = {Tuan Zea Tan and Geok See Ng and Hiok Chai Quek and Stephen C. L. Koh}, editor = {Irwin King and Jun Wang and Laiwan Chan and DeLiang L. Wang}, title = {Ovarian Cancer Prognosis by Hemostasis and Complementary Learning}, booktitle = {Neural Information Processing, 13th International Conference, {ICONIP} 2006, Hong Kong, China, October 3-6, 2006, Proceedings, Part {III}}, series = {Lecture Notes in Computer Science}, volume = {4234}, pages = {145--154}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11893295\_17}, doi = {10.1007/11893295\_17}, timestamp = {Fri, 16 Aug 2024 07:48:40 +0200}, biburl = {https://dblp.org/rec/conf/iconip/TanNQK06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icwn/Turner06, author = {Stephen Turner}, editor = {Hamid R. Arabnia}, title = {Simple Channel Assignment Strategies for Multiple Channel Ad Hoc Networks}, booktitle = {Proceedings of the 2006 International Conference on Wireless Networks, {ICWN} 2006, Las Vegas, Nevada, USA, June 26-29, 2006}, pages = {206--212}, publisher = {{CSREA} Press}, year = {2006}, timestamp = {Tue, 02 Jan 2007 13:08:22 +0100}, biburl = {https://dblp.org/rec/conf/icwn/Turner06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/CeccatoBBCDGRT06, author = {Pietro Ceccato and Michael A. Bell and M. Benno Blumenthal and Stephen J. Connor and Tufa Dinku and Emily K. Grover{-}Kopec and Chester F. Ropelewski and Madeleine C. Thomson}, title = {Use of Remote Sensing for Monitoring Climate Variability for Integrated Early Warning Systems: Applications for Human Diseases and Desert Locust Management}, booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium, {IGARSS} 2006, July 31 - August 4, 2006, Denver, Colorado, USA, Proceedings}, pages = {270--274}, publisher = {{IEEE}}, year = {2006}, url = {https://doi.org/10.1109/IGARSS.2006.74}, doi = {10.1109/IGARSS.2006.74}, timestamp = {Wed, 08 Dec 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/igarss/CeccatoBBCDGRT06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/ChenCTW06, author = {Xinjun Chen and Wentong Cai and Stephen John Turner and Yong Wang}, title = {SOAr-DSGrid: Service-Oriented Architecture for Distributed Simulation on the Grid}, booktitle = {20th {IEEE/ACM/SCS} Workshop on Principles of Advanced and Distributed Simulation, {PADS} 2006, Singapore, May 23-26, 2006}, pages = {65--73}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/PADS.2006.33}, doi = {10.1109/PADS.2006.33}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pads/ChenCTW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/ChenTC06, author = {Dan Chen and Stephen John Turner and Wentong Cai}, title = {A Framework for Robust HLA-based Distributed Simulations}, booktitle = {20th {IEEE/ACM/SCS} Workshop on Principles of Advanced and Distributed Simulation, {PADS} 2006, Singapore, May 23-26, 2006}, pages = {183--192}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/PADS.2006.7}, doi = {10.1109/PADS.2006.7}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pads/ChenTC06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/HuangCTHZLFA06, author = {Shell{-}Ying Huang and Wentong Cai and Stephen John Turner and Wen{-}Jing Hsu and Suiping Zhou and Malcolm Yoke Hean Low and Richard Fujimoto and Rassul Ayani}, title = {A Generic Symbiotic Simulation Framework}, booktitle = {20th {IEEE/ACM/SCS} Workshop on Principles of Advanced and Distributed Simulation, {PADS} 2006, Singapore, May 23-26, 2006}, pages = {131}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/PADS.2006.8}, doi = {10.1109/PADS.2006.8}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pads/HuangCTHZLFA06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/WangTT06, author = {Xiaoguang Wang and Stephen John Turner and Simon J. E. Taylor}, title = {{COTS} Simulation Package {(CSP)} Interoperability -A Solution to Synchronous Entity Passing}, booktitle = {20th {IEEE/ACM/SCS} Workshop on Principles of Advanced and Distributed Simulation, {PADS} 2006, Singapore, May 23-26, 2006}, pages = {201--210}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/PADS.2006.13}, doi = {10.1109/PADS.2006.13}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/WangTT06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wiser/BudgenCTBKL06, author = {David Budgen and Stuart M. Charters and Mark Turner and Pearl Brereton and Barbara A. Kitchenham and Stephen G. Linkman}, editor = {Nikolay Mehandjiev and Pearl Brereton and John G. Hosking}, title = {Investigating the applicability of the evidence-based paradigm to software engineering}, booktitle = {Proceedings of the 2006 Workshop on interdisciplinary software engineering research, {WISER} 2006, Shanghai, China, May 20, 2006}, pages = {7--14}, publisher = {{ACM}}, year = {2006}, url = {https://doi.org/10.1145/1137661.1137665}, doi = {10.1145/1137661.1137665}, timestamp = {Tue, 24 Oct 2023 14:39:14 +0200}, biburl = {https://dblp.org/rec/conf/wiser/BudgenCTBKL06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/GanCT06, author = {Boon{-}Ping Gan and Lai Peng Chan and Stephen John Turner}, editor = {L. Felipe Perrone and Barry Lawson and Jason Liu and Frederick P. Wieland}, title = {Interoperating simulations of automatic material handling systems and manufacturing processes}, booktitle = {Proceedings of the Winter Simulation Conference {WSC} 2006, Monterey, California, USA, December 3-6, 2006}, pages = {1129--1135}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/WSC.2006.323203}, doi = {10.1109/WSC.2006.323203}, timestamp = {Mon, 29 Apr 2024 16:19:40 +0200}, biburl = {https://dblp.org/rec/conf/wsc/GanCT06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/LadbrookLSTTW06, author = {John Ladbrook and Malcolm Y. H. Low and Steffen Stra{\ss}burger and Simon J. E. Taylor and Stephen John Turner and Xiaoguang Wang}, editor = {L. Felipe Perrone and Barry Lawson and Jason Liu and Frederick P. Wieland}, title = {Developing interoperability standards for distributed simulaton and {COTS} simulation packages with the {CSPI} {PDG}}, booktitle = {Proceedings of the Winter Simulation Conference {WSC} 2006, Monterey, California, USA, December 3-6, 2006}, pages = {1101--1110}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/WSC.2006.323200}, doi = {10.1109/WSC.2006.323200}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/LadbrookLSTTW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-cs-0603121, author = {Scott A. Turner and Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and Stephen H. Edwards}, title = {minimUML: {A} Minimalist Approach to {UML} Diagraming for Early Computer Science Education}, journal = {CoRR}, volume = {abs/cs/0603121}, year = {2006}, url = {http://arxiv.org/abs/cs/0603121}, eprinttype = {arXiv}, eprint = {cs/0603121}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-cs-0603121.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-cs-0607072, author = {Scott A. Turner and Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and Stephen H. Edwards}, title = {Effect of Interface Style in Peer Review Comments for {UML} Designs}, journal = {CoRR}, volume = {abs/cs/0607072}, year = {2006}, url = {http://arxiv.org/abs/cs/0607072}, eprinttype = {arXiv}, eprint = {cs/0607072}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-cs-0607072.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aim/AliodABBBBBCGHHLMMMMORSSSTVTTW05, author = {Diego Moll{\'{a}} Aliod and Eduardo Alonso and Srinivas Bangalore and Joseph E. Beck and Bir Bhanu and Jim Blythe and Mark S. Boddy and Amedeo Cesta and Marko Grobelnik and Dilek Hakkani{-}T{\"{u}}r and Sanda M. Harabagiu and Alain L{\'{e}}ger and Deborah L. McGuinness and Stacy Marsella and Natasa Milic{-}Frayling and Dunja Mladenic and Daniel Oblinger and Paul E. Rybski and Pavel Shvaiko and Stephen F. Smith and Biplav Srivastava and Sheila Tejada and Hannes H{\"{o}}gni Vilhj{\'{a}}lmsson and Kristinn R. Th{\'{o}}risson and G{\"{o}}khan T{\"{u}}r and Jos{\'{e}} Luis Vicedo Gonz{\'{a}}lez and Holger Wache}, title = {The Workshops at the Twentieth National Conference on Artificial Intelligence}, journal = {{AI} Mag.}, volume = {26}, number = {4}, pages = {102--108}, year = {2005}, url = {https://doi.org/10.1609/aimag.v26i4.1855}, doi = {10.1609/AIMAG.V26I4.1855}, timestamp = {Tue, 25 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/aim/AliodABBBBBCGHHLMMMMORSSSTVTTW05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bmcbi/DonofrioRBDWNFMGTOPFPSLD05, author = {Nicole Donofrio and Ravi Rajagopalon and Douglas E. Brown and Stephen E. Diener and Donald Windham and Shelly Nolin and Anna Floyd and Thomas K. Mitchell and Natalia Galadima and Sara Tucker and Marc J. Orbach and Gayatri Patel and Mark L. Farman and Vishal Pampanwar and Cari Soderlund and Yong{-}Hwan Lee and Ralph A. Dean}, title = {'PACLIMS': {A} component {LIM} system for high-throughput functional genomic analysis}, journal = {{BMC} Bioinform.}, volume = {6}, pages = {94}, year = {2005}, url = {https://doi.org/10.1186/1471-2105-6-94}, doi = {10.1186/1471-2105-6-94}, timestamp = {Sun, 15 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/bmcbi/DonofrioRBDWNFMGTOPFPSLD05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ec/TuckerCS05, author = {Allan Tucker and Jason Crampton and Stephen Swift}, title = {{RGFGA:} An Efficient Representation and Crossover for Grouping Genetic Algorithms}, journal = {Evol. Comput.}, volume = {13}, number = {4}, pages = {477--499}, year = {2005}, url = {https://doi.org/10.1162/106365605774666903}, doi = {10.1162/106365605774666903}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ec/TuckerCS05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fgcs/CaiYLT05, author = {Wentong Cai and Zijing Yuan and Malcolm Yoke Hean Low and Stephen John Turner}, title = {Federate migration in HLA-based simulation}, journal = {Future Gener. Comput. Syst.}, volume = {21}, number = {1}, pages = {87--95}, year = {2005}, url = {https://doi.org/10.1016/j.future.2004.09.019}, doi = {10.1016/J.FUTURE.2004.09.019}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/fgcs/CaiYLT05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijhpca/DennisFSSTTT05, author = {John M. Dennis and Aim{\'{e}} Fournier and William F. Spotz and Amik St.{-}Cyr and Mark A. Taylor and Stephen J. Thomas and Henry M. Tufo}, title = {High-Resolution Mesh Convergence Properties and Parallel Efficiency of a Spectral Element Atmospheric Dynamical Core}, journal = {Int. J. High Perform. Comput. Appl.}, volume = {19}, number = {3}, pages = {225--235}, year = {2005}, url = {https://doi.org/10.1177/1094342005056108}, doi = {10.1177/1094342005056108}, timestamp = {Thu, 12 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijhpca/DennisFSSTTT05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jeric/TurnerPE05, author = {Scott A. Turner and Manuel A. P{\'{e}}rez{-}Qui{\~{n}}ones and Stephen H. Edwards}, title = {minimUML: {A} minimalist approach to {UML} diagramming for early computer science education}, journal = {{ACM} J. Educ. Resour. Comput.}, volume = {5}, number = {4}, pages = {1:1--1:28}, year = {2005}, url = {https://doi.org/10.1145/1186639.1186640}, doi = {10.1145/1186639.1186640}, timestamp = {Sun, 17 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jeric/TurnerPE05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jwsr/JieZHTC05, author = {Wei Jie and Tianyi Zang and Terence Hung and Stephen John Turner and Wentong Cai}, title = {Information Management for Computational Grids}, journal = {Int. J. Web Serv. Res.}, volume = {2}, number = {3}, pages = {69--82}, year = {2005}, url = {https://doi.org/10.4018/jwsr.2005070103}, doi = {10.4018/JWSR.2005070103}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jwsr/JieZHTC05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/BarrettSTWNLRLFE05, author = {Tanya Barrett and Tugba O. Suzek and Dennis B. Troup and Stephen E. Wilhite and Wing{-}Chi Ngau and Pierre Ledoux and Dmitry Rudnev and Alex E. Lash and Wataru Fujibuchi and Ron Edgar}, title = {{NCBI} {GEO:} mining millions of expression profiles - database and tools}, journal = {Nucleic Acids Res.}, volume = {33}, number = {Database-Issue}, pages = {562--566}, year = {2005}, url = {https://doi.org/10.1093/nar/gki022}, doi = {10.1093/NAR/GKI022}, timestamp = {Sun, 17 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/BarrettSTWNLRLFE05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/WheelerBBBCCDEFHKKLMMOPPSSSSSSSTTWY05, author = {David L. Wheeler and Tanya Barrett and Dennis A. Benson and Stephen H. Bryant and Kathi Canese and Deanna M. Church and Michael DiCuccio and Ron Edgar and Scott Federhen and Wolfgang Helmberg and David L. Kenton and Oleg Khovayko and David J. Lipman and Thomas L. Madden and Donna R. Maglott and James Ostell and Joan U. Pontius and Kim D. Pruitt and Gregory D. Schuler and Lynn M. Schriml and Edwin Sequeira and Steven T. Sherry and Karl Sirotkin and Grigory Starchenko and Tugba O. Suzek and Roman L. Tatusov and Tatiana A. Tatusova and Lukas Wagner and Eugene Yaschenko}, title = {Database resources of the National Center for Biotechnology Information}, journal = {Nucleic Acids Res.}, volume = {33}, number = {Database-Issue}, pages = {39--45}, year = {2005}, url = {https://doi.org/10.1093/nar/gki062}, doi = {10.1093/NAR/GKI062}, timestamp = {Tue, 18 Jun 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/WheelerBBBCCDEFHKKLMMOPPSSSSSSSTTWY05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/simulation/TaylorTMAA05, author = {Simon J. E. Taylor and Stephen John Turner and Navonil Mustafee and Henrik Ahlander and Rassul Ayani}, title = {A Comparison of {CMB-} and HLA-Based Approaches to Type {I} Interoperability Reference Model Problems for COTS-Based Distributed Simulation}, journal = {Simul.}, volume = {81}, number = {1}, pages = {33--43}, year = {2005}, url = {https://doi.org/10.1177/0037549705052455}, doi = {10.1177/0037549705052455}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/simulation/TaylorTMAA05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/simulation/TaylorTV05, author = {Simon J. E. Taylor and Stephen John Turner and Alexander Verbraeck}, title = {Preface to the Special Issue on Applications of Parallel and Distributed Simulation in Industry}, journal = {Simul.}, volume = {81}, number = {1}, pages = {3--4}, year = {2005}, url = {https://doi.org/10.1177/0037549705054576}, doi = {10.1177/0037549705054576}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/simulation/TaylorTV05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/simulation/WangTLG05, author = {Xiaoguang Wang and Stephen John Turner and Malcolm Yoke Hean Low and Boon{-}Ping Gan}, title = {Optimistic Synchronization in HLA-Based Distributed Simulation}, journal = {Simul.}, volume = {81}, number = {4}, pages = {279--291}, year = {2005}, url = {https://doi.org/10.1177/0037549705054931}, doi = {10.1177/0037549705054931}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/simulation/WangTLG05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/technometrics/TurlachVW05, author = {Berwin A. Turlach and William N. Venables and Stephen J. Wright}, title = {Simultaneous Variable Selection}, journal = {Technometrics}, volume = {47}, number = {3}, pages = {349--363}, year = {2005}, url = {https://doi.org/10.1198/004017005000000139}, doi = {10.1198/004017005000000139}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/technometrics/TurlachVW05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tomacs/CaiTLZ05, author = {Wentong Cai and Stephen John Turner and Bu{-}Sung Lee and Junlan Zhou}, title = {An alternative time management mechanism for distributed simulations}, journal = {{ACM} Trans. Model. Comput. Simul.}, volume = {15}, number = {2}, pages = {109--137}, year = {2005}, url = {https://doi.org/10.1145/1060576.1060577}, doi = {10.1145/1060576.1060577}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tomacs/CaiTLZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tomacs/ChenTCGL05, author = {Dan Chen and Stephen John Turner and Wentong Cai and Boon{-}Ping Gan and Malcolm Yoke Hean Low}, title = {Algorithms for HLA-based distributed simulation cloning}, journal = {{ACM} Trans. Model. Comput. Simul.}, volume = {15}, number = {4}, pages = {316--345}, year = {2005}, url = {https://doi.org/10.1145/1113316.1113318}, doi = {10.1145/1113316.1113318}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tomacs/ChenTCGL05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/anss/CaiTZWZ05, author = {Wentong Cai and Stephen John Turner and Suiping Zhou and Junhu Wei and Wenbo Zong}, title = {Performance Evaluation of a Bandwidth Requirements Reduction Technique Based on Timely State Update}, booktitle = {Proceedings 38th Annual Simulation Symposium {(ANSS-38} 2005), 4-6 April 2005, San Diego, CA, {USA}}, pages = {225--232}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://doi.org/10.1109/ANSS.2005.35}, doi = {10.1109/ANSS.2005.35}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/anss/CaiTZWZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/atal/LowLLTCL05, author = {Malcolm Yoke Hean Low and Kong Wei Lye and Peter Lendermann and Stephen John Turner and Reman Tat Wee Chim and Surya Hadisaputra Leo}, editor = {Michal Pechoucek and Donald Steiner and Simon G. Thompson}, title = {An agent-based approach for managing symbiotic simulation of semiconductor assembly and test operation}, booktitle = {4rd International Joint Conference on Autonomous Agents and Multiagent Systems {(AAMAS} 2005), July 25-29, 2005, Utrecht, The Netherlands - Special Track for Industrial Applications}, pages = {85--92}, publisher = {{ACM}}, year = {2005}, url = {https://doi.org/10.1145/1082473.1082809}, doi = {10.1145/1082473.1082809}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/atal/LowLLTCL05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cec/SwiftSCT05, author = {Stephen Swift and Amy Shi and Jason Crampton and Allan Tucker}, title = {{ICARUS:} intelligent coupon allocation for retailers using search}, booktitle = {Proceedings of the {IEEE} Congress on Evolutionary Computation, {CEC} 2005, 2-4 September 2005, Edinburgh, {UK}}, pages = {182--189}, publisher = {{IEEE}}, year = {2005}, url = {https://doi.org/10.1109/CEC.2005.1554683}, doi = {10.1109/CEC.2005.1554683}, timestamp = {Thu, 16 Dec 2021 13:59:05 +0100}, biburl = {https://dblp.org/rec/conf/cec/SwiftSCT05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/chi/WellnerFTW05, author = {Pierre Wellner and Mike Flynn and Simon Tucker and Steve Whittaker}, editor = {Gerrit C. van der Veer and Carolyn Gale}, title = {A meeting browser evaluation test}, booktitle = {Extended Abstracts Proceedings of the 2005 Conference on Human Factors in Computing Systems, {CHI} 2005, Portland, Oregon, USA, April 2-7, 2005}, pages = {2021--2024}, publisher = {{ACM}}, year = {2005}, url = {https://doi.org/10.1145/1056808.1057082}, doi = {10.1145/1056808.1057082}, timestamp = {Mon, 11 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/chi/WellnerFTW05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cicc/BeacomBBRSVDKSC05, author = {Tom Beacom and Timothy C. Buchholtz and D. Bradley and Jack Randolph and Salvatore N. Storino and Mark Veldhuizen and Sherman M. Dance and Jente B. Kuang and Steve Schwinn and Sue Cox and Fred Ziegler and J. Kao and Chuck Li and Christophe Tretz and J. Cabellon and Andrew Freemyer and Matthew Tubbs}, title = {Fine-grained power managed dual-thread vector scalar unit for the first-generation {CELL} processor}, booktitle = {Proceedings of the {IEEE} 2005 Custom Integrated Circuits Conference, {CICC} 2005, DoubleTree Hotel, San Jose, California, USA, September 18-21, 2005}, pages = {235--238}, publisher = {{IEEE}}, year = {2005}, url = {https://doi.org/10.1109/CICC.2005.1568650}, doi = {10.1109/CICC.2005.1568650}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/cicc/BeacomBBRSVDKSC05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/ZengTPLZZHL05, author = {Zhihong Zeng and Jilin Tu and Brian Pianfetti and Ming Liu and Tong Zhang and ZhenQiu Zhang and Thomas S. Huang and Stephen E. Levinson}, title = {Audio-Visual Affect Recognition through Multi-Stream Fused {HMM} for {HCI}}, booktitle = {2005 {IEEE} Computer Society Conference on Computer Vision and Pattern Recognition {(CVPR} 2005), 20-26 June 2005, San Diego, CA, {USA}}, pages = {967--972}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://doi.org/10.1109/CVPR.2005.77}, doi = {10.1109/CVPR.2005.77}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/ZengTPLZZHL05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/GanLWT05, author = {Boon{-}Ping Gan and Malcolm Yoke Hean Low and Xiaoguang Wang and Stephen John Turner}, title = {Using Manufacturing Process Flow for Time Synchronization in HLA-Based Simulation}, booktitle = {9th {IEEE} International Symposium on Distributed Simulation and Real-Time Applications {(DS-RT} 2005), 10-12 October 2005, Montreal, Canada}, pages = {148--160}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://doi.org/10.1109/DISTRA.2005.42}, doi = {10.1109/DISTRA.2005.42}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dsrt/GanLWT05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/TaylorBWT05, author = {Simon J. E. Taylor and Leif Bohli and Xiaoguang Wang and Stephen John Turner}, title = {Investigating Distributed Simulation at The Ford Motor Company}, booktitle = {9th {IEEE} International Symposium on Distributed Simulation and Real-Time Applications {(DS-RT} 2005), 10-12 October 2005, Montreal, Canada}, pages = {139--147}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://doi.org/10.1109/DISTRA.2005.25}, doi = {10.1109/DISTRA.2005.25}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dsrt/TaylorBWT05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/TuckerW05, author = {Simon Tucker and Steve Whittaker}, title = {Novel Techniques For Time-Compressing Speech: An Exploratory Study}, booktitle = {2005 {IEEE} International Conference on Acoustics, Speech, and Signal Processing, {ICASSP} '05, Philadelphia, Pennsylvania, USA, March 18-23, 2005}, pages = {477--480}, publisher = {{IEEE}}, year = {2005}, url = {https://doi.org/10.1109/ICASSP.2005.1415154}, doi = {10.1109/ICASSP.2005.1415154}, timestamp = {Mon, 11 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icassp/TuckerW05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icwn/Turner05, author = {Stephen Turner}, editor = {Laurence Tianruo Yang and Hamid R. Arabnia and Li{-}Chun Wang}, title = {Channel-Changing Heuristics in High-Mobility Ad Hoc Networks with Varying Traffic Demands}, booktitle = {Proceedings of the 2005 International Conference on Wireless Networks, {ICWN} 2005, Las Vegas, Nevada, USA, June 27-30, 2005}, pages = {317--323}, publisher = {{CSREA} Press}, year = {2005}, timestamp = {Tue, 29 Oct 2019 17:54:20 +0100}, biburl = {https://dblp.org/rec/conf/icwn/Turner05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/ChuZKLITCD05, author = {Anhua Chu and Jakob J. van Zyl and Yunjin Kim and Yunling Lou and David A. Imel and Wayne Tung and Bruce Chapman and Stephen L. Durden}, title = {{AIRSAR} automated web-based data processing and distribution system}, booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium, {IGARSS} 2005, July 25-29, 2005, Seoul, Korea, Proceedings}, pages = {1218--1220}, publisher = {{IEEE}}, year = {2005}, url = {https://doi.org/10.1109/IGARSS.2005.1525337}, doi = {10.1109/IGARSS.2005.1525337}, timestamp = {Sat, 19 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/igarss/ChuZKLITCD05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mlmi/WhittakerLT05, author = {Steve Whittaker and Rachel Laban and Simon Tucker}, editor = {Steve Renals and Samy Bengio}, title = {Analysing Meeting Records: An Ethnographic Study and Technological Implications}, booktitle = {Machine Learning for Multimodal Interaction, Second International Workshop, {MLMI} 2005, Edinburgh, UK, July 11-13, 2005, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {3869}, pages = {101--113}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11677482\_9}, doi = {10.1007/11677482\_9}, timestamp = {Mon, 11 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mlmi/WhittakerLT05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/TeoTJ05, author = {Peihan Teo and Stephen John Turner and Zoltan Juhasz}, title = {Optimistic Protocol Analysis in a Performance Analyzer and Prediction Tool}, booktitle = {19th Workshop on Parallel and Distributed Simulation, {PADS} 20055, Monterey, CA, USA, June 1-3, 2005}, pages = {49--58}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://doi.org/10.1109/PADS.2005.17}, doi = {10.1109/PADS.2005.17}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/TeoTJ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/XieTCT05, author = {Yong Xie and Yong Meng Teo and Wentong Cai and Stephen John Turner}, title = {Servicing Provisioning for HLA-Based Distributed Simulation on the Grid}, booktitle = {19th Workshop on Parallel and Distributed Simulation, {PADS} 20055, Monterey, CA, USA, June 1-3, 2005}, pages = {282--291}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://doi.org/10.1109/PADS.2005.26}, doi = {10.1109/PADS.2005.26}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pads/XieTCT05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/scam/CounsellST05, author = {Steve Counsell and Stephen Swift and Allan Tucker}, title = {Object-oriented cohesion as a surrogate of software comprehension: an empirical study}, booktitle = {5th {IEEE} International Workshop on Source Code Analysis and Manipulation {(SCAM} 2005), 30 September - 1 October 2005, Budapest, Hungary}, pages = {161--172}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://doi.org/10.1109/SCAM.2005.19}, doi = {10.1109/SCAM.2005.19}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/scam/CounsellST05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sensys/TollePSCTTBDBGH05, author = {Gilman Tolle and Joseph Polastre and Robert Szewczyk and David E. Culler and Neil Turner and Kevin Tu and Stephen Burgess and Todd Dawson and Philip Buonadonna and David Gay and Wei Hong}, editor = {Jason Redi and Hari Balakrishnan and Feng Zhao}, title = {A macroscope in the redwoods}, booktitle = {Proceedings of the 3rd International Conference on Embedded Networked Sensor Systems, SenSys 2005, San Diego, California, USA, November 2-4, 2005}, pages = {51--63}, publisher = {{ACM}}, year = {2005}, url = {https://doi.org/10.1145/1098918.1098925}, doi = {10.1145/1098918.1098925}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sensys/TollePSCTTBDBGH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/GanLLTWT05, author = {Boon{-}Ping Gan and Peter Lendermann and Malcolm Yoke Hean Low and Stephen John Turner and Xiaoguang Wang and Simon J. E. Taylor}, title = {Interoperating autosched {AP} using the high level architecture}, booktitle = {Proceedings of the 37th Winter Simulation Conference, Orlando, FL, USA, December 4-7, 2005}, pages = {394--401}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://doi.org/10.1109/WSC.2005.1574274}, doi = {10.1109/WSC.2005.1574274}, timestamp = {Thu, 10 Jun 2021 22:18:45 +0200}, biburl = {https://dblp.org/rec/conf/wsc/GanLLTWT05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/LendermannLGJCLTTCWHMB05, author = {Peter Lendermann and Malcolm Y. H. Low and Boon{-}Ping Gan and Nirupam Julka and Lai Peng Chan and Loo Hay Lee and Simon J. E. Taylor and Stephen John Turner and Wentong Cai and Xiaoguang Wang and Terence Hung and Leon F. McGinnis and Stephen J. Buckley}, title = {An integrated and adaptive decision-support framework for high-tech manufacturing and service networks}, booktitle = {Proceedings of the 37th Winter Simulation Conference, Orlando, FL, USA, December 4-7, 2005}, pages = {2052--2062}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://doi.org/10.1109/WSC.2005.1574487}, doi = {10.1109/WSC.2005.1574487}, timestamp = {Thu, 10 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/LendermannLGJCLTTCWHMB05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/WangTTLG05, author = {Xiaoguang Wang and Stephen John Turner and Simon J. E. Taylor and Malcolm Y. H. Low and Boon{-}Ping Gan}, title = {A {COTS} Simulation Package Emulator {(CSPE)} for investigating {COTS} simulation package interoperability}, booktitle = {Proceedings of the 37th Winter Simulation Conference, Orlando, FL, USA, December 4-7, 2005}, pages = {402--411}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://doi.org/10.1109/WSC.2005.1574275}, doi = {10.1109/WSC.2005.1574275}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/WangTTLG05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-nlin-0511072, author = {May Lim and Dan Braha and Sanith Wijesinghe and Stephenson Tucker and Yaneer Bar{-}Yam}, title = {Connectivity and Cost Trade-offs in Multihop Wireless Networks}, journal = {CoRR}, volume = {abs/nlin/0511072}, year = {2005}, url = {http://arxiv.org/abs/nlin/0511072}, eprinttype = {arXiv}, eprint = {nlin/0511072}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-nlin-0511072.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/concurrency/Turner04, author = {Stephen John Turner}, title = {Special Issue: Distributed Simulation and Real-Time Applications}, journal = {Concurr. Pract. Exp.}, volume = {16}, number = {15}, pages = {1477--1481}, year = {2004}, url = {https://doi.org/10.1002/cpe.935}, doi = {10.1002/CPE.935}, timestamp = {Thu, 21 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/concurrency/Turner04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fgcs/ZengCTZL04, author = {Yi Zeng and Wentong Cai and Stephen John Turner and Suiping Zhou and Bu{-}Sung Lee}, title = {Characterization and delivery of directly coupled causal messages in distributed systems}, journal = {Future Gener. Comput. Syst.}, volume = {20}, number = {1}, pages = {171--178}, year = {2004}, url = {https://doi.org/10.1016/j.future.2003.07.013}, doi = {10.1016/J.FUTURE.2003.07.013}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/fgcs/ZengCTZL04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcise/McMahonLCCCSS04, author = {Chris A. McMahon and Alistair Lowe and Steve J. Culley and Mark Corderoy and Rose Crossland and Tulan Shah and Dave Stewart}, title = {Waypoint: An Integrated Search and Retrieval System for Engineering Documents}, journal = {J. Comput. Inf. Sci. Eng.}, volume = {4}, number = {4}, pages = {329--338}, year = {2004}, url = {https://doi.org/10.1115/1.1812557}, doi = {10.1115/1.1812557}, timestamp = {Thu, 07 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jcise/McMahonLCCCSS04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tomacs/ZhouCLT04, author = {Suiping Zhou and Wentong Cai and Bu{-}Sung Lee and Stephen John Turner}, title = {Time-space consistency in large-scale distributed virtual environments}, journal = {{ACM} Trans. Model. Comput. Simul.}, volume = {14}, number = {1}, pages = {31--47}, year = {2004}, url = {https://doi.org/10.1145/974734.974736}, doi = {10.1145/974734.974736}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tomacs/ZhouCLT04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/ChenTGC04, author = {Dan Chen and Stephen John Turner and Boon{-}Ping Gan and Wentong Cai}, title = {HLA-Based Distributed Simulation Cloning}, booktitle = {8th {IEEE} International Symposium on Distributed Simulation and Real-Time Applications {(DS-RT} 2004), 21-23 October 2004, Budapest, Hungary}, pages = {244--247}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/DS-RT.2004.23}, doi = {10.1109/DS-RT.2004.23}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dsrt/ChenTGC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/TaylorPPT04, author = {Simon J. E. Taylor and George V. Popescu and J. Mark Pullen and Stephen John Turner}, title = {Distributed Simulation and the Grid: Position Statements}, booktitle = {8th {IEEE} International Symposium on Distributed Simulation and Real-Time Applications {(DS-RT} 2004), 21-23 October 2004, Budapest, Hungary}, pages = {144--149}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/DS-RT.2004.14}, doi = {10.1109/DS-RT.2004.14}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dsrt/TaylorPPT04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/ZongWCT04, author = {Wenbo Zong and Yong Wang and Wentong Cai and Stephen John Turner}, title = {Grid Services and Service Discovery for HLA-Based Distributed Simulation}, booktitle = {8th {IEEE} International Symposium on Distributed Simulation and Real-Time Applications {(DS-RT} 2004), 21-23 October 2004, Budapest, Hungary}, pages = {116--124}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/DS-RT.2004.22}, doi = {10.1109/DS-RT.2004.22}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dsrt/ZongWCT04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icarcv/WangWBT04, author = {Xin Wang and Brian Stephen Wong and W. M. Bai and Chen Guan Tui}, title = {X-ray image segmentation using wavelet method}, booktitle = {8th International Conference on Control, Automation, Robotics and Vision, {ICARCV} 2004, Kunming, China, 6-9 December 2004, Proceedings}, pages = {1129--1133}, publisher = {{IEEE}}, year = {2004}, url = {https://doi.org/10.1109/ICARCV.2004.1469003}, doi = {10.1109/ICARCV.2004.1469003}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/icarcv/WangWBT04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccS/YuanCLT04, author = {Zijing Yuan and Wentong Cai and Yoke{-}Hean Low and Stephen John Turner}, editor = {Marian Bubak and G. Dick van Albada and Peter M. A. Sloot and Jack J. Dongarra}, title = {Federate Migration in HLA-Based Simulation}, booktitle = {Computational Science - {ICCS} 2004, 4th International Conference, Krak{\'{o}}w, Poland, June 6-9, 2004, Proceedings, Part {III}}, series = {Lecture Notes in Computer Science}, volume = {3038}, pages = {856--864}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/978-3-540-24688-6\_110}, doi = {10.1007/978-3-540-24688-6\_110}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iccS/YuanCLT04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icmi/ZengTLZRZHRL04, author = {Zhihong Zeng and Jilin Tu and Ming Liu and Tong Zhang and Nicholas Rizzolo and ZhenQiu Zhang and Thomas S. Huang and Dan Roth and Stephen E. Levinson}, editor = {Rajeev Sharma and Trevor Darrell and Mary P. Harper and Gianni Lazzari and Matthew A. Turk}, title = {Bimodal HCI-related affect recognition}, booktitle = {Proceedings of the 6th International Conference on Multimodal Interfaces, {ICMI} 2004, State College, PA, USA, October 13-15, 2004}, pages = {137--143}, publisher = {{ACM}}, year = {2004}, url = {https://doi.org/10.1145/1027933.1027958}, doi = {10.1145/1027933.1027958}, timestamp = {Fri, 03 Jul 2020 08:57:26 +0200}, biburl = {https://dblp.org/rec/conf/icmi/ZengTLZRZHRL04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/OlsenWT04, author = {Dan R. Olsen and Stephen Bart Wood and Jonathan Turner}, title = {Metrics for Human Driving of Multiple Robots}, booktitle = {Proceedings of the 2004 {IEEE} International Conference on Robotics and Automation, {ICRA} 2004, April 26 - May 1, 2004, New Orleans, LA, {USA}}, pages = {2315--2320}, publisher = {{IEEE}}, year = {2004}, url = {https://doi.org/10.1109/ROBOT.2004.1307407}, doi = {10.1109/ROBOT.2004.1307407}, timestamp = {Mon, 22 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icra/OlsenWT04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icwn/Turner04, author = {Stephen W. Turner}, editor = {Hamid R. Arabnia and Laurence Tianruo Yang and Chi{-}Hsiang Yeh}, title = {Channel-Changing Strategies to Preserve Bandwidth of Flows in Ad Hoc Networks}, booktitle = {Proceedings of the International Conference on Wireless Networks, {ICWN} '04, June 21-24, 2004, Las Vegas, Nevada, USA, Volume 1}, pages = {172--178}, publisher = {{CSREA} Press}, year = {2004}, timestamp = {Mon, 22 Nov 2004 14:01:57 +0100}, biburl = {https://dblp.org/rec/conf/icwn/Turner04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icws/ZangJHLTC04, author = {Tianyi Zang and Wei Jie and Terence Hung and Zhou Lei and Stephen John Turner and Wentong Cai}, title = {The Design and Implementation of An OGSA-based Grid Information Service}, booktitle = {Proceedings of the {IEEE} International Conference on Web Services (ICWS'04), June 6-9, 2004, San Diego, California, {USA}}, pages = {566}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/ICWS.2004.1314783}, doi = {10.1109/ICWS.2004.1314783}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icws/ZangJHLTC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/TuluF04, author = {Zeynep Tulu and Stephen J. Frasier}, title = {Design considerations for bistatic radar probing of winds in clear air conditions}, booktitle = {2004 {IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS} 2004, Anchorage, Alaska, USA, 20-24 September 2004}, pages = {3662--3665}, publisher = {{IEEE}}, year = {2004}, url = {https://doi.org/10.1109/IGARSS.2004.1369913}, doi = {10.1109/IGARSS.2004.1369913}, timestamp = {Wed, 16 Oct 2019 14:14:53 +0200}, biburl = {https://dblp.org/rec/conf/igarss/TuluF04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ipps/WangTLASHPS04, author = {Peng Wang and George W. Turner and Daniel A. Lauer and Matthew Allen and Stephen C. Simms and David Hart and Mary Papakhian and Craig A. Stewart}, title = {{LINPACK} Performance on a Geographically Distributed Linux Cluster}, booktitle = {18th International Parallel and Distributed Processing Symposium {(IPDPS} 2004), {CD-ROM} / Abstracts Proceedings, 26-30 April 2004, Santa Fe, New Mexico, {USA}}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/IPDPS.2004.1303301}, doi = {10.1109/IPDPS.2004.1303301}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ipps/WangTLASHPS04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/jbi/KellamSTVMOL04, author = {Paul Kellam and Stephen Swift and Allan Tucker and Veronica Vinciotti and Nigel J. Martin and Christine A. Orengo and Xiaohui Liu}, editor = {Xavier Messeguer and Gabriel Valiente}, title = {Consensus Clustering and Functional Interpretation of Gene Expression Data}, booktitle = {Proceedings of the 5th Annual Spanish Bioinformatics Conference, Barcelona, Catalonia, Spain, November 29-30, 2004}, pages = {6}, publisher = {Technical University of Catalonia, Barcelona}, year = {2004}, timestamp = {Mon, 11 Jul 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/jbi/KellamSTVMOL04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mabs/WangTW04, author = {Fang Wang and Stephen John Turner and Lihua Wang}, editor = {Paul Davidsson and Brian Logan and Keiki Takadama}, title = {Agent Communication in Distributed Simulations}, booktitle = {Multi-Agent and Multi-Agent-Based Simulation, Joint Workshop {MABS} 2004, New York, NY, USA, July 19, 2004, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {3415}, pages = {11--24}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/978-3-540-32243-6\_2}, doi = {10.1007/978-3-540-32243-6\_2}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mabs/WangTW04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mlmi/TuckerW04, author = {Simon Tucker and Steve Whittaker}, editor = {Samy Bengio and Herv{\'{e}} Bourlard}, title = {Accessing Multimodal Meeting Data: Systems, Problems and Possibilities}, booktitle = {Machine Learning for Multimodal Interaction, First International Workshop,MLMI 2004, Martigny, Switzerland, June 21-23, 2004, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {3361}, pages = {1--11}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/978-3-540-30568-2\_1}, doi = {10.1007/978-3-540-30568-2\_1}, timestamp = {Mon, 11 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mlmi/TuckerW04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pacis/ChauT04, author = {Stephen B. Chau and Paul Turner}, title = {Examining the Utilisation of Mobile Handheld Devices at an Australian Aged Care Facility}, booktitle = {Pacific Asia Conference on Information Systems, {PACIS} 2004, Shanghai, China, July 8-11, 2004}, pages = {50}, publisher = {AISeL}, year = {2004}, url = {http://aisel.aisnet.org/pacis2004/50}, timestamp = {Sat, 03 Mar 2012 13:26:52 +0100}, biburl = {https://dblp.org/rec/conf/pacis/ChauT04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/WangTLG04, author = {Xiaoguang Wang and Stephen John Turner and Yoke{-}Hean Low and Boon{-}Ping Gan}, editor = {Johannes L{\"{u}}thi and Axel Lehmann and Ernest H. Page and Thom McLean}, title = {Optimistic Synchronization in {HLA} Based Distributed Simulation}, booktitle = {18th Workshop on Parallel and Distributed Simulation, {PADS} 2004, Kufstein, Austria, May 16-19, 2004}, pages = {123--130}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/PADS.2004.1301293}, doi = {10.1109/PADS.2004.1301293}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pads/WangTLG04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/ZengCT04, author = {Yi Zeng and Wentong Cai and Stephen John Turner}, editor = {Johannes L{\"{u}}thi and Axel Lehmann and Ernest H. Page and Thom McLean}, title = {Batch Based Cancellation: {A} Rollback Optimal Cancellation Scheme in Time Warp Simulations}, booktitle = {18th Workshop on Parallel and Distributed Simulation, {PADS} 2004, Kufstein, Austria, May 16-19, 2004}, pages = {78--86}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/PADS.2004.1301288}, doi = {10.1109/PADS.2004.1301288}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pads/ZengCT04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/ZhouTCZP04, author = {Suiping Zhou and Stephen John Turner and Wentong Cai and Hanfeng Zhao and Xiaolin Pang}, editor = {Johannes L{\"{u}}thi and Axel Lehmann and Ernest H. Page and Thom McLean}, title = {A Utility Model for Timely State Update in Distributed Wargame Simulations}, booktitle = {18th Workshop on Parallel and Distributed Simulation, {PADS} 2004, Kufstein, Austria, May 16-19, 2004}, pages = {105--111}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/PADS.2004.1301291}, doi = {10.1109/PADS.2004.1301291}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pads/ZhouTCZP04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ram/WangWT04, author = {Xin Wang and Brian Stephen Wong and Chen Guan Tui}, title = {X-ray image segmentation based on genetic algorithm and maximum fuzzy entropy}, booktitle = {2004 {IEEE} Conference on Robotics, Automation and Mechatronics, {RAM} 2004, December 1-3, 2004, Singapore}, pages = {991--995}, publisher = {{IEEE}}, year = {2004}, url = {https://doi.org/10.1109/RAMECH.2004.1438054}, doi = {10.1109/RAMECH.2004.1438054}, timestamp = {Thu, 12 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ram/WangWT04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sgp/BhatIT04, author = {Pravin Bhat and Stephen Ingram and Greg Turk}, editor = {Jean{-}Daniel Boissonnat and Pierre Alliez}, title = {Geometric Texture Synthesis by Example}, booktitle = {Second Eurographics Symposium on Geometry Processing, Nice, France, July 8-10, 2004}, series = {{ACM} International Conference Proceeding Series}, volume = {71}, pages = {41--44}, publisher = {Eurographics Association}, year = {2004}, url = {https://doi.org/10.2312/SGP/SGP04/043-046}, doi = {10.2312/SGP/SGP04/043-046}, timestamp = {Tue, 06 Nov 2018 16:58:19 +0100}, biburl = {https://dblp.org/rec/conf/sgp/BhatIT04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigcse/TuckerMDSJV04, author = {Allen B. Tucker and Dennis McCowan and Fadi P. Deek and Chris Stephenson and Jill Jones and Anita Verno}, editor = {Daniel T. Joyce and Deborah Knox and Wanda P. Dann and Thomas L. Naps}, title = {Implementation challenges for a {K-12} computer science curriculum}, booktitle = {Proceedings of the 35th {SIGCSE} Technical Symposium on Computer Science Education, {SIGCSE} 2004, Norfolk, Virginia, USA, March 3-7, 2004}, pages = {334--335}, publisher = {{ACM}}, year = {2004}, url = {https://doi.org/10.1145/971300.971418}, doi = {10.1145/971300.971418}, timestamp = {Thu, 10 Jun 2021 16:43:03 +0200}, biburl = {https://dblp.org/rec/conf/sigcse/TuckerMDSJV04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/ChenTCGL04, author = {Dan Chen and Stephen John Turner and Wentong Cai and Boon{-}Ping Gan and Malcolm Yoke Hean Low}, title = {Incremental HLA-Based Distributed Simulation Cloning}, booktitle = {Proceedings of the 36th conference on Winter simulation, Washington, DC, USA, December 5-8, 2004}, pages = {386--394}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {http://www.informs-sim.org/wsc04papers/046.pdf}, timestamp = {Thu, 10 Jun 2021 22:19:50 +0200}, biburl = {https://dblp.org/rec/conf/wsc/ChenTCGL04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/TaylorLPRST04, author = {Simon J. E. Taylor and Peter Lendermann and Ray J. Paul and Steven W. Reichenthal and Steffen Stra{\ss}burger and Stephen John Turner}, title = {Panel on Future Challenges in Modeling Methodology}, booktitle = {Proceedings of the 36th conference on Winter simulation, Washington, DC, USA, December 5-8, 2004}, pages = {327--335}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {http://www.informs-sim.org/wsc04papers/039.pdf}, timestamp = {Thu, 10 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/TaylorLPRST04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/WangTW04, author = {Lihua Wang and Stephen John Turner and Fang Wang}, title = {Resolving Mutually Exclusive Interactions in Agent Based Distributed Simulations}, booktitle = {Proceedings of the 36th conference on Winter simulation, Washington, DC, USA, December 5-8, 2004}, pages = {783--791}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {http://www.informs-sim.org/wsc04papers/097.pdf}, timestamp = {Thu, 10 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/WangTW04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ecra/TungDCCL03, author = {Lai Lai Tung and Roger Debreceny and Ying{-}Git Chan and Aaron Tuck{-}Loon Chan and Stephen Ee{-}Boon Le}, title = {Interacting with hypertext: an experimental investigation of navigation tools}, journal = {Electron. Commer. Res. Appl.}, volume = {2}, number = {1}, pages = {61--72}, year = {2003}, url = {https://doi.org/10.1016/S1567-4223(03)00006-1}, doi = {10.1016/S1567-4223(03)00006-1}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ecra/TungDCCL03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijhci/CoxLTNWTA03, author = {Stephen Cox and Michael Lincoln and Judy Tryggvason and Melanie Nakisa and Mark Wells and Marcus Tutt and Sanja Abbott}, title = {The Development and Evaluation of a Speech-to-Sign Translation System to Assist Transactions}, journal = {Int. J. Hum. Comput. Interact.}, volume = {16}, number = {2}, pages = {141--161}, year = {2003}, url = {https://doi.org/10.1207/S15327590IJHC1602\_02}, doi = {10.1207/S15327590IJHC1602\_02}, timestamp = {Thu, 18 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijhci/CoxLTNWTA03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijmms/HayneST03, author = {Stephen C. Hayne and C. A. P. Smith and Dan Turk}, title = {The effectiveness of groups recognizing patterns}, journal = {Int. J. Hum. Comput. Stud.}, volume = {59}, number = {5}, pages = {523--543}, year = {2003}, url = {https://doi.org/10.1016/S1071-5819(03)00046-6}, doi = {10.1016/S1071-5819(03)00046-6}, timestamp = {Fri, 21 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijmms/HayneST03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ni/EckersleyESTNSMJRHHJKLMMSNRRRSTUPVWWT03, author = {Peter Eckersley and Gary F. Egan and Erik De Schutter and Yiyuan Tang and Mirko Novak and V{\'{a}}clav Sebesta and Line Matthiessen and Iiro P. J{\"{a}}{\"{a}}skel{\"{a}}inen and Ulla Ruotsalainen and Andreas V. M. Herz and K. Peter Hoffmann and Raphael Ritz and Viji Ravindranath and Francesco Beltrame and Shun{-}ichi Amari and Shiro Usui and Soo{-}Young Lee and Jaap van Pelt and Jan G. Bjaalie and Andrzej Wr{\'{o}}bel and Fernando Mira da Silva and Carmen Gonz{\'{a}}lez and Sten Grillner and Paul F. M. J. Verschure and Turgay Dalkara and Robert Bennett and David Willshaw and Stephen H. Koslow and Perry L. Miller and Shankar Subramaniam and Arthur W. Toga}, title = {Neuroscience data and tool sharing - {A} legal and policy framework for neuroinformatics}, journal = {Neuroinformatics}, volume = {1}, number = {2}, pages = {149--165}, year = {2003}, url = {https://doi.org/10.1007/s12021-003-0002-1}, doi = {10.1007/S12021-003-0002-1}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ni/EckersleyESTNSMJRHHJKLMMSNRRRSTUPVWWT03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/scp/ReesST03, author = {D. Ll. L. Rees and Karen Stephenson and John V. Tucker}, title = {The algebraic structure of interfaces}, journal = {Sci. Comput. Program.}, volume = {49}, number = {1-3}, pages = {47--88}, year = {2003}, url = {https://doi.org/10.1016/j.scico.2003.04.001}, doi = {10.1016/J.SCICO.2003.04.001}, timestamp = {Wed, 17 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/scp/ReesST03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/siamsc/ThomasDTF03, author = {Stephen J. Thomas and John M. Dennis and Henry M. Tufo and Paul F. Fischer}, title = {A Schwarz Preconditioner for the Cubed-Sphere}, journal = {{SIAM} J. Sci. Comput.}, volume = {25}, number = {2}, pages = {442--453}, year = {2003}, url = {https://doi.org/10.1137/S1064827502409420}, doi = {10.1137/S1064827502409420}, timestamp = {Thu, 30 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/siamsc/ThomasDTF03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03, author = {James Allan and Jay Aslam and Nicholas J. Belkin and Chris Buckley and James P. Callan and W. Bruce Croft and Susan T. Dumais and Norbert Fuhr and Donna Harman and David J. Harper and Djoerd Hiemstra and Thomas Hofmann and Eduard H. Hovy and Wessel Kraaij and John D. Lafferty and Victor Lavrenko and David D. Lewis and Liz Liddy and R. Manmatha and Andrew McCallum and Jay M. Ponte and John M. Prager and Dragomir R. Radev and Philip Resnik and Stephen E. Robertson and Ronald Rosenfeld and Salim Roukos and Mark Sanderson and Richard M. Schwartz and Amit Singhal and Alan F. Smeaton and Howard R. Turtle and Ellen M. Voorhees and Ralph M. Weischedel and Jinxi Xu and ChengXiang Zhai}, title = {Challenges in information retrieval and language modeling: report of a workshop held at the center for intelligent information retrieval, University of Massachusetts Amherst, September 2002}, journal = {{SIGIR} Forum}, volume = {37}, number = {1}, pages = {31--47}, year = {2003}, url = {https://doi.org/10.1145/945546.945549}, doi = {10.1145/945546.945549}, timestamp = {Sun, 22 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/simulation/ChenTGCWJ03, author = {Dan Chen and Stephen John Turner and Boon{-}Ping Gan and Wentong Cai and Junhu Wei and Nirupam Julka}, title = {Alternative Solutions for Distributed Simulation Cloning}, journal = {Simul.}, volume = {79}, number = {5-6}, pages = {299--315}, year = {2003}, url = {https://doi.org/10.1177/0037549703037147}, doi = {10.1177/0037549703037147}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/simulation/ChenTGCWJ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amia/JohnsonCKTMFH03, author = {Stephen B. Johnson and David A. Campbell and Michael Krauthammer and P. Karina Tulipano and Eneida A. Mendon{\c{c}}a and Carol Friedman and George Hripcsak}, title = {A Native {XML} Database Design for Clinical Document Research}, booktitle = {{AMIA} 2003, American Medical Informatics Association Annual Symposium, Washington, DC, USA, November 8-12, 2003}, publisher = {{AMIA}}, year = {2003}, url = {https://knowledge.amia.org/amia-55142-a2003a-1.616734/t-002-1.618748/f-001-1.618749/a-266-1.619288/a-267-1.619285}, timestamp = {Wed, 17 Apr 2024 11:48:28 +0200}, biburl = {https://dblp.org/rec/conf/amia/JohnsonCKTMFH03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/anss/ChenGJTCW03, author = {Dan Chen and Boon{-}Ping Gan and Nirupam Julka and Stephen John Turner and Wentong Cai and Junhu Wei}, title = {Evaluating Alternative Solutions for Cloning in Distributed Simulation}, booktitle = {Proceedings 36th Annual Simulation Symposium {(ANSS-36} 2003), Orlando, Florida, USA, March 30 - April 2, 2003}, pages = {201--208}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://doi.org/10.1109/SIMSYM.2003.1192814}, doi = {10.1109/SIMSYM.2003.1192814}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/anss/ChenGJTCW03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/anss/ChenLCT03, author = {Dan Chen and Bu{-}Sung Lee and Wentong Cai and Stephen John Turner}, title = {Design and Development of a Cluster Gateway for Cluster-based {HLA} Distributed Virtual Simulation Environments}, booktitle = {Proceedings 36th Annual Simulation Symposium {(ANSS-36} 2003), Orlando, Florida, USA, March 30 - April 2, 2003}, pages = {193--200}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://doi.org/10.1109/SIMSYM.2003.1192813}, doi = {10.1109/SIMSYM.2003.1192813}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/anss/ChenLCT03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/anss/LiuCTL03, author = {Li Liu and Wentong Cai and Stephen John Turner and Guangya Li}, title = {Improving Data Filtering Accuracy in Hierarchical Federations}, booktitle = {Proceedings 36th Annual Simulation Symposium {(ANSS-36} 2003), Orlando, Florida, USA, March 30 - April 2, 2003}, pages = {209--215}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://doi.org/10.1109/SIMSYM.2003.1192815}, doi = {10.1109/SIMSYM.2003.1192815}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/anss/LiuCTL03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cw/ZhouCTZ03, author = {Suiping Zhou and Wentong Cai and Stephen John Turner and Hanfeng Zhao}, title = {A Consistency Model for Evaluating Distributed Virtual Environments}, booktitle = {2nd International Conference on Cyberworlds {(CW} 2003), 3-5 December 2003, Singapore}, pages = {85--91}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://doi.org/10.1109/CYBER.2003.1253439}, doi = {10.1109/CYBER.2003.1253439}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cw/ZhouCTZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/WangTW03, author = {Lihua Wang and Stephen John Turner and Fang Wang}, title = {Interest Management in Agent-Based Distributed Simulations}, booktitle = {7th {IEEE} International Symposium on Distributed Simulation and Real-Time Applications {(DS-RT} 2003), 23-25 October 2003, Delft, The Netherlands}, pages = {20--29}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://doi.org/10.1109/DISRTA.2003.1242993}, doi = {10.1109/DISRTA.2003.1242993}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dsrt/WangTW03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ida/CounsellLNST03, author = {Steve Counsell and Xiaohui Liu and Rajaa Najjar and Stephen Swift and Allan Tucker}, editor = {Michael R. Berthold and Hans{-}Joachim Lenz and Elizabeth Bradley and Rudolf Kruse and Christian Borgelt}, title = {Applying Intelligent Data Analysis to Coupling Relationships in Object-Oriented Software}, booktitle = {Advances in Intelligent Data Analysis V, 5th International Symposium on Intelligent Data Analysis, {IDA} 2003, Berlin, Germany, August 28-30, 2003, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {2810}, pages = {440--450}, publisher = {Springer}, year = {2003}, url = {https://doi.org/10.1007/978-3-540-45231-7\_41}, doi = {10.1007/978-3-540-45231-7\_41}, timestamp = {Wed, 09 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ida/CounsellLNST03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/CaiLTLL03, author = {Wentong Cai and Guangya Li and Stephen John Turner and Bu{-}Sung Lee and Li Liu}, title = {Implementation of Federation Management Services over Federation Community Networks}, booktitle = {Proceedings of the 17th Workshop on Parallel and Distributed Simulation, {PADS} 2003, June 10-13, 2003, San Diego, CA, {USA}}, pages = {50--60}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://doi.org/10.1109/PADS.2003.1207420}, doi = {10.1109/PADS.2003.1207420}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/CaiLTLL03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigcse/TuckerDJMSV03, author = {Allen B. Tucker and Fadi P. Deek and Jill Jones and Dennis McCowan and Chris Stephenson and Anita Verno}, editor = {Scott Grissom and Deborah Knox and Daniel T. Joyce and Wanda P. Dann}, title = {Toward a {K-12} computer science curriculum}, booktitle = {Proceedings of the 34th {SIGCSE} Technical Symposium on Computer Science Education, {SIGCSE} 2003, Reno, Nevada, USA, February 19-23, 2003}, pages = {305--306}, publisher = {{ACM}}, year = {2003}, url = {https://doi.org/10.1145/611892.611912}, doi = {10.1145/611892.611912}, timestamp = {Thu, 10 Jun 2021 16:43:03 +0200}, biburl = {https://dblp.org/rec/conf/sigcse/TuckerDJMSV03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/GanLWWTC03, author = {Boon{-}Ping Gan and Malcolm Yoke Hean Low and Junhu Wei and Xiaoguang Wang and Stephen John Turner and Wentong Cai}, editor = {Stephen E. Chick and Paul J. Sanchez and David M. Ferrin and Douglas J. Morrice}, title = {Distributed simulation and manufacturing: synchronization and management of shared state in HLA-based distributed simulation}, booktitle = {Proceedings of the 35th Winter Simulation Conference: Driving Innovation, New Orleans, Louisiana, USA, December 7-10, 2003}, pages = {847--854}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://doi.org/10.1109/WSC.2003.1261503}, doi = {10.1109/WSC.2003.1261503}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/wsc/GanLWWTC03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/ZengCT03, author = {Yi Zeng and Wentong Cai and Stephen John Turner}, editor = {Stephen E. Chick and Paul J. Sanchez and David M. Ferrin and Douglas J. Morrice}, title = {Parallel distributed simulation and modeling methods: causal order based time warp: a tradeoff of optimism}, booktitle = {Proceedings of the 35th Winter Simulation Conference: Driving Innovation, New Orleans, Louisiana, USA, December 7-10, 2003}, pages = {855--863}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://doi.org/10.1109/WSC.2003.1261504}, doi = {10.1109/WSC.2003.1261504}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/wsc/ZengCT03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aiedam/McMahonCLSWC02, author = {Chris A. McMahon and Rose Crossland and Alistair Lowe and Tulan Shah and J. H. Sims Williams and Steve J. Culley}, title = {No zero match browsing of hierarchically categorized information entities}, journal = {Artif. Intell. Eng. Des. Anal. Manuf.}, volume = {16}, number = {3}, pages = {243--257}, year = {2002}, url = {https://doi.org/10.1017/S0890060402163098}, doi = {10.1017/S0890060402163098}, timestamp = {Thu, 24 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/aiedam/McMahonCLSWC02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/candc/TurcotteMS02, author = {Marcel Turcotte and Stephen H. Muggleton and Michael J. E. Sternberg}, title = {Generating Protein Three-dimensional Fold Signatures using Inductive Logic Programming}, journal = {Comput. Chem.}, volume = {26}, number = {1}, pages = {57--64}, year = {2002}, url = {https://doi.org/10.1016/S0097-8485(01)00100-0}, doi = {10.1016/S0097-8485(01)00100-0}, timestamp = {Sat, 30 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/candc/TurcotteMS02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cj/JieCT02, author = {Wei Jie and Wentong Cai and Stephen John Turner}, title = {{POEMS:} {A} Parallel Object-oriented Environment for Multi-computer Systems}, journal = {Comput. J.}, volume = {45}, number = {5}, pages = {540--560}, year = {2002}, url = {https://doi.org/10.1093/comjnl/45.5.540}, doi = {10.1093/COMJNL/45.5.540}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cj/JieCT02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ida/CounsellLMST02, author = {Steve Counsell and Xiaohui Liu and Janet McFall and Stephen Swift and Allan Tucker}, title = {Evolutionary algorithms for grouping high dimensional Email data}, journal = {Intell. Data Anal.}, volume = {6}, number = {6}, pages = {503--516}, year = {2002}, url = {http://content.iospress.com/articles/intelligent-data-analysis/ida00108}, timestamp = {Mon, 05 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ida/CounsellLMST02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ida/KellamLMOST02, author = {Paul Kellam and Xiaohui Liu and Nigel J. Martin and Christine A. Orengo and Stephen Swift and Allan Tucker}, title = {A framework for modelling virus gene expression data}, journal = {Intell. Data Anal.}, volume = {6}, number = {3}, pages = {267--279}, year = {2002}, url = {http://content.iospress.com/articles/intelligent-data-analysis/ida00092}, timestamp = {Mon, 11 Jul 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ida/KellamLMOST02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcns/TunstallRS02, author = {Mark J. Tunstall and Alan Roberts and Stephen R. Soffe}, title = {Modelling Inter-Segmental Coordination of Neuronal Oscillators: Synaptic Mechanisms for Uni-Directional Coupling During Swimming in Xenopus Tadpoles}, journal = {J. Comput. Neurosci.}, volume = {13}, number = {2}, pages = {143--158}, year = {2002}, url = {https://doi.org/10.1023/A:1020114324350}, doi = {10.1023/A:1020114324350}, timestamp = {Thu, 16 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jcns/TunstallRS02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigmobile/ZhangLWT02, author = {Junbiao Zhang and Jun Li and Stephen B. Weinstein and Nan Tu}, title = {Virtual operator based {AAA} in wireless {LAN} hot spots with ad-hoc networking support}, journal = {{ACM} {SIGMOBILE} Mob. Comput. Commun. Rev.}, volume = {6}, number = {3}, pages = {10--21}, year = {2002}, url = {https://doi.org/10.1145/581291.581297}, doi = {10.1145/581291.581297}, timestamp = {Sun, 17 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigmobile/ZhangLWT02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/wc/LiWZT02, author = {Jun Li and Stephen B. Weinstein and Junbiao Zhang and Nan Tu}, title = {Public access mobility {LAN:} extending the wireless internet into the {LAN} enwronment}, journal = {{IEEE} Wirel. Commun.}, volume = {9}, number = {3}, pages = {22--30}, year = {2002}, url = {https://doi.org/10.1109/MWC.2002.1016707}, doi = {10.1109/MWC.2002.1016707}, timestamp = {Tue, 24 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/wc/LiWZT02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acis/ChauT02, author = {Stephen B. Chau and Paul Turner}, title = {An Exploration of Factors that influence the ability of Small and Medium Sized Enterprises to Engage in Electronic Commerce: preliminary findings from 34 Australian case studies}, booktitle = {Australasian Conference on Information Systems, {ACIS} 2002, Melbourne, Australia, December 3-6, 2002}, year = {2002}, url = {https://aisel.aisnet.org/acis2002/8}, timestamp = {Thu, 16 May 2024 17:06:13 +0200}, biburl = {https://dblp.org/rec/conf/acis/ChauT02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/assets/CoxLTNWTA02, author = {Stephen Cox and Michael Lincoln and Judy Tryggvason and Melanie Nakisa and Mark Wells and Marcus Tutt and Sanja Abbott}, editor = {Vicki L. Hanson and Julie A. Jacko}, title = {Tessa, a system to aid communication with deaf people}, booktitle = {Proceedings of the {ACM} Conference on Assistive Technologies, {ASSETS} 2002, Edinburgh, Scotland, UK, July 8-10, 2002}, pages = {205--212}, publisher = {{ACM}}, year = {2002}, url = {https://doi.org/10.1145/638249.638287}, doi = {10.1145/638249.638287}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/assets/CoxLTNWTA02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ccgrid/CaoSTJKSN02, author = {Junwei Cao and Daniel P. Spooner and James D. Turner and Stephen A. Jarvis and Darren J. Kerbyson and Subhash Saini and Graham R. Nudd}, title = {Agent-Based Resource Management for Grid Computing}, booktitle = {2nd {IEEE} International Symposium on Cluster Computing and the Grid (CCGrid 2002), 22-24 May 2002, Berlin, Germany}, pages = {350--351}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://doi.org/10.1109/CCGRID.2002.1017159}, doi = {10.1109/CCGRID.2002.1017159}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ccgrid/CaoSTJKSN02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/CaiLTLL02, author = {Wentong Cai and Guangya Li and Stephen John Turner and Bu{-}Sung Lee and Li Liu}, title = {Automatic Construction of Hierarchical Federations Architecture}, booktitle = {6th {IEEE} International Workshop on Distributed Simulation and Real-Time Applications {(DS-RT} 2002), 11-13 October 2002, Fort Worth, TX, {USA}}, pages = {50--58}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://doi.org/10.1109/DISRTA.2002.1166888}, doi = {10.1109/DISRTA.2002.1166888}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dsrt/CaiLTLL02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/CaiTZ02, author = {Wentong Cai and Stephen John Turner and Hanfeng Zhao}, title = {A Load Management System for Running HLA-Based Distributed Simulations over the Grid}, booktitle = {6th {IEEE} International Workshop on Distributed Simulation and Real-Time Applications {(DS-RT} 2002), 11-13 October 2002, Fort Worth, TX, {USA}}, pages = {7--14}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://doi.org/10.1109/DISRTA.2002.1166883}, doi = {10.1109/DISRTA.2002.1166883}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dsrt/CaiTZ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ecis/ChauT02, author = {Stephen B. Chau and Paul Turner}, editor = {Stanislaw Wrycza}, title = {A Framework For Analysing Factors Influencing Small To Medium Sized Enterprises (SMEs) Ability To Derive Benefit From The Conduct Of Web-based Electronic Commerce {(EC)-34} Australian Case Studies}, booktitle = {Proceedings of the 10th European Conference on Information Systems, Information Systems and the Future of the Digital Economy, {ECIS} 2002, Gdansk, Poland, June 6-8, 2002}, pages = {625--639}, year = {2002}, url = {http://aisel.aisnet.org/ecis2002/110}, timestamp = {Mon, 05 Dec 2016 15:14:00 +0100}, biburl = {https://dblp.org/rec/conf/ecis/ChauT02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/igarss/HuangJTFD02, author = {Zhi Huang and Xiuping Jia and Brian Turner and William Foley and Stephen Dury}, title = {Use of {HYMAP} image data to estimate sideroxylonal-A concentration of eucalypt foliage}, booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS} 2002, Toronto, Ontario, Canada, 24-28 June 2002}, pages = {1652--1654}, publisher = {{IEEE}}, year = {2002}, url = {https://doi.org/10.1109/IGARSS.2002.1026210}, doi = {10.1109/IGARSS.2002.1026210}, timestamp = {Wed, 16 Oct 2019 14:14:53 +0200}, biburl = {https://dblp.org/rec/conf/igarss/HuangJTFD02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ipps/CaoJSTKN02, author = {Junwei Cao and Stephen A. Jarvis and Daniel P. Spooner and James D. Turner and Darren J. Kerbyson and Graham R. Nudd}, title = {Performance Prediction Technology for Agent-Based Resource Management in Grid Environments}, booktitle = {16th International Parallel and Distributed Processing Symposium {(IPDPS} 2002), 15-19 April 2002, Fort Lauderdale, FL, USA, CD-ROM/Abstracts Proceedings}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://doi.org/10.1109/IPDPS.2002.1015660}, doi = {10.1109/IPDPS.2002.1015660}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ipps/CaoJSTKN02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/CaiXTL02, author = {Wentong Cai and Percival Xavier and Stephen John Turner and Bu{-}Sung Lee}, editor = {Frederick Wieland and Philip A. Wilsey and Lorenzo Donatiello and Francesco Quaglia}, title = {A scalable architecture for supporting interactive games on the internet}, booktitle = {Proceedings of the 16th Workshop on Parallel and Distributed Simulation, {PADS} 2002, Washington, D.C., USA, May 12-15, 2002}, pages = {60--67}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://doi.org/10.1109/PADS.2002.1004201}, doi = {10.1109/PADS.2002.1004201}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/CaiXTL02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/ZhouCTL02, author = {Suiping Zhou and Wentong Cai and Stephen John Turner and Francis B. S. Lee}, editor = {Frederick Wieland and Philip A. Wilsey and Lorenzo Donatiello and Francesco Quaglia}, title = {Critical causality in distributed virtual environments}, booktitle = {Proceedings of the 16th Workshop on Parallel and Distributed Simulation, {PADS} 2002, Washington, D.C., USA, May 12-15, 2002}, pages = {53--59}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://doi.org/10.1109/PADS.2002.1004200}, doi = {10.1109/PADS.2002.1004200}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pads/ZhouCTL02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pdpta/JieCTC02, author = {Wei Jie and Wentong Cai and Stephen John Turner and Wai Keong Chong}, editor = {Hamid R. Arabnia}, title = {A Parallel Object-oriented Environment for Cluster Computing}, booktitle = {Proceedings of the International Conference on Parallel and Distributed Processing Techniques and Applications, {PDPTA} '02, June 24 - 27, 2002, Las Vegas, Nevada, USA, Volume 4}, pages = {1948--1954}, publisher = {{CSREA} Press}, year = {2002}, timestamp = {Wed, 10 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pdpta/JieCTC02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/siguccs/TuckerPZ02, author = {Stephen Tucker and Andrew Pigou and Thom D. Zaugg}, editor = {Pamela Vogel and Catherine Yang and Nancy J. Bauer}, title = {e-Learning: making it happen now}, booktitle = {Proceedings of the 30th annual {ACM} {SIGUCCS} conference on User services: Charting Bold Courses - New Worlds in User Services, Providence, Rhode Island, USA, November 20-23, 2002}, pages = {292--293}, publisher = {{ACM}}, year = {2002}, url = {https://doi.org/10.1145/588646.588726}, doi = {10.1145/588646.588726}, timestamp = {Tue, 06 Nov 2018 16:58:10 +0100}, biburl = {https://dblp.org/rec/conf/siguccs/TuckerPZ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fgcs/FerschaJT01, author = {Alois Ferscha and James Johnson and Stephen John Turner}, title = {Distributed simulation performance data mining}, journal = {Future Gener. Comput. Syst.}, volume = {18}, number = {1}, pages = {157--174}, year = {2001}, url = {https://doi.org/10.1016/S0167-739X(01)00050-4}, doi = {10.1016/S0167-739X(01)00050-4}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/fgcs/FerschaJT01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jsac/PetersonGHTLSDPH01, author = {Larry Peterson and Yitzchak Gottlieb and Mike Hibler and Patrick Tullmann and Jay Lepreau and Stephen Schwab and Hrishikesh Dandekar and Andrew Purtell and John Hartman}, title = {An {OS} interface for active routers}, journal = {{IEEE} J. Sel. Areas Commun.}, volume = {19}, number = {3}, pages = {473--487}, year = {2001}, url = {https://doi.org/10.1109/49.917708}, doi = {10.1109/49.917708}, timestamp = {Wed, 12 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jsac/PetersonGHTLSDPH01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/kbs/SwiftTML01, author = {Stephen Swift and Allan Tucker and Nigel J. Martin and Xiaohui Liu}, title = {Grouping multivariate time series variables: applications to chemical process and visual field data}, journal = {Knowl. Based Syst.}, volume = {14}, number = {3-4}, pages = {147--154}, year = {2001}, url = {https://doi.org/10.1016/S0950-7051(01)00091-0}, doi = {10.1016/S0950-7051(01)00091-0}, timestamp = {Sat, 25 Feb 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/kbs/SwiftTML01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ml/TurcotteMS01, author = {Marcel Turcotte and Stephen H. Muggleton and Michael J. E. Sternberg}, title = {The Effect of Relational Background Knowledge on Learning of Protein Three-Dimensional Fold Signatures}, journal = {Mach. Learn.}, volume = {43}, number = {1/2}, pages = {81--95}, year = {2001}, url = {https://doi.org/10.1023/A:1007672817406}, doi = {10.1023/A:1007672817406}, timestamp = {Sat, 30 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ml/TurcotteMS01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/scpe/GanLCTJHH01, author = {Boon{-}Ping Gan and Yoke{-}Hean Low and Wentong Cai and Stephen John Turner and Sanjay Jain and Wen{-}Jing Hsu and Shell{-}Ying Huang}, title = {The Development of Conservative Superstep Protocols for Shared Memory Multiprocessor Systems}, journal = {Parallel Distributed Comput. Pract.}, volume = {4}, number = {1}, year = {2001}, url = {http://www.scpe.org/index.php/scpe/article/view/222}, timestamp = {Mon, 01 Jul 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/scpe/GanLCTJHH01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigops/LeeCTK01, author = {Bu{-}Sung Lee and Wentong Cai and Stephen John Turner and Jit{-}Beng Koh}, title = {Comparison of Network Protocol and Architecture for Distributed Virtual Simulation Environment}, journal = {{ACM} {SIGOPS} Oper. Syst. Rev.}, volume = {35}, number = {3}, pages = {30--42}, year = {2001}, url = {https://doi.org/10.1145/383237.383242}, doi = {10.1145/383237.383242}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigops/LeeCTK01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/TuckerSL01, author = {Allan Tucker and Stephen Swift and Xiaohui Liu}, title = {Variable grouping in multivariate time series via correlation}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}}, volume = {31}, number = {2}, pages = {235--245}, year = {2001}, url = {https://doi.org/10.1109/3477.915346}, doi = {10.1109/3477.915346}, timestamp = {Thu, 08 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/TuckerSL01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acis/ChauT01, author = {Stephen B. Chau and Paul Turner}, title = {A Four Phase Model of {EC} Business Transformation amongst Small to Medium Sized Enterprises: Preliminary Findings from 34 Australian Case Studies}, booktitle = {Australasian Conference on Information Systems, {ACIS} 2001, Coffs Harbour, Australia, December 5-7, 2001}, year = {2001}, url = {https://aisel.aisnet.org/acis2001/3}, timestamp = {Thu, 16 May 2024 17:06:13 +0200}, biburl = {https://dblp.org/rec/conf/acis/ChauT01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/JiGTC01, author = {Zhengrong Ji and Boon{-}Ping Gan and Stephen John Turner and Wentong Cai}, title = {Parallel Federates - An Architecture for Hybrid Distributed Simulation}, booktitle = {5th {IEEE} International Workshop on Distributed Simulation and Real-Time Applications {(DS-RT} 2001), 13-15 August 2001, Cincinnati, OH, {USA}}, pages = {97--104}, publisher = {{IEEE} Computer Society}, year = {2001}, url = {https://doi.org/10.1109/DISTRA.2001.946449}, doi = {10.1109/DISTRA.2001.946449}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dsrt/JiGTC01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iceis/CounsellLSTM01, author = {Steve Counsell and Xiaohui Liu and Stephen Swift and Allan Tucker and Janet McFall}, title = {Optimising the Grouping of Email Users to Servers Using Intelligent Data Analysis}, booktitle = {{ICEIS} 2001, Proceedings of the 3rd International Conference on Enterprise Information Systems, Setubal, Portugal, July 7-10, 2001}, pages = {489--496}, year = {2001}, timestamp = {Thu, 01 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iceis/CounsellLSTM01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpads/JieCT01, author = {Wei Jie and Wentong Cai and Stephen John Turner}, title = {Dynamic Load-Balancing in a Data Parallel Object-Oriented System}, booktitle = {Eigth International Conference on Parallel and Distributed Systems, {ICPADS} 2001, KyongJu City, Korea, June 26-29, 2001}, pages = {279--288}, publisher = {{IEEE} Computer Society}, year = {2001}, url = {https://doi.org/10.1109/ICPADS.2001.934831}, doi = {10.1109/ICPADS.2001.934831}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icpads/JieCT01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ida/KellamLMOST01, author = {Paul Kellam and Xiaohui Liu and Nigel J. Martin and Christine A. Orengo and Stephen Swift and Allan Tucker}, editor = {Frank Hoffmann and David J. Hand and Niall M. Adams and Douglas H. Fisher and Gabriela Guimar{\~{a}}es}, title = {A Framework for Modelling Short, High-Dimensional Multivariate Time Series: Preliminary Results in Virus Gene Expression Data Analysis}, booktitle = {Advances in Intelligent Data Analysis, 4th International Conference, {IDA} 2001, Cascais, Portugal, September 13-15, 2001, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {2189}, pages = {218--227}, publisher = {Springer}, year = {2001}, url = {https://doi.org/10.1007/3-540-44816-0\_22}, doi = {10.1007/3-540-44816-0\_22}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ida/KellamLMOST01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ipps/JieCT01, author = {Wei Jie and Wentong Cai and Stephen John Turner}, title = {Dynamic Load-balancing Using Prediction in a Parallel Object-oriented System}, booktitle = {Proceedings of the 15th International Parallel {\&} Distributed Processing Symposium (IPDPS-01), San Francisco, CA, USA, April 23-27, 2001}, pages = {76}, publisher = {{IEEE} Computer Society}, year = {2001}, url = {https://doi.org/10.1109/IPDPS.2001.925024}, doi = {10.1109/IPDPS.2001.925024}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ipps/JieCT01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/CaiTG01, author = {Wentong Cai and Stephen John Turner and Boon{-}Ping Gan}, editor = {Rajive L. Bagrodia and Ewa Deelman and Philip A. Wilsey}, title = {Hierarchical federations: an architecture for information hiding}, booktitle = {Proceedings of the 15th Workshop on Parallel and Distributed Simulation, {PADS} 2001, Lake Arrowhead, California, USA, May 15-18, 2001}, pages = {67--74}, publisher = {{IEEE} Computer Society}, year = {2001}, url = {https://doi.org/10.1109/PADS.2001.924622}, doi = {10.1109/PADS.2001.924622}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pads/CaiTG01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/ZhangCT01, author = {Ye Zhang and Wentong Cai and Stephen John Turner}, editor = {Rajive L. Bagrodia and Ewa Deelman and Philip A. Wilsey}, title = {A parallel object-oriented manufacturing simulation language}, booktitle = {Proceedings of the 15th Workshop on Parallel and Distributed Simulation, {PADS} 2001, Lake Arrowhead, California, USA, May 15-18, 2001}, pages = {101--108}, publisher = {{IEEE} Computer Society}, year = {2001}, url = {https://doi.org/10.1109/PADS.2001.924626}, doi = {10.1109/PADS.2001.924626}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pads/ZhangCT01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/robocup/StancliffBBESS01, author = {Stephen B. Stancliff and Ravi Balasubramanian and Tucker R. Balch and Rosemary Emery and Kevin Sikorski and Ashley W. Stroupe}, editor = {Andreas Birk and Silvia Coradeschi and Satoshi Tadokoro}, title = {{CMU} Hammerheads 2001 Team Description}, booktitle = {RoboCup 2001: Robot Soccer World Cup {V}}, series = {Lecture Notes in Computer Science}, volume = {2377}, pages = {631--634}, publisher = {Springer}, year = {2001}, url = {https://doi.org/10.1007/3-540-45603-1\_100}, doi = {10.1007/3-540-45603-1\_100}, timestamp = {Tue, 14 May 2019 10:00:53 +0200}, biburl = {https://dblp.org/rec/conf/robocup/StancliffBBESS01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/uist/MacIntyreMVHTC01, author = {Blair MacIntyre and Elizabeth D. Mynatt and Stephen Voida and Klaus Marius Hansen and Joe Tullio and Gregory M. Corso}, editor = {Joe Marks and Elizabeth D. Mynatt}, title = {Support for multitasking and background awareness using interactive peripheral displays}, booktitle = {Proceedings of the 14th Annual {ACM} Symposium on User Interface Software and Technology, {UIST} 2001, Disney's BoardWalk Inn Resort, Walt Disney World, Orlando, Florida, USA, November 11-14, 2001}, pages = {41--50}, publisher = {{ACM}}, year = {2001}, url = {https://doi.org/10.1145/502348.502355}, doi = {10.1145/502348.502355}, timestamp = {Tue, 06 Nov 2018 16:58:06 +0100}, biburl = {https://dblp.org/rec/conf/uist/MacIntyreMVHTC01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/GanLJTC01, author = {Boon{-}Ping Gan and Li Liu and Zhengrong Ji and Stephen John Turner and Wentong Cai}, editor = {Matthew W. Rohrer and Deborah J. Medeiros and Mark R. Grabau}, title = {Managing event traces for a web front-end to a parallel simulation}, booktitle = {Proceedings of the 33nd conference on Winter simulation, {WSC} 2001, Arlington, VA, USA, December 9-12, 2001}, pages = {637--644}, publisher = {{WSC}}, year = {2001}, url = {https://doi.org/10.1109/WSC.2001.977349}, doi = {10.1109/WSC.2001.977349}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wsc/GanLJTC01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/rfc/rfc3185, author = {Stephen Farrell and Sean Turner}, title = {Reuse of {CMS} Content Encryption Keys}, journal = {{RFC}}, volume = {3185}, pages = {1--10}, year = {2001}, url = {https://doi.org/10.17487/RFC3185}, doi = {10.17487/RFC3185}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/rfc/rfc3185.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/etai/TurcotteMS00, author = {Marcel Turcotte and Stephen H. Muggleton and Michael J. E. Sternberg}, title = {Use of Inductive Logic Programming to Learn Principles of Protein Structure}, journal = {Electron. Trans. Artif. Intell.}, volume = {4}, number = {B}, pages = {119--124}, year = {2000}, url = {http://www.ep.liu.se/ej/etai/2000/013/}, timestamp = {Sat, 30 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/etai/TurcotteMS00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jors/GanT00, author = {Boon{-}Ping Gan and Stephen John Turner}, title = {An asynchronous protocol for virtual factory simulation on shared memory multiprocessor systems}, journal = {J. Oper. Res. Soc.}, volume = {51}, number = {4}, pages = {413--422}, year = {2000}, url = {https://doi.org/10.1057/palgrave.jors.2600914}, doi = {10.1057/PALGRAVE.JORS.2600914}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jors/GanT00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/TurnerCG00, author = {Stephen John Turner and Wentong Cai and Boon{-}Ping Gan}, title = {Adapting a Supply-Chain Simulation for {HLA}}, booktitle = {4th International Workshop on Distributed Simulation and Real-Time Applications {(DS-RT} 2000), 25-17 August 2000, San Francisco, CA, {USA}}, pages = {71--78}, publisher = {{IEEE} Computer Society}, year = {2000}, url = {https://doi.org/10.1109/DISRTA.2000.874065}, doi = {10.1109/DISRTA.2000.874065}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dsrt/TurnerCG00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/esm/ZhangCT00, author = {Ye Zhang and Wentong Cai and Stephen John Turner}, editor = {Rik Van Landeghem}, title = {Parallel discrete event simulation of manufacturing systems using parsec}, booktitle = {14\({}^{\mbox{th}}\) European Simulation Multiconference - Simulation and Modelling: Enablers for a Better Quality of Life, May 23-26, 2000, Ghent, Belgium}, pages = {296--301}, publisher = {{SCS} Europe}, year = {2000}, timestamp = {Wed, 10 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/esm/ZhangCT00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/ThomasTRC00, author = {Federico Thomas and Colin Turnbull and Llu{\'{\i}}s Ros and Stephen Cameron}, title = {Computing Signed Distances between Free-Form Objects}, booktitle = {Proceedings of the 2000 {IEEE} International Conference on Robotics and Automation, {ICRA} 2000, April 24-28, 2000, San Francisco, CA, {USA}}, pages = {3713--3718}, publisher = {{IEEE}}, year = {2000}, url = {https://doi.org/10.1109/ROBOT.2000.845310}, doi = {10.1109/ROBOT.2000.845310}, timestamp = {Mon, 22 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icra/ThomasTRC00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ipps/TurnerAL00, author = {Kenneth J. Turner and F. Javier Argul{-}Marin and Stephen D. Laing}, editor = {Jos{\'{e}} D. P. Rolim}, title = {Concurrent Specification and Timing Analysis of Digital Hardware Using {SDL}}, booktitle = {Parallel and Distributed Processing, 15 {IPDPS} 2000 Workshops, Cancun, Mexico, May 1-5, 2000, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {1800}, pages = {1001--1008}, publisher = {Springer}, year = {2000}, url = {https://doi.org/10.1007/3-540-45591-4\_137}, doi = {10.1007/3-540-45591-4\_137}, timestamp = {Tue, 14 May 2019 10:00:41 +0200}, biburl = {https://dblp.org/rec/conf/ipps/TurnerAL00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/GanLJTCHH00, author = {Boon{-}Ping Gan and Yoke{-}Hean Low and Sanjay Jain and Stephen John Turner and Wentong Cai and Wen{-}Jing Hsu and Shell{-}Ying Huang}, editor = {Lorenzo Donatiello and Stephen John Turner and David Bruce}, title = {Load balancing for conservative simulation on shared memory multiprocessor systems}, booktitle = {Proceedings of the 14th Workshop on Parallel and Distributed Simulation, {PADS} 2000, Bologna, Italy, May 28-31, 2000}, pages = {139--146}, publisher = {{IEEE} Computer Society}, year = {2000}, url = {https://doi.org/10.1109/PADS.2000.847157}, doi = {10.1109/PADS.2000.847157}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/GanLJTCHH00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/smc/DamianoKTB00, author = {Brian Damiano and Stephen W. Kercel and Raymond W. Tucker Jr. and S. Alenka Brown{-}VanHoozer}, title = {Recognizing a voice from its model}, booktitle = {Proceedings of the {IEEE} International Conference on Systems, Man {\&} Cybernetics: "Cybernetics Evolving to Systems, Humans, Organizations, and their Complex Interactions", Sheraton Music City Hotel, Nashville, Tennessee, USA, 8-11 October 2000}, pages = {2216--2221}, publisher = {{IEEE}}, year = {2000}, url = {https://doi.org/10.1109/ICSMC.2000.886445}, doi = {10.1109/ICSMC.2000.886445}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/smc/DamianoKTB00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/GanLJTCH00, author = {Boon{-}Ping Gan and Li Liu and Sanjay Jain and Stephen John Turner and Wentong Cai and Wen{-}Jing Hsu}, editor = {Paul A. Fishwick and Keebom Kang and Jeffrey A. Joines and Russell R. Barton}, title = {Manufacturing sypply chain management: distributed supply chain simulation across enterprise boundaries}, booktitle = {Proceedings of the 32nd conference on Winter simulation, {WSC} 2000, Wyndham Palace Resort {\&} Spa, Orlando, FL, USA, December 10-13, 2000}, pages = {1245--1251}, publisher = {{WSC}}, year = {2000}, url = {https://doi.org/10.1109/WSC.2000.899092}, doi = {10.1109/WSC.2000.899092}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/wsc/GanLJTCH00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/pads/2000, editor = {Lorenzo Donatiello and Stephen John Turner and David Bruce}, title = {Proceedings of the 14th Workshop on Parallel and Distributed Simulation, {PADS} 2000, Bologna, Italy, May 28-31, 2000}, publisher = {{IEEE} Computer Society}, year = {2000}, url = {https://ieeexplore.ieee.org/xpl/conhome/6840/proceeding}, isbn = {0-7695-0667-4}, timestamp = {Wed, 16 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/2000.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/mor/StephenT99, author = {Tamon Stephen and Levent Tun{\c{c}}el}, title = {On a Representation of the Matching Polytope Via Semidefinite Liftings}, journal = {Math. Oper. Res.}, volume = {24}, number = {1}, pages = {1--7}, year = {1999}, url = {https://doi.org/10.1287/moor.24.1.1}, doi = {10.1287/MOOR.24.1.1}, timestamp = {Fri, 30 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/mor/StephenT99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pc/CaiZTS99, author = {Wentong Cai and Kang Zhang and Stephen John Turner and Chengzheng Sun}, title = {Interlock avoidance in transparent and dynamic parallel program instrumentation using logical clocks}, journal = {Parallel Comput.}, volume = {25}, number = {5}, pages = {569--591}, year = {1999}, url = {https://doi.org/10.1016/S0167-8191(99)00010-1}, doi = {10.1016/S0167-8191(99)00010-1}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pc/CaiZTS99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/simulation/LowLCHHJT99, author = {Yoke{-}Hean Low and Chu{-}Cheow Lim and Wentong Cai and Shell{-}Ying Huang and Wen{-}Jing Hsu and Sanjay Jain and Stephen John Turner}, title = {Survey of Languages and Runtime Libraries for Parallel Discrete-Event Simulation}, journal = {Simul.}, volume = {72}, number = {3}, pages = {170--186}, year = {1999}, url = {https://doi.org/10.1177/003754979907200309}, doi = {10.1177/003754979907200309}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/simulation/LowLCHHJT99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/arvlsi/BrittonWSWTBBDEEMTCJTHR99, author = {Charles L. Britton Jr. and R. J. Warmack and Stephen F. Smith and Alan L. Wintenberg and T. Thundat and G. M. Brown and W. L. Bryan and J. C. Depriest and M. Nance Ericson and M. S. Emery and Michael Roy Moore and G. W. Turner and Lloyd G. Clonts and R. L. Jones and T. D. Threatt and Z. Hu and James M. Rochelle}, title = {Battery-powered, Wireless {MEMS} Sensors for High-Sensitivity Chemical and Biological Sensing}, booktitle = {18th Conference on Advanced Research in {VLSI} {(ARVLSI} '99), 21-24 March 1999, Atlanta, GA, {USA}}, pages = {359--368}, publisher = {{IEEE} Computer Society}, year = {1999}, url = {https://doi.org/10.1109/ARVLSI.1999.756060}, doi = {10.1109/ARVLSI.1999.756060}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/arvlsi/BrittonWSWTBBDEEMTCJTHR99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsrt/LiangCLT99, author = {Lawrence A. H. Liang and Wentong Cai and Bu{-}Sung Lee and Stephen John Turner}, title = {Performance Analysis of Packet Bundling Techniques in {DIS}}, booktitle = {3rd International Workshop on Distributed Interactive Simulation and Real-Time Applications {(DIS-RT} '99), 22-23 October 1999, Greenbelt, MD, {USA}}, pages = {75}, publisher = {{IEEE} Computer Society}, year = {1999}, url = {https://doi.org/10.1109/DISRTA.1999.807728}, doi = {10.1109/DISRTA.1999.807728}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dsrt/LiangCLT99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ida/SwiftTL99, author = {Stephen Swift and Allan Tucker and Xiaohui Liu}, editor = {David J. Hand and Joost N. Kok and Michael R. Berthold}, title = {Evolutionary Computation to Search for Strongly Correlated Variables in High-Dimensional Time-Series}, booktitle = {Advances in Intelligent Data Analysis, Third International Symposium, IDA-99, Amsterdam, The Netherlands, August 1999, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {1642}, pages = {51--62}, publisher = {Springer}, year = {1999}, url = {https://doi.org/10.1007/3-540-48412-4\_5}, doi = {10.1007/3-540-48412-4\_5}, timestamp = {Wed, 07 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ida/SwiftTL99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/pads/1999, editor = {Richard M. Fujimoto and Stephen John Turner}, title = {Proceedings of the Thirteenth Workshop on Parallel and Distributed Simulation, {PADS} '99, Atlanta, GA, USA, May 1-4, 1999}, publisher = {{IEEE} Computer Society}, year = {1999}, url = {https://ieeexplore.ieee.org/xpl/conhome/6213/proceeding}, isbn = {0-7695-0155-9}, timestamp = {Wed, 16 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/1999.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jsa/Turner98, author = {Stephen John Turner}, title = {Models of computation for parallel discrete event simulation}, journal = {J. Syst. Archit.}, volume = {44}, number = {6-7}, pages = {395--409}, year = {1998}, url = {https://doi.org/10.1016/S1383-7621(97)00055-6}, doi = {10.1016/S1383-7621(97)00055-6}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jsa/Turner98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/esm/CuiT98, author = {Qung Ming Cui and Stephen John Turner}, editor = {Richard N. Zobel and Dietmar P. F. M{\"{o}}ller}, title = {Reducing Null Messages in The Conservative Parallel Simulation of Timed Petri Nets}, booktitle = {12\({}^{\mbox{th}}\) European Simulation Multiconference - Simulation - Past, Present and Future, June 16-19, 1998, Machester, United Kingdom}, pages = {69--73}, publisher = {{SCS} Europe}, year = {1998}, timestamp = {Fri, 28 Apr 2006 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/esm/CuiT98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icra/TurnbullC98, author = {Colin Turnbull and Stephen Cameron}, title = {Computing Distances between NURBS-defined Convex Objects}, booktitle = {Proceedings of the {IEEE} International Conference on Robotics and Automation, ICRA-98, Leuven, Belgium, May 16-20, 1998}, pages = {3685--3690}, publisher = {{IEEE} Computer Society}, year = {1998}, url = {https://doi.org/10.1109/ROBOT.1998.681406}, doi = {10.1109/ROBOT.1998.681406}, timestamp = {Mon, 22 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icra/TurnbullC98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ilp/TurcotteMS98, author = {Marcel Turcotte and Stephen H. Muggleton and Michael J. E. Sternberg}, editor = {David Page}, title = {Application of Inductive Logic Programming to Discover Rules Governing the Three-Dimensional Topology of Protein Structure}, booktitle = {Inductive Logic Programming, 8th International Workshop, ILP-98, Madison, Wisconsin, USA, July 22-24, 1998, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {1446}, pages = {53--64}, publisher = {Springer}, year = {1998}, url = {https://doi.org/10.1007/BFb0027310}, doi = {10.1007/BFB0027310}, timestamp = {Sat, 30 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ilp/TurcotteMS98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ipps/LimLCHHT98, author = {Chu{-}Cheow Lim and Yoke{-}Hean Low and Wentong Cai and Wen{-}Jing Hsu and Shell{-}Ying Huang and Stephen John Turner}, editor = {Jos{\'{e}} D. P. Rolim}, title = {An Empirical Comparison of Runtime Systems for Conservative Parallel Simulation}, booktitle = {Parallel and Distributed Processing, 10 IPPS/SPDP'98 Workshops Held in Conjunction with the 12th International Parallel Processing Symposium and 9th Symposium on Parallel and Distributed Processing, Orlando, Florida, USA, March 30 - April 3, 1998, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {1388}, pages = {123--134}, publisher = {Springer}, year = {1998}, url = {https://doi.org/10.1007/3-540-64359-1\_683}, doi = {10.1007/3-540-64359-1\_683}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ipps/LimLCHHT98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/TurnerCLLHH98, author = {Stephen John Turner and Wentong Cai and Chu{-}Cheow Lim and Yoke{-}Hean Low and Wen{-}Jing Hsu and Shell{-}Ying Huang}, editor = {Brian W. Unger and Alois Ferscha}, title = {A Methodology for Automating the Parallelization of Manufacturing Simulations}, booktitle = {Proceedings of the 12th Workshop on Parallel and Distributed Simulation, {PADS} '98, Banff, Alberta, Canada, May 26-29, 1998}, pages = {126--133}, publisher = {{IEEE} Computer Society}, year = {1998}, url = {https://doi.org/10.1109/PADS.1998.685278}, doi = {10.1109/PADS.1998.685278}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pads/TurnerCLLHH98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ais/TuckettTJ97, author = {J. Tuckett and Peter J. Thomas and Stephen R. Jones}, title = {Expert Opinion on the Future of Multimedia Based Education}, journal = {{AI} Soc.}, volume = {11}, number = {1}, pages = {88--103}, year = {1997}, url = {https://doi.org/10.1007/BF02812441}, doi = {10.1007/BF02812441}, timestamp = {Fri, 15 Mar 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ais/TuckettTJ97.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hotos/FordMLCRT97, author = {Bryan Ford and Kevin Van Maren and Jay Lepreau and Stephen Clawson and Bart Robinson and Jeff Turner}, title = {The Flux {OS} Toolkit: Reusable Components for {OS} Implementation}, booktitle = {Proceedings of The Sixth Workshop on Hot Topics in Operating Systems, HotOS-VI, Cape Cod, Massachusetts, USA, May 5-6, 1997}, pages = {14--19}, publisher = {{IEEE} Computer Society}, year = {1997}, url = {https://doi.org/10.1109/HOTOS.1997.595175}, doi = {10.1109/HOTOS.1997.595175}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/hotos/FordMLCRT97.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/CaiLT97, author = {Wentong Cai and Emmanuelle Letertre and Stephen John Turner}, editor = {Alois Ferscha and Rassul Ayani and Carl Tropper}, title = {Dag Consistent Parallel Simulation: {A} Predictable and Robust Conservative Algorithm}, booktitle = {Proceedings of the Eleventh Workshop on Parallel and Distributed Simulation, {PADS} '97, Lockenhaus, Austria, June 10-13, 1997}, pages = {178--181}, publisher = {{IEEE} Computer Society}, year = {1997}, url = {https://doi.org/10.1109/PADS.1997.594604}, doi = {10.1109/PADS.1997.594604}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pads/CaiLT97.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pcfd/RycroftT97, author = {N. C. Rycroft and Stephen R. Turnock}, editor = {David R. Emerson and Akin Ecer and Jacques P{\'{e}}riaux and Nobuyuki Satofuka}, title = {Hybrid Cell Finite Volume Euler Solutions of Flow Around a Main-Jib Sail Using an {IBM} {SP2}}, booktitle = {Conference on Parallel Computational Fluid Dynamics 1997, Manchester, UK, May 19-21, 1997}, pages = {263--272}, publisher = {North Holland}, year = {1997}, url = {https://doi.org/10.1016/b978-044482849-1/50032-4}, doi = {10.1016/B978-044482849-1/50032-4}, timestamp = {Fri, 29 May 2020 15:29:13 +0200}, biburl = {https://dblp.org/rec/conf/pcfd/RycroftT97.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pdpta/TurnerY97, author = {Stephen John Turner and Norlaily Yaacob}, editor = {Hamid R. Arabnia}, title = {A Transformational Approach to Object-Based Concurrent Reflective Language}, booktitle = {Proceedings of the International Conference on Parallel and Distributed Processing Techniques and Applications, {PDPTA} 1997, June 30 - July 3, 1997, Las Vegas, Nevada, {USA}}, pages = {226--244}, publisher = {{CSREA} Press}, year = {1997}, timestamp = {Fri, 28 Apr 2006 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pdpta/TurnerY97.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cacm/GeistCHT96, author = {Robert Geist and Madhu Chetuparambil and Stephen T. Hedetniemi and A. Joe Turner}, title = {Computing Research Programs in the {US}}, journal = {Commun. {ACM}}, volume = {39}, number = {12}, pages = {96--99}, year = {1996}, url = {https://doi.org/10.1145/240483.240505}, doi = {10.1145/240483.240505}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cacm/GeistCHT96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/esm/CuiT96, author = {Qing Ming Cui and Stephen J. Turner}, editor = {Andr{\'{a}}s J{\'{a}}vor and Axel Lehmann and Istvan Moln{\'{a}}r}, title = {A New Approach To The Distributed Simulation of Timed Petri Nets}, booktitle = {Modelling and Simulation, ESM96, June 2-6, 1996, Budapest University of Economic Sciences}, pages = {90--94}, publisher = {SCS, The Society for Computer Simulation International}, year = {1996}, timestamp = {Mon, 27 Feb 2023 10:45:50 +0100}, biburl = {https://dblp.org/rec/conf/esm/CuiT96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpp/BlumeEFGLLHPPPPRTW96, author = {William Blume and Rudolf Eigenmann and Keith Faigin and John Grout and Jaejin Lee and Thomas Lawrence and Jay P. Hoeflinger and David A. Padua and Yunheung Paek and Paul Petersen and William M. Pottenger and Lawrence Rauchwerger and Peng Tu and Stephen Weatherford}, editor = {Howard Jay Siegel}, title = {Restructuring Programs for High-Speed Computers with Polaris}, booktitle = {Proceedings of the 1996 International Conference on Parallel Processing Workshop, {ICCPW} 1996, Bloomingdale, IL, USA, August 12-16, 1996}, pages = {149--161}, publisher = {{IEEE} Computer Society}, year = {1996}, url = {https://doi.org/10.1109/ICPPW.1996.538601}, doi = {10.1109/ICPPW.1996.538601}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpp/BlumeEFGLLHPPPPRTW96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/idw/LeeC96, author = {John W. T. Lee and Stephen Chi{-}fai Chan}, editor = {Joseph Fong and Brian Siu}, title = {Extending Path Expression to Tree Expression in {OODM}}, booktitle = {Multimedia, Knowledge-Based {\&} Object-Oriented Databases, 7th International Hong Kong Computer Society Database Workshop, May 1996}, pages = {248--263}, publisher = {Springer, Singapore}, year = {1996}, timestamp = {Thu, 16 Mar 2017 15:23:09 +0100}, biburl = {https://dblp.org/rec/conf/idw/LeeC96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/osdi/FordHLTBC96, author = {Bryan Ford and Mike Hibler and Jay Lepreau and Patrick Tullmann and Godmar Back and Stephen Clawson}, editor = {Karin Petersen and Willy Zwaenepoel}, title = {Microkernels Meet Recursive Virtual Machines}, booktitle = {Proceedings of the Second {USENIX} Symposium on Operating Systems Design and Implementation (OSDI), Seattle, Washington, USA, October 28-31, 1996}, pages = {137--151}, publisher = {{ACM}}, year = {1996}, url = {https://doi.org/10.1145/238721.238769}, doi = {10.1145/238721.238769}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/osdi/FordHLTBC96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tc/TurnerNC95, author = {Stephen W. Turner and Lionel M. Ni and Betty H. C. Cheng}, title = {Contention-Free 2D-Mesh Cluster Allocation in Hypercubes}, journal = {{IEEE} Trans. Computers}, volume = {44}, number = {8}, pages = {1051--1055}, year = {1995}, url = {https://doi.org/10.1109/12.403722}, doi = {10.1109/12.403722}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tc/TurnerNC95.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/anss/BackT95, author = {Adam Back and Stephen John Turner}, title = {Time-stamp generation for optimistic parallel computing}, booktitle = {Proceedings 28st Annual Simulation Symposium {(SS} '95), April 25-28, 1995, Santa Barbara, California, {USA}}, pages = {144}, publisher = {{IEEE} Computer Society}, year = {1995}, url = {https://doi.org/10.1109/SIMSYM.1995.393585}, doi = {10.1109/SIMSYM.1995.393585}, timestamp = {Fri, 05 Jul 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/anss/BackT95.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hpcn/BackT95, author = {Adam Back and Stephen John Turner}, editor = {Louis O. Hertzberger and Giuseppe Serazzi}, title = {Using optimistic execution techniques as a parallelisation tool for general purpose computing}, booktitle = {High-Performance Computing and Networking, International Conference and Exhibition, {HPCN} Europe 1995, Milan, Italy, May 3-5, 1995, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {919}, pages = {21--26}, publisher = {Springer}, year = {1995}, url = {https://doi.org/10.1007/BFb0046604}, doi = {10.1007/BFB0046604}, timestamp = {Fri, 05 Jul 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/hpcn/BackT95.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icannga/RobertsT95, author = {Stephen G. Roberts and Mike Turega}, editor = {David W. Pearson and Nigel C. Steele and Rudolf F. Albrecht}, title = {Evolving Neural Network Structures: An Evaluation of Encoding Techniques}, booktitle = {Artificial Neural Nets and Genetic Algorithms, {ICANNGA} 1995, Proceedings of the International Conference in Al{\`{e}}s, France, 1995}, pages = {96--99}, publisher = {Springer}, year = {1995}, url = {https://doi.org/10.1007/978-3-7091-7535-4\_27}, doi = {10.1007/978-3-7091-7535-4\_27}, timestamp = {Fri, 05 Jul 2019 13:13:56 +0200}, biburl = {https://dblp.org/rec/conf/icannga/RobertsT95.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pdpcs/TanCT95, author = {Hung{-}Khoon Tan and Wentong Cai and Stephen John Turner}, editor = {M. H. Hamza}, title = {{VPE:} {A} Visual Programming Environment for Parallel Processing}, booktitle = {Proceedings of the Seventh {IASTED/ISMM} International Conference on Parallel and Distributed Computing and Systems, Washington, D.C., USA, October 19-21, 1995}, pages = {359--362}, publisher = {{IASTED/ACTA} Press}, year = {1995}, timestamp = {Wed, 10 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pdpcs/TanCT95.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cj/CaiT94, author = {Wentong Cai and Stephen John Turner}, title = {An Approach to the Run-Time Monitoring of Parallel Programs}, journal = {Comput. J.}, volume = {37}, number = {4}, pages = {333--345}, year = {1994}, url = {https://doi.org/10.1093/comjnl/37.4.333}, doi = {10.1093/COMJNL/37.4.333}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cj/CaiT94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lcpc/BlumeEFGHPPPRTW94, author = {William Blume and Rudolf Eigenmann and Keith Faigin and John Grout and Jay P. Hoeflinger and David A. Padua and Paul Petersen and William M. Pottenger and Lawrence Rauchwerger and Peng Tu and Stephen Weatherford}, editor = {Keshav Pingali and Utpal Banerjee and David Gelernter and Alexandru Nicolau and David A. Padua}, title = {Polaris: Improving the Effectiveness of Parallelizing Compilers}, booktitle = {Languages and Compilers for Parallel Computing, 7th International Workshop, LCPC'94, Ithaca, NY, USA, August 8-10, 1994, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {892}, pages = {141--154}, publisher = {Springer}, year = {1994}, url = {https://doi.org/10.1007/BFb0025876}, doi = {10.1007/BFB0025876}, timestamp = {Fri, 24 Dec 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/lcpc/BlumeEFGHPPPRTW94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/BlanchardLT94, author = {Timothy David Blanchard and Thomas W. Lake and Stephen John Turner}, editor = {D. K. Arvind and Rajive L. Bagrodia and Jason Yi{-}Bing Lin}, title = {Cooperative acceleration: robust conservative distributed discrete event simulation}, booktitle = {Proceedings of the Eighth Workshop on Parallel and Distributed Simulation, {PADS} 1994, Edinburgh, Scotland, United Kingdom, July 6-8, 1994}, pages = {58--64}, publisher = {{ACM}}, year = {1994}, url = {https://doi.org/10.1145/182478.182494}, doi = {10.1145/182478.182494}, timestamp = {Fri, 20 May 2022 12:42:41 +0200}, biburl = {https://dblp.org/rec/conf/pads/BlanchardLT94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pads/WoodT94, author = {Kenneth R. Wood and Stephen John Turner}, editor = {D. K. Arvind and Rajive L. Bagrodia and Jason Yi{-}Bing Lin}, title = {A generalized carrier-null method for conservative parallel simulation}, booktitle = {Proceedings of the Eighth Workshop on Parallel and Distributed Simulation, {PADS} 1994, Edinburgh, Scotland, United Kingdom, July 6-8, 1994}, pages = {50--57}, publisher = {{ACM}}, year = {1994}, url = {https://doi.org/10.1145/182478.182492}, doi = {10.1145/182478.182492}, timestamp = {Fri, 05 Jul 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pads/WoodT94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sc/TurnerNC94, author = {Stephen W. Turner and Lionel M. Ni and Betty H. C. Cheng}, editor = {Gary M. Johnson}, title = {Time and/or space sharing in a workstation cluster environment}, booktitle = {Proceedings Supercomputing '94, Washington, DC, USA, November 14-18, 1994}, pages = {630--639}, publisher = {{IEEE} Computer Society}, year = {1994}, url = {https://doi.org/10.1109/SUPERC.1994.344327}, doi = {10.1109/SUPERC.1994.344327}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sc/TurnerNC94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sc/TurnerV94, author = {Stephen W. Turner and Alexander V. Veidenbaum}, editor = {Gary M. Johnson}, title = {Scalability of the Cedar system}, booktitle = {Proceedings Supercomputing '94, Washington, DC, USA, November 14-18, 1994}, pages = {247--254}, publisher = {{IEEE} Computer Society}, year = {1994}, url = {https://doi.org/10.1109/SUPERC.1994.344284}, doi = {10.1109/SUPERC.1994.344284}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sc/TurnerV94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/computer/WhiteAHKMOOTW93, author = {Stephanie White and Mack W. Alford and Julian Holtzman and C. Stephen Kuehl and Brian McCay and David Oliver and David Owens and Colin Tully and Allan Willey}, title = {Systems Engineering of Computer-Based Systems, State of Practice Working Group}, journal = {Computer}, volume = {26}, number = {11}, pages = {54--65}, year = {1993}, url = {http://doi.ieeecomputersociety.org/10.1109/MC.1993.10115}, doi = {10.1109/MC.1993.10115}, timestamp = {Wed, 12 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/computer/WhiteAHKMOOTW93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jpdc/CaiMT93, author = {Wentong Cai and Wendy J. Milne and Stephen John Turner}, title = {Graphical Views of the Behavior of Parallel Programs}, journal = {J. Parallel Distributed Comput.}, volume = {18}, number = {2}, pages = {223--230}, year = {1993}, url = {https://doi.org/10.1006/jpdc.1993.1058}, doi = {10.1006/JPDC.1993.1058}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jpdc/CaiMT93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sp/HamiltonSTVW93, author = {Lisa Hamilton and Mark A. Stalzer and R. Steven Turley and John L. Visher and Stephen M. Wandzura}, title = {FastScat\({}^{\mbox{TM}}\): An Object-Oriented Program for Fast Scattering Computation}, journal = {Sci. Program.}, volume = {2}, number = {4}, pages = {171--178}, year = {1993}, url = {https://doi.org/10.1155/1993/213747}, doi = {10.1155/1993/213747}, timestamp = {Thu, 30 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sp/HamiltonSTVW93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ton/GibbensKT93, author = {Richard J. Gibbens and Frank P. Kelly and Stephen R. E. Turner}, title = {Dynamic routing in multiparented networks}, journal = {{IEEE/ACM} Trans. Netw.}, volume = {1}, number = {2}, pages = {261--270}, year = {1993}, url = {https://doi.org/10.1109/90.222932}, doi = {10.1109/90.222932}, timestamp = {Sat, 27 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ton/GibbensKT93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icci/CzejdoTEL93, author = {Bogdan D. Czejdo and Ralph P. Tucci and David W. Embley and Stephen W. Liddle}, editor = {Osman Abou{-}Rabia and Carl K. Chang and Waldemar W. Koczkodaj}, title = {Graphical Query Specification with Participation Constraints}, booktitle = {Computing and Information - ICCI'93, Fifth International Conference on Computing and Information, Sudbury, Ontario, Canada, May 27-29, 1993, Proceedings}, pages = {433--437}, publisher = {{IEEE} Computer Society}, year = {1993}, timestamp = {Thu, 21 Mar 2002 14:11:16 +0100}, biburl = {https://dblp.org/rec/conf/icci/CzejdoTEL93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpp/TurnerNC93, author = {Stephen W. Turner and Lionel M. Ni and Betty H. C. Cheng}, editor = {Alok N. Choudhary and P. Bruce Berra}, title = {Contention-Free 2D-Mesh Cluster Allocation in Hypercubes}, booktitle = {Proceedings of the 1993 International Conference on Parallel Processing, Syracuse University, NY, USA, August 16-20, 1993. Volume {II:} Software}, pages = {125--129}, publisher = {{CRC} Press}, year = {1993}, url = {https://doi.org/10.1109/ICPP.1993.64}, doi = {10.1109/ICPP.1993.64}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpp/TurnerNC93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isca/KuckDLSZVKYGJWBYEPEHJLMAT93, author = {David J. Kuck and Edward S. Davidson and Duncan H. Lawrie and Ahmed H. Sameh and Chuan{-}Qi Zhu and Alexander V. Veidenbaum and Jeff Konicek and Pen{-}Chung Yew and Kyle A. Gallivan and William Jalby and Harry A. G. Wijshoff and Randall Bramley and Ulrike Meier Yang and Perry A. Emrath and David A. Padua and Rudolf Eigenmann and Jay P. Hoeflinger and Greg P. Jaxon and Zhiyuan Li and T. Murphy and John T. Andrews and Stephen W. Turner}, editor = {Alan Jay Smith}, title = {The Cedar System and an Initial Performance Study}, booktitle = {Proceedings of the 20th Annual International Symposium on Computer Architecture, San Diego, CA, USA, May 1993}, pages = {213--223}, publisher = {{ACM}}, year = {1993}, url = {https://doi.org/10.1145/165123.165157}, doi = {10.1145/165123.165157}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/isca/KuckDLSZVKYGJWBYEPEHJLMAT93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscas/WorthingtonT93, author = {Stephen Worthington and Laurence E. Turner}, title = {A method of evaluating the effects of signal quantization at arbitrary locations in recursive digital filters}, booktitle = {1993 {IEEE} International Symposium on Circuits and Systems, {ISCAS} 1993, Chicago, Illinois, USA, May 3-6, 1993}, pages = {615--618}, publisher = {{IEEE}}, year = {1993}, timestamp = {Wed, 16 Oct 2019 14:14:49 +0200}, biburl = {https://dblp.org/rec/conf/iscas/WorthingtonT93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/air/Turner92, author = {Stephen John Turner}, title = {A concurrent solution to computer security}, journal = {Artif. Intell. Rev.}, volume = {6}, number = {2}, pages = {191--201}, year = {1992}, url = {https://doi.org/10.1007/BF00150233}, doi = {10.1007/BF00150233}, timestamp = {Tue, 07 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/air/Turner92.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccd/WhiteAMOTHKOW92, author = {Stephanie White and Mack W. Alford and Brian McCay and David Oliver and Colin Tully and Julian Holtzman and C. Stephen Kuehl and David Owens and Allan Willey}, title = {Trends in Computer-Based Systems Engineering}, booktitle = {Proceedings 1992 {IEEE} International Conference on Computer Design: {VLSI} in Computer {\&} Processors, {ICCD} '92, Cambridge, MA, USA, October 11-14, 1992}, pages = {12--15}, publisher = {{IEEE} Computer Society}, year = {1992}, url = {https://doi.org/10.1109/ICCD.1992.276215}, doi = {10.1109/ICCD.1992.276215}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccd/WhiteAMOTHKOW92.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/mam/Turner91, author = {Stephen Turner}, title = {Introduction to image processing with the {A100}}, journal = {Microprocess. Microsystems}, volume = {15}, number = {4}, pages = {219--229}, year = {1991}, url = {https://doi.org/10.1016/0141-9331(91)90121-U}, doi = {10.1016/0141-9331(91)90121-U}, timestamp = {Tue, 25 May 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/mam/Turner91.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcad/FeldmannNDR91, author = {Peter Feldmann and Tuyen V. Nguyen and Stephen W. Director and Ronald A. Rohrer}, title = {Sensitivity computation in piecewise approximate circuit simulation}, journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.}, volume = {10}, number = {2}, pages = {171--183}, year = {1991}, url = {https://doi.org/10.1109/43.68404}, doi = {10.1109/43.68404}, timestamp = {Thu, 24 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcad/FeldmannNDR91.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpp/GallivanJTVW91, author = {Kyle A. Gallivan and William Jalby and Stephen W. Turner and Alexander V. Veidenbaum and Harry A. G. Wijshoff}, title = {Preliminary Performance Analysis of the Cedar Multiprocessor Memory System}, booktitle = {Proceedings of the International Conference on Parallel Processing, {ICPP} '91, Austin, Texas, USA, August 1991. Volume {I:} Architecture/Hardware}, pages = {71--75}, publisher = {{CRC} Press}, year = {1991}, timestamp = {Tue, 09 Jan 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpp/GallivanJTVW91.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpp/KonicekTVZDDHSYFKLLPABMTW91, author = {Jeff Konicek and Tracy Tilton and Alexander V. Veidenbaum and Chuan{-}Qi Zhu and Edward S. Davidson and Ruppert A. Downing and Michael J. Haney and Manish Sharma and Pen{-}Chung Yew and P. Michael Farmwald and David J. Kuck and Daniel M. Lavery and Robert A. Lindsey and D. Pointer and John T. Andrews and Thomas Beck and T. Murphy and Stephen W. Turner and Nancy J. Warter}, title = {The Organization of the Cedar System}, booktitle = {Proceedings of the International Conference on Parallel Processing, {ICPP} '91, Austin, Texas, USA, August 1991. Volume {I:} Architecture/Hardware}, pages = {49--56}, publisher = {{CRC} Press}, year = {1991}, timestamp = {Mon, 28 Jul 2014 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icpp/KonicekTVZDDHSYFKLLPABMTW91.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mie/FraserT91, author = {Robert B. Fraser and Stephen Z. Turney}, editor = {Klaus{-}Peter Adlassnig and Georg Grabner and Stellan Bengtsson and Rolf Hansen}, title = {A Bayesian Approach to the Detection of Acute Disorders in a Respiratory Intensive Care Unit}, booktitle = {Medical Informatics Europe 1991, Proceedings, Vienna, Austria, August 19-22, 1991}, series = {Lecture Notes in Medical Informatics}, volume = {45}, pages = {265--269}, publisher = {Springer}, year = {1991}, url = {https://doi.org/10.1007/978-3-642-93503-9\_47}, doi = {10.1007/978-3-642-93503-9\_47}, timestamp = {Wed, 31 May 2017 13:20:44 +0200}, biburl = {https://dblp.org/rec/conf/mie/FraserT91.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mie/FraserWDTCRE91, author = {Robert B. Fraser and Aizik Wolf and C. Michael Dunham and Stephen Z. Turney and Brad M. Cushing and Ameen I. Ramzy and James N. Eastham}, editor = {Klaus{-}Peter Adlassnig and Georg Grabner and Stellan Bengtsson and Rolf Hansen}, title = {An Expert System for the Diagnosis, Treatment, and Triage of Head Injuries in Remote Environments}, booktitle = {Medical Informatics Europe 1991, Proceedings, Vienna, Austria, August 19-22, 1991}, series = {Lecture Notes in Medical Informatics}, volume = {45}, pages = {275--279}, publisher = {Springer}, year = {1991}, url = {https://doi.org/10.1007/978-3-642-93503-9\_49}, doi = {10.1007/978-3-642-93503-9\_49}, timestamp = {Wed, 31 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mie/FraserWDTCRE91.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sc/MarksteinMNP91, author = {Victoria Markstein and Peter W. Markstein and Tung Nguyen and Steve Poole}, editor = {Joanne L. Martin}, title = {Wide format floating-point math libraries}, booktitle = {Proceedings Supercomputing '91, Albuquerque, NM, USA, November 18-22, 1991}, pages = {130--138}, publisher = {{ACM}}, year = {1991}, url = {https://doi.org/10.1145/125826.125903}, doi = {10.1145/125826.125903}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sc/MarksteinMNP91.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigada/BrosgolFGMRT91, author = {Ben Brosgol and Stephen Faris and Marc H. Graham and James W. Moore and Jean{-}Pierre Rosen and S. Tucker Taft}, editor = {Judy Bamberger}, title = {Ada and {SQL}}, booktitle = {Proceedings of the Conference on TRI-Ada 1991 - Today's Accomplishments; Tomorrow's Expectations, TRI-Ada 1991, San Jose, California, USA, October 21-25, 1991}, pages = {257--266}, publisher = {{ACM}}, year = {1991}, url = {https://doi.org/10.1145/126551.126578}, doi = {10.1145/126551.126578}, timestamp = {Mon, 09 May 2022 14:25:34 +0200}, biburl = {https://dblp.org/rec/conf/sigada/BrosgolFGMRT91.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:tr/tum/TUM-I-9014, author = {Stephen L. Bloom and Zolt{\'{a}}n {\'{E}}sik and Dirk Taubner}, title = {Iteration theories of synchronization trees}, journal = {Forschungsberichte, {TU} Munich}, volume = {{TUM} {I} 9014}, pages = {1--60}, year = {1990}, url = {https://d-nb.info/901424242}, timestamp = {Sun, 10 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/tr/tum/TUM-I-9014.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:tr/tum/TUM-I-9034, author = {Stephen F. McCormick and Ulrich R{\"{u}}de}, title = {On local refinement higher order methods for elliptic partial differential equations}, journal = {Forschungsberichte, {TU} Munich}, volume = {{TUM} {I} 9034}, pages = {1--22}, year = {1990}, url = {https://d-nb.info/910513376}, timestamp = {Sun, 10 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/tr/tum/TUM-I-9034.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cor/FloydTD89, author = {Stephen A. Floyd and Charles F. Turner III and K. Roscoe Davis}, title = {Model-based decision support systems: An effective implementation framework}, journal = {Comput. Oper. Res.}, volume = {16}, number = {5}, pages = {481--491}, year = {1989}, url = {https://doi.org/10.1016/0305-0548(89)90035-X}, doi = {10.1016/0305-0548(89)90035-X}, timestamp = {Tue, 18 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cor/FloydTD89.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccad/NguyenFDR89, author = {Tuyen V. Nguyen and Peter Feldmann and Stephen W. Director and Ronald A. Rohrer}, title = {{SPECS} simulation validation with efficient transient sensitivity computation}, booktitle = {1989 {IEEE} International Conference on Computer-Aided Design, {ICCAD} 1989, Santa Clara, CA, USA, November 5-9, 1989. Digest of Technical Papers}, pages = {252--255}, publisher = {{IEEE} Computer Society}, year = {1989}, url = {https://doi.org/10.1109/ICCAD.1989.76947}, doi = {10.1109/ICCAD.1989.76947}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccad/NguyenFDR89.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bioinformatics/TanPTH88, author = {Robert K.{-}Z. Tan and M. Prabhakaran and C. S. Tung and Stephen C. Harvey}, title = {{AUGUR:} a program to predict, display and analyze the tertiary structure of {B-DNA}}, journal = {Comput. Appl. Biosci.}, volume = {4}, number = {1}, pages = {147--151}, year = {1988}, url = {https://doi.org/10.1093/bioinformatics/4.1.147}, doi = {10.1093/BIOINFORMATICS/4.1.147}, timestamp = {Tue, 01 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/bioinformatics/TanPTH88.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ics/TezduyarGLNP88, author = {T. E. Tezduyar and Roland Glowinski and J. Liou and Tung Nguyen and Steve Poole}, editor = {Jacques Lenfant}, title = {Block-iterative finite element computations for incompressible flow problems}, booktitle = {Proceedings of the 2nd international conference on Supercomputing, {ICS} 1988, Saint Malo, France, July 4-8, 1988}, pages = {284--294}, publisher = {{ACM}}, year = {1988}, url = {https://doi.org/10.1145/55364.55392}, doi = {10.1145/55364.55392}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ics/TezduyarGLNP88.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ics/TurnerV88, author = {Stephen W. Turner and Alexander V. Veidenbaum}, editor = {Jacques Lenfant}, title = {Performance of a shared memory system for vector multiprocessors}, booktitle = {Proceedings of the 2nd international conference on Supercomputing, {ICS} 1988, Saint Malo, France, July 4-8, 1988}, pages = {315--325}, publisher = {{ACM}}, year = {1988}, url = {https://doi.org/10.1145/55364.55395}, doi = {10.1145/55364.55395}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ics/TurnerV88.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/air/RossDMBKTMSAMa87, author = {Simon Ross and Tony Dodd and Wendy J. Milne and Mervyn Bennun and Elpida T. Keravnou and Stephen John Turner and Stephen J. Maskell and Kathryn Seifert and Chris Alphey and Yasmin Merali and Jason Cooper and Saad A. Mehdi}, title = {Book reviews}, journal = {Artif. Intell. Rev.}, volume = {1}, number = {4}, pages = {275--295}, year = {1987}, url = {https://doi.org/10.1007/BF00142927}, doi = {10.1007/BF00142927}, timestamp = {Wed, 24 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/air/RossDMBKTMSAMa87.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cacm/MaloneGTBC87, author = {Thomas W. Malone and Kenneth R. Grant and Franklyn A. Turbak and Stephen A. Brobst and Michael D. Cohen}, title = {Intelligent Information-Sharing Systems}, journal = {Commun. {ACM}}, volume = {30}, number = {5}, pages = {390--402}, year = {1987}, url = {https://doi.org/10.1145/22899.22903}, doi = {10.1145/22899.22903}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cacm/MaloneGTBC87.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nar/TungH86, author = {C. S. Tung and Stephen C. Harvey}, title = {Computer graphics program to reveal the dependence of the gross three- dimensional structure of the {B-DNA} double helix on primary structure}, journal = {Nucleic Acids Res.}, volume = {14}, number = {1}, pages = {381--387}, year = {1986}, url = {https://doi.org/10.1093/nar/14.1.381}, doi = {10.1093/NAR/14.1.381}, timestamp = {Sun, 17 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nar/TungH86.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/spe/HortonT86, author = {I. A. Horton and Stephen John Turner}, title = {Using Coroutines in Pascal}, journal = {Softw. Pract. Exp.}, volume = {16}, number = {1}, pages = {45--61}, year = {1986}, url = {https://doi.org/10.1002/spe.4380160105}, doi = {10.1002/SPE.4380160105}, timestamp = {Fri, 05 Jul 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/spe/HortonT86.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jasis/TurnerO84, author = {Stephen J. Turner and Gregory O'Brien}, title = {A fuzzy set theory approach to periodical binding decisions}, journal = {J. Am. Soc. Inf. Sci.}, volume = {35}, number = {4}, pages = {228--234}, year = {1984}, url = {https://doi.org/10.1002/asi.4630350406}, doi = {10.1002/ASI.4630350406}, timestamp = {Wed, 13 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jasis/TurnerO84.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icse/MaibaumT84, author = {T. S. E. Maibaum and Wladyslaw M. Turski}, editor = {Terry A. Straeter and William E. Howden and Jean{-}Claude Rault}, title = {On What Exactly Is Going On When Software Is Developed Step-by-Step}, booktitle = {Proceedings, 7th International Conference on Software Engineering, Orlando, Florida, USA, March 26-29, 1984}, pages = {528--533}, publisher = {{IEEE} Computer Society}, year = {1984}, url = {http://dl.acm.org/citation.cfm?id=802014}, timestamp = {Mon, 14 May 2012 18:17:12 +0200}, biburl = {https://dblp.org/rec/conf/icse/MaibaumT84.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:books/eh/campbell84/Turner84, author = {Stephen John Turner}, editor = {John A. Campbell}, title = {W-Grammars for Logic Programming}, booktitle = {Implementations of Prolog.}, pages = {352--368}, publisher = {Ellis Horwood/Halsted Press/Wiley}, year = {1984}, timestamp = {Mon, 05 Aug 2019 16:47:22 +0200}, biburl = {https://dblp.org/rec/books/eh/campbell84/Turner84.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jasis/RobinsonT81, author = {Earl J. Robinson and Stephen J. Turner}, title = {Improving library effectiveness: {A} proposal for applying fuzzy set concepts in the management of large collections}, journal = {J. Am. Soc. Inf. Sci.}, volume = {32}, number = {6}, pages = {458--462}, year = {1981}, url = {https://doi.org/10.1002/asi.4630320610}, doi = {10.1002/ASI.4630320610}, timestamp = {Wed, 13 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jasis/RobinsonT81.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jasis/TrueswellT79, author = {Richard W. Trueswell and Stephen J. Turner}, title = {Simulating circulation-use characteristic curves using circulation data}, journal = {J. Am. Soc. Inf. Sci.}, volume = {30}, number = {2}, pages = {83--87}, year = {1979}, url = {https://doi.org/10.1002/asi.4630300204}, doi = {10.1002/ASI.4630300204}, timestamp = {Wed, 13 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jasis/TrueswellT79.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ibmsj/EhrsamMMT78, author = {William R. Ehrsam and Stephen M. Matyas and Carl H. Meyer and Walter L. Tuchman}, title = {A Cryptographic Key Management Scheme for Implementing the Data Encryption Standard}, journal = {{IBM} Syst. J.}, volume = {17}, number = {2}, pages = {106--125}, year = {1978}, url = {https://doi.org/10.1147/sj.172.0106}, doi = {10.1147/SJ.172.0106}, timestamp = {Fri, 13 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ibmsj/EhrsamMMT78.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jasis/Turner77, author = {Stephen J. Turner}, title = {The identifier method of measuring use as applied to modeling the circulation use of books from a university library}, journal = {J. Am. Soc. Inf. Sci.}, volume = {28}, number = {2}, pages = {96--100}, year = {1977}, url = {https://doi.org/10.1002/asi.4630280206}, doi = {10.1002/ASI.4630280206}, timestamp = {Wed, 13 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jasis/Turner77.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/TuftsLR76, author = {Donald W. Tufts and Stephen E. Levinson and R. Rao}, title = {Measuring pitch and formant frequencies for a speech understanding system}, booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing, {ICASSP} '76, Philadelphia, Pennsylvania, USA, April 12-14, 1976}, pages = {314--317}, publisher = {{IEEE}}, year = {1976}, url = {https://doi.org/10.1109/ICASSP.1976.1169986}, doi = {10.1109/ICASSP.1976.1169986}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/icassp/TuftsLR76.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/afips/MathisCDMWFHHTW74, author = {Robert F. Mathis and Stephen R. Crocker and Marvin Denicoff and Victor Mitchell and Frederick W. Weingarten and Edward A. Feustel and Lance J. Hoffman and David K. Hsiao and Rein Turn and William A. Wulf}, title = {Research in data security: policies and projects}, booktitle = {American Federation of Information Processing Societies: 1974 National Computer Conference, 6-10 May 1974, Chicago, Illinois, {USA}}, series = {{AFIPS} Conference Proceedings}, volume = {43}, pages = {993--999}, publisher = {{AFIPS} Press}, year = {1974}, url = {https://doi.org/10.1145/1500175.1500368}, doi = {10.1145/1500175.1500368}, timestamp = {Wed, 14 Apr 2021 16:50:07 +0200}, biburl = {https://dblp.org/rec/conf/afips/MathisCDMWFHHTW74.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.