default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Robert Bruce"
download as .bib file
@article{DBLP:journals/jamia/BhasuranSKJDAMCDABWR25,
author = {Balu Bhasuran and
Katharina Schmolly and
Yuvraaj Kapoor and
Nanditha Lakshmi Jayakumar and
Raymond Doan and
Jigar Amin and
Stephen Meninger and
Nathan Cheng and
Robert Deering and
Karl Anderson and
Simon W. Beaven and
Bruce Wang and
Vivek A. Rudrapatna},
title = {Reducing diagnostic delays in acute hepatic porphyria using health
records data and machine learning},
journal = {J. Am. Medical Informatics Assoc.},
volume = {32},
number = {1},
pages = {63--70},
year = {2025},
url = {https://doi.org/10.1093/jamia/ocae141},
doi = {10.1093/JAMIA/OCAE141},
timestamp = {Wed, 08 Jan 2025 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jamia/BhasuranSKJDAMCDABWR25.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/HillWBIRJ24,
author = {Jennie Hill and
T. Owens Walker and
Justin A. Blanco and
Robert W. Ives and
Ryan N. Rakvic and
Bruce Jacob},
title = {Ransomware Classification Using Hardware Performance Counters on a
Non-Virtualized System},
journal = {{IEEE} Access},
volume = {12},
pages = {63865--63884},
year = {2024},
url = {https://doi.org/10.1109/ACCESS.2024.3395491},
doi = {10.1109/ACCESS.2024.3395491},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/HillWBIRJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cm/SchoberMW24,
author = {Robert Schober and
Stan Moyer and
Bruce Worthman},
title = {ComSoc Finance Committee and Financial Status},
journal = {{IEEE} Commun. Mag.},
volume = {62},
number = {8},
pages = {4--5},
year = {2024},
url = {https://doi.org/10.1109/MCOM.2024.10634066},
doi = {10.1109/MCOM.2024.10634066},
timestamp = {Wed, 21 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cm/SchoberMW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ecoi/GoncalvesRVSDANS24,
author = {Nathan Borges Gon{\c{c}}alves and
Diogo Martins Rosa and
Dalton Freitas do Valle and
Marielle N. Smith and
Ricardo Dalagnol and
Danilo Roberti Alves de Almeida and
Bruce W. Nelson and
Scott C. Stark},
title = {Revealing forest structural "fingerprints": An integration of LiDAR
and deep learning uncovers topographical influences on Central Amazon
forests},
journal = {Ecol. Informatics},
volume = {81},
pages = {102628},
year = {2024},
url = {https://doi.org/10.1016/j.ecoinf.2024.102628},
doi = {10.1016/J.ECOINF.2024.102628},
timestamp = {Sat, 03 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ecoi/GoncalvesRVSDANS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/AlexeevABBBCCCCCCCCMDEE24,
author = {Yuri Alexeev and
Maximilian Amsler and
Marco Antonio Barroca and
Sanzio Bassini and
Torey Battelle and
Daan Camps and
David Casanova and
Young Jay Choi and
Frederic T. Chong and
Charles Chung and
Christopher Codella and
Antonio D. C{\'{o}}rcoles and
James Cruise and
Alberto Di Meglio and
Ivan Duran and
Thomas Eckl and
Sophia E. Economou and
Stephan J. Eidenbenz and
Bruce Elmegreen and
Clyde Fare and
Ismael Faro and
Cristina Sanz Fern{\'{a}}ndez and
Rodrigo Neumann Barros Ferreira and
Keisuke Fuji and
Bryce Fuller and
Laura Gagliardi and
Giulia Galli and
Jennifer R. Glick and
Isacco Gobbi and
Pranav Gokhale and
Salvador de la Puente Gonzalez and
Johannes Greiner and
Bill Gropp and
Michele Grossi and
Emanuel Gull and
Burns Healy and
Matthew R. Hermes and
Benchen Huang and
Travis S. Humble and
Nobuyasu Ito and
Artur F. Izmaylov and
Ali Javadi{-}Abhari and
Douglas M. Jennewein and
Shantenu Jha and
Liang Jiang and
Barbara Jones and
Wibe Albert de Jong and
Petar Jurcevic and
William M. Kirby and
Stefan Kister and
Masahiro Kitagawa and
Joel Klassen and
Katherine Klymko and
Kwangwon Koh and
Masaaki Kondo and
Doga Murat K{\"{u}}rk{\c{c}}{\"{u}}oglu and
Krzysztof Kurowski and
Teodoro Laino and
Ryan Landfield and
Matthew L. Leininger and
Vicente Leyton{-}Ortega and
Ang Li and
Meifeng Lin and
Junyu Liu and
Nicol{\'{a}}s Lorente and
Andr{\'{e}} Luckow and
Simon Martiel and
Francisco Mart{\'{\i}}n{-}Fern{\'{a}}ndez and
Margaret Martonosi and
Claire Marvinney and
Arcesio Casta{\~{n}}eda Medina and
Dirk Merten and
Antonio Mezzacapo and
Kristel Michielsen and
Abhishek Mitra and
Tushar Mittal and
Kyungsun Moon and
Joel Moore and
Sarah Mostame and
Mario Motta and
Young{-}Hye Na and
Yunseong Nam and
Prineha Narang and
Yu{-}ya Ohnishi and
Daniele Ottaviani and
Matthew Otten and
Scott Pakin and
Vincent R. Pascuzzi and
Edwin Pednault and
Tomasz Piontek and
Jed Pitera and
Patrick Rall and
Gokul Subramanian Ravi and
Niall Robertson and
Matteo A. C. Rossi and
Piotr Rydlichowski and
Hoon Ryu and
Georgy Samsonidze and
Mitsuhisa Sato and
Nishant Saurabh and
Vidushi Sharma and
Kunal Sharma and
Soyoung Shin and
George Slessman and
Mathias Steiner and
Iskandar Sitdikov and
In{-}Saeng Suh and
Eric D. Switzer and
Wei Tang and
Joel Thompson and
Synge Todo and
Minh C. Tran and
Dimitar Trenev and
Christian Trott and
Huan{-}Hsin Tseng and
Norm M. Tubman and
Esin Tureci and
David Garc{\'{\i}}a Vali{\~{n}}as and
Sofia Vallecorsa and
Christopher Wever and
Konrad Wojciechowski and
Xiaodi Wu and
Shinjae Yoo and
Nobuyuki Yoshioka and
Victor Wen{-}zhe Yu and
Seiji Yunoki and
Sergiy Zhuk and
Dmitry Zubarev},
title = {Quantum-centric supercomputing for materials science: {A} perspective
on challenges and future directions},
journal = {Future Gener. Comput. Syst.},
volume = {160},
pages = {666--710},
year = {2024},
url = {https://doi.org/10.1016/j.future.2024.04.060},
doi = {10.1016/J.FUTURE.2024.04.060},
timestamp = {Mon, 09 Dec 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/fgcs/AlexeevABBBCCCCCCCCMDEE24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/VandewouwNRAMKCKGMTACCG24,
author = {Marlee M. Vandewouw and
Ami Norris{-}Brilliant and
Anum Rahman and
Stephania Assimopoulos and
Sarah U. Morton and
Azadeh Kushki and
Sean Cunningham and
Eileen King and
Elizabeth Goldmuntz and
Thomas A. Miller and
Nina H. Thomas and
Heather R. Adams and
John Cleveland and
James F. Cnota and
Patricia Ellen Grant and
Caren S. Goldberg and
Hao Huang and
Jennifer S. Li and
Patrick S. McQuillen and
George A. Porter and
Amy E. Roberts and
Mark W. Russell and
Christine E. Seidman and
Madalina E. Tivarus and
Wendy K. Chung and
Donald J. Hagler and
Jane W. Newburger and
Ashok Panigrahy and
Jason P. Lerch and
Bruce D. Gelb and
Evdokia Anagnostou},
title = {Identifying novel data-driven subgroups in congenital heart disease
using multi-modal measures of brain structure},
journal = {NeuroImage},
volume = {297},
pages = {120721},
year = {2024},
url = {https://doi.org/10.1016/j.neuroimage.2024.120721},
doi = {10.1016/J.NEUROIMAGE.2024.120721},
timestamp = {Wed, 13 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/VandewouwNRAMKCKGMTACCG24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmpl/SerranoF24,
author = {Manuel Serrano and
Robert Bruce Findler},
title = {The Functional, the Imperative, and the Sudoku: Getting Good, Bad,
and Ugly to Get Along (Functional Pearl)},
journal = {Proc. {ACM} Program. Lang.},
volume = {8},
number = {{ICFP}},
pages = {177--202},
year = {2024},
url = {https://doi.org/10.1145/3674631},
doi = {10.1145/3674631},
timestamp = {Thu, 21 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pacmpl/SerranoF24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scirobotics/MishraKBJHS24,
author = {Anand Kumar Mishra and
Jaeseok Kim and
Hannah Baghdadi and
Bruce R. Johnson and
Kathie T. Hodge and
Robert F. Shepherd},
title = {Sensorimotor control of robots mediated by electrophysiological measurements
of fungal mycelia},
journal = {Sci. Robotics},
volume = {9},
number = {93},
year = {2024},
url = {https://doi.org/10.1126/scirobotics.adk8019},
doi = {10.1126/SCIROBOTICS.ADK8019},
timestamp = {Sun, 08 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/scirobotics/MishraKBJHS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ChaszczewiczSLA24,
author = {Alicja Chaszczewicz and
Raj Sanjay Shah and
Ryan Louie and
Bruce A Arnow and
Robert E. Kraut and
Diyi Yang},
editor = {Lun{-}Wei Ku and
Andre Martins and
Vivek Srikumar},
title = {Multi-Level Feedback Generation with Large Language Models for Empowering
Novice Peer Counselors},
booktitle = {Proceedings of the 62nd Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2024, Bangkok, Thailand,
August 11-16, 2024},
pages = {4130--4161},
publisher = {Association for Computational Linguistics},
year = {2024},
url = {https://doi.org/10.18653/v1/2024.acl-long.227},
doi = {10.18653/V1/2024.ACL-LONG.227},
timestamp = {Tue, 24 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ChaszczewiczSLA24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ZinkeDVFBC24,
author = {Robert Zinke and
Andrea Donnellan and
Bhuvan Varugu and
Eric J. Fielding and
Adrian A. Borsa and
Bruce Chapman},
title = {{UAVSAR} for {NISAR} Solid Earth Calibration and Validation},
booktitle = {{IGARSS} 2024 - 2024 {IEEE} International Geoscience and Remote Sensing
Symposium, Athens, Greece, July 7-12, 2024},
pages = {6678--6680},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/IGARSS53475.2024.10642064},
doi = {10.1109/IGARSS53475.2024.10642064},
timestamp = {Thu, 26 Sep 2024 12:36:11 +0200},
biburl = {https://dblp.org/rec/conf/igarss/ZinkeDVFBC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/imw2/ChienSBYCLLCZGRDHBL24,
author = {Wei{-}Chih Chien and
C. L. Sung and
Robert L. Bruce and
C. W. Yeh and
Huai{-}Yu Cheng and
Z. L. Liu and
E. K. Lai and
C. W. Cheng and
J. X. Zheng and
Alexander Grun and
A. Ray and
D. Daudelin and
H. Y. Ho and
Matthew BrightSky and
H. L. Lung},
title = {A Novel Program-verify Free and Low Drift Multilevel Operation on
Cross-point {OTS-PCM} for In-Memory Computing Application},
booktitle = {{IEEE} International Memory Workshop, {IMW} 2024, Seoul, Republic
of Korea, May 12-15, 2024},
pages = {1--4},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/IMW59701.2024.10536964},
doi = {10.1109/IMW59701.2024.10536964},
timestamp = {Mon, 30 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/imw2/ChienSBYCLLCZGRDHBL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/KarSVSFRLLCZCWAZCGGHJJJJKKLMMNRRRRSSS24,
author = {Monodeep Kar and
Joel Silberman and
Swagath Venkataramani and
Viji Srinivasan and
Bruce M. Fleischer and
Joshua Rubin and
JohnDavid Lancaster and
Sae Kyu Lee and
Matthew Cohen and
Matthew M. Ziegler and
Nianzheng Cao and
Sandra Woodward and
Ankur Agrawal and
Ching Zhou and
Prasanth Chatarasi and
Thomas Gooding and
Michael Guillorn and
Bahman Hekmatshoartabari and
Philip Jacob and
Radhika Jain and
Shubham Jain and
Jinwook Jung and
Kyu{-}Hyoun Kim and
Siyu Koswatta and
Martin Lutz and
Alberto Mannari and
Abey Mathew and
Indira Nair and
Ashish Ranjan and
Zhibin Ren and
Scot Rider and
Thomas Roewer and
David L. Satterfield and
Marcel Schaal and
Sanchari Sen and
Gustavo Tellez and
Hung Tran and
Wei Wang and
Vidhi Zalani and
Jintao Zhang and
Xin Zhang and
Vinay Shah and
Robert M. Senger and
Arvind Kumar and
Pong{-}Fei Lu and
Leland Chang},
title = {14.1 {A} Software-Assisted Peak Current Regulation Scheme to Improve
Power-Limited Inference Performance in a 5nm {AI} SoC},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2024,
San Francisco, CA, USA, February 18-22, 2024},
pages = {254--256},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISSCC49657.2024.10454301},
doi = {10.1109/ISSCC49657.2024.10454301},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/KarSVSFRLLCZCWAZCGGHJJJJKKLMMNRRRRSSS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mipr/TianWZZCWTZKEPS24,
author = {Beitong Tian and
Mingyuan Wu and
Ruixiao Zhang and
Haozhen Zheng and
Bo Chen and
Yaohui Wang and
Shiv Trivedi and
Shanbo Zhang and
Robert Bruce Kaufman and
Leah Espenhahn and
Gianni Pezzarossi and
Mauro Sardela and
John Dallesasse and
Klara Nahrstedt},
title = {GaugeTracker: {AI} - Powered Cost-Effective Analog Gauge Monitoring
System},
booktitle = {7th {IEEE} International Conference on Multimedia Information Processing
and Retrieval, {MIPR} 2024, San Jose, CA, USA, August 7-9, 2024},
pages = {477--483},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/MIPR62202.2024.00081},
doi = {10.1109/MIPR62202.2024.00081},
timestamp = {Wed, 30 Oct 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mipr/TianWZZCWTZKEPS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/ChienZYGCLGSLCC24,
author = {Wei{-}Chih Chien and
J. X. Zheng and
C. W. Yeh and
Lynne M. Gignac and
H. Y. Cheng and
Z. L. Liu and
Alexander Grun and
C. L. Sung and
E. K. Lai and
S. Cheng and
C. W. Cheng and
L. Buzi and
A. Ray and
Douglas M. Bishop and
Robert L. Bruce and
M. J. BrightSky and
H. L. Lung},
title = {A Novel Chalcogenide Based CuGeSe Selector Only Memory {(SOM)} for
3D Xpoint and 3D Vertical Memory Applications},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits 2024, Honolulu,
HI, USA, June 16-20, 2024},
pages = {1--2},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/VLSITechnologyandCir46783.2024.10631520},
doi = {10.1109/VLSITECHNOLOGYANDCIR46783.2024.10631520},
timestamp = {Thu, 17 Oct 2024 14:04:05 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/ChienZYGCLGSLCC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-15482,
author = {Alicja Chaszczewicz and
Raj Sanjay Shah and
Ryan Louie and
Bruce A Arnow and
Robert E. Kraut and
Diyi Yang},
title = {Multi-Level Feedback Generation with Large Language Models for Empowering
Novice Peer Counselors},
journal = {CoRR},
volume = {abs/2403.15482},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.15482},
doi = {10.48550/ARXIV.2403.15482},
eprinttype = {arXiv},
eprint = {2403.15482},
timestamp = {Tue, 09 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-15482.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2407-04917,
author = {Peter Zhong and
Shu{-}Hung You and
Simone Campanoni and
Robert Bruce Findler and
Matthew Flatt and
Christos Dimoulas},
title = {A Calculus for Unreachable Code},
journal = {CoRR},
volume = {abs/2407.04917},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2407.04917},
doi = {10.48550/ARXIV.2407.04917},
eprinttype = {arXiv},
eprint = {2407.04917},
timestamp = {Mon, 12 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2407-04917.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aam/LandmanR23,
author = {Bruce M. Landman and
Aaron Robertson},
title = {Monochromatic strictly ascending waves and permutation pattern waves},
journal = {Adv. Appl. Math.},
volume = {146},
pages = {102501},
year = {2023},
url = {https://doi.org/10.1016/j.aam.2023.102501},
doi = {10.1016/J.AAM.2023.102501},
timestamp = {Wed, 12 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aam/LandmanR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fi/PaglialongaTKKBGK23,
author = {Alessia Paglialonga and
Rebecca Theal and
Bruce Knox and
Robert Kyba and
David Barber and
Aziz Guergachi and
Karim Keshavjee},
title = {Applying Patient Segmentation Using Primary Care Electronic Medical
Records to Develop a Virtual Peer-to-Peer Intervention for Patients
with Type 2 Diabetes},
journal = {Future Internet},
volume = {15},
number = {4},
pages = {149},
year = {2023},
url = {https://doi.org/10.3390/fi15040149},
doi = {10.3390/FI15040149},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fi/PaglialongaTKKBGK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/LangstiehLKS23,
author = {Derek R. Langstieh and
Richard H. Duncan Lyngdoh and
Robert Bruce King and
Henry F. Schaefer III},
title = {Lantern-type dinickel complexes: An exploration of possibilities for
nickel-nickel bonding with bridging bidentate ligands},
journal = {J. Comput. Chem.},
volume = {44},
number = {3},
pages = {355--366},
year = {2023},
url = {https://doi.org/10.1002/jcc.26936},
doi = {10.1002/JCC.26936},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcc/LangstiehLKS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/AananthakrishnanACCBEFHHHJLMNPPST23,
author = {Sriram Aananthakrishnan and
Shamsul Abedin and
Vincent Cav{\'{e}} and
Fabio Checconi and
Kristof Du Bois and
Stijn Eyerman and
Joshua B. Fryman and
Wim Heirman and
Jason Howard and
Ibrahim Hur and
Samkit Jain and
Marek M. Landowski and
Kevin Ma and
Jarrod A. Nelson and
Robert Pawlowski and
Fabrizio Petrini and
Sebastian Szkoda and
Sanjaya Tayal and
Jesmin Jahan Tithi and
Yves Vandriessche},
title = {The Intel Programmable and Integrated Unified Memory Architecture
Graph Analytics Processor},
journal = {{IEEE} Micro},
volume = {43},
number = {5},
pages = {78--87},
year = {2023},
url = {https://doi.org/10.1109/MM.2023.3295848},
doi = {10.1109/MM.2023.3295848},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/AananthakrishnanACCBEFHHHJLMNPPST23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/OlsonABCCDDDDKKLLMMMNNOOPPPPSSSTTVV23,
author = {Robert D. Olson and
Rida Assaf and
Thomas S. Brettin and
Neal Conrad and
Clark Cucinell and
James J. Davis and
Donald M. Dempsey and
Allan Dickerman and
Emily M. Dietrich and
Ronald W. Kenyon and
Mehmet Kuscuoglu and
Elliot J. Lefkowitz and
Jian Lu and
Dustin Machi and
Catherine Macken and
Chunhong Mao and
Anna Maria Niewiadomska and
Marcus Nguyen and
Gary J. Olsen and
Jamie C. Overbeek and
Bruce D. Parrello and
Victoria Parrello and
Jacob s Porter and
Gordon D. Pusch and
Maulik Shukla and
Indresh Singh and
Lucy Stewart and
Gene Tan and
Chris Thomas and
Margo VanOeffelen and
Veronika Vonstein and
Zachary S. Wallace and
Andrew S. Warren and
Alice R. Wattam and
Fangfang Xia and
Hyun Seung Yoo and
Yun Zhang and
Christian M. Zmasek and
Richard H. Scheuermann and
Rick L. Stevens},
title = {Introducing the Bacterial and Viral Bioinformatics Resource Center
{(BV-BRC):} a resource combining PATRIC, {IRD} and ViPR},
journal = {Nucleic Acids Res.},
volume = {51},
number = {{D1}},
pages = {678--689},
year = {2023},
url = {https://doi.org/10.1093/nar/gkac1003},
doi = {10.1093/NAR/GKAC1003},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/OlsonABCCDDDDKKLLMMMNNOOPPPPSSSTTVV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/ZhuKRHSZLLAAABBBBBBCCCCDDDDD23,
author = {Xi Zhu and
Yoojean Kim and
Orren Ravid and
Xiaofu He and
Benjamin Suarez{-}Jimenez and
Sigal Zilcha{-}Mano and
Amit Lazarov and
Seonjoo Lee and
Chadi G. Abdallah and
Michael Angstadt and
Christopher L. Averill and
C. Lexi Baird and
Lee Baugh and
Jennifer Urbano Blackford and
Jessica Bomyea and
Steven E. Bruce and
Richard A. Bryant and
Zhihong Cao and
Kyle Choi and
Josh M. Cisler and
Andrew S. Cotton and
Judith K. Daniels and
Nicholas D. Davenport and
Richard J. Davidson and
Michael D. De Bellis and
Emily L. Dennis and
Maria Densmore and
Terri A. deRoon{-}Cassini and
Seth G. Disner and
Wissam El{-}Hage and
Amit Etkin and
Negar Fani and
Kelene A. Fercho and
Jacklynn M. Fitzgerald and
Gina L. Forster and
Jessie L. Frijling and
Elbert Geuze and
Atilla Gonenc and
Evan M. Gordon and
Staci Gruber and
Daniel W. Grupe and
Jeffrey P. Guenette and
Courtney C. Haswell and
Ryan J. Herringa and
Julia Herzog and
David Bernd Hofmann and
Bobak Hosseini and
Anna R. Hudson and
Ashley A. Huggins and
Jonathan C. Ipser and
Neda Jahanshad and
Meilin Jia{-}Richards and
Tanja Jovanovic and
Milissa L. Kaufman and
Mitzy Kennis and
Anthony King and
Philipp Kinzel and
Saskia B. J. Koch and
Inga Koerte and
Sheri{-}Michelle Koopowitz and
Mayuresh S. Korgaonkar and
John H. Krystal and
Ruth A. Lanius and
Christine L. Larson and
Lauren A. M. Lebois and
Gen Li and
Israel Liberzon and
Guang Ming Lu and
Yifeng Luo and
Vincent A. Magnotta and
Antje Manthey and
Adi Maron{-}Katz and
Geoffery May and
Katie A. McLaughlin and
Sven C. Mueller and
Laura Nawijn and
Steven M. Nelson and
Richard W. J. Neufeld and
Jack B. Nitschke and
Erin O'Leary and
Bunmi O. Olatunji and
Miranda Olff and
Matthew Peverill and
K. Luan Phan and
Rongfeng Qi and
Yann Quid{\'{e}} and
Ivan Rektor and
Kerry J. Ressler and
Pavel Riha and
Marisa Ross and
Isabelle M. Rosso and
Lauren E. Salminen and
Kelly A. Sambrook and
Christian Schmahl and
Martha Elizabeth Shenton and
Margaret A. Sheridan and
Chiahao Shih and
Maurizio Sicorello and
Anika Sierk and
Alan N. Simmons and
Raluca M. Simons and
Jeffrey S. Simons and
Scott R. Sponheim and
Murray B. Stein and
Dan J. Stein and
Jennifer S. Stevens and
Thomas Straube and
Delin Sun and
Jean Th{\'{e}}berge and
Paul M. Thompson and
Sophia I. Thomopoulos and
Nic J. A. van der Wee and
Steven J. A. van der Werff and
Theo G. M. van Erp and
Sanne J. H. van Rooij and
Mirjam van Zuiden and
Tim Varkevisser and
Dick J. Veltman and
Robert R. J. M. Vermeiren and
Henrik Walter and
Li Wang and
Xin Wang and
Carissa N. Weis and
Sherry Winternitz and
Hong Xie and
Ye Zhu and
Melanie Wall and
Yuval Neria and
Rajendra A. Morey},
title = {Neuroimaging-based classification of {PTSD} using data-driven computational
approaches: {A} multisite big data study from the {ENIGMA-PGC} {PTSD}
consortium},
journal = {NeuroImage},
volume = {283},
pages = {120412},
year = {2023},
url = {https://doi.org/10.1016/j.neuroimage.2023.120412},
doi = {10.1016/J.NEUROIMAGE.2023.120412},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/ZhuKRHSZLLAAABBBBBBCCCCDDDDD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmpl/FlattAAGFFGGKKMPPST23,
author = {Matthew Flatt and
Taylor Allred and
Nia Angle and
Stephen De Gabrielle and
Robert Bruce Findler and
Jack Firth and
Kiran Gopinathan and
Ben Greenman and
Siddhartha Kasivajhula and
Alex Knauth and
Jay A. McCarthy and
Sam Phillips and
Sorawee Porncharoenwase and
Jens Axel S{\o}gaard and
Sam Tobin{-}Hochstadt},
title = {Rhombus: {A} New Spin on Macros without All the Parentheses},
journal = {Proc. {ACM} Program. Lang.},
volume = {7},
number = {{OOPSLA2}},
pages = {574--603},
year = {2023},
url = {https://doi.org/10.1145/3622818},
doi = {10.1145/3622818},
timestamp = {Mon, 11 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pacmpl/FlattAAGFFGGKKMPPST23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/BiniCCM23,
author = {Enrico Bini and
Thidapat Chantem and
Bruce R. Childers and
Daniel Moss{\'{e}}},
title = {{IEEE} {TC} Special Issue on Real-Time Systems},
journal = {{IEEE} Trans. Computers},
volume = {72},
number = {1},
pages = {1--2},
year = {2023},
url = {https://doi.org/10.1109/TC.2022.3227228},
doi = {10.1109/TC.2022.3227228},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tc/BiniCCM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/DownsKCBOZ23,
author = {Brandi Downs and
Albert J. Kettner and
Bruce D. Chapman and
G. Robert Brakenridge and
Andrew J. O'Brien and
Cinzia Zuffada},
title = {Assessing the Relative Performance of {GNSS-R} Flood Extent Observations:
Case Study in South Sudan},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {61},
pages = {1--13},
year = {2023},
url = {https://doi.org/10.1109/TGRS.2023.3237461},
doi = {10.1109/TGRS.2023.3237461},
timestamp = {Sat, 03 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/DownsKCBOZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/birthday/BlackB023,
author = {Andrew P. Black and
Kim B. Bruce and
James Noble},
editor = {Ralf L{\"{a}}mmel and
Peter D. Mosses and
Friedrich Steimann},
title = {The Importance of Being Eelco},
booktitle = {Eelco Visser Commemorative Symposium, {EVCS} 2023, April 5, 2023,
Delft, The Netherlands},
series = {OASIcs},
volume = {109},
pages = {4:1--4:15},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2023},
url = {https://doi.org/10.4230/OASIcs.EVCS.2023.4},
doi = {10.4230/OASICS.EVCS.2023.4},
timestamp = {Wed, 21 Aug 2024 22:46:00 +0200},
biburl = {https://dblp.org/rec/conf/birthday/BlackB023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/essderc/RideauUBHMGMNBLRKLLGRBTQMBFHNABPAMP23,
author = {Denis Rideau and
Wilfried Uhring and
R. A. Bianchi and
R{\'{e}}mi Helleboid and
Gabriel Mugny and
J{\'{e}}r{\'{e}}my Grebot and
Jean{-}Robert Manouvrier and
R. Neri and
F. Brun and
Mohammadreza Dolatpoor Lakeh and
Sven Rink and
Jean{-}Baptiste Kammerer and
Christophe Lallement and
E. Lacombe and
Dominique Golanski and
Bruce Rae and
T. M. Bah and
F. Twaddle and
V. Quenette and
G. Marchand and
Christel Buj and
R. Fillon and
Y. Henrion and
Isobel Nicholson and
Megan Agnew and
M. Basset and
R. Perrier and
M. Al{-}Rawhani and
Bastien Mamdy and
S. Pellegrin and
Gilles Gouget and
P. Maciazek and
Andre Juge and
A. Dartigues and
H{\'{e}}l{\`{e}}ne Wehbe{-}Alause},
title = {Direct Measurements and Modeling of Avalanche Dynamics and Quenching
in SPADs},
booktitle = {53rd {IEEE} European Solid-State Device Research Conference, {ESSDERC}
2023, Lisbon, Portugal, September 11-14, 2023},
pages = {144--147},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ESSDERC59256.2023.10268474},
doi = {10.1109/ESSDERC59256.2023.10268474},
timestamp = {Mon, 09 Oct 2023 15:43:28 +0200},
biburl = {https://dblp.org/rec/conf/essderc/RideauUBHMGMNBLRKLLGRBTQMBFHNABPAMP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/BruceAMF23,
author = {Jake Bruce and
Ankit Anand and
Bogdan Mazoure and
Rob Fergus},
title = {Learning About Progress From Experts},
booktitle = {The Eleventh International Conference on Learning Representations,
{ICLR} 2023, Kigali, Rwanda, May 1-5, 2023},
publisher = {OpenReview.net},
year = {2023},
url = {https://openreview.net/forum?id=sKc6fgce1zs},
timestamp = {Wed, 24 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/BruceAMF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmla/MinCKGDTG23,
author = {Yimeng Min and
Ming{-}Chiang Chang and
Shufeng Kong and
John M. Gregoire and
R. Bruce van Dover and
Michael O. Thompson and
Carla P. Gomes},
title = {Physically Informed Graph-Based Deep Reasoning Net for Efficient Combinatorial
Phase Mapping},
booktitle = {International Conference on Machine Learning and Applications, {ICMLA}
2023, Jacksonville, FL, USA, December 15-17, 2023},
pages = {392--399},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICMLA58977.2023.00061},
doi = {10.1109/ICMLA58977.2023.00061},
timestamp = {Tue, 02 Apr 2024 21:06:13 +0200},
biburl = {https://dblp.org/rec/conf/icmla/MinCKGDTG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/imw2/ChienLBCYRGGCGL23,
author = {Wei{-}Chih Chien and
E. K. Lai and
L. Buzi and
C. W. Cheng and
C. W. Yeh and
A. Ray and
Lynne M. Gignac and
N. Gong and
Huai{-}Yu Cheng and
Alexander Grun and
D. Y. Lee and
W. Kim and
A. Majumdar and
Douglas M. Bishop and
Robert L. Bruce and
D. Daudelin and
H. Y. Ho and
M. J. BrightSky and
H. L. Lung},
title = {A Comprehensive Study on the Pillar Size of {OTS-PCM} Memory with
an Optimized Process and Scaling Trends Down to Sub-10 nm for {SCM}
Applications},
booktitle = {{IEEE} International Memory Workshop, {IMW} 2023, Monterey, CA, USA,
May 21-24, 2023},
pages = {1--4},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IMW56887.2023.10145816},
doi = {10.1109/IMW56887.2023.10145816},
timestamp = {Mon, 30 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/imw2/ChienLBCYRGGCGL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/midl/SinghDHFAFDG23,
author = {Nalini M. Singh and
Neel Dey and
Malte Hoffmann and
Bruce Fischl and
Elfar Adalsteinsson and
Robert Frost and
Adrian V. Dalca and
Polina Golland},
editor = {Ipek Oguz and
Jack H. Noble and
Xiaoxiao Li and
Martin Styner and
Christian Baumgartner and
Mirabela Rusu and
Tobias Heimann and
Despina Kontos and
Bennett A. Landman and
Benoit M. Dawant},
title = {Data Consistent Deep Rigid {MRI} Motion Correction},
booktitle = {Medical Imaging with Deep Learning, {MIDL} 2023, 10-12 July 2023,
Nashville, TN, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {227},
pages = {368--381},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v227/singh24a.html},
timestamp = {Tue, 20 Feb 2024 17:19:52 +0100},
biburl = {https://dblp.org/rec/conf/midl/SinghDHFAFDG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sas2/MassonWGG23,
author = {Philippe Masson and
Bruce Wallace and
James Green and
Rafik Goubran},
title = {Comparison of Spatial Coverage of LiDAR Systems for In Home Activity
of Daily Living Applications},
booktitle = {{IEEE} Sensors Applications Symposium, {SAS} 2023, Ottawa, ON, Canada,
July 18-20, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/SAS58821.2023.10254089},
doi = {10.1109/SAS58821.2023.10254089},
timestamp = {Fri, 29 Sep 2023 13:28:51 +0200},
biburl = {https://dblp.org/rec/conf/sas2/MassonWGG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sas2/ZhangSVHWGXG23,
author = {Zhenyu Zhang and
Yichun Shen and
Julio J. Vald{\'{e}}s and
Saiful Huq and
Bruce Wallace and
James Green and
Pengcheng Xi and
Rafik Goubran},
title = {Domestic Sound Classification with Deep Learning},
booktitle = {{IEEE} Sensors Applications Symposium, {SAS} 2023, Ottawa, ON, Canada,
July 18-20, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/SAS58821.2023.10254050},
doi = {10.1109/SAS58821.2023.10254050},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sas2/ZhangSVHWGXG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/stacom-ws/AgrawalABFCYJLVHCDSBHJSZ23,
author = {Shaleka Agrawal and
Joseph Ashby and
Jeiyun Bai and
Fan Feng and
Xue Cai and
Joseph Yanni and
Caroline B. Jones and
Sunil Jit Logantha and
Akbar Vohra and
Robert C. Hutcheon and
Antonio F. Corno and
Halina Dobrzynski and
Robert S. Stephenson and
Mark R. Boyett and
George Hart and
Jonathan C. Jarvis and
Bruce H. Smaill and
Jichao Zhao},
editor = {Oscar Camara and
Esther Puyol{-}Ant{\'{o}}n and
Maxime Sermesant and
Avan Suinesiaputra and
Qian Tao and
Chengyan Wang and
Alistair A. Young},
title = {Inherent Atrial Fibrillation Vulnerability in the Appendages Exacerbated
in Heart Failure},
booktitle = {Statistical Atlases and Computational Models of the Heart. Regular
and CMRxRecon Challenge Papers - 14th International Workshop, {STACOM}
2023, Held in Conjunction with {MICCAI} 2023, Vancouver, BC, Canada,
October 12, 2023, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {14507},
pages = {220--229},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-52448-6\_21},
doi = {10.1007/978-3-031-52448-6\_21},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/stacom-ws/AgrawalABFCYJLVHCDSBHJSZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2301-10365,
author = {Nalini M. Singh and
Neel Dey and
Malte Hoffmann and
Bruce Fischl and
Elfar Adalsteinsson and
Robert Frost and
Adrian V. Dalca and
Polina Golland},
title = {Data Consistent Deep Rigid {MRI} Motion Correction},
journal = {CoRR},
volume = {abs/2301.10365},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2301.10365},
doi = {10.48550/ARXIV.2301.10365},
eprinttype = {arXiv},
eprint = {2301.10365},
timestamp = {Fri, 27 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2301-10365.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-00046,
author = {Bogdan Mazoure and
Jake Bruce and
Doina Precup and
Rob Fergus and
Ankit Anand},
title = {Accelerating exploration and representation learning with offline
pre-training},
journal = {CoRR},
volume = {abs/2304.00046},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.00046},
doi = {10.48550/ARXIV.2304.00046},
eprinttype = {arXiv},
eprint = {2304.00046},
timestamp = {Mon, 17 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-00046.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-07897,
author = {Ming{-}Chiang Chang and
Sebastian Ament and
Maximilian Amsler and
Duncan R. Sutherland and
Lan Zhou and
John M. Gregoire and
Carla P. Gomes and
R. Bruce van Dover and
Michael O. Thompson},
title = {Probabilistic Phase Labeling and Lattice Refinement for Autonomous
Material Research},
journal = {CoRR},
volume = {abs/2308.07897},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.07897},
doi = {10.48550/ARXIV.2308.07897},
eprinttype = {arXiv},
eprint = {2308.07897},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-07897.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-00176,
author = {Mingjie Liu and
Teodor{-}Dumitru Ene and
Robert Kirby and
Chris Cheng and
Nathaniel Ross Pinckney and
Rongjian Liang and
Jonah Alben and
Himyanshu Anand and
Sanmitra Banerjee and
Ismet Bayraktaroglu and
Bonita Bhaskaran and
Bryan Catanzaro and
Arjun Chaudhuri and
Sharon Clay and
Bill Dally and
Laura Dang and
Parikshit Deshpande and
Siddhanth Dhodhi and
Sameer Halepete and
Eric Hill and
Jiashang Hu and
Sumit Jain and
Brucek Khailany and
Kishor Kunal and
Xiaowei Li and
Hao Liu and
Stuart F. Oberman and
Sujeet Omar and
Sreedhar Pratty and
Jonathan Raiman and
Ambar Sarkar and
Zhengjiang Shao and
Hanfei Sun and
Pratik P. Suthar and
Varun Tej and
Kaizhe Xu and
Haoxing Ren},
title = {ChipNeMo: Domain-Adapted LLMs for Chip Design},
journal = {CoRR},
volume = {abs/2311.00176},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.00176},
doi = {10.48550/ARXIV.2311.00176},
eprinttype = {arXiv},
eprint = {2311.00176},
timestamp = {Tue, 21 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-00176.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aisy/HanRLSBCOCLKBCS22,
author = {Jin{-}Ping Han and
Malte J. Rasch and
Zuoguang Liu and
Paul Solomon and
Kevin Brew and
Kangguo Cheng and
Injo Ok and
Victor Chan and
Michael Longstreet and
Wanki Kim and
Robert L. Bruce and
Cheng{-}Wei Cheng and
Nicole Saulnier and
Vijay Narayanan},
title = {Impact of Phase-Change Memory Flicker Noise and Weight Drift on Analog
Hardware Inference for Large-Scale Deep Learning Networks},
journal = {Adv. Intell. Syst.},
volume = {4},
number = {5},
year = {2022},
url = {https://doi.org/10.1002/aisy.202100179},
doi = {10.1002/AISY.202100179},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aisy/HanRLSBCOCLKBCS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biodb/ClaytonDZHMSBEN22,
author = {Ashley Clayton and
Mialy M. DeFelice and
Brynn Zalmanek and
Jay Hodgson and
Caroline Morin and
Stockard Simon and
Julie A. Bletz and
James A. Eddy and
Milen Nikolov and
Jineta Banerjee and
Kalyan C. Vinnakota and
Marco Marasca and
Kevin J. Boske and
Bruce Hoff and
Ljubomir Bradic and
Yoori Kim and
James R. Goss and
Robert J. Allaway},
title = {Centralizing neurofibromatosis experimental tool knowledge with the
{NF} Research Tools Database},
journal = {Database J. Biol. Databases Curation},
volume = {2022},
number = {2022},
year = {2022},
url = {https://doi.org/10.1093/database/baac045},
doi = {10.1093/DATABASE/BAAC045},
timestamp = {Thu, 07 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/biodb/ClaytonDZHMSBEN22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cm/ShenSW22,
author = {Xuemin Sherman Shen and
Robert Schober and
Bruce Worthman},
title = {ComSoc Finance Committee and Financial Status},
journal = {{IEEE} Commun. Mag.},
volume = {60},
number = {8},
pages = {4--5},
year = {2022},
url = {https://doi.org/10.1109/MCOM.2022.9860267},
doi = {10.1109/MCOM.2022.9860267},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cm/ShenSW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fdgth/EscobarVieraCSMRR22,
author = {C{\'{e}}sar G. Escobar{-}Viera and
Sophia Choukas{-}Bradley and
Jaime E. Sidani and
Anne J. Maheux and
Savannah R. Roberts and
Bruce L. Rollman},
title = {Examining Social Media Experiences and Attitudes Toward Technology-Based
Interventions for Reducing Social Isolation Among {LGBTQ} Youth Living
in Rural United States: An Online Qualitative Study},
journal = {Frontiers Digit. Health},
volume = {4},
year = {2022},
url = {https://doi.org/10.3389/fdgth.2022.900695},
doi = {10.3389/FDGTH.2022.900695},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fdgth/EscobarVieraCSMRR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/hf/CatchpolePRACWW22,
author = {Ken Catchpole and
Alicia Privette and
Laura Roberts and
Myrtede Alfred and
Brittan Carter and
Erick Woltz and
Dulaney Wilson and
Bruce Crookes},
title = {A Smartphone Application for Teamwork and Communication in Trauma:
Pilot Evaluation "in the Wild"},
journal = {Hum. Factors},
volume = {64},
number = {1},
pages = {143--158},
year = {2022},
url = {https://doi.org/10.1177/00187208211021717},
doi = {10.1177/00187208211021717},
timestamp = {Thu, 25 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/hf/CatchpolePRACWW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/GrauerKRAAGLLBK22,
author = {Anne Grauer and
Jerard Kneifati{-}Hayek and
Brian Reuland and
Jo R. Applebaum and
Jason S. Adelman and
Robert A. Green and
Jeanette Lisak{-}Phillips and
David M. Liebovitz and
Thomas F. Byrd and
Preeti Kansal and
Cheryl Wilkes and
Suzanne Falck and
Connie Larson and
John Shilka and
Elizabeth Vandril and
Gordon D. Schiff and
William L. Galanter and
Bruce L. Lambert},
title = {Indication alerts to improve problem list documentation},
journal = {J. Am. Medical Informatics Assoc.},
volume = {29},
number = {5},
pages = {909--917},
year = {2022},
url = {https://doi.org/10.1093/jamia/ocab285},
doi = {10.1093/JAMIA/OCAB285},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/GrauerKRAAGLLBK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/BruceFKRS22,
author = {Chrystal D. Bruce and
Patricia M. Flatt and
Sarah R. Kirk and
Elizabeth Roberts{-}Kirchhoff and
Hala G. Schepmann},
title = {The Value of Peer Mentoring Networks for Developing Leaders and Inspiring
Change},
journal = {J. Chem. Inf. Model.},
volume = {62},
number = {24},
pages = {6292--6296},
year = {2022},
url = {https://doi.org/10.1021/acs.jcim.2c00155},
doi = {10.1021/ACS.JCIM.2C00155},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/BruceFKRS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LeeASZKVCFGCMOL22,
author = {Sae Kyu Lee and
Ankur Agrawal and
Joel Silberman and
Matthew M. Ziegler and
Mingu Kang and
Swagath Venkataramani and
Nianzheng Cao and
Bruce M. Fleischer and
Michael Guillorn and
Matthew Cohen and
Silvia M. Mueller and
Jinwook Oh and
Martin Lutz and
Jinwook Jung and
Siyu Koswatta and
Ching Zhou and
Vidhi Zalani and
Monodeep Kar and
James Bonanno and
Robert Casatuta and
Chia{-}Yu Chen and
Jungwook Choi and
Howard Haynie and
Alyssa Herbert and
Radhika Jain and
Kyu{-}Hyoun Kim and
Yulong Li and
Zhibin Ren and
Scot Rider and
Marcel Schaal and
Kerstin Schelm and
Michael Scheuermann and
Xiao Sun and
Hung Tran and
Naigang Wang and
Wei Wang and
Xin Zhang and
Vinay Shah and
Brian W. Curran and
Vijayalakshmi Srinivasan and
Pong{-}Fei Lu and
Sunil Shukla and
Kailash Gopalakrishnan and
Leland Chang},
title = {A 7-nm Four-Core Mixed-Precision {AI} Chip With 26.2-TFLOPS Hybrid-FP8
Training, 104.9-TOPS {INT4} Inference, and Workload-Aware Throttling},
journal = {{IEEE} J. Solid State Circuits},
volume = {57},
number = {1},
pages = {182--197},
year = {2022},
url = {https://doi.org/10.1109/JSSC.2021.3120113},
doi = {10.1109/JSSC.2021.3120113},
timestamp = {Thu, 28 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/LeeASZKVCFGCMOL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ncs/RamamoorthySGSB22,
author = {Divya Ramamoorthy and
Kristen Severson and
Soumya Ghosh and
Karen Sachs and
Emily G. Baxi and
Alyssa N. Coyne and
Elizabeth Mosmiller and
Lindsey Hayes and
Aianna Cerezo and
Omar Ahmad and
Promit Roy and
Steven Zeiler and
John W. Krakauer and
Jonathan Li and
Aneesh Donde and
Nhan Huynh and
Miriam Adam and
Brook T. Wassie and
Alexander LeNail and
Natasha Leanna Patel{-}Murray and
Yogindra Raghav and
Velina Kozareva and
Stanislav Tsitkov and
Tobias Ehrenberger and
Julia A. Kaye and
Leandro Lima and
Stacia K. Wyman and
Edward Vertudes and
Naufa Amirani and
Krishna Raja and
Reuben Thomas and
Ryan G. Lim and
Ricardo Miramontes and
Jie Wu and
Vineet Vaibhav and
Andrea Matlock and
Vidya Venkatraman and
Ronald Holewenski and
Niveda Sundararaman and
Rakhi Pandey and
Danica{-}Mae Manalo and
Aaron Frank and
Loren Ornelas and
Lindsey Panther and
Emilda Gomez and
Erick Galvez and
Daniel P{\'{e}}rez and
Imara Meepe and
Susan Lei and
Louis Pinedo and
Chunyan Liu and
Ruby Moran and
Dhruv Sareen and
Barry Landin and
Carla Agurto and
Guillermo A. Cecchi and
Raquel Norel and
Sara Thrower and
Sarah Luppino and
Alanna Farrar and
Lindsay Pothier and
Hong Yu and
Ervin Sinani and
Prasha Vigneswaran and
Alexander V. Sherman and
S. Michelle Farr and
Berhan Mandefro and
Hannah Trost and
Maria G. Banuelos and
Veronica Garcia and
Michael Workman and
Richie Ho and
Robert Baloh and
Jennifer Roggenbuck and
Matthew B. Harms and
Carolyn Prina and
Sarah Heintzman and
Stephen Kolb and
Jennifer Stocksdale and
Keona Wang and
Todd Morgan and
Daragh Heitzman and
Arish Jamil and
Jennifer Jockel{-}Balsarotti and
Elizabeth Karanja and
Jesse Markway and
Molly McCallum and
Tim Miller and
Ben Joslin and
Deniz Alibazoglu and
Senda Ajroud{-}Driss and
Jay C. Beavers and
Mary Bellard and
Elizabeth Bruce and
Nicholas J. Maragakis and
Merit E. Cudkowicz and
James D. Berry and
Terri Thompson and
Steven Finkbeiner and
Leslie M. Thompson and
Jennifer E. Van Eyk and
Clive N. Svendsen and
Jeffrey D. Rothstein and
Jonathan D. Glass and
Christina N. Fournier and
Alexander Sherman and
Christian Lunetta and
David Walk and
Ghazala Hayat and
James Wymer and
Kelly Gwathmey and
Nicholas Olney and
Terry Heiman{-}Patterson and
Ximena Arcila{-}Londono and
Kenneth Faulconer and
Ervin Sanani and
Alex Berger and
Julia Mirochnick and
Todd M. Herrington and
Kenney Ng and
Ernest Fraenkel},
title = {Identifying patterns in amyotrophic lateral sclerosis progression
from sparse longitudinal data},
journal = {Nat. Comput. Sci.},
volume = {2},
number = {9},
pages = {605--616},
year = {2022},
url = {https://doi.org/10.1038/s43588-022-00299-w},
doi = {10.1038/S43588-022-00299-W},
timestamp = {Sat, 27 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ncs/RamamoorthySGSB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ncs/ZhaoWMLWAAAAAAA22,
author = {Jia Zhao and
Gefei Wang and
Jingsi Ming and
Zhixiang Lin and
Yang Wang and
Snigdha Agarwal and
Aditi Agrawal and
Ahmad Al{-}Moujahed and
Alina Alam and
Megan A. Albertelli and
Paul Allegakoen and
Thomas Ambrosi and
Jane Antony and
Steven Artandi and
Fabienne Aujard and
Kyle Awayan and
Ankit Baghel and
Isaac Bakerman and
Trygve E. Bakken and
Jalal Baruni and
Philip Beachy and
Biter Bilen and
Olga B. Botvinnik and
Scott D. Boyd and
Deviana Burhan and
Kerriann M. Casey and
Charles Chan and
Charles A. Chang and
Stephen Chang and
Ming Chen and
Michael F. Clarke and
Sheela Crasta and
Rebecca Culver and
Jessica D'Addabbo and
Spyros Darmanis and
Roozbeh Dehghannasiri and
Song{-}Lin Ding and
Connor V. Duffy and
Jacques Epelbaum and
F. Hern{\'{a}}n Espinoza and
Camille Ezran and
Jean Farup and
James E. Ferrell Jr and
Hannah K. Frank and
Margaret Fuller and
Astrid Gillich and
Elias Godoy and
Dita Gratzinger and
Lisbeth A. Guethlein and
Yan Hang and
Kazuteru Hasegawa and
Rebecca D. Hodge and
Malachia Hoover and
Franklin W. Huang and
Kerwyn Casey Huang and
Shelly Huynh and
Taichi Isobe and
Carly Israel and
Sori Jang and
Qiuyu Jing and
Robert C. Jones and
Jengmin Kang and
Caitlin J. Karanewsky and
Jim Karkanias and
Justus Kebschull and
Aaron Kershner and
Lily Kim and
Seung K. Kim and
E. Christopher Kirk and
Winston Koh and
Silvana Konermann and
William Kong and
Mark A. Krasnow and
Christin Kuo and
Corinne Lautier and
Song Eun Lee and
Ed S. Lein and
Rebecca Lewis and
Peng Li and
Shengda Lin and
Shixuan Liu and
Yin Liu and
Gabriel Loeb and
Jonathan Z. Long and
Wan{-}Jin Lu and
Katherine Lucot and
Liqun Luo and
Aaron McGeever and
Ross Metzger and
Jingsi Ming and
Thomas J. Montine and
Antoine de Morree and
Maurizio Morri and
Karim Mrouj and
Shravani Mukherjee and
Ahmad Nabhan and
Saba Nafees and
Norma Neff and
Patrick Neuh{\"{o}}fer and
Patricia Nguyen and
Jennifer Okamoto and
Julia Eve Olivieri and
Youcef Ouadah and
Honor Paine and
Peter Parham and
Jozeph L. Pendleton and
Lolita Penland and
Martine Perret and
Angela Oliveira Pisco and
Zhen Qi and
Stephen R. Quake and
Ute Radespiel and
Thomas A. Rando and
Hajanirina No{\"{e}}line Ravelonjanahary and
Andriamahery Razafindrakoto and
Julia Salzman and
Nicholas Schaum and
Robert Schopler and
Bronwyn Scott and
Liza Shapiro and
Hosu Sin and
Rahul Sinha and
Rene Sit and
Geoff Stanley and
Lubert Stryer and
Varun Ramanan Subramaniam and
Aditi Swarup and
Weilun Tan and
Alexander Tarashansky and
Aris Taychameekiatchai and
J{\'{e}}r{\'{e}}my Terrien and
Kyle J. Travaglini and
Andoni Urtasun and
Sivakamasundari and
Avin Veerakumar and
Venkata Naga Pranathi Vemuri and
Jean{-}Michel Verdier and
Iwijn De Vlaminck and
Douglas Vollrath and
Bo Wang and
Bruce Wang and
Gefei Wang and
Michael F. Z. Wang and
Sheng Wang and
James Webber and
Hannah Weinstein and
Irving L. Weissman and
Amanda L. Wiggenhorn and
Cathy V. Williams and
Patricia Wright and
Albert Y. Wu and
Angela Ruohao Wu and
Tony Wyss{-}Coray and
Bao Xiang and
Jia Yan and
Can Yang and
Jinxurong Yang and
Anne D. Yoder and
Brian Yu and
Andrea R. Yung and
Yue Zhang and
Jia Zhao and
Zicheng Zhao},
title = {Adversarial domain translation networks for integrating large-scale
atlas-level single-cell datasets},
journal = {Nat. Comput. Sci.},
volume = {2},
number = {5},
pages = {317--330},
year = {2022},
url = {https://doi.org/10.1038/s43588-022-00251-y},
doi = {10.1038/S43588-022-00251-Y},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ncs/ZhaoWMLWAAAAAAA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/IaccarinoJKSHGW22,
author = {Leonardo Iaccarino and
Renaud La Joie and
Robert A. Koeppe and
Barry A. Siegel and
Bruce E. Hillner and
Constantine Gatsonis and
Rachel A. Whitmer and
Maria C. Carrillo and
Charles Apgar and
Monica R. Camacho and
Rachel Nosheny and
Gil D. Rabinovici},
title = {rPOP: Robust PET-only processing of community acquired heterogeneous
amyloid-PET data},
journal = {NeuroImage},
volume = {246},
pages = {118775},
year = {2022},
url = {https://doi.org/10.1016/j.neuroimage.2021.118775},
doi = {10.1016/J.NEUROIMAGE.2021.118775},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/IaccarinoJKSHGW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmpl/HoeflichFS22,
author = {Joshua Hoeflich and
Robert Bruce Findler and
Manuel Serrano},
title = {Highly illogical, Kirk: spotting type mismatches in the large despite
broken contracts, unsound types, and too many linters},
journal = {Proc. {ACM} Program. Lang.},
volume = {6},
number = {{OOPSLA2}},
pages = {479--504},
year = {2022},
url = {https://doi.org/10.1145/3563305},
doi = {10.1145/3563305},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pacmpl/HoeflichFS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/patterns/RamirezSSHQRLMB22,
author = {Andrea H. Ramirez and
Lina M. Sulieman and
David J. Schlueter and
Alese E. Halvorson and
Jun Qian and
Francis Ratsimbazafy and
Roxana Loperena{-}Cortes and
Kelsey R. Mayo and
Melissa A. Basford and
Nicole Deflaux and
Karthik Muthuraman and
Karthik Natarajan and
Abel N. Kho and
Hua Xu and
Consuelo H. Wilkins and
Hoda Anton{-}Culver and
Eric Boerwinkle and
Mine Cicek and
Cheryl R. Clark and
Elizabeth Cohn and
Lucila Ohno{-}Machado and
Sheri D. Schully and
Brian K. Ahmedani and
Maria Argos and
Robert M. Cronin and
Christopher J. O'Donnell and
Mona Fouad and
David B. Goldstein and
Philip Greenland and
Scott J. Hebbring and
Elizabeth W. Karlson and
Parinda Khatri and
Bruce Korf and
Jordan W. Smoller and
Stephen Sodeke and
John Wilbanks and
Justin Hentges and
Stephen Mockrin and
Christopher Lunt and
Stephanie A. Devaney and
Kelly Gebo and
Joshua C. Denny and
Robert J. Carroll and
David Glazer and
Paul A. Harris and
George Hripcsak and
Anthony A. Philippakis and
Dan M. Roden},
title = {The \emph{All of Us} Research Program: Data quality, utility, and
diversity},
journal = {Patterns},
volume = {3},
number = {8},
pages = {100570},
year = {2022},
url = {https://doi.org/10.1016/j.patter.2022.100570},
doi = {10.1016/J.PATTER.2022.100570},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/patterns/RamirezSSHQRLMB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/software/Blumen22,
author = {Robert Blumen},
title = {Postgres Server Developer Bruce Momjian Discusses Multiversion Concurrency
Control},
journal = {{IEEE} Softw.},
volume = {39},
number = {5},
pages = {113--115},
year = {2022},
url = {https://doi.org/10.1109/MS.2022.3179865},
doi = {10.1109/MS.2022.3179865},
timestamp = {Tue, 30 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/software/Blumen22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/Iturbide-Sanchez22,
author = {Flavio Iturbide{-}Sanchez and
Larrabee L. Strow and
David C. Tobin and
Yong Chen and
Denis Tremblay and
Robert O. Knuteson and
David G. Johnson and
Clayton Buttles and
Lawrence Suwinski and
Bruce P. Thomas and
Adhemar R. Rivera and
Erin Lynch and
Kun Zhang and
Zhipeng Wang and
Warren Porter and
Xin Jin and
Joe Predina and
Reima I. Eresmaa and
Andrew Collard and
Benjamin C. Ruston and
James A. Jung and
Christopher D. Barnet and
Peter J. Beierle and
Banghua Yan and
Daniel L. Mooney and
Henry E. Revercomb},
title = {Recalibration and Assessment of the {SNPP} CrIS Instrument: {A} Successful
History of Restoration After Midwave Infrared Band Anomaly},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {60},
pages = {1--21},
year = {2022},
url = {https://doi.org/10.1109/TGRS.2021.3112400},
doi = {10.1109/TGRS.2021.3112400},
timestamp = {Thu, 09 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/Iturbide-Sanchez22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/avi/AignerEIREHRW22,
author = {Wolfgang Aigner and
Kajetan Enge and
Michael Iber and
Alexander Rind and
Niklas Elmqvist and
Robert H{\"{o}}ldrich and
Niklas R{\"{o}}nnberg and
Bruce N. Walker},
editor = {Paolo Bottoni and
Emanuele Panizzi},
title = {Workshop on Audio-Visual Analytics},
booktitle = {{AVI} 2022: International Conference on Advanced Visual Interfaces,
Frascati, Rome, Italy, June 6 - 10, 2022},
pages = {92:1--92:4},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3531073.3535252},
doi = {10.1145/3531073.3535252},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/avi/AignerEIREHRW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/essderc/RinkQMJGRBGMKULPAR22,
author = {Sven Rink and
V. Quenette and
Jean{-}Robert Manouvrier and
Andre Juge and
Gilles Gouget and
Denis Rideau and
R. A. Bianchi and
Dominique Golanski and
Bastien Mamdy and
Jean{-}Baptiste Kammerer and
Wilfried Uhring and
Christophe Lallement and
Sara Pellegrini and
Megan Agnew and
Bruce Rae},
title = {A self-sustaining Single Photon Avalanche Diode Model},
booktitle = {52nd {IEEE} European Solid-State Device Research Conference, {ESSDERC}
2022, Milan, Italy, September 19-22, 2022},
pages = {281--284},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ESSDERC55479.2022.9947120},
doi = {10.1109/ESSDERC55479.2022.9947120},
timestamp = {Mon, 07 Aug 2023 15:56:22 +0200},
biburl = {https://dblp.org/rec/conf/essderc/RinkQMJGRBGMKULPAR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/irps/ChienGCYGHYCKKL22,
author = {Wei{-}Chih Chien and
Lynne M. Gignac and
Y. C. Chou and
C. H. Yang and
N. Gong and
H. Y. Ho and
C. W. Yeh and
H. Y. Cheng and
W. Kim and
I. T. Kuo and
E. K. Lai and
C. W. Cheng and
L. Buzi and
A. Ray and
Chia{-}Sheng Hsu and
Robert L. Bruce and
Matthew BrightSky and
H. L. Lung},
title = {Endurance Evaluation on {OTS-PCM} Device using Constant Current Stress
Scheme},
booktitle = {{IEEE} International Reliability Physics Symposium, {IRPS} 2022, Dallas,
TX, USA, March 27-31, 2022},
pages = {7--1},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IRPS48227.2022.9764481},
doi = {10.1109/IRPS48227.2022.9764481},
timestamp = {Wed, 14 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/irps/ChienGCYGHYCKKL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/irps/StahlbushMBSOSA22,
author = {Robert Stahlbush and
Nadeemullah A. Mahadik and
Peter Bonanno and
Jake Soto and
Bruce Odekirk and
Woongje Sung and
Anant K. Agarwal},
title = {Defects in 4H-SiC epilayers affecting device yield and reliability},
booktitle = {{IEEE} International Reliability Physics Symposium, {IRPS} 2022, Dallas,
TX, USA, March 27-31, 2022},
pages = {65--1},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IRPS48227.2022.9764473},
doi = {10.1109/IRPS48227.2022.9764473},
timestamp = {Mon, 09 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/irps/StahlbushMBSOSA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tvx/SaegheMWC022,
author = {Pejman Saeghe and
Mark McGill and
Bruce Weir and
Sarah Clinch and
Robert Stevens},
title = {Evaluating and Updating a Design Space for Augmented Reality Television},
booktitle = {{IMX} '22: {ACM} International Conference on Interactive Media Experiences,
Aveiro, Portugal, June 22 - 24, 2022},
pages = {79--94},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3505284.3529965},
doi = {10.1145/3505284.3529965},
timestamp = {Thu, 23 Jun 2022 15:06:59 +0200},
biburl = {https://dblp.org/rec/conf/tvx/SaegheMWC022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tvx/SaegheWMC022,
author = {Pejman Saeghe and
Bruce Weir and
Mark McGill and
Sarah Clinch and
Robert Stevens},
title = {Augmenting a Nature Documentary with a Lifelike Hologram in Virtual
Reality},
booktitle = {{IMX} '22: {ACM} International Conference on Interactive Media Experiences,
Aveiro, Portugal, June 22 - 24, 2022},
pages = {275--280},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3505284.3532974},
doi = {10.1145/3505284.3532974},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tvx/SaegheWMC022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-06068,
author = {Jeremy Kepner and
Jonathan Bernays and
Stephen Buckley and
Kenjiro Cho and
Cary Conrad and
Leslie Daigle and
Keeley Erhardt and
Vijay Gadepally and
Barry Greene and
Michael Jones and
Robert Knake and
Bruce M. Maggs and
Peter Michaleas and
Chad R. Meiners and
Andrew Morris and
Alex Pentland and
Sandeep Pisharody and
Sarah Powazek and
Andrew Prout and
Philip Reiner and
Koichi Suzuki and
Kenji Takahashi and
Tony Tauber and
Leah Walker and
Doug Stetson},
title = {Zero Botnets: An Observe-Pursue-Counter Approach},
journal = {CoRR},
volume = {abs/2201.06068},
year = {2022},
url = {https://arxiv.org/abs/2201.06068},
eprinttype = {arXiv},
eprint = {2201.06068},
timestamp = {Fri, 21 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2201-06068.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aeog/SchonauerVPLPJM21,
author = {Marian Sch{\"{o}}nauer and
Kari V{\"{a}}{\"{a}}t{\"{a}}inen and
Robert Prinz and
Harri Lindeman and
Dariusz Pszenny and
Martin Jansen and
Joachim Maack and
Bruce Talbot and
Rasmus Astrup and
Dirk Jaeger},
title = {Spatio-temporal prediction of soil moisture and soil strength by depth-to-water
maps},
journal = {Int. J. Appl. Earth Obs. Geoinformation},
volume = {105},
pages = {102614},
year = {2021},
url = {https://doi.org/10.1016/j.jag.2021.102614},
doi = {10.1016/J.JAG.2021.102614},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aeog/SchonauerVPLPJM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdc/SanduskyABCCFGH21,
author = {Robert J. Sandusky and
Suzie Allard and
Lynn Baird and
Leah Cannon and
Kevin Crowston and
Amy Forrester and
Bruce Grant and
Rachael Hu and
Robert Olendorf and
Danielle Pollock and
Alison Specht and
Carol Tenopir and
Rachel Volentine},
title = {Assessment, Usability, and Sociocultural Impacts of DataONE},
journal = {Int. J. Digit. Curation},
volume = {16},
number = {1},
pages = {48},
year = {2021},
url = {https://doi.org/10.2218/ijdc.v16i1.678},
doi = {10.2218/IJDC.V16I1.678},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijdc/SanduskyABCCFGH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/CordobaIGKPBBRB21,
author = {Evette Cordoba and
Betina Ross S. Idnay and
Robert Garofalo and
Lisa M. Kuhns and
Cynthia Pearson and
Josh Bruce and
D. Scott Batey and
Asa Radix and
Uri Belkind and
Marco A. Hidalgo and
Sabina Hirshfield and
Rafael Garibay Rodriguez and
Rebecca Schnall},
title = {Examining the Information Systems Success {(ISS)} of a mobile sexual
health app (MyPEEPS Mobile) from the perspective of very young men
who have sex with men {(YMSM)}},
journal = {Int. J. Medical Informatics},
volume = {153},
pages = {104529},
year = {2021},
url = {https://doi.org/10.1016/j.ijmedinf.2021.104529},
doi = {10.1016/J.IJMEDINF.2021.104529},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmi/CordobaIGKPBBRB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/CroninHSFSLMCCA21,
author = {Robert M. Cronin and
Alese E. Halvorson and
Cassie Springer and
Xiaoke Feng and
Lina M. Sulieman and
Roxana Loperena{-}Cortes and
Kelsey R. Mayo and
Robert J. Carroll and
Qingxia Chen and
Brian K. Ahmedani and
Jason Karnes and
Bruce Korf and
Christopher J. O'Donnell and
Jun Qian and
Andrea H. Ramirez},
title = {Comparison of family health history in surveys vs electronic health
record data mapped to the observational medical outcomes partnership
data model in the All of Us Research Program},
journal = {J. Am. Medical Informatics Assoc.},
volume = {28},
number = {4},
pages = {695--703},
year = {2021},
url = {https://doi.org/10.1093/jamia/ocaa315},
doi = {10.1093/JAMIA/OCAA315},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/CroninHSFSLMCCA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsc/NabeshimaT21,
author = {Katsusuke Nabeshima and
Shinichi Tajima},
title = {A new algorithm for computing logarithmic vector fields along an isolated
singularity and Bruce-Roberts Milnor ideals},
journal = {J. Symb. Comput.},
volume = {107},
pages = {190--208},
year = {2021},
url = {https://doi.org/10.1016/j.jsc.2021.03.003},
doi = {10.1016/J.JSC.2021.03.003},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsc/NabeshimaT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/natmi/ChenBAZGZSDGG21,
author = {Di Chen and
Yiwei Bai and
Sebastian Ament and
Wenting Zhao and
Dan Guevarra and
Lan Zhou and
Bart Selman and
R. Bruce van Dover and
John M. Gregoire and
Carla P. Gomes},
title = {Automating crystal-structure phase mapping by combining deep learning
with constraint reasoning},
journal = {Nat. Mach. Intell.},
volume = {3},
number = {9},
pages = {812--822},
year = {2021},
url = {https://doi.org/10.1038/s42256-021-00384-1},
doi = {10.1038/S42256-021-00384-1},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/natmi/ChenBAZGZSDGG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/JonesMAFWBY21,
author = {Robert Jones and
Chiara Maffei and
Jean Augustinack and
Bruce Fischl and
Hui Wang and
Berkin Bilgic and
Anastasia Yendiki},
title = {High-fidelity approximation of grid- and shell-based sampling schemes
from undersampled {DSI} using compressed sensing: Post mortem validation},
journal = {NeuroImage},
volume = {244},
pages = {118621},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2021.118621},
doi = {10.1016/J.NEUROIMAGE.2021.118621},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/JonesMAFWBY21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tamm/Torrence21,
author = {Bruce Torrence},
title = {Tessellations: Mathematics, Art, and Recreation: By Robert Fathauer.
{A} {K} Peters/CRC Press, Boca Raton, FL, 2020. 464 pp., {ISBN} 978-0367185978},
journal = {Am. Math. Mon.},
volume = {128},
number = {10},
pages = {955--959},
year = {2021},
url = {https://doi.org/10.1080/00029890.2021.1971917},
doi = {10.1080/00029890.2021.1971917},
timestamp = {Tue, 30 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tamm/Torrence21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcasII/Khaddam-Aljameh21,
author = {Riduan Khaddam{-}Aljameh and
Michele Martemucci and
Benedikt Kersting and
Manuel Le Gallo and
Robert L. Bruce and
Matthew BrightSky and
Abu Sebastian},
title = {A Multi-Memristive Unit-Cell Array With Diagonal Interconnects for
In-Memory Computing},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {68},
number = {12},
pages = {3522--3526},
year = {2021},
url = {https://doi.org/10.1109/TCSII.2021.3078614},
doi = {10.1109/TCSII.2021.3078614},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcasII/Khaddam-Aljameh21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/CakmakPPRMNHBAS21,
author = {Ayse S. Cakmak and
Erick Andres Perez{-}Alday and
Giulia Da Poian and
Ali Bahrami Rad and
Thomas J. Metzler and
Thomas Neylan and
Stacey L. House and
Francesca L. Beaudoin and
Xinming An and
Jennifer S. Stevens and
Donglin Zeng and
Sarah D. Linnstaedt and
Tanja Jovanovic and
Laura T. Germine and
Kenneth A. Bollen and
Scott L. Rauch and
Christopher A. Lewandowski and
Phyllis L. Hendry and
Sophia Sheikh and
Alan B. Storrow and
Paul I. Musey and
John P. Haran and
Christopher W. Jones and
Brittany E. Punches and
Robert A. Swor and
Nina T. Gentile and
Meghan McGrath and
Mark J. Seamon and
Kamran Mohiuddin and
Anna M. Chang and
Claire Pearson and
Robert M. Domeier and
Steven E. Bruce and
Brian J. O'Neil and
Niels K. Rathlev and
Leon D. Sanchez and
Robert H. Pietrzak and
Jutta Joormann and
Deanna M. Barch and
Diego A. Pizzagalli and
Steven E. Harte and
James M. Elliott and
Ronald C. Kessler and
Karestan C. Koenen and
Kerry J. Ressler and
Samuel A. McLean and
Qiao Li and
Gari D. Clifford},
title = {Classification and Prediction of Post-Trauma Outcomes Related to {PTSD}
Using Circadian Rhythm Changes Measured via Wrist-Worn Research Watch
in a Large Longitudinal Cohort},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {25},
number = {8},
pages = {2866--2876},
year = {2021},
url = {https://doi.org/10.1109/JBHI.2021.3053909},
doi = {10.1109/JBHI.2021.3053909},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/titb/CakmakPPRMNHBAS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esop/YouFD21,
author = {Shu{-}Hung You and
Robert Bruce Findler and
Christos Dimoulas},
editor = {Nobuko Yoshida},
title = {Sound and Complete Concolic Testing for Higher-order Functions},
booktitle = {Programming Languages and Systems - 30th European Symposium on Programming,
{ESOP} 2021, Held as Part of the European Joint Conferences on Theory
and Practice of Software, {ETAPS} 2021, Luxembourg City, Luxembourg,
March 27 - April 1, 2021, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12648},
pages = {635--663},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-72019-3\_23},
doi = {10.1007/978-3-030-72019-3\_23},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/esop/YouFD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/ReinigB21,
author = {Bruce A. Reinig and
Robert O. Briggs},
title = {An Experimental Test of the Yield Shift Theory of Satisfaction In
the Field},
booktitle = {54th Hawaii International Conference on System Sciences, {HICSS} 2021,
Kauai, Hawaii, USA, January 5, 2021},
pages = {1--10},
publisher = {ScholarSpace},
year = {2021},
url = {https://hdl.handle.net/10125/70665},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hicss/ReinigB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccad/RenGKKLNR021,
author = {Haoxing Ren and
Saad Godil and
Brucek Khailany and
Robert Kirby and
Haiguang Liao and
Siddhartha Nath and
Jonathan Raiman and
Rajarshi Roy},
title = {Optimizing {VLSI} Implementation with Reinforcement Learning - {ICCAD}
Special Session Paper},
booktitle = {{IEEE/ACM} International Conference On Computer Aided Design, {ICCAD}
2021, Munich, Germany, November 1-4, 2021},
pages = {1--6},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICCAD51958.2021.9643589},
doi = {10.1109/ICCAD51958.2021.9643589},
timestamp = {Mon, 07 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccad/RenGKKLNR021.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/RomanelloNR21,
author = {Matteo Romanello and
Sven Najem{-}Meyer and
Bruce Robertson},
editor = {Apostolos Antonacopoulos and
Christian Clausner and
Maud Ehrmann and
Clemens Neudecker and
Stefan Pletschacher},
title = {Optical Character Recognition of 19th Century Classical Commentaries:
the Current State of Affairs},
booktitle = {HIP@ICDAR 2021: The 6th International Workshop on Historical Document
Imaging and Processing, Lausanne, Switzerland, September 5-6, 2021},
pages = {1--6},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3476887.3476911},
doi = {10.1145/3476887.3476911},
timestamp = {Sat, 30 Sep 2023 09:44:45 +0200},
biburl = {https://dblp.org/rec/conf/icdar/RomanelloNR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/JaegleSABFW21,
author = {Andrew Jaegle and
Yury Sulsky and
Arun Ahuja and
Jake Bruce and
Rob Fergus and
Greg Wayne},
editor = {Marina Meila and
Tong Zhang},
title = {Imitation by Predicting Observations},
booktitle = {Proceedings of the 38th International Conference on Machine Learning,
{ICML} 2021, 18-24 July 2021, Virtual Event},
series = {Proceedings of Machine Learning Research},
volume = {139},
pages = {4665--4676},
publisher = {{PMLR}},
year = {2021},
url = {http://proceedings.mlr.press/v139/jaegle21b.html},
timestamp = {Wed, 25 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/JaegleSABFW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwsm/RobertsBVJMBNDC21,
author = {Hal Roberts and
Rahul Bhargava and
Linas Valiukas and
Dennis Jen and
Momin M. Malik and
Cindy Bishop and
Emily Ndulue and
Aashka Dave and
Justin Clark and
Bruce Etling and
Robert Faris and
Anushka Shah and
Jasmin Rubinovitz and
Alexis Hope and
Catherine D'Ignazio and
Fernando Bermejo and
Yochai Benkler and
Ethan Zuckerman},
editor = {Ceren Budak and
Meeyoung Cha and
Daniele Quercia and
Lexing Xie},
title = {Media Cloud: Massive Open Source Collection of Global News on the
Open Web},
booktitle = {Proceedings of the Fifteenth International {AAAI} Conference on Web
and Social Media, {ICWSM} 2021, held virtually, June 7-10, 2021},
pages = {1034--1045},
publisher = {{AAAI} Press},
year = {2021},
url = {https://ojs.aaai.org/index.php/ICWSM/article/view/18127},
timestamp = {Wed, 22 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icwsm/RobertsBVJMBNDC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/irps/BruceSBCKNMPLBG21,
author = {Robert L. Bruce and
Syed Ghazi Sarwat and
Irem Boybat and
Cheng{-}Wei Cheng and
Wanki Kim and
S. R. Nandakumar and
Charles Mackin and
Timothy Philip and
Zuoguang Liu and
Kevin Brew and
Nanbo Gong and
Injo Ok and
Praneet Adusumilli and
Katie Spoon and
Stefano Ambrogio and
Benedikt Kersting and
Thomas Bohnstingl and
Manuel Le Gallo and
Andrew Simon and
Ning Li and
Iqbal Saraf and
Jin{-}Ping Han and
Lynne M. Gignac and
John M. Papalia and
Tenko Yamashita and
Nicole Saulnier and
Geoffrey W. Burr and
Hsinyu Tsai and
Abu Sebastian and
Vijay Narayanan and
Matthew BrightSky},
title = {Mushroom-Type phase change memory with projection liner: An array-level
demonstration of conductance drift and noise mitigation},
booktitle = {{IEEE} International Reliability Physics Symposium, {IRPS} 2021, Monterey,
CA, USA, March 21-25, 2021},
pages = {1--6},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IRPS46558.2021.9405191},
doi = {10.1109/IRPS46558.2021.9405191},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/irps/BruceSBCKNMPLBG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/VenkataramaniSW21,
author = {Swagath Venkataramani and
Vijayalakshmi Srinivasan and
Wei Wang and
Sanchari Sen and
Jintao Zhang and
Ankur Agrawal and
Monodeep Kar and
Shubham Jain and
Alberto Mannari and
Hoang Tran and
Yulong Li and
Eri Ogawa and
Kazuaki Ishizaki and
Hiroshi Inoue and
Marcel Schaal and
Mauricio J. Serrano and
Jungwook Choi and
Xiao Sun and
Naigang Wang and
Chia{-}Yu Chen and
Allison Allain and
James Bonanno and
Nianzheng Cao and
Robert Casatuta and
Matthew Cohen and
Bruce M. Fleischer and
Michael Guillorn and
Howard Haynie and
Jinwook Jung and
Mingu Kang and
Kyu{-}Hyoun Kim and
Siyu Koswatta and
Sae Kyu Lee and
Martin Lutz and
Silvia M. Mueller and
Jinwook Oh and
Ashish Ranjan and
Zhibin Ren and
Scot Rider and
Kerstin Schelm and
Michael Scheuermann and
Joel Silberman and
Jie Yang and
Vidhi Zalani and
Xin Zhang and
Ching Zhou and
Matthew M. Ziegler and
Vinay Shah and
Moriyoshi Ohara and
Pong{-}Fei Lu and
Brian W. Curran and
Sunil Shukla and
Leland Chang and
Kailash Gopalakrishnan},
title = {RaPiD: {AI} Accelerator for Ultra-low Precision Training and Inference},
booktitle = {48th {ACM/IEEE} Annual International Symposium on Computer Architecture,
{ISCA} 2021, Virtual Event / Valencia, Spain, June 14-18, 2021},
pages = {153--166},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISCA52012.2021.00021},
doi = {10.1109/ISCA52012.2021.00021},
timestamp = {Thu, 28 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isca/VenkataramaniSW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/MartemucciKKBNE21,
author = {Michele Martemucci and
Benedikt Kersting and
Riduan Khaddam{-}Aljameh and
Irem Boybat and
S. R. Nandakumar and
Urs Egger and
Matthew BrightSky and
Robert L. Bruce and
Manuel Le Gallo and
Abu Sebastian},
title = {Accurate Weight Mapping in a Multi-Memristive Synaptic Unit},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2021,
Daegu, South Korea, May 22-28, 2021},
pages = {1--5},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISCAS51556.2021.9401558},
doi = {10.1109/ISCAS51556.2021.9401558},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/MartemucciKKBNE21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/AgrawalLSZKVCFG21,
author = {Ankur Agrawal and
Sae Kyu Lee and
Joel Silberman and
Matthew M. Ziegler and
Mingu Kang and
Swagath Venkataramani and
Nianzheng Cao and
Bruce M. Fleischer and
Michael Guillorn and
Matt Cohen and
Silvia M. Mueller and
Jinwook Oh and
Martin Lutz and
Jinwook Jung and
Siyu Koswatta and
Ching Zhou and
Vidhi Zalani and
James Bonanno and
Robert Casatuta and
Chia{-}Yu Chen and
Jungwook Choi and
Howard Haynie and
Alyssa Herbert and
Radhika Jain and
Monodeep Kar and
Kyu{-}Hyoun Kim and
Yulong Li and
Zhibin Ren and
Scot Rider and
Marcel Schaal and
Kerstin Schelm and
Michael Scheuermann and
Xiao Sun and
Hung Tran and
Naigang Wang and
Wei Wang and
Xin Zhang and
Vinay Shah and
Brian W. Curran and
Vijayalakshmi Srinivasan and
Pong{-}Fei Lu and
Sunil Shukla and
Leland Chang and
Kailash Gopalakrishnan},
title = {A 7nm 4-Core {AI} Chip with 25.6TFLOPS Hybrid {FP8} Training, 102.4TOPS
{INT4} Inference and Workload-Aware Throttling},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2021,
San Francisco, CA, USA, February 13-22, 2021},
pages = {144--146},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISSCC42613.2021.9365791},
doi = {10.1109/ISSCC42613.2021.9365791},
timestamp = {Thu, 28 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/AgrawalLSZKVCFG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mass/TianYMGSKMDN21,
author = {Beitong Tian and
Zhe Yang and
Hessam Moeini and
Ragini Gupta and
Patrick Su and
Robert Bruce Kaufman and
Mark McCollum and
John Dallesasse and
Klara Nahrstedt},
title = {{SENSELET++:} {A} Low-cost Internet of Things Sensing Platform for
Academic Cleanrooms},
booktitle = {{IEEE} 18th International Conference on Mobile Ad Hoc and Smart Systems,
{MASS} 2021, Denver, CO, USA, October 4-7, 2021},
pages = {90--98},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/MASS52906.2021.00020},
doi = {10.1109/MASS52906.2021.00020},
timestamp = {Mon, 28 Oct 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mass/TianYMGSKMDN21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShawAABBBBBBCDD21,
author = {David E. Shaw and
Peter J. Adams and
Asaph Azaria and
Joseph A. Bank and
Brannon Batson and
Alistair Bell and
Michael Bergdorf and
Jhanvi Bhatt and
J. Adam Butts and
Timothy Correia and
Robert M. Dirks and
Ron O. Dror and
Michael P. Eastwood and
Bruce Edwards and
Amos Even and
Peter Feldmann and
Michael Fenn and
Christopher H. Fenton and
Anthony Forte and
Joseph Gagliardo and
Gennette Gill and
Maria Gorlatova and
Brian Greskamp and
J. P. Grossman and
Justin Gullingsrud and
Anissa Harper and
William Hasenplaugh and
Mark Heily and
Benjamin Colin Heshmat and
Jeremy Hunt and
Douglas J. Ierardi and
Lev Iserovich and
Bryan L. Jackson and
Nick P. Johnson and
Mollie M. Kirk and
John L. Klepeis and
Jeffrey S. Kuskin and
Kenneth M. Mackenzie and
Roy J. Mader and
Richard McGowen and
Adam McLaughlin and
Mark A. Moraes and
Mohamed H. Nasr and
Lawrence J. Nociolo and
Lief O'Donnell and
Andrew Parker and
Jon L. Peticolas and
Goran Pocina and
Cristian Predescu and
Terry Quan and
John K. Salmon and
Carl Schwink and
Keun Sup Shim and
Naseer Siddique and
Jochen Spengler and
Tamas Szalay and
Raymond Tabladillo and
Reinhard Tartler and
Andrew G. Taube and
Michael Theobald and
Brian Towles and
William Vick and
Stanley C. Wang and
Michael Wazlowski and
Madeleine J. Weingarten and
John M. Williams and
Kevin A. Yuh},
editor = {Bronis R. de Supinski and
Mary W. Hall and
Todd Gamblin},
title = {Anton 3: twenty microseconds of molecular dynamics simulation before
lunch},
booktitle = {International Conference for High Performance Computing, Networking,
Storage and Analysis, {SC} 2021, St. Louis, Missouri, USA, November
14-19, 2021},
pages = {1},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3458817.3487397},
doi = {10.1145/3458817.3487397},
timestamp = {Tue, 08 Nov 2022 16:03:02 +0100},
biburl = {https://dblp.org/rec/conf/sc/ShawAABBBBBBCDD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2101-07385,
author = {Sebastian Ament and
Maximilian Amsler and
Duncan R. Sutherland and
Ming{-}Chiang Chang and
Dan Guevarra and
Aine B. Connolly and
John M. Gregoire and
Michael O. Thompson and
Carla P. Gomes and
R. Bruce van Dover},
title = {Autonomous synthesis of metastable materials},
journal = {CoRR},
volume = {abs/2101.07385},
year = {2021},
url = {https://arxiv.org/abs/2101.07385},
eprinttype = {arXiv},
eprint = {2101.07385},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2101-07385.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2104-03702,
author = {Hal Roberts and
Rahul Bhargava and
Linas Valiukas and
Dennis Jen and
Momin M. Malik and
Cindy Bishop and
Emily Ndulue and
Aashka Dave and
Justin Clark and
Bruce Etling and
Robert Faris and
Anushka Shah and
Jasmin Rubinovitz and
Alexis Hope and
Catherine D'Ignazio and
Fernando Bermejo and
Yochai Benkler and
Ethan Zuckerman},
title = {Media Cloud: Massive Open Source Collection of Global News on the
Open Web},
journal = {CoRR},
volume = {abs/2104.03702},
year = {2021},
url = {https://arxiv.org/abs/2104.03702},
eprinttype = {arXiv},
eprint = {2104.03702},
timestamp = {Mon, 19 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2104-03702.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-03851,
author = {Andrew Jaegle and
Yury Sulsky and
Arun Ahuja and
Jake Bruce and
Rob Fergus and
Greg Wayne},
title = {Imitation by Predicting Observations},
journal = {CoRR},
volume = {abs/2107.03851},
year = {2021},
url = {https://arxiv.org/abs/2107.03851},
eprinttype = {arXiv},
eprint = {2107.03851},
timestamp = {Tue, 20 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2107-03851.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2108-09523,
author = {Di Chen and
Yiwei Bai and
Sebastian Ament and
Wenting Zhao and
Dan Guevarra and
Lan Zhou and
Bart Selman and
R. Bruce van Dover and
John M. Gregoire and
Carla P. Gomes},
title = {Automating Crystal-Structure Phase Mapping: Combining Deep Learning
with Constraint Reasoning},
journal = {CoRR},
volume = {abs/2108.09523},
year = {2021},
url = {https://arxiv.org/abs/2108.09523},
eprinttype = {arXiv},
eprint = {2108.09523},
timestamp = {Fri, 27 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2108-09523.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-06817,
author = {Matteo Romanello and
Sven Najem{-}Meyer and
Bruce Robertson},
title = {Optical Character Recognition of 19th Century Classical Commentaries:
the Current State of Affairs},
journal = {CoRR},
volume = {abs/2110.06817},
year = {2021},
url = {https://arxiv.org/abs/2110.06817},
eprinttype = {arXiv},
eprint = {2110.06817},
timestamp = {Fri, 22 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2110-06817.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SmithKGLFWKBHA20,
author = {Stanley W. Smith and
Yeojun Kim and
Jacopo Guanetti and
Ruolin Li and
Roya Firoozi and
Bruce Wootton and
Alex A. Kurzhanskiy and
Francesco Borrelli and
Roberto Horowitz and
Murat Arcak},
title = {Improving Urban Traffic Throughput With Vehicle Platooning: Theory
and Experiments},
journal = {{IEEE} Access},
volume = {8},
pages = {141208--141223},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.3012618},
doi = {10.1109/ACCESS.2020.3012618},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/SmithKGLFWKBHA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SoltanzadehHMF20,
author = {Ramin Soltanzadeh and
Bruce Hardy and
Robert D. McLeod and
Marcia R. Friesen},
title = {A Prototype System for Real-Time Monitoring of Arctic Char in Indoor
Aquaculture Operations: Possibilities {\&} Challenges},
journal = {{IEEE} Access},
volume = {8},
pages = {180815--180824},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.3028544},
doi = {10.1109/ACCESS.2020.3028544},
timestamp = {Tue, 20 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/SoltanzadehHMF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cea/AstillDFRS20,
author = {Jake Astill and
Rozita A. Dara and
Evan D. G. Fraser and
Bruce Roberts and
Shayan Sharif},
title = {Smart poultry management: Smart sensors, big data, and the internet
of things},
journal = {Comput. Electron. Agric.},
volume = {170},
pages = {105291},
year = {2020},
url = {https://doi.org/10.1016/j.compag.2020.105291},
doi = {10.1016/J.COMPAG.2020.105291},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cea/AstillDFRS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhis/RobertsBL20,
author = {Ethan Roberts and
Bruce A. Bassett and
Michelle Lochner},
title = {Bayesian anomaly detection and classification for noisy data},
journal = {Int. J. Hybrid Intell. Syst.},
volume = {16},
number = {4},
pages = {207--222},
year = {2020},
url = {https://doi.org/10.3233/HIS-200282},
doi = {10.3233/HIS-200282},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijhis/RobertsBL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isj/HafermalzJHR20,
author = {Ella Hafermalz and
Robert Bruce Johnston and
Dirk S. Hovorka and
Kai Riemer},
title = {Beyond 'mobility': {A} new understanding of moving with technology},
journal = {Inf. Syst. J.},
volume = {30},
number = {4},
pages = {762--786},
year = {2020},
url = {https://doi.org/10.1111/isj.12283},
doi = {10.1111/ISJ.12283},
timestamp = {Fri, 14 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/isj/HafermalzJHR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/SchindlerBBBBBC20,
author = {Christina E. M. Schindler and
Hannah M. Baumann and
Andreas Blum and
Dietrich B{\"{o}}se and
Hans{-}Peter Buchstaller and
Lars Burgdorf and
Daniel Cappel and
Eugene Chekler and
Paul Czodrowski and
Dieter Dorsch and
Merveille K. I. Eguida and
Bruce Follows and
Thomas Fuch{\ss} and
Ulrich Gr{\"{a}}dler and
Jakub Gunera and
Theresa Johnson and
Catherine Jorand Lebrun and
Srinivasa Karra and
Markus Klein and
Tim Knehans and
Lisa Koetzner and
Mireille Krier and
Matthias Leiendecker and
Birgitta Leuthner and
Liwei Li and
Igor Mochalkin and
Djordje Musil and
Constantin Neagu and
Friedrich Rippmann and
Kai Schiemann and
Robert Schulz and
Thomas Steinbrecher and
Eva{-}Maria Tanzer and
Andrea Unzue Lopez and
Ariele Viacava Follis and
Ansgar Wegener and
Daniel Kuhn},
title = {Large-Scale Assessment of Binding Free Energy Calculations in Active
Drug Discovery Projects},
journal = {J. Chem. Inf. Model.},
volume = {60},
number = {11},
pages = {5457--5474},
year = {2020},
url = {https://doi.org/10.1021/acs.jcim.0c00900},
doi = {10.1021/ACS.JCIM.0C00900},
timestamp = {Fri, 16 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/SchindlerBBBBBC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/KhailanyRDGKKKV20,
author = {Brucek Khailany and
Haoxing Ren and
Steve Dai and
Saad Godil and
Ben Keller and
Robert Kirby and
Alicia Klinefelter and
Rangharajan Venkatesan and
Yanqing Zhang and
Bryan Catanzaro and
William J. Dally},
title = {Accelerating Chip Design With Machine Learning},
journal = {{IEEE} Micro},
volume = {40},
number = {6},
pages = {23--32},
year = {2020},
url = {https://doi.org/10.1109/MM.2020.3026231},
doi = {10.1109/MM.2020.3026231},
timestamp = {Mon, 07 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/KhailanyRDGKKKV20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/TanDCRCMMJGMSAT20,
author = {Audrey Tan and
Mark Durbin and
Frank R. Chung and
Ada L. Rubin and
Allison M. Cuthel and
Jordan A. McQuilkin and
Aram S. Modrek and
Catherine T. Jamin and
Nicholas Gavin and
Devin M. Mann and
Jordan L. Swartz and
Jonathan S. Austrian and
Paul A. Testa and
Jacob D. Hill and
Corita R. Grudzen and
Benjamin Abella and
David Allard and
M. Fernanda Bellolio and
Michael Blum and
Todd Burstain and
Jeffrey Caterino and
Julie Cooper and
Bruce Darrow and
Marie{-}Carmelle Elie and
Ahmed Elsayem and
John Frenzel and
Howard Goldberg and
Iris Herrera and
John Howell and
Allen Hsaio and
Eric Isaacs and
Karen Jubanyik and
Ken Kawamoto and
Sangeeta Lamba and
Troy Madsen and
Joseph Miller and
Kei Ouchi and
Rajesh Patel and
Rajiv Pramanik and
Lynne Richardson and
Milisa Rizer and
Elizabeth Schoenfeld and
Timothy Shiuh and
Ashley Shreves and
Robert Swor and
Arvind Venkat and
Kendall Webb and
Howard Weeks and
Robert White and
Decker Wyatt and
Matthew Zimmie and
Erin Zimny},
title = {Design and implementation of a clinical decision support tool for
primary palliative Care for Emergency Medicine {(PRIM-ER)}},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {20},
number = {1},
pages = {13},
year = {2020},
url = {https://doi.org/10.1186/s12911-020-1021-7},
doi = {10.1186/S12911-020-1021-7},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/TanDCRCMMJGMSAT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/0002WABBBCCDDGG20,
author = {James J. Davis and
Alice R. Wattam and
Ramy K. Aziz and
Thomas S. Brettin and
Ralph Butler and
Rory Butler and
Philippe Chlenski and
Neal Conrad and
Allan Dickerman and
Emily M. Dietrich and
Joseph L. Gabbard and
Svetlana Gerdes and
Andrew Guard and
Ronald W. Kenyon and
Dustin Machi and
Chunhong Mao and
Daniel E. Murphy{-}Olson and
Marcus Nguyen and
Eric K. Nordberg and
Gary J. Olsen and
Robert Olson and
Jamie C. Overbeek and
Ross A. Overbeek and
Bruce D. Parrello and
Gordon D. Pusch and
Maulik Shukla and
Chris Thomas and
Margo VanOeffelen and
Veronika Vonstein and
Andrew S. Warren and
Fangfang Xia and
Dawen Xie and
Hyun Seung Yoo and
Rick Stevens},
title = {The {PATRIC} Bioinformatics Resource Center: expanding data and analysis
capabilities},
journal = {Nucleic Acids Res.},
volume = {48},
number = {Database-Issue},
pages = {D606--D612},
year = {2020},
url = {https://doi.org/10.1093/nar/gkz943},
doi = {10.1093/NAR/GKZ943},
timestamp = {Fri, 04 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/0002WABBBCCDDGG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/CollinsBKZAFKLG20,
author = {Ryan L. Collins and
Harrison Brand and
Konrad J. Karczewski and
Xuefang Zhao and
Jessica Alf{\"{o}}ldi and
Laurent C. Francioli and
Amit V. Khera and
Chelsea Lowther and
Laura D. Gauthier and
Harold Wang and
Nicholas A. Watts and
Matthew Solomonson and
Alexander Baumann and
Ruchi Munshi and
Mark Walker and
Christopher W. Whelan and
Yongqing Huang and
Ted Brookings and
Ted Sharpe and
Matthew R. Stone and
Elise Valkanas and
Jack Fu and
Grace Tiao and
Kristen M. Laricchia and
Valent{\'{\i}}n Ruano{-}Rubio and
Christine Stevens and
Namrata Gupta and
Caroline Cusick and
Lauren Margolin and
Irina M. Armean and
Eric Banks and
Louis Bergelson and
Kristian Cibulskis and
Kristen M. Connolly and
Miguel Covarrubias and
Beryl B. Cummings and
Mark J. Daly and
Stacey Donnelly and
Yossi Farjoun and
Steven Ferriera and
Stacey Gabriel and
Jeff Gentry and
Thibault Jeandet and
Diane Kaplan and
Christopher Llanwarne and
Eric V. Minikel and
Benjamin M. Neale and
Sam Novod and
Anne H. O'Donnell{-}Luria and
Nikelle Petrillo and
Timothy Poterba and
David Roazen and
Andrea Saltzman and
Kaitlin E. Samocha and
Molly Schleicher and
Cotton Seed and
Jos{\'{e}} Soto and
Kathleen Tibbetts and
Charlotte Tolonen and
Christopher Vittal and
Gordon Wade and
Arcturus Wang and
Qingbo Wang and
James S. Ware and
Ben Weisburd and
Nicola Whiffin and
Carlos A. Aguilar Salinas and
Tariq Ahmad and
Christine M. Albert and
Diego Ardissino and
Gil Atzmon and
John Barnard and
Laurent Beaugerie and
Emelia J. Benjamin and
Michael Boehnke and
Lori L. Bonnycastle and
Erwin P. Bottinger and
Donald W. Bowden and
Matthew J. Bown and
John C. Chambers and
Juliana C. Chan and
Daniel Chasman and
Judy Cho and
Mina K. Chung and
Bruce Cohen and
Adolfo Correa and
Dana Dabelea and
Dawood Darbar and
Ravindranath Duggirala and
Jos{\'{e}}e Dupuis and
Patrick T. Ellinor and
Roberto Elosua and
Jeanette Erdmann and
T{\~{o}}nu Esko and
Martti F{\"{a}}rkkil{\"{a}} and
Jose Florez and
Andre Franke and
Gad Getz and
Benjamin Glaser and
Stephen J. Glatt and
David Goldstein and
Clicerio Gonzalez and
Leif Groop and
Christopher A. Haiman and
Craig Hanis and
Matthew Harms and
Mikko Hiltunen and
Matti M. Holi and
Christina M. Hultman and
Mikko Kallela and
Jaakko Kaprio and
Sekar Kathiresan and
Bong{-}Jo Kim and
Young Jin Kim and
George Kirov and
Jaspal Kooner and
Seppo Koskinen and
Harlan M. Krumholz and
Subra Kugathasan and
Soo Heon Kwak and
Markku Laakso and
Terho Lehtim{\"{a}}ki and
Ruth J. F. Loos and
Steven A. Lubitz and
Ronald C. W. Ma and
Daniel G. MacArthur and
Jaume Marrugat and
Kari M. Mattila and
Steven A. McCarroll and
Mark I. McCarthy and
Dermot McGovern and
Ruth McPherson and
James B. Meigs and
Olle Melander and
Andres Metspalu and
Peter M. Nilsson and
Michael C. O'Donovan and
Dost {\"{O}}ng{\"{u}}r and
Lorena Orozco and
Michael J. Owen and
Colin N. A. Palmer and
Aarno Palotie and
Kyong Soo Park and
Carlos Pato and
Ann E. Pulver and
Nazneen Rahman and
Anne M. Remes and
John D. Rioux and
Samuli Ripatti and
Dan M. Roden and
Danish Saleheen and
Veikko Salomaa and
Nilesh J. Samani and
Jeremiah Scharf and
Heribert Schunkert and
Moore B. Shoemaker and
Pamela Sklar and
Hilkka Soininen and
Harry Sokol and
Tim Spector and
Patrick F. Sullivan and
Jaana Suvisaari and
E. Shyong Tai and
Yik Ying Teo and
Tuomi Tiinamaija and
Ming Tsuang and
Dan Turner and
Teresa Tusie{-}Luna and
Erkki Vartiainen and
Hugh Watkins and
Rinse K. Weersma and
Maija Wessman and
James G. Wilson and
Ramnik J. Xavier and
Kent D. Taylor and
Henry J. Lin and
Stephen S. Rich and
Wendy S. Post and
Yii{-}Der Ida Chen and
Jerome I. Rotter and
Chad Nusbaum and
Anthony A. Philippakis and
Eric S. Lander and
Michael E. Talkowski},
title = {A structural variation reference for medical and population genetics},
journal = {Nat.},
volume = {581},
number = {7809},
pages = {444--451},
year = {2020},
url = {https://doi.org/10.1038/s41586-020-2287-8},
doi = {10.1038/S41586-020-2287-8},
timestamp = {Wed, 16 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/CollinsBKZAFKLG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/CrowellDBDLHPBP20,
author = {C. A. Crowell and
Simon W. Davis and
Lysianne Beynel and
Lifu Deng and
Devi Lakhlani and
S. A. Hilbig and
Hannah Palmer and
A. Brito and
Angel V. Peterchev and
Bruce Luber and
Sarah H. Lisanby and
Lawrence G. Appelbaum and
Roberto Cabeza},
title = {Older adults benefit from more widespread brain network integration
during working memory},
journal = {NeuroImage},
volume = {218},
pages = {116959},
year = {2020},
url = {https://doi.org/10.1016/j.neuroimage.2020.116959},
doi = {10.1016/J.NEUROIMAGE.2020.116959},
timestamp = {Sun, 27 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/CrowellDBDLHPBP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/JonesGAMBFWY20,
author = {Robert Jones and
Giorgia Grisot and
Jean Augustinack and
Caroline Magnain and
David A. Boas and
Bruce Fischl and
Hui Wang and
Anastasia Yendiki},
title = {Insight into the fundamental trade-offs of diffusion {MRI} from polarization-sensitive
optical coherence tomography in ex vivo human brain},
journal = {NeuroImage},
volume = {214},
pages = {116704},
year = {2020},
url = {https://doi.org/10.1016/j.neuroimage.2020.116704},
doi = {10.1016/J.NEUROIMAGE.2020.116704},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/JonesGAMBFWY20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/KimMLGWKOCLWEKK20,
author = {Hyungjun Kim and
Ishtiaq Mawla and
Jeungchan Lee and
Jessica Gerber and
Kathryn Walker and
Jieun Kim and
Ana Ortiz and
Suk{-}Tak Chan and
Marco L. Loggia and
Ajay D. Wasan and
Robert R. Edwards and
Jian Kong and
Ted J. Kaptchuk and
Randy L. Gollub and
Bruce R. Rosen and
Vitaly Napadow},
title = {Reduced tactile acuity in chronic low back pain is linked with structural
neuroplasticity in primary somatosensory cortex and is modulated by
acupuncture therapy},
journal = {NeuroImage},
volume = {217},
pages = {116899},
year = {2020},
url = {https://doi.org/10.1016/j.neuroimage.2020.116899},
doi = {10.1016/J.NEUROIMAGE.2020.116899},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/KimMLGWKOCLWEKK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/YuLSEGWPOCGMCLW20,
author = {Siyi Yu and
Wen Li and
Wei Shen and
Robert R. Edwards and
Randy L. Gollub and
Georgia Wilson and
Joel Park and
Ana Ortiz and
Jin Cao and
Jessica Gerber and
Ishtiaq Mawla and
Suk{-}Tak Chan and
Jeungchan Lee and
Ajay D. Wasan and
Vitaly Napadow and
Ted J. Kaptchuk and
Bruce R. Rosen and
Jian Kong},
title = {Impaired mesocorticolimbic connectivity underlies increased pain sensitivity
in chronic low back pain},
journal = {NeuroImage},
volume = {218},
pages = {116969},
year = {2020},
url = {https://doi.org/10.1016/j.neuroimage.2020.116969},
doi = {10.1016/J.NEUROIMAGE.2020.116969},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/YuLSEGWPOCGMCLW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/PhamHGBHBCF20,
author = {Quynh Pham and
Jason Hearn and
Bruce Gao and
Ian Brown and
Robert J. Hamilton and
Alejandro Berlin and
Joseph A. Cafazzo and
Andrew Feifer},
title = {Virtual care models for cancer survivorship},
journal = {npj Digit. Medicine},
volume = {3},
year = {2020},
url = {https://doi.org/10.1038/s41746-020-00321-3},
doi = {10.1038/S41746-020-00321-3},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/PhamHGBHBCF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmpl/LazarekKSFD20,
author = {Lukas Lazarek and
Alexis King and
Samanvitha Sundar and
Robert Bruce Findler and
Christos Dimoulas},
title = {Does blame shifting work?},
journal = {Proc. {ACM} Program. Lang.},
volume = {4},
number = {{POPL}},
pages = {65:1--65:29},
year = {2020},
url = {https://doi.org/10.1145/3371133},
doi = {10.1145/3371133},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pacmpl/LazarekKSFD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/WangGLH20,
author = {Hongfei Wang and
Aniruddha Ghosh and
Bruce A. Linquist and
Robert J. Hijmans},
title = {Satellite-Based Observations Reveal Effects of Weather Variation on
Rice Phenology},
journal = {Remote. Sens.},
volume = {12},
number = {9},
pages = {1522},
year = {2020},
url = {https://doi.org/10.3390/rs12091522},
doi = {10.3390/RS12091522},
timestamp = {Tue, 04 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/WangGLH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmobile/NahrstedtYYSKCK20,
author = {Klara Nahrstedt and
Zhe Yang and
Tuo Yu and
Patrick Su and
Robert Bruce Kaufman and
I{-}Shan Chen and
Steven Konstanty and
Mark McCollum and
John Dallesasse},
title = {Senselet: Distributed Sensing Infrastructure for Improving Process
Control and Safety in Academic Cleanroom Environments},
journal = {GetMobile Mob. Comput. Commun.},
volume = {24},
number = {2},
pages = {12--16},
year = {2020},
url = {https://doi.org/10.1145/3427384.3427388},
doi = {10.1145/3427384.3427388},
timestamp = {Mon, 28 Oct 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigmobile/NahrstedtYYSKCK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taccess/MayTMRW20,
author = {Keenan R. May and
Brianna J. Tomlinson and
Xiaomeng Ma and
Phillip Roberts and
Bruce N. Walker},
title = {Spotlights and Soundscapes: On the Design of Mixed Reality Auditory
Environments for Persons with Visual Impairment},
journal = {{ACM} Trans. Access. Comput.},
volume = {13},
number = {2},
pages = {8:1--8:47},
year = {2020},
url = {https://doi.org/10.1145/3378576},
doi = {10.1145/3378576},
timestamp = {Sat, 08 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/taccess/MayTMRW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/AmelardLHDCT20,
author = {Robert Amelard and
Jesse H. Lam and
Brian Hill and
Amanda Durkin and
Kyle Cutler and
Bruce J. Tromberg},
title = {Monocular 3D Probe Tracking for Generating Sub-Surface Optical Property
Maps From Diffuse Optical Spectroscopic Imaging},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {67},
number = {7},
pages = {1872--1881},
year = {2020},
url = {https://doi.org/10.1109/TBME.2019.2950004},
doi = {10.1109/TBME.2019.2950004},
timestamp = {Wed, 02 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/AmelardLHDCT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/YuCHQW20,
author = {Qi Yu and
Bruce R. Childers and
Libo Huang and
Cheng Qian and
Zhiying Wang},
title = {{HPE:} Hierarchical Page Eviction Policy for Unified Memory in GPUs},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {39},
number = {10},
pages = {2461--2474},
year = {2020},
url = {https://doi.org/10.1109/TCAD.2019.2944790},
doi = {10.1109/TCAD.2019.2944790},
timestamp = {Tue, 06 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcad/YuCHQW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tjs/YuCHQW20,
author = {Qi Yu and
Bruce R. Childers and
Libo Huang and
Cheng Qian and
Zhiying Wang},
title = {A quantitative evaluation of unified memory in GPUs},
journal = {J. Supercomput.},
volume = {76},
number = {4},
pages = {2958--2985},
year = {2020},
url = {https://doi.org/10.1007/s11227-019-03079-y},
doi = {10.1007/S11227-019-03079-Y},
timestamp = {Tue, 15 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tjs/YuCHQW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cc/SerranoF20,
author = {Manuel Serrano and
Robert Bruce Findler},
editor = {Louis{-}No{\"{e}}l Pouchet and
Alexandra Jimborean},
title = {Dynamic property caches: a step towards faster JavaScript proxy objects},
booktitle = {{CC} '20: 29th International Conference on Compiler Construction,
San Diego, CA, USA, February 22-23, 2020},
pages = {108--118},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3377555.3377888},
doi = {10.1145/3377555.3377888},
timestamp = {Mon, 03 Jan 2022 22:32:58 +0100},
biburl = {https://dblp.org/rec/conf/cc/SerranoF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cinc/ZengerBGSM20,
author = {Brian Zenger and
Jake A. Bergquist and
Wilson W. Good and
Bruce Steadman and
Rob S. MacLeod},
title = {High-Capacity Cardiac Signal Acquisition System for Flexible, Simultaneous,
Multidomain Acquisition},
booktitle = {Computing in Cardiology, CinC 2020, Rimini, Italy, September 13-16,
2020},
pages = {1--4},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.22489/CinC.2020.188},
doi = {10.22489/CINC.2020.188},
timestamp = {Fri, 19 Feb 2021 11:06:11 +0100},
biburl = {https://dblp.org/rec/conf/cinc/ZengerBGSM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/MeshramJMWDHV20,
author = {Nirvedh H. Meshram and
Daren Jackson and
Carol C. Mitchell and
Stephanie M. Wilbrand and
Robert J. Dempsey and
Bruce P. Hermann and
Tomy Varghese},
title = {Study of the Relationship Between Ultrasound Strain Indices and Cognitive
Decline for Vulnerable Carotid Plaque},
booktitle = {42nd Annual International Conference of the {IEEE} Engineering in
Medicine {\&} Biology Society, {EMBC} 2020, Montreal, QC, Canada,
July 20-24, 2020},
pages = {2088--2091},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/EMBC44109.2020.9175911},
doi = {10.1109/EMBC44109.2020.9175911},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/MeshramJMWDHV20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpdc/OliveiraWMC20,
author = {Luis Oliveira and
David Wilkinson and
Daniel Moss{\'{e}} and
Bruce R. Childers},
editor = {Ivo Jimenez and
Carlos Maltzahn and
Jay F. Lofstead},
title = {Stimulating Reproducible Software Artifacts},
booktitle = {Proceedings of the 3rd International Workshop on Practical Reproducible
Evaluation of Computer Systems, P-RECS@HPDC 2020, Stockholm, Sweden,
June 23, 2020},
pages = {3--7},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3391800.3398177},
doi = {10.1145/3391800.3398177},
timestamp = {Tue, 22 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpdc/OliveiraWMC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpec/Aananthakrishnan20,
author = {Sriram Aananthakrishnan and
Robert Pawlowski and
Joshua B. Fryman and
Ibrahim Hur},
title = {Efficient Sparse Matrix-Vector Multiplication on Intel {PIUMA} Architecture},
booktitle = {2020 {IEEE} High Performance Extreme Computing Conference, {HPEC}
2020, Waltham, MA, USA, September 22-24, 2020},
pages = {1--2},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/HPEC43674.2020.9286245},
doi = {10.1109/HPEC43674.2020.9286245},
timestamp = {Thu, 14 Jan 2021 08:55:23 +0100},
biburl = {https://dblp.org/rec/conf/hpec/Aananthakrishnan20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/HensleyACHLPPPS20,
author = {Scott Hensley and
Razi Ahmed and
Bruce Chapman and
Brian P. Hawkins and
Marco Lavalle and
Naiara Pinto and
Matteo Pardini and
Kostas Papathanassiou and
Paul Siqueira and
Robert N. Treuhaft},
title = {Boreal Forest Radar Tomography at P, {L} and S-Bands at Berms and
Delta Junction},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2020, Waikoloa, HI, USA, September 26 - October 2, 2020},
pages = {96--99},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IGARSS39084.2020.9323337},
doi = {10.1109/IGARSS39084.2020.9323337},
timestamp = {Mon, 22 Feb 2021 16:46:47 +0100},
biburl = {https://dblp.org/rec/conf/igarss/HensleyACHLPPPS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/0003CHQ0W20,
author = {Qi Yu and
Bruce R. Childers and
Libo Huang and
Cheng Qian and
Hui Guo and
Zhiying Wang},
title = {Coordinated Page Prefetch and Eviction for Memory Oversubscription
Management in GPUs},
booktitle = {2020 {IEEE} International Parallel and Distributed Processing Symposium
(IPDPS), New Orleans, LA, USA, May 18-22, 2020},
pages = {472--482},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IPDPS47924.2020.00056},
doi = {10.1109/IPDPS47924.2020.00056},
timestamp = {Tue, 15 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ipps/0003CHQ0W20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mie/SchnallKPBBRBHH20,
author = {Rebecca Schnall and
Lisa M. Kuhns and
Cynthia Pearson and
Joshua Bruce and
D. Scott Batey and
Asa Radix and
Uri Belkind and
Marco A. Hidalgo and
Sabina Hirshfield and
Sarah Ganzhorn and
Robert Garofalo},
editor = {Louise Bilenberg Pape{-}Haugaard and
Christian Lovis and
Inge Cort Madsen and
Patrick Weber and
Per Hostrup Nielsen and
Philip Scott},
title = {Preliminary Results from a Pragmatic Clinical Trial of MyPEEPS Mobile
to Improve {HIV} Prevention Behaviors in Young Men},
booktitle = {Digital Personalized Health and Medicine - Proceedings of {MIE} 2020,
Medical Informatics Europe, Geneva, Switzerland, April 28 - May 1,
2020},
series = {Studies in Health Technology and Informatics},
volume = {270},
pages = {1365--1366},
publisher = {{IOS} Press},
year = {2020},
url = {https://doi.org/10.3233/SHTI200444},
doi = {10.3233/SHTI200444},
timestamp = {Thu, 04 Apr 2024 17:06:52 +0200},
biburl = {https://dblp.org/rec/conf/mie/SchnallKPBBRBHH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tvx/SaegheAWCP020,
author = {Pejman Saeghe and
Gavin Abercrombie and
Bruce Weir and
Sarah Clinch and
Stephen Pettifer and
Robert Stevens},
title = {Augmented Reality and Television: Dimensions and Themes},
booktitle = {Proceedings of the {ACM} International Conference on Interactive Media
Experiences. {IMX} 2020, Barcelona, Spain, June 17-19, 2020},
pages = {13--23},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3391614.3393649},
doi = {10.1145/3391614.3393649},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tvx/SaegheAWCP020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/OhLKZSAVFGCWMBB20,
author = {Jinwook Oh and
Sae Kyu Lee and
Mingu Kang and
Matthew M. Ziegler and
Joel Silberman and
Ankur Agrawal and
Swagath Venkataramani and
Bruce M. Fleischer and
Michael Guillorn and
Jungwook Choi and
Wei Wang and
Silvia M. Mueller and
Shimon Ben{-}Yehuda and
James Bonanno and
Nianzheng Cao and
Robert Casatuta and
Chia{-}Yu Chen and
Matt Cohen and
Ophir Erez and
Thomas W. Fox and
George Gristede and
Howard Haynie and
Vicktoria Ivanov and
Siyu Koswatta and
Shih{-}Hsien Lo and
Martin Lutz and
Gary W. Maier and
Alex Mesh and
Yevgeny Nustov and
Scot Rider and
Marcel Schaal and
Michael Scheuermann and
Xiao Sun and
Naigang Wang and
Fanchieh Yee and
Ching Zhou and
Vinay Shah and
Brian W. Curran and
Vijayalakshmi Srinivasan and
Pong{-}Fei Lu and
Sunil Shukla and
Kailash Gopalakrishnan and
Leland Chang},
title = {A 3.0 {TFLOPS} 0.62V Scalable Processor Core for High Compute Utilization
{AI} Training and Inference},
booktitle = {{IEEE} Symposium on {VLSI} Circuits, {VLSI} Circuits 2020, Honolulu,
HI, USA, June 16-19, 2020},
pages = {1--2},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/VLSICircuits18222.2020.9162917},
doi = {10.1109/VLSICIRCUITS18222.2020.9162917},
timestamp = {Thu, 28 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsic/OhLKZSAVFGCWMBB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-10272,
author = {Stanley W. Smith and
Yeojun Kim and
Jacopo Guanetti and
Ruolin Li and
Roya Firoozi and
Bruce Wootton and
Alexander Kurzhanskiy and
Francesco Borrelli and
Roberto Horowitz and
Murat Arcak},
title = {Improving Urban Traffic Throughput with Vehicle Platooning: Theory
and Experiments},
journal = {CoRR},
volume = {abs/2006.10272},
year = {2020},
url = {https://arxiv.org/abs/2006.10272},
eprinttype = {arXiv},
eprint = {2006.10272},
timestamp = {Tue, 23 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2006-10272.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-11639,
author = {Shu{-}Hung You and
Robert Bruce Findler and
Christos Dimoulas},
title = {Dynamic Symbolic Execution of Higher-Order Functions},
journal = {CoRR},
volume = {abs/2006.11639},
year = {2020},
url = {https://arxiv.org/abs/2006.11639},
eprinttype = {arXiv},
eprint = {2006.11639},
timestamp = {Tue, 23 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2006-11639.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-06277,
author = {Sriram Aananthakrishnan and
Nesreen K. Ahmed and
Vincent Cav{\'{e}} and
Marcelo Cintra and
Yigit Demir and
Kristof Du Bois and
Stijn Eyerman and
Joshua B. Fryman and
Ivan Ganev and
Wim Heirman and
Hans{-}Christian Hoppe and
Jason Howard and
Ibrahim Hur and
Midhunchandra Kodiyath and
Samkit Jain and
Daniel S. Klowden and
Marek M. Landowski and
Laurent Montigny and
Ankit More and
Przemyslaw Ossowski and
Robert Pawlowski and
Nick Pepperling and
Fabrizio Petrini and
Mariusz Sikora and
Balasubramanian Seshasayee and
Shaden Smith and
Sebastian Szkoda and
Sanjaya Tayal and
Jesmin Jahan Tithi and
Yves Vandriessche and
Izajasz P. Wrosz},
title = {{PIUMA:} Programmable Integrated Unified Memory Architecture},
journal = {CoRR},
volume = {abs/2010.06277},
year = {2020},
url = {https://arxiv.org/abs/2010.06277},
eprinttype = {arXiv},
eprint = {2010.06277},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-06277.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bib/AntonopoulosAAB19,
author = {Dionysios A. Antonopoulos and
Rida Assaf and
Ramy Karam Aziz and
Thomas S. Brettin and
Christopher Bun and
Neal Conrad and
James J. Davis and
Emily M. Dietrich and
Terry Disz and
Svetlana Gerdes and
Ronald W. Kenyon and
Dustin Machi and
Chunhong Mao and
Daniel E. Murphy{-}Olson and
Eric K. Nordberg and
Gary J. Olsen and
Robert Olson and
Ross A. Overbeek and
Bruce D. Parrello and
Gordon D. Pusch and
John Santerre and
Maulik Shukla and
Rick L. Stevens and
Margo VanOeffelen and
Veronika Vonstein and
Andrew S. Warren and
Alice R. Wattam and
Fangfang Xia and
Hyun Seung Yoo},
title = {{PATRIC} as a unique resource for studying antimicrobial resistance},
journal = {Briefings Bioinform.},
volume = {20},
number = {4},
pages = {1094--1102},
year = {2019},
url = {https://doi.org/10.1093/bib/bbx083},
doi = {10.1093/BIB/BBX083},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bib/AntonopoulosAAB19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/ChagasGOTAPMJRC19,
author = {Vinicius S. Chagas and
Clarice S. Groeneveld and
Kelin G. Oliveira and
Sheyla Trefflich and
Rodrigo C. de Almeida and
Bruce A. J. Ponder and
Kerstin B. Meyer and
Steven J. M. Jones and
A. Gordon Robertson and
Mauro A. A. Castro},
title = {RTNduals: an R/Bioconductor package for analysis of co-regulation
and inference of dual regulons},
journal = {Bioinform.},
volume = {35},
number = {24},
pages = {5357--5358},
year = {2019},
url = {https://doi.org/10.1093/bioinformatics/btz534},
doi = {10.1093/BIOINFORMATICS/BTZ534},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/ChagasGOTAPMJRC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/GroeneveldCJRPM19,
author = {Clarice S. Groeneveld and
Vinicius S. Chagas and
Steven J. M. Jones and
A. Gordon Robertson and
Bruce A. J. Ponder and
Kerstin B. Meyer and
Mauro A. A. Castro},
title = {RTNsurvival: an R/Bioconductor package for regulatory network survival
analysis},
journal = {Bioinform.},
volume = {35},
number = {21},
pages = {4488--4489},
year = {2019},
url = {https://doi.org/10.1093/bioinformatics/btz229},
doi = {10.1093/BIOINFORMATICS/BTZ229},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/GroeneveldCJRPM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/ParrelloBCOOPVO19,
author = {Bruce D. Parrello and
Rory Butler and
Philippe Chlenski and
Robert Olson and
Jamie C. Overbeek and
Gordon D. Pusch and
Veronika Vonstein and
Ross A. Overbeek},
title = {A machine learning-based service for estimating quality of genomes
using {PATRIC}},
journal = {{BMC} Bioinform.},
volume = {20},
number = {1},
pages = {486:1--486:9},
year = {2019},
url = {https://doi.org/10.1186/s12859-019-3068-y},
doi = {10.1186/S12859-019-3068-Y},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/ParrelloBCOOPVO19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfp/GreenmanTNFFVF19,
author = {Ben Greenman and
Asumu Takikawa and
Max S. New and
Daniel Feltey and
Robert Bruce Findler and
Jan Vitek and
Matthias Felleisen},
title = {How to evaluate the performance of gradual type systems},
journal = {J. Funct. Program.},
volume = {29},
pages = {e4},
year = {2019},
url = {https://doi.org/10.1017/S0956796818000217},
doi = {10.1017/S0956796818000217},
timestamp = {Fri, 12 Apr 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfp/GreenmanTNFFVF19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/SnyderLPARRRGHS19,
author = {Michael P. Snyder and
Shin Lin and
Amanda Posgai and
Mark Atkinson and
Aviv Regev and
Jennifer Rood and
Orit Rozenblatt{-}Rosen and
Leslie Gaffney and
Anna Hupalowska and
Rahul Satija and
Nils Gehlenborg and
Jay Shendure and
Julia Laskin and
Pehr Harbury and
Nicholas A. Nystrom and
Jonathan C. Silverstein and
Ziv Bar{-}Joseph and
Kun Zhang and
Katy B{\"{o}}rner and
Yiing Lin and
Richard Conroy and
Dena Procaccini and
Ananda L. Roy and
Ajay Pillai and
Marishka Brown and
Zorina S. Galis and
Long Cai and
Cole Trapnell and
Dana Jackson and
Garry P. Nolan and
William James Greenleaf and
Sylvia K. Plevritis and
Sara Ahadi and
Stephanie A. Nevins and
Hayan Lee and
Christian Martijn Schuerch and
Sarah Black and
Vishal Gautham Venkataraaman and
Ed Esplin and
Aaron Horning and
Amir Bahmani and
Xin Sun and
Sanjay Jain and
James S. Hagood and
Gloria Pryhuber and
Peter V. Kharchenko and
Bernd Bodenmiller and
Todd Brusko and
Michael Clare{-}Salzler and
Harry Nick and
Kevin Otto and
Clive Wasserfall and
Marda Jorgensen and
Maigan Brusko and
Sergio Maffioletti and
Richard M. Caprioli and
Jeffrey M. Spraggins and
Danielle Gutierrez and
Nathan Heath Patterson and
Elizabeth K. Neumann and
Raymond Harris and
Mark P. de Caestecker and
Agnes B. Fogo and
Raf Van de Plas and
Ken Lau and
Guo{-}Cheng Yuan and
Qian Zhu and
Ruben Dries and
Peng Yin and
Sinem K. Saka and
Jocelyn Y. Kishi and
Yu Wang and
Isabel Goldaracena and
Dong Hye Ye and
Kristin E. Burnum{-}Johnson and
Paul D. Piehowski and
Charles Ansong and
Ying Zhu and
Tushar Desai and
Jay Mulye and
Peter Chou and
Monica Nagendran and
Sarah A. Teichmann and
Benedict Paten and
Robert F. Murphy and
Jian Ma and
Vladimir Yu. Kiselev and
Carl Kingsford and
Allyson Ricarte and
Maria Keays and
Sushma Anand Akoju and
Matthew Ruffalo and
Margaret Vella and
Chuck McCallum and
Leonard E. Cross and
Samuel H. Friedman and
Randy W. Heiland and
Bruce William Herr II and
Paul Macklin and
Ellen M. Quardokus and
Lisel Record and
James P. Sluka and
Griffin M. Weber and
Philip D. Blood and
Alexander Ropelewski and
William Shirey and
Robin M. Scibek and
Paula M. Mabee and
W. Christopher Lenhardt and
Kimberly Robasky and
Stavros Michailidis and
John C. Marioni and
Andrew Butler and
Tim Stuart and
Eyal Fisher and
Shila Ghazanfar and
G{\"{o}}kcen Eraslan and
Tommaso Biancalani and
Eeshit D. Vaishnav and
Pothur Srinivas and
Aaron Pawlyk and
Salvatore Sechi and
Elizabeth L. Wilder and
James Anderson},
title = {The human body at cellular resolution: the {NIH} Human Biomolecular
Atlas Program},
journal = {Nat.},
volume = {574},
number = {7777},
pages = {187--192},
year = {2019},
url = {https://doi.org/10.1038/s41586-019-1629-x},
doi = {10.1038/S41586-019-1629-X},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/SnyderLPARRRGHS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BerkowitzRPLSRW19,
author = {Bruce A. Berkowitz and
Roberto Romero and
Robert H. Podolsky and
Karen M. Lins{-}Childers and
Yimin Shen and
Tilman Rosales and
Youssef Zaim Wadghiri and
Dung Minh Hoang and
Marcia Arenas{-}Hernandez and
Valeria Garcia{-}Flores and
George Schwenkel and
Bogdan Panaitescu and
Nardhy Gomez{-}Lopez},
title = {{QUEST} {MRI} assessment of fetal brain oxidative stress \emph{in
utero}},
journal = {NeuroImage},
volume = {200},
pages = {601--606},
year = {2019},
url = {https://doi.org/10.1016/j.neuroimage.2019.05.069},
doi = {10.1016/J.NEUROIMAGE.2019.05.069},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/BerkowitzRPLSRW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmpl/FlorenceYTF19,
author = {Spencer P. Florence and
Shu{-}Hung You and
Jesse A. Tov and
Robert Bruce Findler},
title = {A calculus for Esterel: if can, can. if no can, no can},
journal = {Proc. {ACM} Program. Lang.},
volume = {3},
number = {{POPL}},
pages = {61:1--61:29},
year = {2019},
url = {https://doi.org/10.1145/3290374},
doi = {10.1145/3290374},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pacmpl/FlorenceYTF19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/ArnNEDKP19,
author = {Robert T. Arn and
Pradyumna Narayana and
Tegan Emerson and
Bruce A. Draper and
Michael Kirby and
Chris Peterson},
title = {Motion Segmentation via Generalized Curvatures},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {41},
number = {12},
pages = {2919--2932},
year = {2019},
url = {https://doi.org/10.1109/TPAMI.2018.2869741},
doi = {10.1109/TPAMI.2018.2869741},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pami/ArnNEDKP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/AlmeidaSSSNSGVP19,
author = {Danilo Roberti Alves de Almeida and
Scott C. Stark and
Gang Shao and
Juliana Schietti and
Bruce Walker Nelson and
Carlos Alberto Silva and
Eric Bastos G{\"{o}}rgens and
Ruben Valbuena and
Daniel de Almeida Papa and
Pedro Henrique Santin Brancalion},
title = {Optimizing the Remote Detection of Tropical Rainforest Structure with
Airborne Lidar: Leaf Area Profile Sensitivity to Pulse Density and
Spatial Sampling},
journal = {Remote. Sens.},
volume = {11},
number = {1},
pages = {92},
year = {2019},
url = {https://doi.org/10.3390/rs11010092},
doi = {10.3390/RS11010092},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/AlmeidaSSSNSGVP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acis/EshraghiJR19,
author = {Ali Eshraghi and
Robert Bruce Johnston and
Kai Riemer},
title = {Technology Introduction as Social Interpretation by End-Users: Key
Articulations in the Literature},
booktitle = {Australasian Conference on Information Systems, {ACIS} 2019, Curtin
University, Perth, Australia, December 9-11, 2019},
pages = {77},
year = {2019},
url = {https://aisel.aisnet.org/acis2019/77},
timestamp = {Thu, 16 May 2024 17:06:12 +0200},
biburl = {https://dblp.org/rec/conf/acis/EshraghiJR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icis/RiemerJ19,
author = {Kai Riemer and
Robert Bruce Johnston},
editor = {Helmut Krcmar and
Jane Fedorowicz and
Wai Fong Boh and
Jan Marco Leimeister and
Sunil Wattal},
title = {Wither Interpretivism? Re-interpreting interpretation to fit a world
of ubiquitous {ICT}},
booktitle = {Proceedings of the 40th International Conference on Information Systems,
{ICIS} 2019, Munich, Germany, December 15-18, 2019},
publisher = {Association for Information Systems},
year = {2019},
url = {https://aisel.aisnet.org/icis2019/research\_methods/research\_methods/12},
timestamp = {Tue, 10 Dec 2019 12:03:30 +0100},
biburl = {https://dblp.org/rec/conf/icis/RiemerJ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isda/RobertsBL19,
author = {Ethan Roberts and
Bruce A. Bassett and
Michelle Lochner},
editor = {Ajith Abraham and
Patrick Siarry and
Kun Ma and
Arturas Kaklauskas},
title = {Bayesian Anomaly Detection and Classification for Noisy Data},
booktitle = {Intelligent Systems Design and Applications - 19th International Conference
on Intelligent Systems Design and Applications {(ISDA} 2019), Auburn,
WA, USA, December 3-5, 2019},
series = {Advances in Intelligent Systems and Computing},
volume = {1181},
pages = {426--435},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-49342-4\_41},
doi = {10.1007/978-3-030-49342-4\_41},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isda/RobertsBL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispass/0003CHQW19,
author = {Qi Yu and
Bruce R. Childers and
Libo Huang and
Cheng Qian and
Zhiying Wang},
title = {Hierarchical Page Eviction Policy for Unified Memory in GPUs},
booktitle = {{IEEE} International Symposium on Performance Analysis of Systems
and Software, {ISPASS} 2019, Madison, WI, USA, March 24-26, 2019},
pages = {149--150},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISPASS.2019.00027},
doi = {10.1109/ISPASS.2019.00027},
timestamp = {Tue, 15 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ispass/0003CHQW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itib/RomaniszynKNSTM19,
author = {Patrycja Romaniszyn and
Damian Kania and
Katarzyna Nowakowska and
Marta Sobkowiak and
Bruce Turner and
Andrzej Mysliwiec and
Robert Michnik and
Andrzej W. Mitas},
editor = {Ewa Pietka and
Pawel Badura and
Jacek Kawa and
Wojciech Wieclawek},
title = {{RAS} in the Aspect of Symmetrization of Lower Limb Loads},
booktitle = {Information Technology in Biomedicine, {ITIB} 2019, Kamie{\'{n}}
{\'{S}}l{\k{a}}ski, Poland, 18-20 June, 2019},
series = {Advances in Intelligent Systems and Computing},
volume = {1011},
pages = {436--447},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-23762-2\_39},
doi = {10.1007/978-3-030-23762-2\_39},
timestamp = {Sun, 02 Oct 2022 16:10:20 +0200},
biburl = {https://dblp.org/rec/conf/itib/RomaniszynKNSTM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miip/RusuDW19,
author = {Mirabela Rusu and
Bruce Daniel and
Robert B. West},
editor = {Elsa D. Angelini and
Bennett A. Landman},
title = {Spatial integration of radiology and pathology images to characterize
breast cancer aggressiveness on pre-surgical {MRI}},
booktitle = {Medical Imaging 2019: Image Processing, San Diego, California, United
States, 16-21 February 2019},
series = {{SPIE} Proceedings},
volume = {10949},
pages = {109490Y},
publisher = {{SPIE}},
year = {2019},
url = {https://doi.org/10.1117/12.2512670},
doi = {10.1117/12.2512670},
timestamp = {Wed, 27 Nov 2024 12:15:59 +0100},
biburl = {https://dblp.org/rec/conf/miip/RusuDW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tvx/SaegheCWGVPP019,
author = {Pejman Saeghe and
Sarah Clinch and
Bruce Weir and
Maxine Glancy and
Vinoba Vinayagamoorthy and
Ollie Pattinson and
Stephen Robert Pettifer and
Robert Stevens},
editor = {Jonathan Hook and
Phil Stenton and
Marian Florin Ursu and
Guy Schofield and
Radu{-}Daniel Vatavu},
title = {Augmenting Television With Augmented Reality},
booktitle = {Proceedings of the 2019 {ACM} International Conference on Interactive
Experiences for {TV} and Online Video, {TVX} 2019, Salford (Manchester),
UK, June 5-7, 2019},
pages = {255--261},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3317697.3325129},
doi = {10.1145/3317697.3325129},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tvx/SaegheCWGVPP019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/BowenHFRD19,
author = {Lucy Bowen and
Robert Hulbert and
Jason Fong and
Zachary Rentz and
Bruce DeBruhl},
title = {Democratized Radio Tomography: Using Consumer Equipment to See through
Walls},
booktitle = {90th {IEEE} Vehicular Technology Conference, {VTC} Fall 2019, Honolulu,
HI, USA, September 22-25, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/VTCFall.2019.8891265},
doi = {10.1109/VTCFALL.2019.8891265},
timestamp = {Mon, 20 Dec 2021 11:29:04 +0100},
biburl = {https://dblp.org/rec/conf/vtc/BowenHFRD19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1902-08627,
author = {Ethan Roberts and
Bruce A. Bassett and
Michelle Lochner},
title = {Bayesian Anomaly Detection and Classification},
journal = {CoRR},
volume = {abs/1902.08627},
year = {2019},
url = {http://arxiv.org/abs/1902.08627},
eprinttype = {arXiv},
eprint = {1902.08627},
timestamp = {Sat, 23 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1902-08627.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1905-01330,
author = {Chase Roberts and
Ashley Milsted and
Martin Ganahl and
Adam Zalcman and
Bruce Fontaine and
Yijian Zou and
Jack Hidary and
Guifre Vidal and
Stefan Leichenauer},
title = {TensorNetwork: {A} Library for Physics and Machine Learning},
journal = {CoRR},
volume = {abs/1905.01330},
year = {2019},
url = {http://arxiv.org/abs/1905.01330},
eprinttype = {arXiv},
eprint = {1905.01330},
timestamp = {Wed, 29 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1905-01330.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1911-08666,
author = {Vibhavari Dasagi and
Robert Lee and
Jake Bruce and
J{\"{u}}rgen Leitner},
title = {Evaluating task-agnostic exploration for fixed-batch learning of arbitrary
future tasks},
journal = {CoRR},
volume = {abs/1911.08666},
year = {2019},
url = {http://arxiv.org/abs/1911.08666},
eprinttype = {arXiv},
eprint = {1911.08666},
timestamp = {Tue, 03 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1911-08666.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1911-11779,
author = {Eliu A. Huerta and
Gabrielle Allen and
Igor Andreoni and
Javier Mauricio Antelis and
Etienne Bachelet and
G. Bruce Berriman and
Federica B. Bianco and
Rahul Biswas and
Matias Carrasco Kind and
Kyle Chard and
Minsik Cho and
Philip S. Cowperthwaite and
Zachariah B. Etienne and
Maya Fishbach and
Francisco F{\"{o}}rster and
Daniel George and
Tom Gibbs and
Matthew J. Graham and
William Gropp and
Robert A. Gruendl and
Anushri Gupta and
Roland Haas and
Sarah Habib and
Elise Jennings and
Margaret W. G. Johnson and
Erik Katsavounidis and
Daniel S. Katz and
Asad Khan and
Volodymyr V. Kindratenko and
William T. C. Kramer and
Xin Liu and
Ashish Mahabal and
Zsuzsa M{\'{a}}rka and
Kenton McHenry and
Jonah Miller and
Claudia Moreno and
Mark S. Neubauer and
Steve Oberlin and
Alexander R. Olivas and
Donald Petravick and
Adam Rebei and
Shawn Rosofsky and
Milton Ruiz and
Aaron Saxton and
Bernard F. Schutz and
Alexander G. Schwing and
Ed Seidel and
Stuart L. Shapiro and
Hongyu Shen and
Yue Shen and
Leo Singer and
Brigitta M. Sipocz and
Lunan Sun and
John Towns and
Antonios Tsokaros and
Wei Wei and
Jack Wells and
Timothy J. Williams and
Jinjun Xiong and
Zhizhen Zhao},
title = {Enabling real-time multi-messenger astrophysics discoveries with deep
learning},
journal = {CoRR},
volume = {abs/1911.11779},
year = {2019},
url = {http://arxiv.org/abs/1911.11779},
eprinttype = {arXiv},
eprint = {1911.11779},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1911-11779.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aam/CampbellDDGGPS18,
author = {Lindsey R. Campbell and
Samantha Dahlberg and
Robert Dorward and
Jonathan Gerhard and
Thomas Grubb and
Carlin Purcell and
Bruce E. Sagan},
title = {Restricted growth function patterns and statistics},
journal = {Adv. Appl. Math.},
volume = {100},
pages = {1--42},
year = {2018},
url = {https://doi.org/10.1016/j.aam.2018.05.002},
doi = {10.1016/J.AAM.2018.05.002},
timestamp = {Thu, 08 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aam/CampbellDDGGPS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/BaiXBBRBSDGG18,
author = {Junwen Bai and
Yexiang Xue and
Johan Bjorck and
Ronan Le Bras and
Brendan Rappazzo and
Richard Bernstein and
Santosh K. Suram and
Robert Bruce van Dover and
John M. Gregoire and
Carla P. Gomes},
title = {Phase Mapper: Accelerating Materials Discovery with {AI}},
journal = {{AI} Mag.},
volume = {39},
number = {1},
pages = {15--26},
year = {2018},
url = {https://doi.org/10.1609/aimag.v39i1.2785},
doi = {10.1609/AIMAG.V39I1.2785},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aim/BaiXBBRBSDGG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/FelleisenFFKBMT18,
author = {Matthias Felleisen and
Robert Bruce Findler and
Matthew Flatt and
Shriram Krishnamurthi and
Eli Barzilay and
Jay A. McCarthy and
Sam Tobin{-}Hochstadt},
title = {A programmable programming language},
journal = {Commun. {ACM}},
volume = {61},
number = {3},
pages = {62--71},
year = {2018},
url = {https://doi.org/10.1145/3127323},
doi = {10.1145/3127323},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cacm/FelleisenFFKBMT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dsj/MejiasRDM18,
author = {Roberto J. Mejias and
Bruce A. Reinig and
Alan R. Dennis and
Scott B. MacKenzie},
title = {Observation versus Perception in the Conceptualization and Measurement
of Participation Equality in Computer-Mediated Communication},
journal = {Decis. Sci.},
volume = {49},
number = {4},
pages = {593--624},
year = {2018},
url = {https://doi.org/10.1111/deci.12292},
doi = {10.1111/DECI.12292},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dsj/MejiasRDM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejc/DavisS18,
author = {Robert Davis and
Bruce E. Sagan},
title = {Pattern-avoiding polytopes},
journal = {Eur. J. Comb.},
volume = {74},
pages = {48--84},
year = {2018},
url = {https://doi.org/10.1016/j.ejc.2018.07.006},
doi = {10.1016/J.EJC.2018.07.006},
timestamp = {Thu, 13 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ejc/DavisS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcsm/ArloffSV18,
author = {William Arloff and
Karl R. B. Schmitt and
Luke J. Venstrom},
title = {A parameter estimation method for stiff ordinary differential equations
using particle swarm optimisation},
journal = {Int. J. Comput. Sci. Math.},
volume = {9},
number = {5},
pages = {419--432},
year = {2018},
url = {https://doi.org/10.1504/IJCSM.2018.10016539},
doi = {10.1504/IJCSM.2018.10016539},
timestamp = {Thu, 20 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijcsm/ArloffSV18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/WuZHCKZ18,
author = {Xue Wu and
Si Zhou and
Xiaoming Huang and
Maodu Chen and
Robert Bruce King and
Jijun Zhao},
title = {Revisit of large-gap Si16 clusters encapsulating group-IV metal atoms
(Ti, Zr, Hf)},
journal = {J. Comput. Chem.},
volume = {39},
number = {27},
pages = {2268--2272},
year = {2018},
url = {https://doi.org/10.1002/jcc.25545},
doi = {10.1002/JCC.25545},
timestamp = {Tue, 07 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcc/WuZHCKZ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmis/GomberKPW18,
author = {Peter Gomber and
Robert J. Kauffman and
Christopher Parker and
Bruce W. Weber},
title = {Special Issue: Financial Information Systems and the Fintech Revolution},
journal = {J. Manag. Inf. Syst.},
volume = {35},
number = {1},
pages = {12--18},
year = {2018},
url = {https://doi.org/10.1080/07421222.2018.1440778},
doi = {10.1080/07421222.2018.1440778},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmis/GomberKPW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmis/GomberKPW18a,
author = {Peter Gomber and
Robert J. Kauffman and
Christopher Parker and
Bruce W. Weber},
title = {On the Fintech Revolution: Interpreting the Forces of Innovation,
Disruption, and Transformation in Financial Services},
journal = {J. Manag. Inf. Syst.},
volume = {35},
number = {1},
pages = {220--265},
year = {2018},
url = {https://doi.org/10.1080/07421222.2018.1440766},
doi = {10.1080/07421222.2018.1440766},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmis/GomberKPW18a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mia/IglesiasMPSAVLF18,
author = {Juan Eugenio Iglesias and
Marc Modat and
Lo{\"{\i}}c Peter and
Allison Stevens and
Roberto Annunziata and
Tom Vercauteren and
Ed S. Lein and
Bruce Fischl and
S{\'{e}}bastien Ourselin},
title = {Joint registration and synthesis using a probabilistic model for alignment
of {MRI} and histological sections},
journal = {Medical Image Anal.},
volume = {50},
pages = {127--144},
year = {2018},
url = {https://doi.org/10.1016/j.media.2018.09.002},
doi = {10.1016/J.MEDIA.2018.09.002},
timestamp = {Mon, 08 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mia/IglesiasMPSAVLF18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/KerseyAABBBCCDG18,
author = {Paul Julian Kersey and
James E. Allen and
Alexis Allot and
Matthieu Barba and
Sanjay Boddu and
Bruce J. Bolt and
Denise Carvalho{-}Silva and
Mikkel B. Christensen and
Paul Davis and
Christoph Grabmueller and
Navin Kumar and
Zicheng Liu and
Thomas Maurel and
Benjamin Moore and
Mark D. McDowall and
Uma Maheswari and
Guy Naamati and
Victoria Newman and
Chuang Kee Ong and
Michael Paulini and
Helder Pedro and
Emily Perry and
Matthew Russell and
Helen Sparrow and
Electra Tapanari and
Kieron R. Taylor and
Alessandro Vullo and
Gareth Williams and
Amonida Zadissa and
Andrew Olson and
Joshua C. Stein and
Sharon Wei and
Marcela K. Tello{-}Ruiz and
Doreen Ware and
Aurelien Luciani and
Simon C. Potter and
Robert D. Finn and
Martin Urban and
Kim E. Hammond{-}Kosack and
Dan M. Bolser and
Nishadi De Silva and
Kevin L. Howe and
Nicholas Langridge and
Gareth Maslen and
Daniel Michael Staines and
Andrew D. Yates},
title = {Ensembl Genomes 2018: an integrated omics infrastructure for non-vertebrate
species},
journal = {Nucleic Acids Res.},
volume = {46},
number = {Database-Issue},
pages = {D802--D808},
year = {2018},
url = {https://doi.org/10.1093/nar/gkx1011},
doi = {10.1093/NAR/GKX1011},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/KerseyAABBBCCDG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/HuaQDMLSB18,
author = {Andrew Hua and
Zachary Quicksall and
Chongzhi Di and
Robert W. Motl and
Andrea Z. LaCroix and
Bruce R. Schatz and
David Buchner},
title = {Accelerometer-based predictive models of fall risk in older women:
a pilot study},
journal = {npj Digit. Medicine},
volume = {1},
year = {2018},
url = {https://doi.org/10.1038/s41746-018-0033-5},
doi = {10.1038/S41746-018-0033-5},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/HuaQDMLSB18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmpl/FelteyGSFS18,
author = {Daniel Feltey and
Ben Greenman and
Christophe Scholliers and
Robert Bruce Findler and
Vincent St{-}Amour},
title = {Collapsible contracts: fixing a pathology of gradual typing},
journal = {Proc. {ACM} Program. Lang.},
volume = {2},
number = {{OOPSLA}},
pages = {133:1--133:27},
year = {2018},
url = {https://doi.org/10.1145/3276503},
doi = {10.1145/3276503},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pacmpl/FelteyGSFS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scp/McCarthyFNFF18,
author = {Jay A. McCarthy and
Burke Fetscher and
Max S. New and
Daniel Feltey and
Robert Bruce Findler},
title = {A Coq library for internal verification of running-times},
journal = {Sci. Comput. Program.},
volume = {164},
pages = {49--65},
year = {2018},
url = {https://doi.org/10.1016/j.scico.2017.05.001},
doi = {10.1016/J.SCICO.2017.05.001},
timestamp = {Tue, 18 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/scp/McCarthyFNFF18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/toplas/FlorenceFFTSKWN18,
author = {Spencer P. Florence and
Burke Fetscher and
Matthew Flatt and
William H. Temps and
Vincent St{-}Amour and
Tina Kiguradze and
Dennis P. West and
Charlotte Niznik and
Paul R. Yarnold and
Robert Bruce Findler and
Steven M. Belknap},
title = {{POP-PL:} {A} Patient-Oriented Prescription Programming Language},
journal = {{ACM} Trans. Program. Lang. Syst.},
volume = {40},
number = {3},
pages = {10:1--10:37},
year = {2018},
url = {https://doi.org/10.1145/3210256},
doi = {10.1145/3210256},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/toplas/FlorenceFFTSKWN18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cf/QianHYWC18,
author = {Cheng Qian and
Libo Huang and
Qi Yu and
Zhiying Wang and
Bruce R. Childers},
editor = {David R. Kaeli and
Miquel Peric{\`{a}}s},
title = {{CMH:} compression management for improving capacity in the hybrid
memory cube},
booktitle = {Proceedings of the 15th {ACM} International Conference on Computing
Frontiers, {CF} 2018, Ischia, Italy, May 08-10, 2018},
pages = {121--128},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3203217.3203235},
doi = {10.1145/3203217.3203235},
timestamp = {Tue, 15 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cf/QianHYWC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/PiumsomboonLHEL18,
author = {Thammathip Piumsomboon and
Gun A. Lee and
Jonathon D. Hart and
Barrett Ens and
Robert W. Lindeman and
Bruce H. Thomas and
Mark Billinghurst},
editor = {Regan L. Mandryk and
Mark Hancock and
Mark Perry and
Anna L. Cox},
title = {Mini-Me: An Adaptive Avatar for Mixed Reality Remote Collaboration},
booktitle = {Proceedings of the 2018 {CHI} Conference on Human Factors in Computing
Systems, {CHI} 2018, Montreal, QC, Canada, April 21-26, 2018},
pages = {46},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3173574.3173620},
doi = {10.1145/3173574.3173620},
timestamp = {Fri, 12 Mar 2021 15:28:42 +0100},
biburl = {https://dblp.org/rec/conf/chi/PiumsomboonLHEL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cinc/ZengerGMTSB18,
author = {Brian Zenger and
Wilson Good and
Rob S. MacLeod and
Jess D. Tate and
Vikas Sharma and
Jake Bergquist},
title = {Electrocardiographic Comparison of Dobutamine and Bruce Cardiac Stress
Testing With High Resolution Mapping in Experimental Models},
booktitle = {Computing in Cardiology, CinC 2018, Maastricht, The Netherlands, September
23-26, 2018},
pages = {1--4},
publisher = {www.cinc.org},
year = {2018},
url = {http://www.cinc.org/archives/2018/pdf/CinC2018-305.pdf},
doi = {10.22489/CINC.2018.305},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cinc/ZengerGMTSB18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cist/PonchioLSR18,
author = {Federico Ponchio and
Marion Lam{\'{e}} and
Roberto Scopigno and
Bruce Robertson},
editor = {Mohammed El Mohajir and
Mohammed Al Achhab and
Badr Eddine El Mohajir and
Ismail Jellouli},
title = {Visualizing and Transcribing Complex Writings Through {RTI}},
booktitle = {5th {IEEE} International Congress on Information Science and Technology,
CiSt 2018, Marrakech, Morocco, October 21-27, 2018},
pages = {227--231},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/CIST.2018.8596602},
doi = {10.1109/CIST.2018.8596602},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cist/PonchioLSR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eScience/OliveiraWMC18,
author = {Luis Oliveira and
David Wilkinson and
Daniel Moss{\'{e}} and
Bruce R. Childers},
title = {Occam: Software Environment for Creating Reproducible Research},
booktitle = {14th {IEEE} International Conference on e-Science, e-Science 2018,
Amsterdam, The Netherlands, October 29 - November 1, 2018},
pages = {394--395},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/eScience.2018.00117},
doi = {10.1109/ESCIENCE.2018.00117},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eScience/OliveiraWMC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/ElliottMPW18,
author = {Linda R. Elliott and
Bruce J. P. Mortimer and
Rodger A. Pettitt and
Robert E. Wooldridge},
editor = {Dylan D. Schmorrow and
Cali M. Fidopiastis},
title = {Assessment of Wearable Tactile System: Perception, Learning, and Recall},
booktitle = {Augmented Cognition: Users and Contexts - 12th International Conference,
{AC} 2018, Held as Part of {HCI} International 2018, Las Vegas, NV,
USA, July 15-20, 2018, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {10916},
pages = {67--77},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-319-91467-1\_6},
doi = {10.1007/978-3-319-91467-1\_6},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/hci/ElliottMPW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icde/ChildersC18,
author = {Bruce R. Childers and
Panos K. Chrysanthis},
title = {Artifact Evaluation: {FAD} or Real News?},
booktitle = {34th {IEEE} International Conference on Data Engineering, {ICDE} 2018,
Paris, France, April 16-19, 2018},
pages = {1664--1665},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/ICDE.2018.00204},
doi = {10.1109/ICDE.2018.00204},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icde/ChildersC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/irps/KimKBCFRLBZMSXK18,
author = {Wanki Kim and
SangBum Kim and
Robert L. Bruce and
Fabio Carta and
G. Fraczak and
A. Ray and
Chung Lam and
Matthew BrightSky and
Yu Zhu and
T. Masuda and
K. Suu and
Yujun Xie and
Yerin Kim and
Judy J. Cha},
title = {Reliability benefits of a metallic liner in confined {PCM}},
booktitle = {{IEEE} International Reliability Physics Symposium, {IRPS} 2018, Burlingame,
CA, USA, March 11-15, 2018},
pages = {6},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IRPS.2018.8353636},
doi = {10.1109/IRPS.2018.8353636},
timestamp = {Sat, 17 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/irps/KimKBCFRLBZMSXK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispass/QianCHYW18,
author = {Cheng Qian and
Bruce R. Childers and
Libo Huang and
Qi Yu and
Zhiying Wang},
title = {{HMCSP:} Reducing Transaction Latency of CSR-based {SPMV} in Hybrid
Memory Cube},
booktitle = {{IEEE} International Symposium on Performance Analysis of Systems
and Software, {ISPASS} 2018, Belfast, United Kingdom, April 2-4, 2018},
pages = {114--116},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/ISPASS.2018.00021},
doi = {10.1109/ISPASS.2018.00021},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ispass/QianCHYW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/milcis/CampbellPHWN18,
author = {Benjamin Campbell and
Anthony Perry and
Robert A. Hunjet and
Guangsong Wang and
Bruce S. Northcote},
title = {Minimising {RF} Detectability for Low Probability of Detection Communication},
booktitle = {2018 Military Communications and Information Systems Conference, MilCIS
2018, Canberra, Australia, November 13-15, 2018},
pages = {1--6},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/MilCIS.2018.8574116},
doi = {10.1109/MILCIS.2018.8574116},
timestamp = {Tue, 09 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/milcis/CampbellPHWN18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ni/SchnallKHHPRBBB18,
author = {Rebecca Schnall and
Lisa M. Kuhns and
Marco Hidalgo and
Sabina Hirshfield and
Cynthia Pearson and
Asa Radix and
Uri Belkind and
Joshua Bruce and
D. Scott Batey and
Robert Garofalo},
editor = {Ann Kristin Roteg{\aa}rd and
Diane J. Skiba and
Sayonara F. F. Barbosa and
Angelica G. Davalos Alc{\'{a}}zar},
title = {Development of MyPEEPS Mobile: {A} Behavioral Health Intervention
for Young Men},
booktitle = {Nursing Informatics 2018 - {ICT} to Improve Quality and Safety at
the Point of Care, Proceedings of the 14th International Congress
on Nursing Informatics, Guadalajara, Mexico, June 6-8, 2018},
series = {Studies in Health Technology and Informatics},
volume = {250},
pages = {31},
publisher = {{IOS} Press},
year = {2018},
url = {https://doi.org/10.3233/978-1-61499-872-3-31},
doi = {10.3233/978-1-61499-872-3-31},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ni/SchnallKHHPRBBB18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/aied/2018-1,
editor = {Carolyn Penstein Ros{\'{e}} and
Roberto Mart{'{i}}nez{ }Maldonado and
Heinz Ulrich Hoppe and
Rose Luckin and
Manolis Mavrikis and
Kaska Porayska{-}Pomsta and
Bruce M. McLaren and
Benedict du Boulay},
title = {Artificial Intelligence in Education - 19th International Conference,
{AIED} 2018, London, UK, June 27-30, 2018, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {10947},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-319-93843-1},
doi = {10.1007/978-3-319-93843-1},
isbn = {978-3-319-93842-4},
timestamp = {Mon, 23 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aied/2018-1.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/aied/2018-2,
editor = {Carolyn Penstein Ros{\'{e}} and
Roberto Mart{'{i}}nez{ }Maldonado and
Heinz Ulrich Hoppe and
Rose Luckin and
Manolis Mavrikis and
Kaska Porayska{-}Pomsta and
Bruce M. McLaren and
Benedict du Boulay},
title = {Artificial Intelligence in Education - 19th International Conference,
{AIED} 2018, London, UK, June 27-30, 2018, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {10948},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-319-93846-2},
doi = {10.1007/978-3-319-93846-2},
isbn = {978-3-319-93845-5},
timestamp = {Mon, 23 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aied/2018-2.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1801-05284,
author = {Juan Eugenio Iglesias and
Marc Modat and
Lo{\"{\i}}c Peter and
Allison Stevens and
Roberto Annunziata and
Tom Vercauteren and
Ed S. Lein and
Bruce Fischl and
S{\'{e}}bastien Ourselin},
title = {Joint registration and synthesis using a probabilistic model for alignment
of {MRI} and histological sections},
journal = {CoRR},
volume = {abs/1801.05284},
year = {2018},
url = {http://arxiv.org/abs/1801.05284},
eprinttype = {arXiv},
eprint = {1801.05284},
timestamp = {Mon, 08 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1801-05284.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1802-00552,
author = {Lior Shamir and
G. Bruce Berriman and
Peter J. Teuben and
Robert J. Nemiroff and
Alice Allen},
title = {Best Practices for a Future Open Code Policy: Experiences and Vision
of the Astrophysics Source Code Library},
journal = {CoRR},
volume = {abs/1802.00552},
year = {2018},
url = {http://arxiv.org/abs/1802.00552},
eprinttype = {arXiv},
eprint = {1802.00552},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1802-00552.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-07480,
author = {Robert Lee and
Serena Mou and
Vibhavari Dasagi and
Jake Bruce and
J{\"{u}}rgen Leitner and
Niko S{\"{u}}nderhauf},
title = {Zero-shot Sim-to-Real Transfer with Modular Priors},
journal = {CoRR},
volume = {abs/1809.07480},
year = {2018},
url = {http://arxiv.org/abs/1809.07480},
eprinttype = {arXiv},
eprint = {1809.07480},
timestamp = {Fri, 05 Oct 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1809-07480.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csm/JacquenetLFMMRT17,
author = {Christian Jacquenet and
Yannick Lair and
Francois Le Faucheur and
Kevin J. Ma and
A. Jean Mahoney and
Brian Rosen and
Timothy B. Terriberry and
Mo Zanaty and
Roni Even and
Bron Gondwana and
Barry Leiba and
Scott Mansfield and
Bruce Gracie and
Jaafar Elmirghanni and
Gonzalo Camarillo and
Robert Sparks and
Russ Housley},
title = {Standards News},
journal = {{IEEE} Commun. Stand. Mag.},
volume = {1},
number = {2},
pages = {13--19},
year = {2017},
url = {https://doi.org/10.1109/MCOMSTD.2017.7992922},
doi = {10.1109/MCOMSTD.2017.7992922},
timestamp = {Thu, 27 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csm/JacquenetLFMMRT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-cds/HarrisHCOKSPA17,
author = {Sarah L. Harris and
David Money Harris and
Daniel Chaver and
Robert Owen and
Zubair L. Kakakhel and
Enrique Sedano and
Yuri Panchul and
Bruce Ableidinger},
title = {MIPSfpga: using a commercial {MIPS} soft-core in computer architecture
education},
journal = {{IET} Circuits Devices Syst.},
volume = {11},
number = {4},
pages = {283--291},
year = {2017},
url = {https://doi.org/10.1049/iet-cds.2016.0383},
doi = {10.1049/IET-CDS.2016.0383},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iet-cds/HarrisHCOKSPA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/AdelmanBRGLSVGS17,
author = {Jason S. Adelman and
Matthew A. Berger and
Amisha Rai and
William L. Galanter and
Bruce L. Lambert and
Gordon D. Schiff and
David K. Vawdrey and
Robert A. Green and
Hojjat Salmasian and
Ross Koppel and
Clyde B. Schechter and
Jo R. Applebaum and
William N. Southern},
title = {A national survey assessing the number of records allowed open in
electronic health records at hospitals and ambulatory sites},
journal = {J. Am. Medical Informatics Assoc.},
volume = {24},
number = {5},
pages = {992--995},
year = {2017},
url = {https://doi.org/10.1093/jamia/ocx034},
doi = {10.1093/JAMIA/OCX034},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/AdelmanBRGLSVGS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/Munoz-CastroK17,
author = {Alvaro Mu{\~{n}}oz{-}Castro and
Robert Bruce King},
title = {Evaluation of bonding, electron affinity, and optical properties of
M@C\({}_{\mbox{28}}\) {(M} = Zr, Hf, Th, and {U):} Role of d- and
f-orbitals in endohedral fullerenes from relativistic {DFT} calculations},
journal = {J. Comput. Chem.},
volume = {38},
number = {1},
pages = {44--50},
year = {2017},
url = {https://doi.org/10.1002/jcc.24518},
doi = {10.1002/JCC.24518},
timestamp = {Tue, 07 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcc/Munoz-CastroK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/Munoz-CastroK17a,
author = {Alvaro Mu{\~{n}}oz{-}Castro and
Robert Bruce King},
title = {On the formation of smaller \emph{p}-block endohedral fullerenes:
Bonding analysis in the E@C\({}_{\mbox{20}}\) {(E} = Si, Ge, Sn, Pb)
series from relativistic {DFT} calculations},
journal = {J. Comput. Chem.},
volume = {38},
number = {19},
pages = {1661--1667},
year = {2017},
url = {https://doi.org/10.1002/jcc.24809},
doi = {10.1002/JCC.24809},
timestamp = {Tue, 07 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcc/Munoz-CastroK17a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfp/NewFFM17,
author = {Max S. New and
Burke Fetscher and
Robert Bruce Findler and
Jay A. McCarthy},
title = {Fair enumeration combinators},
journal = {J. Funct. Program.},
volume = {27},
pages = {e19},
year = {2017},
url = {https://doi.org/10.1017/S0956796817000107},
doi = {10.1017/S0956796817000107},
timestamp = {Mon, 18 Sep 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfp/NewFFM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/SharmaBTSMAC17,
author = {Sunita Sharma and
J. Martijn Bos and
Robert F. Tarrell and
Gy{\"{o}}rgy J. Simon and
Bruce W. Morlan and
Michael J. Ackerman and
Pedro J. Caraballo},
title = {Providers' Response to Clinical Decision Support for {QT} Prolonging
Drugs},
journal = {J. Medical Syst.},
volume = {41},
number = {10},
pages = {161:1--161:8},
year = {2017},
url = {https://doi.org/10.1007/s10916-017-0803-7},
doi = {10.1007/S10916-017-0803-7},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jms/SharmaBTSMAC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jot/NobleBBHJ17,
author = {James Noble and
Andrew P. Black and
Kim B. Bruce and
Michael Homer and
Timothy Jones},
title = {Grace's Inheritance},
journal = {J. Object Technol.},
volume = {16},
number = {2},
pages = {2:1--35},
year = {2017},
url = {https://doi.org/10.5381/jot.2017.16.2.a2},
doi = {10.5381/JOT.2017.16.2.A2},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jot/NobleBBHJ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/misq/RiemerJ17,
author = {Kai Riemer and
Robert Bruce Johnston},
title = {Clarifying Ontological Inseparabiilty with Heidegger's Analysis of
Equipment},
journal = {{MIS} Q.},
volume = {41},
number = {4},
pages = {1059--1081},
year = {2017},
url = {https://doi.org/10.25300/misq/2017/41.4.03},
doi = {10.25300/MISQ/2017/41.4.03},
timestamp = {Sun, 17 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/misq/RiemerJ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WattamDABBBCDDG17,
author = {Alice R. Wattam and
James J. Davis and
Rida Assaf and
S{\'{e}}bastien Boisvert and
Thomas S. Brettin and
Christopher Bun and
Neal Conrad and
Emily M. Dietrich and
Terry Disz and
Joseph L. Gabbard and
Svetlana Gerdes and
Christopher S. Henry and
Ronald W. Kenyon and
Dustin Machi and
Chunhong Mao and
Eric K. Nordberg and
Gary J. Olsen and
Daniel E. Murphy{-}Olson and
Robert Olson and
Ross A. Overbeek and
Bruce D. Parrello and
Gordon D. Pusch and
Maulik Shukla and
Veronika Vonstein and
Andrew S. Warren and
Fangfang Xia and
Hyun Seung Yoo and
Rick L. Stevens},
title = {Improvements to PATRIC, the all-bacterial Bioinformatics Database
and Analysis Resource Center},
journal = {Nucleic Acids Res.},
volume = {45},
number = {Database-Issue},
pages = {D535--D542},
year = {2017},
url = {https://doi.org/10.1093/nar/gkw1017},
doi = {10.1093/NAR/GKW1017},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/WattamDABBBCDDG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/AndohFLMPZ17,
author = {Jamila Andoh and
M. Ferreira and
Ilana Leppert and
Reiko Matsushita and
G. Bruce Pike and
Robert J. Zatorre},
title = {How restful is it with all that noise? Comparison of Interleaved silent
steady state {(ISSS)} and conventional imaging in resting-state fMRI},
journal = {NeuroImage},
volume = {147},
pages = {726--735},
year = {2017},
url = {https://doi.org/10.1016/j.neuroimage.2016.11.065},
doi = {10.1016/J.NEUROIMAGE.2016.11.065},
timestamp = {Wed, 05 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/AndohFLMPZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmpl/St-AmourFFYF17,
author = {Vincent St{-}Amour and
Daniel Feltey and
Spencer P. Florence and
Shu{-}Hung You and
Robert Bruce Findler},
title = {Herbarium Racketensis: a stroll through the woods (functional pearl)},
journal = {Proc. {ACM} Program. Lang.},
volume = {1},
number = {{ICFP}},
pages = {1:1--1:15},
year = {2017},
url = {https://doi.org/10.1145/3110245},
doi = {10.1145/3110245},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pacmpl/St-AmourFFYF17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/MiddletonRCHCNS17,
author = {Elizabeth M. Middleton and
Uwe Rascher and
Lawrence A. Corp and
Karl Fred Huemmrich and
Bruce D. Cook and
Asko Noormets and
Anke Schickling and
Francisco Pinto and
Luis Alonso and
Alexander Damm and
Luis Guanter and
Roberto Colombo and
Petya K. E. Campbell and
David R. Landis and
Qingyuan Zhang and
Micol Rossini and
Dirk Schuettemeyer and
Remo Bianchi},
title = {The 2013 {FLEX} - {US} Airborne Campaign at the Parker Tract Loblolly
Pine Plantation in North Carolina, {USA}},
journal = {Remote. Sens.},
volume = {9},
number = {6},
pages = {612},
year = {2017},
url = {https://doi.org/10.3390/rs9060612},
doi = {10.3390/RS9060612},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/remotesensing/MiddletonRCHCNS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/CarterCNNPJB17,
author = {Lynn M. Carter and
Bruce A. Campbell and
Catherine Neish and
Michael C. Nolan and
G. Wesley Patterson and
J. Robert Jensen and
D. Benjamin J. Bussey},
title = {A Comparison of Radar Polarimetry Data of the Moon From the {LRO}
Mini-RF Instrument and Earth-Based Systems},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {55},
number = {4},
pages = {1915--1927},
year = {2017},
url = {https://doi.org/10.1109/TGRS.2016.2631144},
doi = {10.1109/TGRS.2016.2631144},
timestamp = {Mon, 29 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/CarterCNNPJB17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/todaes/ZhangZCY17,
author = {XianWei Zhang and
Youtao Zhang and
Bruce R. Childers and
Jun Yang},
title = {On the Restore Time Variations of Future {DRAM} Memory},
journal = {{ACM} Trans. Design Autom. Electr. Syst.},
volume = {22},
number = {2},
pages = {26:1--26:24},
year = {2017},
url = {https://doi.org/10.1145/2967609},
doi = {10.1145/2967609},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/todaes/ZhangZCY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEpact/ZhangZCY17,
author = {XianWei Zhang and
Youtao Zhang and
Bruce R. Childers and
Jun Yang},
title = {DrMP: Mixed Precision-Aware {DRAM} for High Performance Approximate
and Precise Computing},
booktitle = {26th International Conference on Parallel Architectures and Compilation
Techniques, {PACT} 2017, Portland, OR, USA, September 9-13, 2017},
pages = {53--63},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/PACT.2017.34},
doi = {10.1109/PACT.2017.34},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/IEEEpact/ZhangZCY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/XueBBRBBLSDGG17,
author = {Yexiang Xue and
Junwen Bai and
Ronan Le Bras and
Brendan Rappazzo and
Richard Bernstein and
Johan Bjorck and
Liane Longpre and
Santosh K. Suram and
Robert Bruce van Dover and
John M. Gregoire and
Carla P. Gomes},
editor = {Satinder Singh and
Shaul Markovitch},
title = {Phase-Mapper: An {AI} Platform to Accelerate High Throughput Materials
Discovery},
booktitle = {Proceedings of the Thirty-First {AAAI} Conference on Artificial Intelligence,
February 4-9, 2017, San Francisco, California, {USA}},
pages = {4635--4643},
publisher = {{AAAI} Press},
year = {2017},
url = {https://doi.org/10.1609/aaai.v31i1.19087},
doi = {10.1609/AAAI.V31I1.19087},
timestamp = {Mon, 04 Sep 2023 14:40:32 +0200},
biburl = {https://dblp.org/rec/conf/aaai/XueBBRBBLSDGG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asunam/GeraJS17,
author = {Ralucca Gera and
Nicholas R. Juliano and
Karl R. B. Schmitt},
editor = {Jana Diesner and
Elena Ferrari and
Guandong Xu},
title = {Optimizing Network Discovery with Clever Walks},
booktitle = {Proceedings of the 2017 {IEEE/ACM} International Conference on Advances
in Social Networks Analysis and Mining 2017, Sydney, Australia, July
31 - August 03, 2017},
pages = {1217--1224},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3110025.3120961},
doi = {10.1145/3110025.3120961},
timestamp = {Tue, 12 Nov 2024 10:12:41 +0100},
biburl = {https://dblp.org/rec/conf/asunam/GeraJS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eScience/ChildersC17,
author = {Bruce R. Childers and
Panos K. Chrysanthis},
title = {Artifact Evaluation: Is It a Real Incentive?},
booktitle = {13th {IEEE} International Conference on e-Science, e-Science 2017,
Auckland, New Zealand, October 24-27, 2017},
pages = {488--489},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/eScience.2017.79},
doi = {10.1109/ESCIENCE.2017.79},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eScience/ChildersC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoc/RosenbergHKALBG17,
author = {Jessie C. Rosenberg and
Folkert Horst and
Marwan Khater and
Frederick G. Anderson and
Robert Leidy and
Tymon Barwicz and
Douglas M. Gill and
Edward Kiewra and
Yves Martin and
Jason S. Orcutt and
Andreas D. Stricker and
Charles Whiting and
Kate McLean and
Bruce Porth and
Chi Xiong and
Natalie B. Feilchenfeld and
Ken Giewont and
Karen Nummy and
Bert J. Offrein and
Wilfried Haensch and
William M. J. Green},
title = {Monolithic Silicon Photonic {WDM} Transceivers},
booktitle = {European Conference on Optical Communication, {ECOC} 2017, Gothenburg,
Sweden, September 17-21, 2017},
pages = {1--3},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ECOC.2017.8346134},
doi = {10.1109/ECOC.2017.8346134},
timestamp = {Mon, 09 Aug 2021 14:54:02 +0200},
biburl = {https://dblp.org/rec/conf/ecoc/RosenbergHKALBG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/GonzalezFFLG17,
author = {Andres Gonzalez and
Robert Michael Fowler and
Harrison Froeschke and
Sabra Leong and
Bruce Gooch},
editor = {Panayiotis Zaphiris and
Andri Ioannou},
title = {Fairy Houses: {A} Creative Engineering Experience},
booktitle = {Learning and Collaboration Technologies. Technology in Education -
4th International Conference, {LCT} 2017, Held as Part of {HCI} International
2017, Vancouver, BC, Canada, July 9-14, 2017, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {10296},
pages = {41--49},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-58515-4\_4},
doi = {10.1007/978-3-319-58515-4\_4},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/hci/GonzalezFFLG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/LightfootGF17,
author = {Robert Lightfoot and
Bruce Gooch and
Robert Michael Fowler},
editor = {Constantine Stephanidis},
title = {Humanizing the Machine - Basic Communication for Unskilled Operators},
booktitle = {{HCI} International 2017 - Posters' Extended Abstracts - 19th International
Conference, {HCI} International 2017, Vancouver, BC, Canada, July
9-14, 2017, Proceedings, Part {II}},
series = {Communications in Computer and Information Science},
volume = {714},
pages = {569--574},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-58753-0\_80},
doi = {10.1007/978-3-319-58753-0\_80},
timestamp = {Mon, 03 Jul 2017 14:48:38 +0200},
biburl = {https://dblp.org/rec/conf/hci/LightfootGF17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/WangYMCZG17,
author = {Zhenning Wang and
Jun Yang and
Rami G. Melhem and
Bruce R. Childers and
Youtao Zhang and
Minyi Guo},
title = {Quality of Service Support for Fine-Grained Sharing on GPUs},
booktitle = {Proceedings of the 44th Annual International Symposium on Computer
Architecture, {ISCA} 2017, Toronto, ON, Canada, June 24-28, 2017},
pages = {269--281},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3079856.3080203},
doi = {10.1145/3079856.3080203},
timestamp = {Thu, 17 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isca/WangYMCZG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/BarwiczKMBE17,
author = {Tymon Barwicz and
Swetha Kamlapurkar and
Yves Martin and
Robert L. Bruce and
Sebastian Engelmann},
title = {A silicon metamaterial chip-to-chip coupler for photonic flip-chip
applications},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2017,
Los Angeles, CA, USA, March 19-23, 2017},
pages = {1--3},
publisher = {{IEEE}},
year = {2017},
url = {https://ieeexplore.ieee.org/document/7936988},
timestamp = {Thu, 26 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/BarwiczKMBE17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/snapl/Tobin-Hochstadt17,
author = {Sam Tobin{-}Hochstadt and
Matthias Felleisen and
Robert Bruce Findler and
Matthew Flatt and
Ben Greenman and
Andrew M. Kent and
Vincent St{-}Amour and
T. Stephen Strickland and
Asumu Takikawa},
editor = {Benjamin S. Lerner and
Rastislav Bod{\'{\i}}k and
Shriram Krishnamurthi},
title = {Migratory Typing: Ten Years Later},
booktitle = {2nd Summit on Advances in Programming Languages, {SNAPL} 2017, May
7-10, 2017, Asilomar, CA, {USA}},
series = {LIPIcs},
volume = {71},
pages = {17:1--17:17},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2017},
url = {https://doi.org/10.4230/LIPIcs.SNAPL.2017.17},
doi = {10.4230/LIPICS.SNAPL.2017.17},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/snapl/Tobin-Hochstadt17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TaylorAFCMBB17,
author = {Simon J. E. Taylor and
Anastasia Anagnostou and
Adedeji O. Fabiyi and
Christine S. M. Currie and
Thomas Monks and
Roberto Barbera and
Bruce Becker},
title = {Open science: Approaches and benefits for modeling {\&} simulation},
booktitle = {2017 Winter Simulation Conference, {WSC} 2017, Las Vegas, NV, USA,
December 3-6, 2017},
pages = {535--549},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/WSC.2017.8247813},
doi = {10.1109/WSC.2017.8247813},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wsc/TaylorAFCMBB17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/3dui/2017,
editor = {Maud Marchal and
Robert J. Teather and
Bruce H. Thomas},
title = {2017 {IEEE} Symposium on 3D User Interfaces, 3DUI 2017, Los Angeles,
CA, USA, March 18-19, 2017},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://ieeexplore.ieee.org/xpl/conhome/7889402/proceeding},
isbn = {978-1-5090-6716-9},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/3dui/2017.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1709-04481,
author = {James P. Canning and
Emma E. Ingram and
Sammantha Nowak{-}Wolff and
Adriana M. Ortiz and
Nesreen K. Ahmed and
Ryan A. Rossi and
Karl Robert Bruce Schmitt and
Sucheta Soundarajan},
title = {Network Classification and Categorization},
journal = {CoRR},
volume = {abs/1709.04481},
year = {2017},
url = {http://arxiv.org/abs/1709.04481},
eprinttype = {arXiv},
eprint = {1709.04481},
timestamp = {Sat, 23 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1709-04481.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/ShannonCTHBMTSN16,
author = {Casey P. Shannon and
Virginia Chen and
Mandeep Takhar and
Zsuzsanna Hollander and
Robert Balshaw and
Bruce McManus and
Scott J. Tebbutt and
Don D. Sin and
Raymond T. Ng},
title = {{SABRE:} a method for assessing the stability of gene modules in complex
tissues and subject populations},
journal = {{BMC} Bioinform.},
volume = {17},
pages = {460:1--460:11},
year = {2016},
url = {https://doi.org/10.1186/s12859-016-1319-8},
doi = {10.1186/S12859-016-1319-8},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/ShannonCTHBMTSN16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cal/WangYMCZG16,
author = {Zhenning Wang and
Jun Yang and
Rami G. Melhem and
Bruce R. Childers and
Youtao Zhang and
Minyi Guo},
title = {Simultaneous Multikernel: Fine-Grained Sharing of GPUs},
journal = {{IEEE} Comput. Archit. Lett.},
volume = {15},
number = {2},
pages = {113--116},
year = {2016},
url = {https://doi.org/10.1109/LCA.2015.2477405},
doi = {10.1109/LCA.2015.2477405},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cal/WangYMCZG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/DahlbergDGGPRS16,
author = {Samantha Dahlberg and
Robert Dorward and
Jonathan Gerhard and
Thomas Grubb and
Carlin Purcell and
Lindsey Reppuhn and
Bruce E. Sagan},
title = {Set partition patterns and statistics},
journal = {Discret. Math.},
volume = {339},
number = {1},
pages = {1--16},
year = {2016},
url = {https://doi.org/10.1016/j.disc.2015.07.001},
doi = {10.1016/J.DISC.2015.07.001},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dm/DahlbergDGGPRS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejgta/ErohEGPS16,
author = {Linda Eroh and
Henry Escuadro and
Ralucca Gera and
Samuel Prahlow and
Karl R. B. Schmitt},
title = {A graph theoretical analysis of the number of edges in k-dense graphs},
journal = {Electron. J. Graph Theory Appl.},
volume = {4},
number = {1},
pages = {26--41},
year = {2016},
url = {https://doi.org/10.5614/ejgta.2016.4.1.4},
doi = {10.5614/EJGTA.2016.4.1.4},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ejgta/ErohEGPS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijpp/RahmanC16,
author = {Musfiq Rahman and
Bruce R. Childers},
title = {Asteroid: Scalable Online Memory Diagnostics for Multi-core, Multi-socket
Servers},
journal = {Int. J. Parallel Program.},
volume = {44},
number = {5},
pages = {949--974},
year = {2016},
url = {https://doi.org/10.1007/s10766-016-0400-2},
doi = {10.1007/S10766-016-0400-2},
timestamp = {Wed, 01 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijpp/RahmanC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/LupanK16,
author = {Alexandru Lupan and
Robert Bruce King},
title = {Molybdatricarbaboranes as examples of isocloso metallaborane deltahedra
with three carbon vertices},
journal = {J. Comput. Chem.},
volume = {37},
number = {1},
pages = {64--69},
year = {2016},
url = {https://doi.org/10.1002/jcc.23995},
doi = {10.1002/JCC.23995},
timestamp = {Tue, 07 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcc/LupanK16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/TraoreRADASB16,
author = {Seydou Traor{\'{e}} and
Kyle E. Roberts and
David Allouche and
Bruce Randall Donald and
Isabelle Andr{\'{e}} and
Thomas Schiex and
Sophie Barbe},
title = {Fast search algorithms for computational protein design},
journal = {J. Comput. Chem.},
volume = {37},
number = {12},
pages = {1048--1058},
year = {2016},
url = {https://doi.org/10.1002/jcc.24290},
doi = {10.1002/JCC.24290},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcc/TraoreRADASB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/WangWKS16,
author = {Hong{-}Yan Wang and
Hui Wang and
Robert Bruce King and
Henry F. Schaefer III},
title = {Bis(azulene) "submarine" metal dimer sandwich compounds (C\({}_{\mbox{10}}\)H\({}_{\mbox{8}}\))\({}_{\mbox{2}}\)M\({}_{\mbox{2}}\)
{(M} = Ti, V, Cr, Mn, Fe, Co, Ni): Parallel and opposed orientations},
journal = {J. Comput. Chem.},
volume = {37},
number = {2},
pages = {250--260},
year = {2016},
url = {https://doi.org/10.1002/jcc.24013},
doi = {10.1002/JCC.24013},
timestamp = {Tue, 07 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcc/WangWKS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/FanWNDHDSSSSHSH16,
author = {Qiuyun Fan and
Thomas Witzel and
Aapo Nummenmaa and
Koene R. A. Van Dijk and
John D. Van Horn and
Michelle K. Drews and
Leah H. Somerville and
Margaret A. Sheridan and
Rosario M. Santillana and
Jenna Snyder and
Trey Hedden and
Emily E. Shaw and
Marisa O. Hollinshead and
Ville Renvall and
Roberta Zanzonico and
Boris Keil and
Stephen F. Cauley and
Jonathan R. Polimeni and
M. Dylan Tisdall and
Randy L. Buckner and
Van J. Wedeen and
Lawrence L. Wald and
Arthur W. Toga and
Bruce R. Rosen},
title = {{MGH-USC} Human Connectome Project datasets with ultra-high b-value
diffusion {MRI}},
journal = {NeuroImage},
volume = {124},
pages = {1108--1114},
year = {2016},
url = {https://doi.org/10.1016/j.neuroimage.2015.08.075},
doi = {10.1016/J.NEUROIMAGE.2015.08.075},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/FanWNDHDSSSSHSH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigact/Gasarch16e,
author = {William I. Gasarch},
title = {Review of: Ramsey Theory over the Integers (Second Edition) by Bruce
M. Landman and Aaron Robertson},
journal = {{SIGACT} News},
volume = {47},
number = {2},
pages = {14--17},
year = {2016},
url = {https://doi.org/10.1145/2951860.2951866},
doi = {10.1145/2951860.2951866},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigact/Gasarch16e.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taco/ZhouDCMM16,
author = {Miao Zhou and
Yu Du and
Bruce R. Childers and
Daniel Moss{\'{e}} and
Rami G. Melhem},
title = {Symmetry-Agnostic Coordinated Management of the Memory Hierarchy in
Multicore Systems},
journal = {{ACM} Trans. Archit. Code Optim.},
volume = {12},
number = {4},
pages = {61:1--61:26},
year = {2016},
url = {https://doi.org/10.1145/2847254},
doi = {10.1145/2847254},
timestamp = {Thu, 14 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/taco/ZhouDCMM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/DoborjehWKKR16,
author = {Maryam Gholami Doborjeh and
Grace Y. Wang and
Nikola K. Kasabov and
Robert Kydd and
Bruce Russell},
title = {A Spiking Neural Network Methodology and System for Learning and Comparative
Analysis of {EEG} Data From Healthy Versus Addiction Treated Versus
Addiction Not Treated Subjects},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {63},
number = {9},
pages = {1830--1841},
year = {2016},
url = {https://doi.org/10.1109/TBME.2015.2503400},
doi = {10.1109/TBME.2015.2503400},
timestamp = {Wed, 02 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/DoborjehWKKR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acis/RiemerJ16,
author = {Kai Riemer and
Robert Bruce Johnston},
title = {Making Sense of Disruption: {A} Kuhnian Analysis},
booktitle = {Australasian Conference on Information Systems, {ACIS} 2016, Wollongong,
NSW, Australia, December 5-7, 2016},
pages = {6},
year = {2016},
url = {https://aisel.aisnet.org/acis2016/6},
timestamp = {Thu, 16 May 2024 17:06:12 +0200},
biburl = {https://dblp.org/rec/conf/acis/RiemerJ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aics/Bruce16,
author = {Robert Bruce},
editor = {Derek Greene and
Brian Mac Namee and
Robert J. Ross},
title = {Recursion in Fixed Motor Sequences},
booktitle = {Proceedings of the 24th Irish Conference on Artificial Intelligence
and Cognitive Science, {AICS} 2016, Dublin, Ireland, September 20-21,
2016},
series = {{CEUR} Workshop Proceedings},
volume = {1751},
pages = {272--282},
publisher = {CEUR-WS.org},
year = {2016},
url = {https://ceur-ws.org/Vol-1751/AICS\_2016\_paper\_56.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:43 +0100},
biburl = {https://dblp.org/rec/conf/aics/Bruce16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/birthday/BlackBN16,
author = {Andrew P. Black and
Kim B. Bruce and
James Noble},
editor = {Sam Lindley and
Conor McBride and
Philip W. Trinder and
Donald Sannella},
title = {The Essence of Inheritance},
booktitle = {A List of Successes That Can Change the World - Essays Dedicated to
Philip Wadler on the Occasion of His 60th Birthday},
series = {Lecture Notes in Computer Science},
volume = {9600},
pages = {73--94},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-30936-1\_4},
doi = {10.1007/978-3-319-30936-1\_4},
timestamp = {Tue, 14 May 2019 10:00:52 +0200},
biburl = {https://dblp.org/rec/conf/birthday/BlackBN16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsrt/TaylorFABTRB16,
author = {Simon J. E. Taylor and
Adedeji O. Fabiyi and
Anastasia Anagnostou and
Roberto Barbera and
Mario Torrisi and
Rita Ricceri and
Bruce Becker},
title = {Demonstrating Open Science for Modeling {\&} Simulation Research},
booktitle = {20th {IEEE/ACM} International Symposium on Distributed Simulation
and Real Time Applications, {DS-RT} 2016, London, United Kingdom,
September 21-23, 2016},
pages = {191--192},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/DS-RT.2016.35},
doi = {10.1109/DS-RT.2016.35},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsrt/TaylorFABTRB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/0002HNB16,
author = {Timothy Jones and
Michael Homer and
James Noble and
Kim B. Bruce},
editor = {Shriram Krishnamurthi and
Benjamin S. Lerner},
title = {Object Inheritance Without Classes},
booktitle = {30th European Conference on Object-Oriented Programming, {ECOOP} 2016,
July 18-22, 2016, Rome, Italy},
series = {LIPIcs},
volume = {56},
pages = {13:1--13:26},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2016},
url = {https://doi.org/10.4230/LIPIcs.ECOOP.2016.13},
doi = {10.4230/LIPICS.ECOOP.2016.13},
timestamp = {Tue, 11 Feb 2020 15:52:14 +0100},
biburl = {https://dblp.org/rec/conf/ecoop/0002HNB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/egve/OHareBRTWR16,
author = {John O'Hare and
Robert C. A. Bendall and
John Rae and
Graham Thomas and
Bruce Weir and
David J. Roberts},
editor = {Dirk Reiners and
Daisuke Iwai and
Frank Steinicke},
title = {Is This Seat Taken? Behavioural Analysis of the Telethrone: {A} Novel
Situated Telepresence Display},
booktitle = {International Conference on Artificial Reality and Telexistence and
Eurographics Symposium on Virtual Environments, {ICAT-EGVE} 2016,
Little Rock, Arkansas, USA, December 7-9, 2016},
pages = {99--106},
publisher = {Eurographics Association},
year = {2016},
url = {https://doi.org/10.2312/egve.20161441},
doi = {10.2312/EGVE.20161441},
timestamp = {Mon, 25 Feb 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/egve/OHareBRTWR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/flops/McCarthyFNFF16,
author = {Jay A. McCarthy and
Burke Fetscher and
Max S. New and
Daniel Feltey and
Robert Bruce Findler},
editor = {Oleg Kiselyov and
Andy King},
title = {A Coq Library for Internal Verification of Running-Times},
booktitle = {Functional and Logic Programming - 13th International Symposium, {FLOPS}
2016, Kochi, Japan, March 4-6, 2016, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9613},
pages = {144--162},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-29604-3\_10},
doi = {10.1007/978-3-319-29604-3\_10},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/flops/McCarthyFNFF16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/WangYMCZG16,
author = {Zhenning Wang and
Jun Yang and
Rami G. Melhem and
Bruce R. Childers and
Youtao Zhang and
Minyi Guo},
title = {Simultaneous Multikernel {GPU:} Multi-tasking throughput processors
via fine-grained sharing},
booktitle = {2016 {IEEE} International Symposium on High Performance Computer Architecture,
{HPCA} 2016, Barcelona, Spain, March 12-16, 2016},
pages = {358--369},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/HPCA.2016.7446078},
doi = {10.1109/HPCA.2016.7446078},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpca/WangYMCZG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/ZhangZCY16,
author = {XianWei Zhang and
Youtao Zhang and
Bruce R. Childers and
Jun Yang},
title = {Restore truncation for performance improvement in future {DRAM} systems},
booktitle = {2016 {IEEE} International Symposium on High Performance Computer Architecture,
{HPCA} 2016, Barcelona, Spain, March 12-16, 2016},
pages = {543--554},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/HPCA.2016.7446093},
doi = {10.1109/HPCA.2016.7446093},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpca/ZhangZCY16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccd/BockCMM16,
author = {Santiago Bock and
Bruce R. Childers and
Rami G. Melhem and
Daniel Moss{\'{e}}},
title = {Concurrent Migration of Multiple Pages in software-managed hybrid
main memory},
booktitle = {34th {IEEE} International Conference on Computer Design, {ICCD} 2016,
Scottsdale, AZ, USA, October 2-5, 2016},
pages = {420--423},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/ICCD.2016.7753318},
doi = {10.1109/ICCD.2016.7753318},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccd/BockCMM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icfp/DimoulasNFF16,
author = {Christos Dimoulas and
Max S. New and
Robert Bruce Findler and
Matthias Felleisen},
editor = {Jacques Garrigue and
Gabriele Keller and
Eijiro Sumii},
title = {Oh Lord, please don't let contracts be misunderstood (functional pearl)},
booktitle = {Proceedings of the 21st {ACM} {SIGPLAN} International Conference on
Functional Programming, {ICFP} 2016, Nara, Japan, September 18-22,
2016},
pages = {117--131},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2951913.2951930},
doi = {10.1145/2951913.2951930},
timestamp = {Wed, 23 Jun 2021 15:34:31 +0200},
biburl = {https://dblp.org/rec/conf/icfp/DimoulasNFF16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/memsys/ZhangZCY16,
author = {XianWei Zhang and
Youtao Zhang and
Bruce R. Childers and
Jun Yang},
editor = {Bruce L. Jacob},
title = {{AWARD:} Approximation-aWAre Restore in Further Scaling {DRAM}},
booktitle = {Proceedings of the Second International Symposium on Memory Systems,
{MEMSYS} 2016, Alexandria, VA, USA, October 3-6, 2016},
pages = {322--324},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2989081.2989127},
doi = {10.1145/2989081.2989127},
timestamp = {Fri, 13 Nov 2020 09:24:44 +0100},
biburl = {https://dblp.org/rec/conf/memsys/ZhangZCY16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nvmsa/ZhangAZC16,
author = {Chi Zhang and
Wonsun Ahn and
Youtao Zhang and
Bruce R. Childers},
title = {Live code update for IoT devices in energy harvesting environments},
booktitle = {5th Non-Volatile Memory Systems and Applications Symposium, {NVMSA}
2016, Daegu, South Korea, August 17-19, 2016},
pages = {1--6},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/NVMSA.2016.7547182},
doi = {10.1109/NVMSA.2016.7547182},
timestamp = {Fri, 21 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nvmsa/ZhangAZC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/BarwiczBJMTPLKM16,
author = {Tymon Barwicz and
Nicolas Boyer and
Alexander Janta{-}Polczynski and
Jean{-}Fran{\c{c}}ois Morissette and
Yan Thibodeau and
Luc Patry and
Ted W. Lichoulas and
Eddie L. Kimbrell and
Stephan Martel and
Swetha Kamlapurkar and
Sebastian Engelmann and
Robert L. Bruce and
Yurii A. Vlasov and
Paul Fortier},
title = {A metamaterial converter centered at 1490nm for interfacing standard
fibers to nanophotonic waveguides},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2016,
Anaheim, CA, USA, March 20-24, 2016},
pages = {1--3},
publisher = {{IEEE}},
year = {2016},
url = {https://ieeexplore.ieee.org/document/7537226},
timestamp = {Thu, 26 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/BarwiczBJMTPLKM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/MooreDFFC16,
author = {Scott Moore and
Christos Dimoulas and
Robert Bruce Findler and
Matthew Flatt and
Stephen Chong},
editor = {Eelco Visser and
Yannis Smaragdakis},
title = {Extensible access control with authorization contracts},
booktitle = {Proceedings of the 2016 {ACM} {SIGPLAN} International Conference on
Object-Oriented Programming, Systems, Languages, and Applications,
{OOPSLA} 2016, part of {SPLASH} 2016, Amsterdam, The Netherlands,
October 30 - November 4, 2016},
pages = {214--233},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2983990.2984021},
doi = {10.1145/2983990.2984021},
timestamp = {Wed, 23 Jun 2021 15:34:31 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/MooreDFFC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/NobleBBHM16,
author = {James Noble and
Andrew P. Black and
Kim B. Bruce and
Michael Homer and
Mark S. Miller},
editor = {Eelco Visser and
Emerson R. Murphy{-}Hill and
Cristina V. Lopes},
title = {The left hand of equals},
booktitle = {2016 {ACM} International Symposium on New Ideas, New Paradigms, and
Reflections on Programming and Software, Onward! 2016, Amsterdam,
The Netherlands, November 2-4, 2016},
pages = {224--237},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2986012.2986031},
doi = {10.1145/2986012.2986031},
timestamp = {Tue, 27 Dec 2022 12:44:40 +0100},
biburl = {https://dblp.org/rec/conf/oopsla/NobleBBHM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scsc/SmithLMZPSCGFBC16,
author = {Robert J. Smith? and
Bruce Y. Lee and
Aristides Moustakas and
Andreas Zeigler and
M{\'{e}}lanie Prague and
Romualdo Santos and
Matthias Chung and
Robin Gras and
Valery Forbes and
Sixten Borg and
Tracy Comans and
Yifei Ma and
Nieko Punt and
William Jusko and
Lucas Brotz and
Ayaz Hyder},
editor = {Floriano De Rango and
Jos{\'{e}} Luis Risco{-}Mart{\'{\i}}n},
title = {Population modelling by examples ii},
booktitle = {Proceedings of the Summer Computer Simulation Conference, SummerSim
2016, Montreal, QC, Canada, July 24-27, 2016},
pages = {51},
publisher = {Society for Computer Simulation International / {ACM} {DL}},
year = {2016},
url = {http://dl.acm.org/citation.cfm?id=3015625},
timestamp = {Wed, 22 Nov 2017 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/scsc/SmithLMZPSCGFBC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sle/Findler16,
author = {Robby Bruce Findler},
editor = {Tijs van der Storm and
Emilie Balland and
D{\'{a}}niel Varr{\'{o}}},
title = {Redex: a language for lightweight semantics engineering (keynote)},
booktitle = {Proceedings of the 2016 {ACM} {SIGPLAN} International Conference on
Software Language Engineering, Amsterdam, The Netherlands, October
31 - November 1, 2016},
pages = {1},
publisher = {{ACM}},
year = {2016},
url = {http://dl.acm.org/citation.cfm?id=2998391},
timestamp = {Tue, 06 Nov 2018 11:07:20 +0100},
biburl = {https://dblp.org/rec/conf/sle/Findler16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/3dui/2016,
editor = {Bruce H. Thomas and
Rob Lindeman and
Maud Marchal},
title = {2016 {IEEE} Symposium on 3D User Interfaces, 3DUI 2016, Greenville,
SC, USA, March 19-20, 2016},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://ieeexplore.ieee.org/xpl/conhome/7454633/proceeding},
isbn = {978-1-5090-0842-1},
timestamp = {Thu, 08 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/3dui/2016.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/BlackBN16,
author = {Andrew P. Black and
Kim B. Bruce and
James Noble},
title = {The Essence of Inheritance},
journal = {CoRR},
volume = {abs/1601.02059},
year = {2016},
url = {http://arxiv.org/abs/1601.02059},
eprinttype = {arXiv},
eprint = {1601.02059},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/BlackBN16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/XueBBRBBLSDGG16,
author = {Yexiang Xue and
Junwen Bai and
Ronan Le Bras and
Brendan Rappazzo and
Richard Bernstein and
Johan Bjorck and
Liane Longpre and
Santosh K. Suram and
Robert Bruce van Dover and
John M. Gregoire and
Carla P. Gomes},
title = {Phase-Mapper: An {AI} Platform to Accelerate High Throughput Materials
Discovery},
journal = {CoRR},
volume = {abs/1610.00689},
year = {2016},
url = {http://arxiv.org/abs/1610.00689},
eprinttype = {arXiv},
eprint = {1610.00689},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/XueBBRBBLSDGG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ascom/HanischBLBEMP15,
author = {Robert J. Hanisch and
G. Bruce Berriman and
T. Joseph L. W. Lazio and
S. Emery Bunn and
Janet D. Evans and
Tom McGlynn and
Raymond Plante},
title = {The Virtual Astronomical Observatory: Re-engineering access to astronomical
data},
journal = {Astron. Comput.},
volume = {11},
pages = {190--209},
year = {2015},
url = {https://doi.org/10.1016/j.ascom.2015.03.007},
doi = {10.1016/J.ASCOM.2015.03.007},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ascom/HanischBLBEMP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/SethiJSCRLARDBFDCSO15,
author = {Mansi Sethi and
Shreyas S. Joshi and
Martin Striz and
Neil Cole and
Jennifer Ryan and
Michael E. Lhamon and
Anuj Agarwal and
Stacey J. Sukoff Rizzo and
James M. Denegre and
Robert E. Braun and
David W. Fardo and
Kevin D. Donohue and
Elissa J. Chesler and
Karen L. Svenson and
Bruce F. O'Hara},
title = {Analysis of sleep traits in knockout mice from the large-scale {KOMP2}
population using a non-invasive, high-throughput piezoelectric system},
journal = {{BMC} Bioinform.},
volume = {16},
number = {{S15}},
pages = {P15},
year = {2015},
url = {https://doi.org/10.1186/1471-2105-16-s15-p15},
doi = {10.1186/1471-2105-16-S15-P15},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/SethiJSCRLARDBFDCSO15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gpb/ColangeloSCSCGL15,
author = {Christopher M. Colangelo and
Mark A. Shifman and
Kei{-}Hoi Cheung and
Kathryn L. Stone and
Nicholas Carriero and
Erol E. Gulcicek and
TuKiet T. Lam and
Terence Wu and
Robert D. Bjornson and
Can Bruce and
Angus C. Nairn and
Jesse Rinehart and
Perry L. Miller and
Kenneth R. Williams},
title = {{YPED:} An Integrated Bioinformatics Suite and Database for Mass Spectrometry-based
Proteomics Research},
journal = {Genom. Proteom. Bioinform.},
volume = {13},
number = {1},
pages = {25--35},
year = {2015},
url = {https://doi.org/10.1016/j.gpb.2014.11.002},
doi = {10.1016/J.GPB.2014.11.002},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/gpb/ColangeloSCSCGL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/DekarskeZCGC15,
author = {Brian M. Dekarske and
Christopher R. Zimmerman and
Robert Chang and
Paul J. Grant and
Bruce W. Chaffee},
title = {Increased appropriateness of customized alert acknowledgement reasons
for overridden medication alerts in a computerized provider order
entry system},
journal = {Int. J. Medical Informatics},
volume = {84},
number = {12},
pages = {1085--1093},
year = {2015},
url = {https://doi.org/10.1016/j.ijmedinf.2015.09.001},
doi = {10.1016/J.IJMEDINF.2015.09.001},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijmi/DekarskeZCGC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/KawamotoMWTPHSB15,
author = {Kensaku Kawamoto and
Cary J. Martin and
Kip Williams and
Ming{-}Chieh Tu and
Charlton G. Park and
Cheri Hunter and
Catherine J. Staes and
Bruce E. Bray and
Vikrant G. Deshmukh and
Reid A. Holbrook and
Scott J. Morris and
Matthew B. Fedderson and
Amy Sletta and
James Turnbull and
Sean J. Mulvihill and
Gordon L. Crabtree and
David E. Entwistle and
Quinn L. McKenna and
Michael B. Strong and
Robert C. Pendleton and
Vivian S. Lee},
title = {Value Driven Outcomes {(VDO):} a pragmatic, modular, and extensible
software framework for understanding and improving health care costs
and outcomes},
journal = {J. Am. Medical Informatics Assoc.},
volume = {22},
number = {1},
pages = {223--235},
year = {2015},
url = {https://doi.org/10.1136/amiajnl-2013-002511},
doi = {10.1136/AMIAJNL-2013-002511},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/KawamotoMWTPHSB15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/SoritaBMTAC15,
author = {Atsushi Sorita and
J. Martijn Bos and
Bruce W. Morlan and
Robert F. Tarrell and
Michael J. Ackerman and
Pedro J. Caraballo},
title = {Impact of clinical decision support preventing the use of QT-prolonging
medications for patients at risk for torsade de pointes},
journal = {J. Am. Medical Informatics Assoc.},
volume = {22},
number = {e1},
pages = {e21--e27},
year = {2015},
url = {https://doi.org/10.1136/amiajnl-2014-002896},
doi = {10.1136/AMIAJNL-2014-002896},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/SoritaBMTAC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/juq/MahmoodWP15,
author = {Asif Mahmood and
Robert L. Wolpert and
E. Bruce Pitman},
title = {A Physics-Based Emulator for the Simulation of Geophysical Mass Flows},
journal = {{SIAM/ASA} J. Uncertain. Quantification},
volume = {3},
number = {1},
pages = {562--585},
year = {2015},
url = {https://doi.org/10.1137/130909445},
doi = {10.1137/130909445},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/juq/MahmoodWP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/StikovCSLFNNHBD15,
author = {Nikola Stikov and
Jennifer S. W. Campbell and
Thomas Stroh and
Mariette Lavel{\'{e}}e and
Stephen Frey and
Jennifer Novek and
Stephen Nuara and
Ming{-}Kai Ho and
Barry J. Bedell and
Robert F. Dougherty and
Ilana R. Leppert and
Mathieu Boudreau and
Sridar Narayanan and
Tanguy Duval and
Julien Cohen{-}Adad and
Paul{-}Alexandre Picard and
Alicja Gasecka and
Daniel C{\^{o}}t{\'{e}} and
G. Bruce Pike},
title = {In vivo histology of the myelin g-ratio with magnetic resonance imaging},
journal = {NeuroImage},
volume = {118},
pages = {397--405},
year = {2015},
url = {https://doi.org/10.1016/j.neuroimage.2015.05.023},
doi = {10.1016/J.NEUROIMAGE.2015.05.023},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/StikovCSLFNNHBD15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/ReussRG15,
author = {Robert H. Reuss and
Gregory B. Raupp and
Bruce E. Gnade},
title = {Special issue on advanced flexible electronics for sensing applications
[Scanning the Issue]},
journal = {Proc. {IEEE}},
volume = {103},
number = {4},
pages = {491--496},
year = {2015},
url = {https://doi.org/10.1109/JPROC.2015.2414486},
doi = {10.1109/JPROC.2015.2414486},
timestamp = {Fri, 02 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pieee/ReussRG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigops/ChildersJM15,
author = {Bruce R. Childers and
Alex K. Jones and
Daniel Moss{\'{e}}},
title = {A Roadmap and Plan of Action for Community-Supported Empirical Evaluation
in Computer Architecture},
journal = {{ACM} {SIGOPS} Oper. Syst. Rev.},
volume = {49},
number = {1},
pages = {108--117},
year = {2015},
url = {https://doi.org/10.1145/2723872.2723886},
doi = {10.1145/2723872.2723886},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigops/ChildersJM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/BasuGNMZMMVDDCY15,
author = {Saikat Basu and
Sangram Ganguly and
Ramakrishna R. Nemani and
Supratik Mukhopadhyay and
Gong Zhang and
Cristina Milesi and
Andrew R. Michaelis and
Petr Votava and
Ralph Dubayah and
Laura Duncanson and
Bruce D. Cook and
Yifan Yu and
Sassan Saatchi and
Robert DiBiano and
Manohar Karki and
Edward Boyda and
Uttam Kumar and
Shuang Li},
title = {A Semiautomated Probabilistic Framework for Tree-Cover Delineation
From 1-m {NAIP} Imagery Using a High-Performance Computing Architecture},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {53},
number = {10},
pages = {5690--5708},
year = {2015},
url = {https://doi.org/10.1109/TGRS.2015.2428197},
doi = {10.1109/TGRS.2015.2428197},
timestamp = {Fri, 21 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/BasuGNMZMMVDDCY15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ErmonBSGGSD15,
author = {Stefano Ermon and
Ronan Le Bras and
Santosh K. Suram and
John M. Gregoire and
Carla P. Gomes and
Bart Selman and
Robert Bruce van Dover},
editor = {Blai Bonet and
Sven Koenig},
title = {Pattern Decomposition with Complex Combinatorial Constraints: Application
to Materials Discovery},
booktitle = {Proceedings of the Twenty-Ninth {AAAI} Conference on Artificial Intelligence,
January 25-30, 2015, Austin, Texas, {USA}},
pages = {636--643},
publisher = {{AAAI} Press},
year = {2015},
url = {https://doi.org/10.1609/aaai.v29i1.9233},
doi = {10.1609/AAAI.V29I1.9233},
timestamp = {Mon, 18 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/ErmonBSGGSD15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aied/KumarCMR15,
author = {Rohit Kumar and
Gregory K. W. K. Chung and
Ayesha Madni and
R. Bruce Roberts},
editor = {Cristina Conati and
Neil T. Heffernan and
Antonija Mitrovic and
M. Felisa Verdejo},
title = {First Evaluation of the Physics Instantiation of a Problem-Solving-Based
Online Learning Platform},
booktitle = {Artificial Intelligence in Education - 17th International Conference,
{AIED} 2015, Madrid, Spain, June 22-26, 2015. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9112},
pages = {686--689},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-19773-9\_92},
doi = {10.1007/978-3-319-19773-9\_92},
timestamp = {Thu, 23 Jun 2022 19:58:27 +0200},
biburl = {https://dblp.org/rec/conf/aied/KumarCMR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atal/ShapiroTMLRSMFD15,
author = {Daniel G. Shapiro and
Karen Tanenbaum and
Joshua McCoy and
Larry LeBron and
Craig W. Reynolds and
Andrew Stern and
Michael Mateas and
Bill Ferguson and
David Diller and
Kerry Moffitt and
Will Coon and
Bruce Roberts},
editor = {Gerhard Weiss and
Pinar Yolum and
Rafael H. Bordini and
Edith Elkind},
title = {Composing Social Interactions via Social Games},
booktitle = {Proceedings of the 2015 International Conference on Autonomous Agents
and Multiagent Systems, {AAMAS} 2015, Istanbul, Turkey, May 4-8, 2015},
pages = {573--580},
publisher = {{ACM}},
year = {2015},
url = {http://dl.acm.org/citation.cfm?id=2772952},
timestamp = {Tue, 08 Mar 2022 10:12:47 +0100},
biburl = {https://dblp.org/rec/conf/atal/ShapiroTMLRSMFD15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cf/BockCMM15,
author = {Santiago Bock and
Bruce R. Childers and
Rami G. Melhem and
Daniel Moss{\'{e}}},
editor = {Claudia Di Napoli and
Valentina Salapura and
Hubertus Franke and
Rui Hou},
title = {Understanding the limiting factors of page migration in hybrid main
memory},
booktitle = {Proceedings of the 12th {ACM} International Conference on Computing
Frontiers, CF'15, Ischia, Italy, May 18-21, 2015},
pages = {45:1--45:2},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2742854.2742901},
doi = {10.1145/2742854.2742901},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cf/BockCMM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cf/RahmanC15,
author = {Musfiq Rahman and
Bruce R. Childers},
editor = {Claudia Di Napoli and
Valentina Salapura and
Hubertus Franke and
Rui Hou},
title = {Asteroid: scalable online memory diagnostics},
booktitle = {Proceedings of the 12th {ACM} International Conference on Computing
Frontiers, CF'15, Ischia, Italy, May 18-21, 2015},
pages = {15:1--15:8},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2742854.2742861},
doi = {10.1145/2742854.2742861},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cf/RahmanC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/ZhangZCY15,
author = {XianWei Zhang and
Youtao Zhang and
Bruce R. Childers and
Jun Yang},
editor = {Wolfgang Nebel and
David Atienza},
title = {Exploiting {DRAM} restore time variations in deep sub-micron scaling},
booktitle = {Proceedings of the 2015 Design, Automation {\&} Test in Europe
Conference {\&} Exhibition, {DATE} 2015, Grenoble, France, March
9-13, 2015},
pages = {477--482},
publisher = {{ACM}},
year = {2015},
url = {http://dl.acm.org/citation.cfm?id=2755862},
timestamp = {Mon, 09 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/date/ZhangZCY15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/TakikawaFDFFTF15,
author = {Asumu Takikawa and
Daniel Feltey and
Earl Dean and
Matthew Flatt and
Robert Bruce Findler and
Sam Tobin{-}Hochstadt and
Matthias Felleisen},
editor = {John Tang Boyland},
title = {Towards Practical Gradual Typing},
booktitle = {29th European Conference on Object-Oriented Programming, {ECOOP} 2015,
July 5-10, 2015, Prague, Czech Republic},
series = {LIPIcs},
volume = {37},
pages = {4--27},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2015},
url = {https://doi.org/10.4230/LIPIcs.ECOOP.2015.4},
doi = {10.4230/LIPICS.ECOOP.2015.4},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ecoop/TakikawaFDFFTF15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esop/FetscherCPHF15,
author = {Burke Fetscher and
Koen Claessen and
Michal H. Palka and
John Hughes and
Robert Bruce Findler},
editor = {Jan Vitek},
title = {Making Random Judgments: Automatically Generating Well-Typed Terms
from the Definition of a Type-System},
booktitle = {Programming Languages and Systems - 24th European Symposium on Programming,
{ESOP} 2015, Held as Part of the European Joint Conferences on Theory
and Practice of Software, {ETAPS} 2015, London, UK, April 11-18, 2015.
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9032},
pages = {383--405},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-662-46669-8\_16},
doi = {10.1007/978-3-662-46669-8\_16},
timestamp = {Wed, 02 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esop/FetscherCPHF15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fgr/BeveridgeZDFFHK15,
author = {J. Ross Beveridge and
Hao Zhang and
Bruce A. Draper and
Patrick J. Flynn and
Zhenhua Feng and
Patrik Huber and
Josef Kittler and
Zhiwu Huang and
Shaoxin Li and
Yan Li and
Meina Kan and
Ruiping Wang and
Shiguang Shan and
Xilin Chen and
Haoxiang Li and
Gang Hua and
Vitomir Struc and
Janez Krizaj and
Changxing Ding and
Dacheng Tao and
P. Jonathon Phillips},
title = {Report on the {FG} 2015 Video Person Recognition Evaluation},
booktitle = {11th {IEEE} International Conference and Workshops on Automatic Face
and Gesture Recognition, {FG} 2015, Ljubljana, Slovenia, May 4-8,
2015},
pages = {1--8},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/FG.2015.7163156},
doi = {10.1109/FG.2015.7163156},
timestamp = {Fri, 06 Dec 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fgr/BeveridgeZDFFHK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gpce/FlorenceFFTKWNY15,
author = {Spencer P. Florence and
Burke Fetscher and
Matthew Flatt and
William H. Temps and
Tina Kiguradze and
Dennis P. West and
Charlotte Niznik and
Paul R. Yarnold and
Robert Bruce Findler and
Steven M. Belknap},
editor = {Christian K{\"{a}}stner and
Aniruddha S. Gokhale},
title = {{POP-PL:} a patient-oriented prescription programming language},
booktitle = {Proceedings of the 2015 {ACM} {SIGPLAN} International Conference on
Generative Programming: Concepts and Experiences, {GPCE} 2015, Pittsburgh,
PA, USA, October 26-27, 2015},
pages = {131--140},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2814204.2814221},
doi = {10.1145/2814204.2814221},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gpce/FlorenceFFTKWNY15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/DuZCMM15,
author = {Yu Du and
Miao Zhou and
Bruce R. Childers and
Daniel Moss{\'{e}} and
Rami G. Melhem},
title = {Supporting superpages in non-contiguous physical memory},
booktitle = {21st {IEEE} International Symposium on High Performance Computer Architecture,
{HPCA} 2015, Burlingame, CA, USA, February 7-11, 2015},
pages = {223--234},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/HPCA.2015.7056035},
doi = {10.1109/HPCA.2015.7056035},
timestamp = {Thu, 14 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpca/DuZCMM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpcc/MooreCX15,
author = {Ryan W. Moore and
Bruce R. Childers and
Jingling Xue},
title = {Performance Modeling of Multithreaded Programs for Mobile Asymmetric
Chip Multiprocessors},
booktitle = {17th {IEEE} International Conference on High Performance Computing
and Communications, {HPCC} 2015, 7th {IEEE} International Symposium
on Cyberspace Safety and Security, {CSS} 2015, and 12th {IEEE} International
Conference on Embedded Software and Systems, {ICESS} 2015, New York,
NY, USA, August 24-26, 2015},
pages = {957--963},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/HPCC-CSS-ICESS.2015.151},
doi = {10.1109/HPCC-CSS-ICESS.2015.151},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hpcc/MooreCX15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icbo/CheethamGGHS15,
author = {Edward Cheetham and
Yongsheng Gao and
Bruce Goldberg and
Robert R. Hausam and
Stefan Schulz},
editor = {Francisco M. Couto and
Janna Hastings},
title = {Formal representation of disorder associations in {SNOMED} {CT}},
booktitle = {Proceedings of the International Conference on Biomedical Ontology,
{ICBO} 2015, Lisbon, Portugal, July 27-30, 2015},
series = {{CEUR} Workshop Proceedings},
volume = {1515},
publisher = {CEUR-WS.org},
year = {2015},
url = {https://ceur-ws.org/Vol-1515/regular6.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:24 +0100},
biburl = {https://dblp.org/rec/conf/icbo/CheethamGGHS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/BruzzonePABBCCG15,
author = {Lorenzo Bruzzone and
Jeffrey J. Plaut and
Giovanni Alberti and
Donald D. Blankenship and
Francesca Bovolo and
Bruce A. Campbell and
Davide Castelletti and
Yonggyu Gim and
Ana{-}Maria Ilisei and
Wlodek Kofman and
Goro Komatsu and
William McKinnon and
Giuseppe Mitri and
Alina Moussessian and
Claudia Notarnicola and
Roberto Orosei and
G. Wesley Patterson and
Elena Pettinelli and
Dirk Plettemeier},
title = {Jupiter {ICY} moon explorer {(JUICE):} Advances in the design of the
radar for Icy Moons {(RIME)}},
booktitle = {2015 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2015, Milan, Italy, July 26-31, 2015},
pages = {1257--1260},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/IGARSS.2015.7326002},
doi = {10.1109/IGARSS.2015.7326002},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/BruzzonePABBCCG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscram/SodenPCDASGLJD15,
author = {Robert Soden and
Leysia Palen and
Claire Chase and
Derya Deniz and
Erin Arneson and
Leah Sprain and
Bruce Evan Goldstein and
Abbie Liel and
Amy Javernick{-}Will and
Shideh Dashti},
editor = {Leysia Palen and
Monika B{\"{u}}scher and
Tina Comes and
Amanda Lee Hughes},
title = {The Polyvocality of Resilience: Discovering a Research Agenda through
Interdisciplinary Investigation {\&} Community Engagement},
booktitle = {12th Proceedings of the International Conference on Information Systems
for Crisis Response and Management, Krystiansand, Norway, May 24-27,
2015},
publisher = {{ISCRAM} Association},
year = {2015},
url = {http://idl.iscram.org/files/robertsoden/2015/1268\_RobertSoden\_etal2015.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iscram/SodenPCDASGLJD15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/DuttonGPHRGH15,
author = {Neale A. W. Dutton and
Salvatore Gnecchi and
Luca Parmesan and
Andrew J. Holmes and
Bruce Rae and
Lindsay A. Grant and
Robert K. Henderson},
title = {11.5 {A} time-correlated single-photon-counting sensor with 14GS/S
histogramming time-to-digital converter},
booktitle = {2015 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2015, Digest of Technical Papers, San Francisco, CA, USA, February
22-26, 2015},
pages = {1--3},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ISSCC.2015.7062997},
doi = {10.1109/ISSCC.2015.7062997},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/DuttonGPHRGH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mascots/BockCMM15,
author = {Santiago Bock and
Bruce R. Childers and
Rami G. Melhem and
Daniel Moss{\'{e}}},
title = {Characterizing the Overhead of Software-Managed Hybrid Main Memory},
booktitle = {23rd {IEEE} International Symposium on Modeling, Analysis, and Simulation
of Computer and Telecommunication Systems, {MASCOTS} 2015, Atlanta,
GA, USA, October 5-7, 2015},
pages = {33--42},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/MASCOTS.2015.20},
doi = {10.1109/MASCOTS.2015.20},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mascots/BockCMM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/memsys/ChildersYZ15,
author = {Bruce R. Childers and
Jun Yang and
Youtao Zhang},
editor = {Bruce L. Jacob},
title = {Achieving Yield, Density and Performance Effective {DRAM} at Extreme
Technology Sizes},
booktitle = {Proceedings of the 2015 International Symposium on Memory Systems,
{MEMSYS} 2015, Washington DC, DC, USA, October 5-8, 2015},
pages = {78--84},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2818950.2818963},
doi = {10.1145/2818950.2818963},
timestamp = {Fri, 13 Nov 2020 09:24:44 +0100},
biburl = {https://dblp.org/rec/conf/memsys/ChildersYZ15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/memsys/KocoloskiZCL15,
author = {Brian Kocoloski and
Yuyu Zhou and
Bruce R. Childers and
John R. Lange},
editor = {Bruce L. Jacob},
title = {Implications of Memory Interference for Composed {HPC} Applications},
booktitle = {Proceedings of the 2015 International Symposium on Memory Systems,
{MEMSYS} 2015, Washington DC, DC, USA, October 5-8, 2015},
pages = {95--97},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2818950.2818965},
doi = {10.1145/2818950.2818965},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/memsys/KocoloskiZCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nvmsa/BockCMM15,
author = {Santiago Bock and
Bruce R. Childers and
Rami G. Melhem and
Daniel Moss{\'{e}}},
title = {HMMSim: a simulator for hardware-software co-design of hybrid main
memory},
booktitle = {{IEEE} Non-Volatile Memory System and Applications Symposium, {NVMSA}
2015, Hong Kong, China, August 19-21, 2015},
pages = {1--6},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/NVMSA.2015.7304374},
doi = {10.1109/NVMSA.2015.7304374},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/nvmsa/BockCMM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nvmsa/MafricaJBPCCL15,
author = {Chelsea Mafrica and
John Johnson and
Santiago Bock and
Thao N. Pham and
Bruce R. Childers and
Panos K. Chrysanthis and
Alexandros Labrinidis},
title = {Stream query processing on emerging memory architectures},
booktitle = {{IEEE} Non-Volatile Memory System and Applications Symposium, {NVMSA}
2015, Hong Kong, China, August 19-21, 2015},
pages = {1--6},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/NVMSA.2015.7304367},
doi = {10.1109/NVMSA.2015.7304367},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nvmsa/MafricaJBPCCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/BarwiczTTBJTKEN15,
author = {Tymon Barwicz and
Yoichi Taira and
Shotaro Takenobu and
Nicolas Boyer and
Alexander Janta{-}Polczynski and
Yan Thibodeau and
Swetha Kamlapurkar and
Sebastian Engelmann and
Hidetoshi Numata and
Robert L. Bruce and
Simon Laflamme and
Paul Fortier and
Yurii A. Vlasov},
title = {Optical demonstration of a compliant polymer interface between standard
fibers and nanophotonic waveguides},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2015,
Los Angeles, CA, USA, March 22-26, 2015},
pages = {1--3},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1364/OFC.2015.Th3F.5},
doi = {10.1364/OFC.2015.TH3F.5},
timestamp = {Mon, 09 Aug 2021 14:54:04 +0200},
biburl = {https://dblp.org/rec/conf/ofc/BarwiczTTBJTKEN15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/snapl/FelleisenFFKBMT15,
author = {Matthias Felleisen and
Robert Bruce Findler and
Matthew Flatt and
Shriram Krishnamurthi and
Eli Barzilay and
Jay A. McCarthy and
Sam Tobin{-}Hochstadt},
editor = {Thomas Ball and
Rastislav Bod{\'{\i}}k and
Shriram Krishnamurthi and
Benjamin S. Lerner and
Greg Morrisett},
title = {The Racket Manifesto},
booktitle = {1st Summit on Advances in Programming Languages, {SNAPL} 2015, May
3-6, 2015, Asilomar, California, {USA}},
series = {LIPIcs},
volume = {32},
pages = {113--128},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2015},
url = {https://doi.org/10.4230/LIPIcs.SNAPL.2015.113},
doi = {10.4230/LIPICS.SNAPL.2015.113},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/snapl/FelleisenFFKBMT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/3dui/2015,
editor = {Rob Lindeman and
Frank Steinicke and
Bruce H. Thomas},
title = {2015 {IEEE} Symposium on 3D User Interfaces, 3DUI 2015, Arles, France,
March 23-24, 2015},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://ieeexplore.ieee.org/xpl/conhome/7114633/proceeding},
isbn = {978-1-4673-6886-5},
timestamp = {Thu, 08 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/3dui/2015.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/AllenBDMNRSSTTW15,
author = {Alice Allen and
G. Bruce Berriman and
Kimberly DuPrie and
Jessica Mink and
Robert J. Nemiroff and
Thomas Robitaille and
Lior Shamir and
Keith Shortridge and
Mark B. Taylor and
Peter J. Teuben and
John F. Wallin},
title = {Improving Software Citation and Credit},
journal = {CoRR},
volume = {abs/1512.07919},
year = {2015},
url = {http://arxiv.org/abs/1512.07919},
eprinttype = {arXiv},
eprint = {1512.07919},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/AllenBDMNRSSTTW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/BibakKSTT15,
author = {Khodakhast Bibak and
Bruce M. Kapron and
Srinivasan Venkatesh and
Roberto Tauraso and
L{\'{a}}szl{\'{o}} T{\'{o}}th},
title = {Restricted linear congruences and an authenticated encryption scheme},
journal = {CoRR},
volume = {abs/1503.01806},
year = {2015},
url = {http://arxiv.org/abs/1503.01806},
eprinttype = {arXiv},
eprint = {1503.01806},
timestamp = {Fri, 14 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/BibakKSTT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dagstuhl-reports/ChildersFKZ15,
author = {Bruce R. Childers and
Grigori Fursin and
Shriram Krishnamurthi and
Andreas Zeller},
title = {Artifact Evaluation for Publications (Dagstuhl Perspectives Workshop
15452)},
journal = {Dagstuhl Reports},
volume = {5},
number = {11},
pages = {29--35},
year = {2015},
url = {https://doi.org/10.4230/DagRep.5.11.29},
doi = {10.4230/DAGREP.5.11.29},
timestamp = {Wed, 07 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dagstuhl-reports/ChildersFKZ15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/f1000research/CokelaerBBBBNEGHHKKMMNPPW15,
author = {Thomas Cokelaer and
Mukesh Bansal and
Christopher Bare and
Erhan Bilal and
Brian M. Bot and
Elias Chaibub Neto and
Federica Eduati and
Mehmet G{\"{o}}nen and
Steven M. Hill and
Bruce R. Hoff and
Jonathan R. Karr and
Robert K{\"{u}}ffner and
Michael P. Menden and
Pablo Meyer and
Raquel Norel and
Abhishek Pratap and
Robert J. Prill and
Matthew T. Weirauch and
James C. Costello and
Gustavo Stolovitzky and
Julio Saez{-}Rodriguez},
title = {DREAMTools: a Python package for scoring collaborative challenges},
journal = {F1000Research},
volume = {4},
pages = {1030},
year = {2015},
url = {https://doi.org/10.12688/f1000research.7118.1},
doi = {10.12688/F1000RESEARCH.7118.1},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/f1000research/CokelaerBBBBNEGHHKKMMNPPW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/BibakK0TT15,
author = {Khodakhast Bibak and
Bruce M. Kapron and
S. Venkatesh and
Roberto Tauraso and
L{\'{a}}szl{\'{o}} T{\'{o}}th},
title = {Restricted linear congruences},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {1186},
year = {2015},
url = {http://eprint.iacr.org/2015/1186},
timestamp = {Fri, 14 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/BibakK0TT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/brain/FanNWZKCPTDBWRW14,
author = {Qiuyun Fan and
Aapo Nummenmaa and
Thomas Witzel and
Roberta Zanzonico and
Boris Keil and
Stephen F. Cauley and
Jonathan R. Polimeni and
M. Dylan Tisdall and
Koene R. A. Van Dijk and
Randy L. Buckner and
Van J. Wedeen and
Bruce R. Rosen and
Lawrence L. Wald},
title = {Investigating the Capability to Resolve Complex White Matter Structures
with High \emph{b}-Value Diffusion Magnetic Resonance Imaging on the
{MGH-USC} Connectom Scanner},
journal = {Brain Connect.},
volume = {4},
number = {9},
pages = {718--726},
year = {2014},
url = {https://doi.org/10.1089/brain.2014.0305},
doi = {10.1089/BRAIN.2014.0305},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/brain/FanNWZKCPTDBWRW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cais/JohnstonR14,
author = {Robert Bruce Johnston and
Kai Riemer},
title = {On Putting the Score ahead of the Game},
journal = {Commun. Assoc. Inf. Syst.},
volume = {34},
pages = {47},
year = {2014},
url = {https://doi.org/10.17705/1cais.03447},
doi = {10.17705/1CAIS.03447},
timestamp = {Wed, 15 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cais/JohnstonR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejis/RiemerJ14,
author = {Kai Riemer and
Robert Bruce Johnston},
title = {Rethinking the place of the artefact in {IS} using Heidegger's analysis
of equipment},
journal = {Eur. J. Inf. Syst.},
volume = {23},
number = {3},
pages = {273--288},
year = {2014},
url = {https://doi.org/10.1057/ejis.2013.5},
doi = {10.1057/EJIS.2013.5},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ejis/RiemerJ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijec/ReinigM14,
author = {Bruce A. Reinig and
Roberto J. Mejias},
title = {On the Measurement of Participation Equality},
journal = {Int. J. e Collab.},
volume = {10},
number = {4},
pages = {32--48},
year = {2014},
url = {https://doi.org/10.4018/ijec.2014100103},
doi = {10.4018/IJEC.2014100103},
timestamp = {Thu, 20 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijec/ReinigM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpca/DubeyACDFGLLORRRRRSTWTVZ14,
author = {Anshu Dubey and
Katie Antypas and
Alan C. Calder and
Christopher S. Daley and
Bruce Fryxell and
Brad Gallagher and
Donald Q. Lamb and
Dongwook Lee and
Kevin Olson and
Lynn B. Reid and
Paul M. Rich and
Paul M. Ricker and
Katherine Riley and
Robert Rosner and
Andrew R. Siegel and
Noel T. Taylor and
Klaus Weide and
Francis X. Timmes and
Natasha Vladimirova and
John ZuHone},
title = {Evolution of FLASH, a multi-physics scientific simulation code for
high-performance computing},
journal = {Int. J. High Perform. Comput. Appl.},
volume = {28},
number = {2},
pages = {225--237},
year = {2014},
url = {https://doi.org/10.1177/1094342013505656},
doi = {10.1177/1094342013505656},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhpca/DubeyACDFGLLORRRRRSTWTVZ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfp/SinghF14,
author = {Satnam Singh and
Robert Bruce Findler},
title = {Special Issue Dedicated to {ICFP} 2012: Editorial},
journal = {J. Funct. Program.},
volume = {24},
number = {2-3},
pages = {131--132},
year = {2014},
url = {https://doi.org/10.1017/S0956796814000124},
doi = {10.1017/S0956796814000124},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfp/SinghF14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/juq/SpillerBBCPPW14,
author = {Elaine T. Spiller and
Maria J. Bayarri and
James O. Berger and
Eliza S. Calder and
Abani K. Patra and
E. Bruce Pitman and
Robert L. Wolpert},
title = {Automating Emulator Construction for Geophysical Hazard Maps},
journal = {{SIAM/ASA} J. Uncertain. Quantification},
volume = {2},
number = {1},
pages = {126--152},
year = {2014},
url = {https://doi.org/10.1137/120899285},
doi = {10.1137/120899285},
timestamp = {Tue, 06 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/juq/SpillerBBCPPW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/OverbeekOPODDEGPSVWXS14,
author = {Ross A. Overbeek and
Robert Olson and
Gordon D. Pusch and
Gary J. Olsen and
James J. Davis and
Terry Disz and
Robert A. Edwards and
Svetlana Gerdes and
Bruce D. Parrello and
Maulik Shukla and
Veronika Vonstein and
Alice R. Wattam and
Fangfang Xia and
Rick Stevens},
title = {The {SEED} and the Rapid Annotation of microbial genomes using Subsystems
Technology {(RAST)}},
journal = {Nucleic Acids Res.},
volume = {42},
number = {Database-Issue},
pages = {206--214},
year = {2014},
url = {https://doi.org/10.1093/nar/gkt1226},
doi = {10.1093/NAR/GKT1226},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/OverbeekOPODDEGPSVWXS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ress/HansenBBBCGHHHJLLMMMPRSSSW14,
author = {Clifford W. Hansen and
Jens T. Birkholzer and
J. Blink and
C. R. Bryan and
Y. Chen and
M. B. Gross and
E. Hardin and
James E. Houseworth and
Robert L. Howard and
R. Jarek and
K. P. Lee and
B. Lester and
P. Mariner and
P. D. Mattie and
S. Mehta and
F. V. Perry and
Bruce A. Robinson and
D. Sassani and
S. David Sevougian and
Joshua S. Stein and
M. Wasiolek},
title = {Overview of total system model used for the 2008 performance assessment
for the proposed high-level radioactive waste repository at Yucca
Mountain, Nevada},
journal = {Reliab. Eng. Syst. Saf.},
volume = {122},
pages = {249--266},
year = {2014},
url = {https://doi.org/10.1016/j.ress.2013.06.001},
doi = {10.1016/J.RESS.2013.06.001},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ress/HansenBBBCGHHHJLLMMMPRSSSW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ress/RechardARH14,
author = {Rob P. Rechard and
Bill W. Arnold and
Bruce A. Robinson and
James E. Houseworth},
title = {Transport modeling in performance assessments for the Yucca Mountain
disposal system for spent nuclear fuel and high-level radioactive
waste},
journal = {Reliab. Eng. Syst. Saf.},
volume = {122},
pages = {189--206},
year = {2014},
url = {https://doi.org/10.1016/j.ress.2013.06.031},
doi = {10.1016/J.RESS.2013.06.031},
timestamp = {Tue, 25 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ress/RechardARH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/RahmanCC14,
author = {Musfiq Rahman and
Bruce R. Childers and
Sangyeun Cho},
title = {COMeT+: Continuous Online Memory Testing with Multi-Threading Extension},
journal = {{IEEE} Trans. Computers},
volume = {63},
number = {7},
pages = {1668--1681},
year = {2014},
url = {https://doi.org/10.1109/TC.2013.65},
doi = {10.1109/TC.2013.65},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/RahmanCC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tjs/MooreC14,
author = {Ryan W. Moore and
Bruce R. Childers},
title = {Building and using application utility models to dynamically choose
thread counts},
journal = {J. Supercomput.},
volume = {68},
number = {3},
pages = {1184--1213},
year = {2014},
url = {https://doi.org/10.1007/s11227-014-1148-3},
doi = {10.1007/S11227-014-1148-3},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tjs/MooreC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/topc/JimenezCGBBOM14,
author = {V{\'{\i}}ctor Jim{\'{e}}nez and
Francisco J. Cazorla and
Roberto Gioiosa and
Alper Buyuktosunoglu and
Pradip Bose and
Francis P. O'Connell and
Bruce G. Mealey},
title = {Adaptive Prefetching on {POWER7:} Improving Performance and Power
Consumption},
journal = {{ACM} Trans. Parallel Comput.},
volume = {1},
number = {1},
pages = {4:1--4:25},
year = {2014},
url = {https://doi.org/10.1145/2588889},
doi = {10.1145/2588889},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/topc/JimenezCGBBOM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/BrasBGSGSD14,
author = {Ronan Le Bras and
Richard Bernstein and
John M. Gregoire and
Santosh K. Suram and
Carla P. Gomes and
Bart Selman and
R. Bruce van Dover},
editor = {Carla E. Brodley and
Peter Stone},
title = {Challenges in Materials Discovery - Synthetic Generator and Real Datasets},
booktitle = {Proceedings of the Twenty-Eighth {AAAI} Conference on Artificial Intelligence,
July 27 -31, 2014, Qu{\'{e}}bec City, Qu{\'{e}}bec, Canada},
pages = {438--443},
publisher = {{AAAI} Press},
year = {2014},
url = {https://doi.org/10.1609/aaai.v28i1.8770},
doi = {10.1609/AAAI.V28I1.8770},
timestamp = {Tue, 19 Nov 2024 15:59:16 +0100},
biburl = {https://dblp.org/rec/conf/aaai/BrasBGSGSD14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asap/HanHSBDD14,
author = {Junyi Han and
Robert Haines and
Adel Salhli and
John Martin Brooke and
Bruce D'Amora and
Bob Danani},
title = {Virtual science on the move: Interactive access to simulations on
supercomputers},
booktitle = {{IEEE} 25th International Conference on Application-Specific Systems,
Architectures and Processors, {ASAP} 2014, Zurich, Switzerland, June
18-20, 2014},
pages = {178--179},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/ASAP.2014.6868654},
doi = {10.1109/ASAP.2014.6868654},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/asap/HanHSBDD14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cf/BockCMM14,
author = {Santiago Bock and
Bruce R. Childers and
Rami G. Melhem and
Daniel Moss{\'{e}}},
editor = {Pedro Trancoso and
Diana Franklin and
Sally A. McKee},
title = {Concurrent page migration for mobile systems with OS-managed hybrid
memory},
booktitle = {Computing Frontiers Conference, CF'14, Cagliari, Italy - May 20 -
22, 2014},
pages = {31:1--31:10},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2597917.2597924},
doi = {10.1145/2597917.2597924},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cf/BockCMM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cinc/KharcheCTCJSZSZ14,
author = {Sanjay Kharche and
Simon J. Castro and
Belvin Thomas and
Michael A. Colman and
Jonathan C. Jarvis and
Bruce Smail and
Henggui Zhang and
Robert S. Stephenson and
Jichao Zhao},
title = {Role of Fiber Orientation in Atrial Arrythmogenesis},
booktitle = {Computing in Cardiology, CinC 2014, Cambridge, Massachusetts, USA,
September 7-10, 2014},
pages = {1041--1044},
publisher = {www.cinc.org},
year = {2014},
url = {http://www.cinc.org/archives/2014/pdf/1041.pdf},
timestamp = {Sun, 08 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cinc/KharcheCTCJSZSZ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/MooreC14,
author = {Ryan W. Moore and
Bruce R. Childers},
editor = {Gerhard P. Fettweis and
Wolfgang Nebel},
title = {Program affinity performance models for performance and utilization},
booktitle = {Design, Automation {\&} Test in Europe Conference {\&} Exhibition,
{DATE} 2014, Dresden, Germany, March 24-28, 2014},
pages = {1--4},
publisher = {European Design and Automation Association},
year = {2014},
url = {https://doi.org/10.7873/DATE.2014.036},
doi = {10.7873/DATE.2014.036},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/date/MooreC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/datech/RobertsonDS14,
author = {Bruce Robertson and
Christoph Dalitz and
Fabian Schmitt},
editor = {Apostolos Antonacopoulos and
Klaus U. Schulz},
title = {Automated page layout simplification of \emph{Patrologia Graeca}},
booktitle = {Digital Access to Textual Cultural Heritage 2014, DATeCH 2014, Madrid,
Spain, May 19-20, 2014},
pages = {167--172},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2595188.2595213},
doi = {10.1145/2595188.2595213},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/datech/RobertsonDS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/HomerJNBB14,
author = {Michael Homer and
Timothy Jones and
James Noble and
Kim B. Bruce and
Andrew P. Black},
editor = {Richard E. Jones},
title = {Graceful Dialects},
booktitle = {{ECOOP} 2014 - Object-Oriented Programming - 28th European Conference,
Uppsala, Sweden, July 28 - August 1, 2014. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8586},
pages = {131--156},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-662-44202-9\_6},
doi = {10.1007/978-3-662-44202-9\_6},
timestamp = {Tue, 14 May 2019 10:00:54 +0200},
biburl = {https://dblp.org/rec/conf/ecoop/HomerJNBB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edm/0001RRM14,
author = {Rohit Kumar and
Matthew E. Roy and
R. Bruce Roberts and
John Makhoul},
editor = {John C. Stamper and
Zachary A. Pardos and
Manolis Mavrikis and
Bruce M. McLaren},
title = {Comparison of Algorithms for Automatically Building Example-Tracing
Tutor Models},
booktitle = {Proceedings of the 7th International Conference on Educational Data
Mining, {EDM} 2014, London, UK, July 4-7, 2014},
pages = {217--220},
publisher = {International Educational Data Mining Society {(IEDMS)}},
year = {2014},
url = {http://www.educationaldatamining.org/EDM2014/uploads/procs2014/shortpapers/217\_EDM-2014-Short.pdf},
timestamp = {Thu, 02 Jun 2022 10:23:43 +0200},
biburl = {https://dblp.org/rec/conf/edm/0001RRM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/HalRDB14,
author = {Bryan Van Hal and
Samhita Rhodes and
Bruce E. Dunne and
Robert Bossemeyer},
title = {Low-cost EEG-based sleep detection},
booktitle = {36th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2014, Chicago, IL, USA, August
26-30, 2014},
pages = {4571--4574},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/EMBC.2014.6944641},
doi = {10.1109/EMBC.2014.6944641},
timestamp = {Wed, 25 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/embc/HalRDB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/WangJMVHKD14,
author = {Xiao Wang and
Daren C. Jackson and
Carol C. Mitchell and
Tomy Varghese and
Bruce P. Hermann and
Mark A. Kliewer and
Robert J. Dempsey},
title = {Estimation of ultrasound strain indices in carotid plaque and correlation
to cognitive dysfunction},
booktitle = {36th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2014, Chicago, IL, USA, August
26-30, 2014},
pages = {5627--5630},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/EMBC.2014.6944903},
doi = {10.1109/EMBC.2014.6944903},
timestamp = {Mon, 10 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/WangJMVHKD14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eos/FrouinSHP14,
author = {Robert Frouin and
Alain Sei and
Bruce Hauss and
Patty Pratt},
editor = {James J. Butler and
Xiaoxiong (Jack) Xiong and
Xingfa Gu},
title = {Operational in-flight calibration of {S-NPP} {VIIRS} in the visible
using Rayleigh scattering},
booktitle = {Earth Observing Systems XIX, {SPIE} Optical Engineering + Applications,
San Diego, California, USA, 17-21 August 2014},
series = {{SPIE} Proceedings},
volume = {9218},
pages = {921806},
publisher = {{SPIE}},
year = {2014},
url = {https://doi.org/10.1117/12.2069433},
doi = {10.1117/12.2069433},
timestamp = {Thu, 19 May 2022 21:17:47 +0200},
biburl = {https://dblp.org/rec/conf/eos/FrouinSHP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gree/ManicWAHHBPP14,
author = {Milos Manic and
Dumidu Wijayasekara and
Kasun Amarasinghe and
Joel D. Hewlett and
Kevin Handy and
Christopher Becker and
Bruce Patterson and
Robert Peterson},
title = {Next Generation Emergency Communication Systems via Software Defined
Networks},
booktitle = {2014 Third {GENI} Research and Educational Experiment Workshop, Atlanta,
GA, USA, March 19-20, 2014},
pages = {1--8},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/GREE.2014.26},
doi = {10.1109/GREE.2014.26},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gree/ManicWAHHBPP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/BriggsRV14,
author = {Robert O. Briggs and
Bruce A. Reinig and
Gert{-}Jan de Vreede},
title = {An Empirical Field Study of the Yield Shift Theory of Satisfaction},
booktitle = {47th Hawaii International Conference on System Sciences, {HICSS} 2014,
Waikoloa, HI, USA, January 6-9, 2014},
pages = {492--499},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/HICSS.2014.69},
doi = {10.1109/HICSS.2014.69},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/BriggsRV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icfp/Findler14,
author = {Robert Bruce Findler},
editor = {Johan Jeuring and
Manuel M. T. Chakravarty},
title = {Behavioral software contracts},
booktitle = {Proceedings of the 19th {ACM} {SIGPLAN} international conference on
Functional programming, Gothenburg, Sweden, September 1-3, 2014},
pages = {137--138},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2628136.2632855},
doi = {10.1145/2628136.2632855},
timestamp = {Thu, 24 Jun 2021 16:19:30 +0200},
biburl = {https://dblp.org/rec/conf/icfp/Findler14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isdevel/FreemanTR14,
author = {Mark B. Freeman and
Holly Tootell and
Madeleine R. H. Roberts},
editor = {Vjeran Strahonja and
Neven Vrcek and
Dijana Plantak Vukovac and
Chris Barry and
Michael Lang and
Henry Linger and
Christoph Schneider},
title = {Increasing Retention in First-Year Systems Analysis Through Student
Collaboration Using Real World Examples},
booktitle = {Information Systems Development: Transforming Organisations and Society
through Information Systems - Proceedings of the 23rd International
Conference on Information Systems Development, {ISD} 2014, Vara{\v{z}}din,
Croatia, September 2-4, 2014},
publisher = {Association for Information Systems},
year = {2014},
url = {http://aisel.aisnet.org/isd2014/proceedings/Education/6},
timestamp = {Mon, 28 Aug 2017 15:34:49 +0200},
biburl = {https://dblp.org/rec/conf/isdevel/FreemanTR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/its/KumarRRM14,
author = {Rohit Kumar and
Matthew E. Roy and
R. Bruce Roberts and
John I. Makhoul},
editor = {Stefan Trausan{-}Matu and
Kristy Elizabeth Boyer and
Martha E. Crosby and
Kitty Panourgia},
title = {Towards Automatically Building Tutor Models Using Multiple Behavior
Demonstrations},
booktitle = {Intelligent Tutoring Systems - 12th International Conference, {ITS}
2014, Honolulu, HI, USA, June 5-9, 2014. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8474},
pages = {535--544},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-07221-0\_68},
doi = {10.1007/978-3-319-07221-0\_68},
timestamp = {Wed, 25 Sep 2019 18:06:32 +0200},
biburl = {https://dblp.org/rec/conf/its/KumarRRM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbp/YohaiSMH14,
author = {Ian Yohai and
Bruce Skarin and
Robert McCormack and
Jasmine Hsu},
editor = {William G. Kennedy and
Nitin Agarwal and
Shanchieh Jay Yang},
title = {Deriving Population Assessment through Opinion Polls, Text Analytics,
and Agent-Based Modeling},
booktitle = {Social Computing, Behavioral-Cultural Modeling and Prediction - 7th
International Conference, {SBP} 2014, Washington, DC, USA, April 1-4,
2014. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8393},
pages = {187--194},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-05579-4\_23},
doi = {10.1007/978-3-319-05579-4\_23},
timestamp = {Tue, 14 May 2019 10:00:49 +0200},
biburl = {https://dblp.org/rec/conf/sbp/YohaiSMH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/cu/p/RobertsD14,
author = {Bruce Roberts and
David Diller},
editor = {Talib S. Hussain and
Susan L. Coleman},
title = {Development Methods},
booktitle = {Design and Development of Training Games: Practical Guidelines from
a Multidisciplinary Perspective},
pages = {464--475},
publisher = {Cambridge University Press},
year = {2014},
url = {https://doi.org/10.1017/CBO9781107280137.021},
doi = {10.1017/CBO9781107280137.021},
timestamp = {Tue, 16 May 2017 14:01:41 +0200},
biburl = {https://dblp.org/rec/books/cu/p/RobertsD14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/pldi/2014trust,
editor = {Grigori Fursin and
Bruce R. Childers and
Alex K. Jones and
Daniel Moss{\'{e}}},
title = {Proceedings of the 1st {ACM} {SIGPLAN} Workshop on Reproducible Research
Methodologies and New Publication Models in Computer Engineering,
{TRUST} 2014, Edinburgh, United Kingdom, June 9-11, 2014},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2618137},
doi = {10.1145/2618137},
isbn = {978-1-4503-2951-4},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pldi/2014trust.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/pppj/2014,
editor = {Joanna Kolodziej and
Bruce R. Childers},
title = {2014 International Conference on Principles and Practices of Programming
on the Java Platform Virtual Machines, Languages and Tools, {PPPJ}
'14, Cracow, Poland, September 23-26, 2014},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2647508},
doi = {10.1145/2647508},
isbn = {978-1-4503-2926-2},
timestamp = {Mon, 26 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pppj/2014.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ErmonBSGGSD14,
author = {Stefano Ermon and
Ronan Le Bras and
Santosh K. Suram and
John M. Gregoire and
Carla P. Gomes and
Bart Selman and
Robert Bruce van Dover},
title = {Pattern Decomposition with Complex Combinatorial Constraints: Application
to Materials Discovery},
journal = {CoRR},
volume = {abs/1411.7441},
year = {2014},
url = {http://arxiv.org/abs/1411.7441},
eprinttype = {arXiv},
eprint = {1411.7441},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/ErmonBSGGSD14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/HanischABDMNSSSTTW14,
author = {Robert J. Hanisch and
Alice Allen and
G. Bruce Berriman and
Kimberly DuPrie and
Jessica Mink and
Robert J. Nemiroff and
Judy Schmidt and
Lior Shamir and
Keith Shortridge and
Mark B. Taylor and
Peter J. Teuben and
John F. Wallin},
title = {Astrophysics Source Code Library Enhancements},
journal = {CoRR},
volume = {abs/1411.2031},
year = {2014},
url = {http://arxiv.org/abs/1411.2031},
eprinttype = {arXiv},
eprint = {1411.2031},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/HanischABDMNSSSTTW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/basesearch/Schmitt13,
author = {Karl Robert Bruce Schmitt},
title = {Network Algorithms for Complex Systems with Applications to Non-linear
Oscillators and Genome Assembly},
school = {University of Maryland, College Park, MD, {USA}},
year = {2013},
url = {https://hdl.handle.net/1903/14099},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/basesearch/Schmitt13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ascom/ShamirWABTN0HD13,
author = {Lior Shamir and
John F. Wallin and
Alice Allen and
G. Bruce Berriman and
Peter J. Teuben and
Robert J. Nemiroff and
Jessica Mink and
Robert J. Hanisch and
Kimberly DuPrie},
title = {Practices in source code sharing in astrophysics},
journal = {Astron. Comput.},
volume = {1},
pages = {54--58},
year = {2013},
url = {https://doi.org/10.1016/j.ascom.2013.04.001},
doi = {10.1016/J.ASCOM.2013.04.001},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ascom/ShamirWABTN0HD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmiv/RittnerCFAPL13,
author = {Let{\'{\i}}cia Rittner and
Jennifer S. W. Campbell and
Pedro Freitas and
Simone Appenzeller and
G. Bruce Pike and
Roberto A. Lotufo},
title = {Analysis of Scalar Maps for the Segmentation of the Corpus Callosum
in Diffusion Tensor Fields},
journal = {J. Math. Imaging Vis.},
volume = {45},
number = {3},
pages = {214--226},
year = {2013},
url = {https://doi.org/10.1007/s10851-012-0377-4},
doi = {10.1007/S10851-012-0377-4},
timestamp = {Tue, 24 Dec 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jmiv/RittnerCFAPL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/GalanterABKLMRTWL13,
author = {William L. Galanter and
Andrew Applebaum and
Viveka Boddipalli and
Abel N. Kho and
Michael Lin and
David O. Meltzer and
Anna Roberts and
William E. Trick and
Surrey M. Walton and
Bruce L. Lambert},
title = {Migration of Patients Between Five Urban Teaching Hospitals in Chicago},
journal = {J. Medical Syst.},
volume = {37},
number = {2},
pages = {9930},
year = {2013},
url = {https://doi.org/10.1007/s10916-013-9930-y},
doi = {10.1007/S10916-013-9930-Y},
timestamp = {Fri, 21 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jms/GalanterABKLMRTWL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/FreueMSBSLHOTLWBKBMNM13,
author = {Gabriela V. Cohen Freue and
Anna Meredith and
Derek Smith and
Axel Bergman and
Mayu Sasaki and
Karen K. Y. Lam and
Zsuzsanna Hollander and
Nina Opushneva and
Mandeep Takhar and
David Lin and
Janet Wilson{-}McManus and
Robert Balshaw and
Paul A. Keown and
Christoph H. Borchers and
Bruce McManus and
Raymond T. Ng and
W. Robert McMaster},
title = {Computational Biomarker Pipeline from Discovery to Clinical Implementation:
Plasma Proteomic Biomarkers for Cardiac Transplantation},
journal = {PLoS Comput. Biol.},
volume = {9},
number = {4},
year = {2013},
url = {https://doi.org/10.1371/journal.pcbi.1002963},
doi = {10.1371/JOURNAL.PCBI.1002963},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/FreueMSBSLHOTLWBKBMNM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigplan/FindlerF13,
author = {Robert Bruce Findler and
Matthias Felleisen},
title = {{ICFP} 2002: Contracts for higher-order functions},
journal = {{ACM} {SIGPLAN} Notices},
volume = {48},
number = {4S},
pages = {34--45},
year = {2013},
url = {https://doi.org/10.1145/2502508.2502521},
doi = {10.1145/2502508.2502521},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigplan/FindlerF13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taco/DuZCMM13,
author = {Yu Du and
Miao Zhou and
Bruce R. Childers and
Rami G. Melhem and
Daniel Moss{\'{e}}},
title = {Delta-compressed caching for overcoming the write bandwidth limitation
of hybrid main memory},
journal = {{ACM} Trans. Archit. Code Optim.},
volume = {9},
number = {4},
pages = {55:1--55:20},
year = {2013},
url = {https://doi.org/10.1145/2400682.2400714},
doi = {10.1145/2400682.2400714},
timestamp = {Thu, 14 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/taco/DuZCMM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taco/JiangDZZCY13,
author = {Lei Jiang and
Yu Du and
Bo Zhao and
Youtao Zhang and
Bruce R. Childers and
Jun Yang},
title = {Hardware-Assisted Cooperative Integration of Wear-Leveling and Salvaging
for Phase Change Memory},
journal = {{ACM} Trans. Archit. Code Optim.},
volume = {10},
number = {2},
pages = {7:1--7:25},
year = {2013},
url = {https://doi.org/10.1145/2459316.2459318},
doi = {10.1145/2459316.2459318},
timestamp = {Thu, 14 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/taco/JiangDZZCY13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/HeBBDGHHLLLNPPRWWYZ13,
author = {Bin He and
Richard Baird and
Robert J. Butera and
Aniruddha Datta and
Steven George and
Bruce Hecht and
Alfred O. Hero III and
Gianluca Lazzi and
Raphael C. Lee and
Jie Liang and
Michael R. Neuman and
Grace C. Y. Peng and
Eric J. Perreault and
Melur Ramasubramanian and
May D. Wang and
John P. Wikswo and
Guang{-}Zhong Yang and
Yuan{-}Ting Zhang},
title = {Grand Challenges in Interfacing Engineering With Life Sciences and
Medicine},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {60},
number = {3},
pages = {589--598},
year = {2013},
url = {https://doi.org/10.1109/TBME.2013.2244886},
doi = {10.1109/TBME.2013.2244886},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbe/HeBBDGHHLLLNPPRWWYZ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/AslanidiNZSGHLWSJHBZ13,
author = {Oleg V. Aslanidi and
Theodora Nikolaidou and
Jichao Zhao and
Bruce H. Smaill and
Stephen H. Gilbert and
Arun V. Holden and
Tristan Lowe and
Philip J. Withers and
Robert S. Stephenson and
Jonathan C. Jarvis and
Jules C. Hancox and
Mark R. Boyett and
Henggui Zhang},
title = {Application of Micro-Computed Tomography With Iodine Staining to Cardiac
Imaging, Segmentation, and Computational Model Development},
journal = {{IEEE} Trans. Medical Imaging},
volume = {32},
number = {1},
pages = {8--17},
year = {2013},
url = {https://doi.org/10.1109/TMI.2012.2209183},
doi = {10.1109/TMI.2012.2209183},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tmi/AslanidiNZSGHLWSJHBZ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEpact/ZhouDCMM13,
author = {Miao Zhou and
Yu Du and
Bruce R. Childers and
Rami G. Melhem and
Daniel Moss{\'{e}}},
editor = {Christian Fensch and
Michael F. P. O'Boyle and
Andr{\'{e}} Seznec and
Fran{\c{c}}ois Bodin},
title = {Writeback-aware bandwidth partitioning for multi-core systems with
{PCM}},
booktitle = {Proceedings of the 22nd International Conference on Parallel Architectures
and Compilation Techniques, Edinburgh, United Kingdom, September 7-11,
2013},
pages = {113--122},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/PACT.2013.6618809},
doi = {10.1109/PACT.2013.6618809},
timestamp = {Thu, 14 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/IEEEpact/ZhouDCMM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cc/MooreC13,
author = {Ryan W. Moore and
Bruce R. Childers},
editor = {Ranjit Jhala and
Koen De Bosschere},
title = {Automatic Generation of Program Affinity Policies Using Machine Learning},
booktitle = {Compiler Construction - 22nd International Conference, {CC} 2013,
Held as Part of the European Joint Conferences on Theory and Practice
of Software, {ETAPS} 2013, Rome, Italy, March 16-24, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7791},
pages = {184--203},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-37051-9\_10},
doi = {10.1007/978-3-642-37051-9\_10},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/cc/MooreC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csee/NobleHBB13,
author = {James Noble and
Michael Homer and
Kim B. Bruce and
Andrew P. Black},
editor = {Tony Cowling and
Shawn A. Bohner and
Mark A. Ardis},
title = {Designing Grace: Can an introductory programming language support
the teaching of software engineering?},
booktitle = {26th International Conference on Software Engineering Education and
Training, CSEE{\&}T 2013, San Francisco, CA, USA, May 19-21, 2013},
pages = {219--228},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/CSEET.2013.6595253},
doi = {10.1109/CSEET.2013.6595253},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/csee/NobleHBB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/BadawySKHLADMTR13,
author = {Abdel{-}Hameed A. Badawy and
Karl Robert Bruce Schmitt and
Sabrina R. Kramer and
Katie M. Hrapczynski and
Elise A. Larsen and
Andrea A. Andrew and
Mara R. Dougherty and
Matthew W. Miller and
Artesha C. Taylor and
Breanne Roberston and
Alexis Y. Williams and
Spencer A. Benson},
editor = {Randa L. Shehab and
James J. Sluss and
Deborah Anne Trytten},
title = {Expectations of computing and other {STEM} students: {A} comparison
for different Class Levels, or {(CSE} {\(\not =\)} {STEM} - {CSE)}
{\(\vert\)} \({}_{\mbox{course level}}\)},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2013, Oklahoma City,
Oklahoma, USA, October 23-26, 2013},
pages = {1657--1663},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/FIE.2013.6685120},
doi = {10.1109/FIE.2013.6685120},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fie/BadawySKHLADMTR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fimh/ZhaoSSLZJS13,
author = {Jichao Zhao and
Robert S. Stephenson and
Gregory B. Sands and
Ian J. LeGrice and
Henggui Zhang and
Jonathan C. Jarvis and
Bruce H. Smaill},
editor = {S{\'{e}}bastien Ourselin and
Daniel Rueckert and
Nicolas Smith},
title = {Atrial Fibrosis and Atrial Fibrillation: {A} Computer Simulation in
the Posterior Left Atrium},
booktitle = {Functional Imaging and Modeling of the Heart - 7th International Conference,
{FIMH} 2013, London, UK, June 20-22, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7945},
pages = {400--408},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-38899-6\_47},
doi = {10.1007/978-3-642-38899-6\_47},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fimh/ZhaoSSLZJS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icis/RiemerJHI13,
author = {Kai Riemer and
Robert Bruce Johnston and
Dirk S. Hovorka and
Marta Indulska},
editor = {Richard L. Baskerville and
Michael Chau},
title = {Challenging the Philosophical Foundations of Modeling Organizational
Reality: The Case of Process Modeling},
booktitle = {Proceedings of the International Conference on Information Systems,
{ICIS} 2013, Milano, Italy, December 15-18, 2013},
publisher = {Association for Information Systems},
year = {2013},
url = {http://aisel.aisnet.org/icis2013/proceedings/BreakthroughIdeas/4},
timestamp = {Wed, 30 Oct 2019 17:01:36 +0100},
biburl = {https://dblp.org/rec/conf/icis/RiemerJHI13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/DubeyACFLRRRRST13,
author = {Anshu Dubey and
Katie Antypas and
Alan C. Calder and
Bruce Fryxell and
Don Q. Lamb and
Paul M. Ricker and
Lynn B. Reid and
Katherine Riley and
Robert Rosner and
Andrew R. Siegel and
Francis X. Timmes and
Natalia Vladimirova and
Klaus Weide},
editor = {Jeffrey C. Carver},
title = {The software development process of FLASH, a multiphysics simulation
code},
booktitle = {Proceedings of the 5th International Workshop on Software Engineering
for Computational Science and Engineering, {SE-CSE} 2013, San Francisco,
California, USA, May 18, 2013},
pages = {1--8},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/SECSE.2013.6615093},
doi = {10.1109/SECSE.2013.6615093},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icse/DubeyACFLRRRRST13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/BruzzonePABBCFGKKMMOPPS13,
author = {Lorenzo Bruzzone and
Jeffrey J. Plaut and
Giovanni Alberti and
Donald D. Blankenship and
Francesca Bovolo and
Bruce A. Campbell and
Adamo Ferro and
Yonggyu Gim and
Wlodek Kofman and
Goro Komatsu and
William McKinnon and
Giuseppe Mitri and
Roberto Orosei and
G. Wesley Patterson and
Dirk Plettemeier and
Roberto Seu},
title = {{RIME:} Radar for Icy Moon Exploration},
booktitle = {2013 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2013, Melbourne, Australia, July 21-26, 2013},
pages = {3907--3910},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/IGARSS.2013.6723686},
doi = {10.1109/IGARSS.2013.6723686},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/BruzzonePABBCFGKKMMOPPS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/LeBrasBGSD13,
author = {Ronan LeBras and
Richard Bernstein and
Carla P. Gomes and
Bart Selman and
R. Bruce van Dover},
editor = {Francesca Rossi},
title = {Crowdsourcing Backdoor Identification for Combinatorial Optimization},
booktitle = {{IJCAI} 2013, Proceedings of the 23rd International Joint Conference
on Artificial Intelligence, Beijing, China, August 3-9, 2013},
pages = {2840--2847},
publisher = {{IJCAI/AAAI}},
year = {2013},
url = {http://www.aaai.org/ocs/index.php/IJCAI/IJCAI13/paper/view/6993},
timestamp = {Tue, 23 Jan 2024 13:25:46 +0100},
biburl = {https://dblp.org/rec/conf/ijcai/LeBrasBGSD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/DuZCMM13,
author = {Yu Du and
Miao Zhou and
Bruce R. Childers and
Daniel Moss{\'{e}} and
Rami G. Melhem},
editor = {Avi Mendelson},
title = {Bit mapping for balanced {PCM} cell programming},
booktitle = {The 40th Annual International Symposium on Computer Architecture,
ISCA'13, Tel-Aviv, Israel, June 23-27, 2013},
pages = {428--439},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2485922.2485959},
doi = {10.1145/2485922.2485959},
timestamp = {Thu, 14 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isca/DuZCMM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/DimoulasFF13,
author = {Christos Dimoulas and
Robert Bruce Findler and
Matthias Felleisen},
editor = {Antony L. Hosking and
Patrick Th. Eugster and
Cristina V. Lopes},
title = {Option contracts},
booktitle = {Proceedings of the 2013 {ACM} {SIGPLAN} International Conference on
Object Oriented Programming Systems Languages {\&} Applications,
{OOPSLA} 2013, part of {SPLASH} 2013, Indianapolis, IN, USA, October
26-31, 2013},
pages = {475--494},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2509136.2509548},
doi = {10.1145/2509136.2509548},
timestamp = {Sun, 06 Oct 2024 21:12:41 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/DimoulasFF13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sfp/TewSFFD13,
author = {Kevin Tew and
James Swaine and
Matthew Flatt and
Robert Bruce Findler and
Peter A. Dinda},
editor = {Jay McCarthy},
title = {Distributed Places},
booktitle = {Trends in Functional Programming - 14th International Symposium, {TFP}
2013, Provo, UT, USA, May 14-16, 2013, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {8322},
pages = {34--57},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-45340-3\_3},
doi = {10.1007/978-3-642-45340-3\_3},
timestamp = {Tue, 14 May 2019 10:00:44 +0200},
biburl = {https://dblp.org/rec/conf/sfp/TewSFFD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/BlackBHNRY13,
author = {Andrew P. Black and
Kim B. Bruce and
Michael Homer and
James Noble and
Amy Ruskin and
Richard Yannow},
editor = {Tracy Camp and
Paul T. Tymann and
J. D. Dougherty and
Kris Nagel},
title = {Seeking grace: a new object-oriented language for novices},
booktitle = {The 44th {ACM} Technical Symposium on Computer Science Education,
{SIGCSE} 2013, Denver, CO, USA, March 6-9, 2013},
pages = {129--134},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2445196.2445240},
doi = {10.1145/2445196.2445240},
timestamp = {Tue, 23 Mar 2021 10:54:19 +0100},
biburl = {https://dblp.org/rec/conf/sigcse/BlackBHNRY13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/CooperGKMF13,
author = {Gregory H. Cooper and
Arjun Guha and
Shriram Krishnamurthi and
Jay A. McCarthy and
Robert Bruce Findler},
editor = {Tracy Camp and
Paul T. Tymann and
J. D. Dougherty and
Kris Nagel},
title = {Teaching garbage collection without implementing compiler or interpreters},
booktitle = {The 44th {ACM} Technical Symposium on Computer Science Education,
{SIGCSE} 2013, Denver, CO, USA, March 6-9, 2013},
pages = {385--390},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2445196.2445314},
doi = {10.1145/2445196.2445314},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigcse/CooperGKMF13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/whispers/SamiappanBYHBBC13,
author = {Sathishkumar Samiappan and
Lori M. Bruce and
Haibo Yao and
Zuzana Hruska and
Robert L. Brown and
Deepak Bhatnagar and
Thomas E. Cleveland},
title = {Support vector machines classification of fluorescence hyperspectral
image for detection of aflatoxin in corn kernels},
booktitle = {5th Workshop on Hyperspectral Image and Signal Processing: Evolution
in Remote Sensing, {WHISPERS} 2013, Gainesville, FL, USA, June 26-28,
2013},
pages = {1--4},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/WHISPERS.2013.8080645},
doi = {10.1109/WHISPERS.2013.8080645},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/whispers/SamiappanBYHBBC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/DuPrieABHMNSSTTW13,
author = {Kimberly DuPrie and
Alice Allen and
G. Bruce Berriman and
Robert J. Hanisch and
Jessica Mink and
Robert J. Nemiroff and
Lior Shamir and
Keith Shortridge and
Mark B. Taylor and
Peter J. Teuben and
John F. Wallin},
title = {Astrophysics Source Code Library: Incite to Cite!},
journal = {CoRR},
volume = {abs/1312.6693},
year = {2013},
url = {http://arxiv.org/abs/1312.6693},
eprinttype = {arXiv},
eprint = {1312.6693},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/DuPrieABHMNSSTTW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/TeubenABDHMNSSTW13,
author = {Peter J. Teuben and
Alice Allen and
G. Bruce Berriman and
Kimberly DuPrie and
Robert J. Hanisch and
Jessica Mink and
Robert J. Nemiroff and
Lior Shamir and
Keith Shortridge and
Mark B. Taylor and
John F. Wallin},
title = {Ideas for Advancing Code Sharing {(A} Different Kind of Hack Day)},
journal = {CoRR},
volume = {abs/1312.7352},
year = {2013},
url = {http://arxiv.org/abs/1312.7352},
eprinttype = {arXiv},
eprint = {1312.7352},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/TeubenABDHMNSSTW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1304-1533,
author = {David S. Vaughan and
Bruce M. Perrin and
Robert M. Yadrick},
title = {Comparing Expert Systems Built Using Different Uncertain Inference
Systems},
journal = {CoRR},
volume = {abs/1304.1533},
year = {2013},
url = {http://arxiv.org/abs/1304.1533},
eprinttype = {arXiv},
eprint = {1304.1533},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1304-1533.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1304-1903,
author = {Mario Paolucci and
Donald Kossmann and
Rosaria Conte and
Paul Lukowicz and
Panos Argyrakis and
Ann Blandford and
Giulia Bonelli and
Stuart Anderson and
Sara de Freitas and
Bruce Edmonds and
Nigel Gilbert and
Markus H. Gross and
J{\"{o}}rn Kohlhammer and
Petros Koumoutsakos and
Andreas Krause and
Bj{\"{o}}rn{-}Ola Linn{\'{e}}r and
Philipp Slusallek and
Olga Sorkine and
Robert W. Sumner and
Dirk Helbing},
title = {Towards a living earth simulator},
journal = {CoRR},
volume = {abs/1304.1903},
year = {2013},
url = {http://arxiv.org/abs/1304.1903},
eprinttype = {arXiv},
eprint = {1304.1903},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1304-1903.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1304-2748,
author = {Ben P. Wise and
Bruce M. Perrin and
David S. Vaughan and
Robert M. Yadrick},
title = {The Role of Tuning Uncertain Inference Systems},
journal = {CoRR},
volume = {abs/1304.2748},
year = {2013},
url = {http://arxiv.org/abs/1304.2748},
eprinttype = {arXiv},
eprint = {1304.2748},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1304-2748.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1304-3117,
author = {Robert M. Yadrick and
Bruce M. Perrin and
David S. Vaughan and
Peter D. Holden and
Karl G. Kempf},
title = {Evaluation of Uncertain Inference Models {I:} {PROSPECTOR}},
journal = {CoRR},
volume = {abs/1304.3117},
year = {2013},
url = {http://arxiv.org/abs/1304.3117},
eprinttype = {arXiv},
eprint = {1304.3117},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1304-3117.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1304-3434,
author = {David S. Vaughan and
Bruce M. Perrin and
Robert M. Yadrick and
Peter D. Holden and
Karl G. Kempf},
title = {An Odds Ratio Based Inference Engine},
journal = {CoRR},
volume = {abs/1304.3434},
year = {2013},
url = {http://arxiv.org/abs/1304.3434},
eprinttype = {arXiv},
eprint = {1304.3434},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1304-3434.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1304-6780,
author = {Lior Shamir and
John F. Wallin and
Alice Allen and
G. Bruce Berriman and
Peter J. Teuben and
Robert J. Nemiroff and
Jessica Mink and
Robert J. Hanisch and
Kimberly DuPrie},
title = {Practices in source code sharing in astrophysics},
journal = {CoRR},
volume = {abs/1304.6780},
year = {2013},
url = {http://arxiv.org/abs/1304.6780},
eprinttype = {arXiv},
eprint = {1304.6780},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1304-6780.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/GuntherCFBTHTMMKN12,
author = {Oliver P. G{\"{u}}nther and
Virginia Chen and
Gabriela V. Cohen Freue and
Robert Balshaw and
Scott J. Tebbutt and
Zsuzsanna Hollander and
Mandeep Takhar and
W. Robert McMaster and
Bruce McManus and
Paul Keown and
Raymond T. Ng},
title = {A computational pipeline for the development of multi-marker bio-signature
panels and ensemble classifiers},
journal = {{BMC} Bioinform.},
volume = {13},
pages = {326},
year = {2012},
url = {https://doi.org/10.1186/1471-2105-13-326},
doi = {10.1186/1471-2105-13-326},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/GuntherCFBTHTMMKN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfp/FlattCDF12,
author = {Matthew Flatt and
Ryan Culpepper and
David Darais and
Robert Bruce Findler},
title = {Macros that Work Together - Compile-time bindings, partial expansion,
and definition contexts},
journal = {J. Funct. Program.},
volume = {22},
number = {2},
pages = {181--216},
year = {2012},
url = {https://doi.org/10.1017/S0956796812000093},
doi = {10.1017/S0956796812000093},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfp/FlattCDF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lisp/KleinFF12,
author = {Casey Klein and
Matthew Flatt and
Robert Bruce Findler},
title = {The Racket virtual machine and randomized testing},
journal = {High. Order Symb. Comput.},
volume = {25},
number = {2-4},
pages = {209--253},
year = {2012},
url = {https://doi.org/10.1007/s10990-013-9091-1},
doi = {10.1007/S10990-013-9091-1},
timestamp = {Thu, 05 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/lisp/KleinFF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mktsci/ChylinskiRH12,
author = {Mathew B. Chylinski and
John H. Roberts and
Bruce G. S. Hardie},
title = {Consumer Learning of New Binary Attribute Importance Accounting for
Priors, Bias, and Order Effects},
journal = {Mark. Sci.},
volume = {31},
number = {4},
pages = {549--566},
year = {2012},
url = {https://doi.org/10.1287/mksc.1120.0719},
doi = {10.1287/MKSC.1120.0719},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mktsci/ChylinskiRH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/CooperCDFCTFWDB12,
author = {Robert J. Cooper and
Matteo Caffini and
Jay Dubb and
Qianqian Fang and
Anna Custo and
Daisuke Tsuzuki and
Bruce Fischl and
William M. Wells III and
Ippeita Dan and
David A. Boas},
title = {Validating atlas-guided {DOT:} {A} comparison of diffuse optical tomography
informed by atlas and subject-specific anatomies},
journal = {NeuroImage},
volume = {62},
number = {3},
pages = {1999--2006},
year = {2012},
url = {https://doi.org/10.1016/j.neuroimage.2012.05.031},
doi = {10.1016/J.NEUROIMAGE.2012.05.031},
timestamp = {Fri, 30 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/CooperCDFCTFWDB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/RosenS12,
author = {Bruce R. Rosen and
Robert L. Savoy},
title = {fMRI at 20: Has it changed the world?},
journal = {NeuroImage},
volume = {62},
number = {2},
pages = {1316--1324},
year = {2012},
url = {https://doi.org/10.1016/j.neuroimage.2012.03.004},
doi = {10.1016/J.NEUROIMAGE.2012.03.004},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/RosenS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/SutherlandZWHLPWP12,
author = {Mary Elizabeth Sutherland and
Robert J. Zatorre and
Kate E. Watkins and
Pierre{-}Yves Herv{\'{e}} and
Gabriel Leonard and
G. Bruce Pike and
Caroline Witton and
Tom{\'{a}}s Paus},
title = {Anatomical correlates of dynamic auditory processing: Relationship
to literacy during early adolescence},
journal = {NeuroImage},
volume = {60},
number = {2},
pages = {1287--1295},
year = {2012},
url = {https://doi.org/10.1016/j.neuroimage.2012.01.051},
doi = {10.1016/J.NEUROIMAGE.2012.01.051},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/SutherlandZWHLPWP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/GainzaRD12,
author = {Pablo Gainza and
Kyle E. Roberts and
Bruce Randall Donald},
title = {Protein Design Using Continuous Rotamers},
journal = {PLoS Comput. Biol.},
volume = {8},
number = {1},
year = {2012},
url = {https://doi.org/10.1371/journal.pcbi.1002335},
doi = {10.1371/JOURNAL.PCBI.1002335},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/GainzaRD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/RobertsCBMD12,
author = {Kyle E. Roberts and
Patrick R. Cushing and
Prisca Boisguerin and
Dean R. Madden and
Bruce Randall Donald},
title = {Computational Design of a {PDZ} Domain Peptide Inhibitor that Rescues
{CFTR} Activity},
journal = {PLoS Comput. Biol.},
volume = {8},
number = {4},
year = {2012},
url = {https://doi.org/10.1371/journal.pcbi.1002477},
doi = {10.1371/JOURNAL.PCBI.1002477},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/RobertsCBMD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/se/ElliottORSS12,
author = {Bruce Elliott and
Anne O'Neil and
Clive Roberts and
Felix Schmid and
Ian Shannon},
title = {Overcoming barriers to transferring systems engineering practices
into the rail sector},
journal = {Syst. Eng.},
volume = {15},
number = {2},
pages = {203--212},
year = {2012},
url = {https://doi.org/10.1002/sys.20203},
doi = {10.1002/SYS.20203},
timestamp = {Sat, 31 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/se/ElliottORSS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmetrics/ErikssonBMN12,
author = {Brian Eriksson and
Paul Barford and
Bruce M. Maggs and
Robert D. Nowak},
title = {Posit: a lightweight approach for {IP} geolocation},
journal = {{SIGMETRICS} Perform. Evaluation Rev.},
volume = {40},
number = {2},
pages = {2--11},
year = {2012},
url = {https://doi.org/10.1145/2381056.2381058},
doi = {10.1145/2381056.2381058},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigmetrics/ErikssonBMN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taco/ZhouDCMM12,
author = {Miao Zhou and
Yu Du and
Bruce R. Childers and
Rami G. Melhem and
Daniel Moss{\'{e}}},
title = {Writeback-aware partitioning and replacement for last-level caches
in phase change main memory systems},
journal = {{ACM} Trans. Archit. Code Optim.},
volume = {8},
number = {4},
pages = {53:1--53:21},
year = {2012},
url = {https://doi.org/10.1145/2086696.2086732},
doi = {10.1145/2086696.2086732},
timestamp = {Thu, 14 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/taco/ZhouDCMM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/TyndallRLAJRH12,
author = {David Tyndall and
Bruce Rae and
David Day{-}Uei Li and
Jochen Arlt and
Abigail Johnston and
Justin A. Richardson and
Robert K. Henderson},
title = {A High-Throughput Time-Resolved Mini-Silicon Photomultiplier With
Embedded Fluorescence Lifetime Estimation in 0.13 {\(\mathrm{\mu}\)}m
{CMOS}},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {6},
number = {6},
pages = {562--570},
year = {2012},
url = {https://doi.org/10.1109/TBCAS.2012.2222639},
doi = {10.1109/TBCAS.2012.2222639},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbcas/TyndallRLAJRH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tecs/BaiocchiCDH12,
author = {Jos{\'{e}} Baiocchi and
Bruce R. Childers and
Jack W. Davidson and
Jason Hiser},
title = {Enabling dynamic binary translation in embedded systems with scratchpad
memory},
journal = {{ACM} Trans. Embed. Comput. Syst.},
volume = {11},
number = {4},
pages = {89:1--89:33},
year = {2012},
url = {https://doi.org/10.1145/2362336.2399178},
doi = {10.1145/2362336.2399178},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tecs/BaiocchiCDH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dls/HomerNBBP12,
author = {Michael Homer and
James Noble and
Kim B. Bruce and
Andrew P. Black and
David J. Pearce},
editor = {Alessandro Warth},
title = {Patterns as objects in grace},
booktitle = {Proceedings of the 8th Symposium on Dynamic Languages, {DLS} '12,
Tucson, AZ, USA, October 22, 2012},
pages = {17--28},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2384577.2384581},
doi = {10.1145/2384577.2384581},
timestamp = {Thu, 24 Jun 2021 16:19:31 +0200},
biburl = {https://dblp.org/rec/conf/dls/HomerNBBP12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/ReinigB12,
author = {Bruce A. Reinig and
Robert O. Briggs},
title = {Toward Better Solutions: An Analysis of the Ideation Literature in
Light of Bounded Ideation Theory},
booktitle = {45th Hawaii International International Conference on Systems Science
{(HICSS-45} 2012), Proceedings, 4-7 January 2012, Grand Wailea, Maui,
HI, {USA}},
pages = {159--168},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/HICSS.2012.596},
doi = {10.1109/HICSS.2012.596},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/ReinigB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/JiangZZYC12,
author = {Lei Jiang and
Bo Zhao and
Youtao Zhang and
Jun Yang and
Bruce R. Childers},
title = {Improving write operations in {MLC} phase change memory},
booktitle = {18th {IEEE} International Symposium on High Performance Computer Architecture,
{HPCA} 2012, New Orleans, LA, USA, 25-29 February, 2012},
pages = {201--210},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/HPCA.2012.6169027},
doi = {10.1109/HPCA.2012.6169027},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpca/JiangZZYC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icfp/SwaineFSFF12,
author = {James Swaine and
Burke Fetscher and
Vincent St{-}Amour and
Robert Bruce Findler and
Matthew Flatt},
editor = {Andrzej Filinski and
Clemens Grelck},
title = {Seeing the futures: profiling shared-memory parallel racket},
booktitle = {Proceedings of the 1st {ACM} {SIGPLAN} workshop on Functional high-performance
computing, Copenhagen, Denmark, FHPC@ICFP 2012, September 9-15, 2012},
pages = {73--82},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2364474.2364485},
doi = {10.1145/2364474.2364485},
timestamp = {Tue, 06 Nov 2018 16:59:25 +0100},
biburl = {https://dblp.org/rec/conf/icfp/SwaineFSFF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icis/RiemerJ12,
author = {Kai Riemer and
Robert Bruce Johnston},
title = {Place-making: {A} Phenomenological Theory of Technology Appropriation},
booktitle = {Proceedings of the International Conference on Information Systems,
{ICIS} 2012, Orlando, Florida, USA, December 16-19, 2012},
publisher = {Association for Information Systems},
year = {2012},
url = {http://aisel.aisnet.org/icis2012/proceedings/SocialImpacts/5},
timestamp = {Tue, 29 Jan 2013 19:04:31 +0100},
biburl = {https://dblp.org/rec/conf/icis/RiemerJ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispass/MooreC12,
author = {Ryan W. Moore and
Bruce R. Childers},
editor = {Rajeev Balasubramonian and
Vijayalakshmi Srinivasan},
title = {Using utility prediction models to dynamically choose program thread
counts},
booktitle = {2012 {IEEE} International Symposium on Performance Analysis of Systems
{\&} Software, New Brunswick, NJ, USA, April 1-3, 2012},
pages = {135--144},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/ISPASS.2012.6189220},
doi = {10.1109/ISPASS.2012.6189220},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ispass/MooreC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/TyndallRLRAH12,
author = {David Tyndall and
Bruce Rae and
David Day{-}Uei Li and
Justin A. Richardson and
Jochen Arlt and
Robert K. Henderson},
title = {A 100Mphoton/s time-resolved mini-silicon photomultiplier with on-chip
fluorescence lifetime estimation in 0.13{\(\mu\)}m {CMOS} imaging
technology},
booktitle = {2012 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2012, San Francisco, CA, USA, February 19-23, 2012},
pages = {122--124},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISSCC.2012.6176946},
doi = {10.1109/ISSCC.2012.6176946},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/TyndallRLRAH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micro/JiangZC012,
author = {Lei Jiang and
Youtao Zhang and
Bruce R. Childers and
Jun Yang},
title = {{FPB:} Fine-grained Power Budgeting to Improve Write Throughput of
Multi-level Cell Phase Change Memory},
booktitle = {45th Annual {IEEE/ACM} International Symposium on Microarchitecture,
{MICRO} 2012, Vancouver, BC, Canada, December 1-5, 2012},
pages = {1--12},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/MICRO.2012.10},
doi = {10.1109/MICRO.2012.10},
timestamp = {Tue, 31 May 2022 14:39:58 +0200},
biburl = {https://dblp.org/rec/conf/micro/JiangZC012.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/BlackBHN12,
author = {Andrew P. Black and
Kim B. Bruce and
Michael Homer and
James Noble},
editor = {Gary T. Leavens and
Jonathan Edwards},
title = {Grace: the absence of (inessential) difficulty},
booktitle = {{ACM} Symposium on New Ideas in Programming and Reflections on Software,
Onward! 2012, part of {SPLASH} '12, Tucson, AZ, USA, October 21-26,
2012},
pages = {85--98},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2384592.2384601},
doi = {10.1145/2384592.2384601},
timestamp = {Mon, 12 Jul 2021 15:34:15 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/BlackBHN12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/StricklandTFF12,
author = {T. Stephen Strickland and
Sam Tobin{-}Hochstadt and
Robert Bruce Findler and
Matthew Flatt},
editor = {Gary T. Leavens and
Matthew B. Dwyer},
title = {Chaperones and impersonators: run-time support for reasonable interposition},
booktitle = {Proceedings of the 27th Annual {ACM} {SIGPLAN} Conference on Object-Oriented
Programming, Systems, Languages, and Applications, {OOPSLA} 2012,
part of {SPLASH} 2012, Tucson, AZ, USA, October 21-25, 2012},
pages = {943--962},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2384616.2384685},
doi = {10.1145/2384616.2384685},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/StricklandTFF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/popl/KleinCDEFFMRTF12,
author = {Casey Klein and
John Clements and
Christos Dimoulas and
Carl Eastlund and
Matthias Felleisen and
Matthew Flatt and
Jay A. McCarthy and
Jon Rafkind and
Sam Tobin{-}Hochstadt and
Robert Bruce Findler},
editor = {John Field and
Michael Hicks},
title = {Run your research: on the effectiveness of lightweight mechanization},
booktitle = {Proceedings of the 39th {ACM} {SIGPLAN-SIGACT} Symposium on Principles
of Programming Languages, {POPL} 2012, Philadelphia, Pennsylvania,
USA, January 22-28, 2012},
pages = {285--296},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2103656.2103691},
doi = {10.1145/2103656.2103691},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/popl/KleinCDEFFMRTF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sat/ErmonLGSD12,
author = {Stefano Ermon and
Ronan LeBras and
Carla P. Gomes and
Bart Selman and
R. Bruce van Dover},
editor = {Alessandro Cimatti and
Roberto Sebastiani},
title = {SMT-Aided Combinatorial Materials Discovery},
booktitle = {Theory and Applications of Satisfiability Testing - {SAT} 2012 - 15th
International Conference, Trento, Italy, June 17-20, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7317},
pages = {172--185},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-31612-8\_14},
doi = {10.1007/978-3-642-31612-8\_14},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sat/ErmonLGSD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vee/WangDMACDIKS12,
author = {Wei Wang and
Tanima Dey and
Ryan W. Moore and
Mahmut Aktasoglu and
Bruce R. Childers and
Jack W. Davidson and
Mary Jane Irwin and
Mahmut T. Kandemir and
Mary Lou Soffa},
editor = {Steven Hand and
Dilma Da Silva},
title = {REEact: a customizable virtual execution manager for multicore platforms},
booktitle = {Proceedings of the 8th International Conference on Virtual Execution
Environments, {VEE} 2012, London, UK, March 3-4, 2012 (co-located
with {ASPLOS} 2012)},
pages = {27--38},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2151024.2151031},
doi = {10.1145/2151024.2151031},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vee/WangDMACDIKS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icfp/2012,
editor = {Peter Thiemann and
Robby Bruce Findler},
title = {{ACM} {SIGPLAN} International Conference on Functional Programming,
ICFP'12, Copenhagen, Denmark, September 9-15, 2012},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2364527},
doi = {10.1145/2364527},
isbn = {978-1-4503-1054-3},
timestamp = {Thu, 24 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icfp/2012.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1212-1915,
author = {Alice Allen and
G. Bruce Berriman and
Robert Brunner and
Dan Burger and
Kimberly DuPrie and
Robert J. Hanisch and
Robert G. Mann and
Jessica Mink and
Christer Sandin and
Keith Shortridge and
Peter J. Teuben},
title = {Bring out your codes! Bring out your codes! (Increasing Software Visibility
and Re-use)},
journal = {CoRR},
volume = {abs/1212.1915},
year = {2012},
url = {http://arxiv.org/abs/1212.1915},
eprinttype = {arXiv},
eprint = {1212.1915},
timestamp = {Mon, 12 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1212-1915.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1212-1916,
author = {Alice Allen and
Kimberly DuPrie and
G. Bruce Berriman and
Robert J. Hanisch and
Jessica Mink and
Peter J. Teuben},
title = {Astrophysics Source Code Library},
journal = {CoRR},
volume = {abs/1212.1916},
year = {2012},
url = {http://arxiv.org/abs/1212.1916},
eprinttype = {arXiv},
eprint = {1212.1916},
timestamp = {Mon, 12 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1212-1916.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cse/AhrensHLMRW11,
author = {James P. Ahrens and
Bruce Hendrickson and
Gabrielle Long and
Steve Miller and
Robert B. Ross and
Dean N. Williams},
title = {Data-Intensive Science in the {US} {DOE:} Case Studies and Future
Challenges},
journal = {Comput. Sci. Eng.},
volume = {13},
number = {6},
pages = {14--24},
year = {2011},
url = {https://doi.org/10.1109/MCSE.2011.77},
doi = {10.1109/MCSE.2011.77},
timestamp = {Mon, 06 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cse/AhrensHLMRW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esi/DuerrDTBLGBS11,
author = {Ruth E. Duerr and
Robert R. Downs and
Curt Tilmes and
Bruce R. Barkstrom and
W. Christopher Lenhardt and
Joseph Glassy and
Luis Bermudez and
Peter Slaughter},
title = {On the utility of identification schemes for digital earth science
data: an assessment and recommendations},
journal = {Earth Sci. Informatics},
volume = {4},
number = {3},
pages = {139--160},
year = {2011},
url = {https://doi.org/10.1007/s12145-011-0083-6},
doi = {10.1007/S12145-011-0083-6},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/esi/DuerrDTBLGBS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esi/VannanCPW11,
author = {Suresh K. Santhana Vannan and
Robert B. Cook and
Jerry Y. Pan and
Bruce E. Wilson},
title = {A {SOAP} Web Service for accessing {MODIS} land product subsets},
journal = {Earth Sci. Informatics},
volume = {4},
number = {2},
pages = {97--106},
year = {2011},
url = {https://doi.org/10.1007/s12145-011-0079-2},
doi = {10.1007/S12145-011-0079-2},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/esi/VannanCPW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/grid/AndronicoABBBCCCFGRMPRS11,
author = {Giuseppe Andronico and
Valeria Ardizzone and
Roberto Barbera and
Bruce Becker and
Riccardo Bruno and
Antonio Calanducci and
Diego Moreira de Araujo Carvalho and
Leandro Neumann Ciuffo and
Marco Fargetta and
Emidio Giorgio and
Giuseppe La Rocca and
Alberto Masoni and
Marco Paganoni and
Federico Ruggieri and
Diego Scardaci},
title = {e-Infrastructures for e-Science: {A} Global View},
journal = {J. Grid Comput.},
volume = {9},
number = {2},
pages = {155--184},
year = {2011},
url = {https://doi.org/10.1007/s10723-011-9187-y},
doi = {10.1007/S10723-011-9187-Y},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/grid/AndronicoABBBCCCFGRMPRS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsodit/ReinigP11,
author = {Bruce A. Reinig and
Robert K. Plice},
title = {Toward an Understanding of Software Piracy in Developed and Emerging
Economies},
journal = {Int. J. Soc. Organ. Dyn. {IT}},
volume = {1},
number = {1},
pages = {1--12},
year = {2011},
url = {https://doi.org/10.4018/ijsodit.2011010101},
doi = {10.4018/IJSODIT.2011010101},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijsodit/ReinigP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/HelmerAAABCFLKMMNPRRSTTWK11,
author = {Karl G. Helmer and
Jos{\'{e}} Luis Ambite and
Joseph Ames and
Rachana Ananthakrishnan and
Gully Burns and
Ann L. Chervenak and
Ian T. Foster and
Lee Liming and
David B. Keator and
Fabio Macciardi and
Ravi K. Madduri and
John{-}Paul Navarro and
Steven G. Potkin and
Bruce R. Rosen and
Seth Ruffins and
Robert Schuler and
Jessica A. Turner and
Arthur W. Toga and
Christina Williams and
Carl Kesselman},
title = {Enabling collaborative research using the Biomedical Informatics Research
Network {(BIRN)}},
journal = {J. Am. Medical Informatics Assoc.},
volume = {18},
number = {4},
pages = {416--422},
year = {2011},
url = {https://doi.org/10.1136/amiajnl-2010-000032},
doi = {10.1136/AMIAJNL-2010-000032},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jamia/HelmerAAABCFLKMMNPRRSTTWK11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcb/ZengRZD11,
author = {Jianyang Zeng and
Kyle E. Roberts and
Pei Zhou and
Bruce Randall Donald},
title = {A Bayesian Approach for Determining Protein Side-Chain Rotamer Conformations
Using Unassigned {NOE} Data},
journal = {J. Comput. Biol.},
volume = {18},
number = {11},
pages = {1661--1679},
year = {2011},
url = {https://doi.org/10.1089/cmb.2011.0172},
doi = {10.1089/CMB.2011.0172},
timestamp = {Wed, 02 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcb/ZengRZD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/CerBMYVLBCS11,
author = {Regina Z. Cer and
Kevin H. Bruce and
Uma Mudunuri and
Ming Yi and
Natalia Volfovsky and
Brian T. Luke and
Albino Bacolla and
Jack R. Collins and
Robert M. Stephens},
title = {Non-B {DB:} a database of predicted non-B DNA-forming motifs in mammalian
genomes},
journal = {Nucleic Acids Res.},
volume = {39},
number = {Database-Issue},
pages = {383--391},
year = {2011},
url = {https://doi.org/10.1093/nar/gkq1170},
doi = {10.1093/NAR/GKQ1170},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/CerBMYVLBCS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/XingMBCRMDCRKC11,
author = {Heming Xing and
Paul D. McDonagh and
Jadwiga R. Bienkowska and
Tanya Cashorali and
Karl Runge and
Robert E. Miller and
Dave DeCaprio and
Bruce Church and
Ronenn Roubenoff and
Iya G. Khalil and
John Carulli},
title = {Causal Modeling Using Network Ensemble Simulations of Genetic and
Gene Expression Data Predicts Genes Involved in Rheumatoid Arthritis},
journal = {PLoS Comput. Biol.},
volume = {7},
number = {3},
year = {2011},
url = {https://doi.org/10.1371/journal.pcbi.1001105},
doi = {10.1371/JOURNAL.PCBI.1001105},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/XingMBCRMDCRKC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taco/HiserWHDMC11,
author = {Jason Hiser and
Daniel W. Williams and
Wei Hu and
Jack W. Davidson and
Jason Mars and
Bruce R. Childers},
title = {Evaluating indirect branch handling mechanisms in software dynamic
translation systems},
journal = {{ACM} Trans. Archit. Code Optim.},
volume = {8},
number = {2},
pages = {9:1--9:28},
year = {2011},
url = {https://doi.org/10.1145/1970386.1970390},
doi = {10.1145/1970386.1970390},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/taco/HiserWHDMC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taco/LeeCC11,
author = {Hyunjin Lee and
Sangyeun Cho and
Bruce R. Childers},
title = {{DEFCAM:} {A} design and evaluation framework for defect-tolerant
cache memories},
journal = {{ACM} Trans. Archit. Code Optim.},
volume = {8},
number = {3},
pages = {17:1--17:29},
year = {2011},
url = {https://doi.org/10.1145/2019608.2019616},
doi = {10.1145/2019608.2019616},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/taco/LeeCC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/ClaytonCRSCHLM11,
author = {Thomas F. Clayton and
Katherine L. Cameron and
Bruce Rae and
Nancy Sabatier and
Edoardo Charbon and
Robert K. Henderson and
Gareth Leng and
Alan F. Murray},
title = {An Implementation of a Spike-Response Model With Escape Noise Using
an Avalanche Diode},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {5},
number = {3},
pages = {231--243},
year = {2011},
url = {https://doi.org/10.1109/TBCAS.2010.2100392},
doi = {10.1109/TBCAS.2010.2100392},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbcas/ClaytonCRSCHLM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aplas/KleinMJF11,
author = {Casey Klein and
Jay A. McCarthy and
Steven Jaconette and
Robert Bruce Findler},
editor = {Hongseok Yang},
title = {A Semantics for Context-Sensitive Reduction Semantics},
booktitle = {Programming Languages and Systems - 9th Asian Symposium, {APLAS} 2011,
Kenting, Taiwan, December 5-7, 2011. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7078},
pages = {369--383},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-25318-8\_27},
doi = {10.1007/978-3-642-25318-8\_27},
timestamp = {Tue, 14 May 2019 10:00:41 +0200},
biburl = {https://dblp.org/rec/conf/aplas/KleinMJF11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asplos/HoangFJ11,
author = {Giang Hoang and
Robby Bruce Findler and
Russ Joseph},
editor = {Rajiv Gupta and
Todd C. Mowry},
title = {Exploring circuit timing-aware language and compilation},
booktitle = {Proceedings of the 16th International Conference on Architectural
Support for Programming Languages and Operating Systems, {ASPLOS}
2011, Newport Beach, CA, USA, March 5-11, 2011},
pages = {345--356},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/1950365.1950405},
doi = {10.1145/1950365.1950405},
timestamp = {Wed, 07 Jul 2021 13:23:08 +0200},
biburl = {https://dblp.org/rec/conf/asplos/HoangFJ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/assets/JeonRRYW11,
author = {Myounghoon Jeon and
Jason Roberts and
Parameshwaran Raman and
Jung{-}Bin Yim and
Bruce N. Walker},
editor = {Kathleen F. McCoy and
Yeliz Yesilada},
title = {Participatory design process for an in-vehicle affect detection and
regulation system for various drivers},
booktitle = {The 13th International {ACM} {SIGACCESS} Conference on Computers and
Accessibility, {ASSETS} '11, Dundee, Scotland, UK, October 24-26,
2011},
pages = {271--272},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2049536.2049602},
doi = {10.1145/2049536.2049602},
timestamp = {Wed, 20 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/assets/JeonRRYW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cp/LeBrasDGSGD11,
author = {Ronan LeBras and
Theodoros Damoulas and
John M. Gregoire and
Ashish Sabharwal and
Carla P. Gomes and
R. Bruce van Dover},
editor = {Jimmy Ho{-}Man Lee},
title = {Constraint Reasoning and Kernel Clustering for Pattern Decomposition
with Scaling},
booktitle = {Principles and Practice of Constraint Programming - {CP} 2011 - 17th
International Conference, {CP} 2011, Perugia, Italy, September 12-16,
2011. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6876},
pages = {508--522},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-23786-7\_39},
doi = {10.1007/978-3-642-23786-7\_39},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cp/LeBrasDGSGD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/BaiocchiC11,
author = {Jos{\'{e}} Baiocchi and
Bruce R. Childers},
title = {Demand code paging for {NAND} flash in MMU-less embedded systems},
booktitle = {Design, Automation and Test in Europe, {DATE} 2011, Grenoble, France,
March 14-18, 2011},
pages = {517--532},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/DATE.2011.5763095},
doi = {10.1109/DATE.2011.5763095},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/date/BaiocchiC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/FerreiraBCMM11,
author = {Alexandre Peixoto Ferreira and
Santiago Bock and
Bruce R. Childers and
Rami G. Melhem and
Daniel Moss{\'{e}}},
title = {Impact of process variation on endurance algorithms for wear-prone
memories},
booktitle = {Design, Automation and Test in Europe, {DATE} 2011, Grenoble, France,
March 14-18, 2011},
pages = {962--967},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/DATE.2011.5763156},
doi = {10.1109/DATE.2011.5763156},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/date/FerreiraBCMM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/RichardsB11,
author = {Robert C. Richards Jr. and
Thomas R. Bruce},
editor = {John Carlo Bertot and
Karine Nahon and
Soon Ae Chun and
Luis F. Luna{-}Reyes and
Vijay Atluri},
title = {Examples of specialized legal metadata adapted to the digital environment,
from the {U.S.} \emph{code of federal regulations}},
booktitle = {Proceedings of the 12th Annual International Conference on Digital
Government Research, {DG.O} 2011, College Park, MD, USA, June 12 -
15, 2011},
series = {{ACM} International Conference Proceeding Series},
pages = {229--234},
publisher = {Digital Government Research Center},
year = {2011},
url = {https://doi.org/10.1145/2037556.2037594},
doi = {10.1145/2037556.2037594},
timestamp = {Tue, 06 Nov 2018 11:06:50 +0100},
biburl = {https://dblp.org/rec/conf/dgo/RichardsB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dls/TewSFFD11,
author = {Kevin Tew and
James Swaine and
Matthew Flatt and
Robert Bruce Findler and
Peter A. Dinda},
editor = {Theo D'Hondt},
title = {Places: adding message-passing parallelism to racket},
booktitle = {Proceedings of the 7th Symposium on Dynamic Languages, {DLS} 2011,
October 24, 2011, Portland, OR, {USA}},
pages = {85--96},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2047849.2047860},
doi = {10.1145/2047849.2047860},
timestamp = {Thu, 24 Jun 2021 16:19:31 +0200},
biburl = {https://dblp.org/rec/conf/dls/TewSFFD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsn/JiangDZCY11,
author = {Lei Jiang and
Yu Du and
Youtao Zhang and
Bruce R. Childers and
Jun Yang},
title = {{LLS:} Cooperative integration of wear-leveling and salvaging for
{PCM} main memory},
booktitle = {Proceedings of the 2011 {IEEE/IFIP} International Conference on Dependable
Systems and Networks, {DSN} 2011, Hong Kong, China, June 27-30 2011},
pages = {221--232},
publisher = {{IEEE} Compute Society},
year = {2011},
url = {https://doi.org/10.1109/DSN.2011.5958221},
doi = {10.1109/DSN.2011.5958221},
timestamp = {Thu, 14 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dsn/JiangDZCY11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/flairs/HoareEMP11,
author = {John Robert Hoare and
Richard E. Edwards and
Bruce J. MacLennan and
Lynne E. Parker},
editor = {R. Charles Murray and
Philip M. McCarthy},
title = {Myro-C++: An Open Source {C++} Library for {CS} Education Using {AI}},
booktitle = {Proceedings of the Twenty-Fourth International Florida Artificial
Intelligence Research Society Conference, May 18-20, 2011, Palm Beach,
Florida, {USA}},
publisher = {{AAAI} Press},
year = {2011},
url = {http://aaai.org/ocs/index.php/FLAIRS/FLAIRS11/paper/view/2539},
timestamp = {Wed, 26 Oct 2022 08:35:19 +0200},
biburl = {https://dblp.org/rec/conf/flairs/HoareEMP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/SindhavRB11,
author = {Birud Sindhav and
Bruce A. Reinig and
Robert O. Briggs},
title = {A Field Investigation of the Nostalgia Effect},
booktitle = {44th Hawaii International International Conference on Systems Science
{(HICSS-44} 2011), Proceedings, 4-7 January 2011, Koloa, Kauai, HI,
{USA}},
pages = {1--8},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/HICSS.2011.9},
doi = {10.1109/HICSS.2011.9},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/SindhavRB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/LeeCC11,
author = {Hyunjin Lee and
Sangyeun Cho and
Bruce R. Childers},
title = {CloudCache: Expanding and shrinking private caches},
booktitle = {17th International Conference on High-Performance Computer Architecture
{(HPCA-17} 2011), February 12-16 2011, San Antonio, Texas, {USA}},
pages = {219--230},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/HPCA.2011.5749731},
doi = {10.1109/HPCA.2011.5749731},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpca/LeeCC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icail/RichardsB11,
author = {Robert C. Richards Jr. and
Thomas R. Bruce},
editor = {Kevin D. Ashley and
Tom M. van Engers},
title = {Adapting specialized legal metadata to the digital environment: \emph{the
code of federal regulations parallel table of authorities and rules}},
booktitle = {The 13th International Conference on Artificial Intelligence and Law,
Proceedings of the Conference, June 6-10, 2011, Pittsburgh, PA, {USA}},
pages = {126--130},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2018358.2018377},
doi = {10.1145/2018358.2018377},
timestamp = {Tue, 06 Nov 2018 16:58:12 +0100},
biburl = {https://dblp.org/rec/conf/icail/RichardsB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icis/RiemerJ11,
author = {Kai Riemer and
Robert Bruce Johnston},
editor = {Dennis F. Galletta and
Ting{-}Peng Liang},
title = {Artifact or Equipment? Rethinking the Core of {IS} using Heidegger's
ways of being},
booktitle = {Proceedings of the International Conference on Information Systems,
{ICIS} 2011, Shanghai, China, December 4-7, 2011},
publisher = {Association for Information Systems},
year = {2011},
url = {http://aisel.aisnet.org/icis2011/proceedings/researchmethods/5},
timestamp = {Tue, 29 Jan 2013 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icis/RiemerJ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/MooreC11,
author = {Ryan W. Moore and
Bruce R. Childers},
editor = {Holger Giese and
Betty H. C. Cheng},
title = {Inflation and deflation of self-adaptive applications},
booktitle = {2011 {ICSE} Symposium on Software Engineering for Adaptive and Self-Managing
Systems, {SEAMS} 2011, Waikiki, Honolulu , HI, USA, May 23-24, 2011},
pages = {228--237},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/1988008.1988041},
doi = {10.1145/1988008.1988041},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icse/MooreC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/PanLWPCS11,
author = {Jerry Y. Pan and
W. Christopher Lenhardt and
Bruce E. Wilson and
Giri Palanisamy and
Robert B. Cook and
Biva Shrestha},
title = {Geoscience data curation using a digital object model and open-source
frameworks: Provenance applications},
booktitle = {2011 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2011, Vancouver, BC, Canada, July 24-29, 2011},
pages = {3815--3818},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/IGARSS.2011.6050062},
doi = {10.1109/IGARSS.2011.6050062},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/PanLWPCS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispass/BockCMMZ11,
author = {Santiago Bock and
Bruce R. Childers and
Rami G. Melhem and
Daniel Moss{\'{e}} and
Youtao Zhang},
title = {Analyzing the impact of useless write-backs on the endurance and energy
consumption of {PCM} main memory},
booktitle = {{IEEE} International Symposium on Performance Analysis of Systems
and Software, {ISPASS} 2011, 10-12 April, 2011, Austin, TX, {USA}},
pages = {56--65},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ISPASS.2011.5762715},
doi = {10.1109/ISPASS.2011.5762715},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ispass/BockCMMZ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/DitlowMSDEFFHMNOSWC11,
author = {Gary S. Ditlow and
Robert K. Montoye and
Salvatore N. Storino and
Sherman M. Dance and
Sebastian Ehrenreich and
Bruce M. Fleischer and
Thomas W. Fox and
Kyle M. Holmes and
Junichi Mihara and
Yutaka Nakamura and
Shohji Onishi and
Robert Shearer and
Dieter F. Wendel and
Leland Chang},
title = {A 4R2W register file for a 2.3GHz wire-speed POWER{\texttrademark}
processor with double-pumped write operation},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2011,
Digest of Technical Papers, San Francisco, CA, USA, 20-24 February,
2011},
pages = {256--258},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ISSCC.2011.5746308},
doi = {10.1109/ISSCC.2011.5746308},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/DitlowMSDEFFHMNOSWC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/milcom/PrattTFBWA11,
author = {Thomas G. Pratt and
Hrishikesh Tapse and
Bruce Fette and
Robert J. Baxley and
Brett T. Walkenhorst and
Guillermo Acosta{-}Marum},
title = {Polarization-based zero forcing suppression with multiple degrees
of freedom},
booktitle = {{MILCOM} 2011 - 2011 {IEEE} Military Communications Conference, Baltimore,
MD, USA, November 7-10, 2011},
pages = {2246--2251},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/MILCOM.2011.6127654},
doi = {10.1109/MILCOM.2011.6127654},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/milcom/PrattTFBWA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/popl/AhmedFSW11,
author = {Amal Ahmed and
Robert Bruce Findler and
Jeremy G. Siek and
Philip Wadler},
editor = {Thomas Ball and
Mooly Sagiv},
title = {Blame for all},
booktitle = {Proceedings of the 38th {ACM} {SIGPLAN-SIGACT} Symposium on Principles
of Programming Languages, {POPL} 2011, Austin, TX, USA, January 26-28,
2011},
pages = {201--214},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/1926385.1926409},
doi = {10.1145/1926385.1926409},
timestamp = {Tue, 09 Jul 2024 07:54:49 +0200},
biburl = {https://dblp.org/rec/conf/popl/AhmedFSW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/popl/DimoulasFFF11,
author = {Christos Dimoulas and
Robert Bruce Findler and
Cormac Flanagan and
Matthias Felleisen},
editor = {Thomas Ball and
Mooly Sagiv},
title = {Correct blame for contracts: no more scapegoating},
booktitle = {Proceedings of the 38th {ACM} {SIGPLAN-SIGACT} Symposium on Principles
of Programming Languages, {POPL} 2011, Austin, TX, USA, January 26-28,
2011},
pages = {215--226},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/1926385.1926410},
doi = {10.1145/1926385.1926410},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/popl/DimoulasFFF11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pppj/MisurdaCS11,
author = {Jonathan Misurda and
Bruce R. Childers and
Mary Lou Soffa},
editor = {Christian W. Probst and
Christian Wimmer},
title = {Jazz2: a flexible and extensible framework for structural testing
in a Java {VM}},
booktitle = {Proceedings of the 9th International Conference on Principles and
Practice of Programming in Java, {PPPJ} 2011, Kongens Lyngby, Denmark,
August 24-26, 2011},
pages = {81--90},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2093157.2093169},
doi = {10.1145/2093157.2093169},
timestamp = {Mon, 26 Nov 2018 15:05:58 +0100},
biburl = {https://dblp.org/rec/conf/pppj/MisurdaCS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/prdc/RahmanCC11,
author = {Musfiq Rahman and
Bruce R. Childers and
Sangyeun Cho},
editor = {Leon Alkalai and
Timothy Tsai and
Tomohiro Yoneda},
title = {COMeT: Continuous Online Memory Test},
booktitle = {17th {IEEE} Pacific Rim International Symposium on Dependable Computing,
{PRDC} 2011, Pasadena, CA, USA, December 12-14, 2011},
pages = {109--118},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/PRDC.2011.22},
doi = {10.1109/PRDC.2011.22},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/prdc/RahmanCC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/recomb/RobertsCBMD11,
author = {Kyle E. Roberts and
Patrick R. Cushing and
Prisca Boisguerin and
Dean R. Madden and
Bruce Randall Donald},
editor = {Vineet Bafna and
S{\"{u}}leyman Cenk Sahinalp},
title = {Design of Protein-Protein Interactions with a Novel Ensemble-Based
Scoring Algorithm},
booktitle = {Research in Computational Molecular Biology - 15th Annual International
Conference, {RECOMB} 2011, Vancouver, BC, Canada, March 28-31, 2011.
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6577},
pages = {361--376},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-20036-6\_35},
doi = {10.1007/978-3-642-20036-6\_35},
timestamp = {Mon, 13 May 2019 09:30:09 +0200},
biburl = {https://dblp.org/rec/conf/recomb/RobertsCBMD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/recomb/ZengRZD11,
author = {Jianyang Zeng and
Kyle E. Roberts and
Pei Zhou and
Bruce Randall Donald},
editor = {Vineet Bafna and
S{\"{u}}leyman Cenk Sahinalp},
title = {A Bayesian Approach for Determining Protein Side-Chain Rotamer Conformations
Using Unassigned {NOE} Data},
booktitle = {Research in Computational Molecular Biology - 15th Annual International
Conference, {RECOMB} 2011, Vancouver, BC, Canada, March 28-31, 2011.
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6577},
pages = {563--578},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-20036-6\_49},
doi = {10.1007/978-3-642-20036-6\_49},
timestamp = {Wed, 02 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/recomb/ZengRZD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trustcom/ZhouBFCMM11,
author = {Miao Zhou and
Santiago Bock and
Alexandre Peixoto Ferreira and
Bruce R. Childers and
Rami G. Melhem and
Daniel Moss{\'{e}}},
title = {Real-Time Scheduling for Phase Change Main Memory Systems},
booktitle = {{IEEE} 10th International Conference on Trust, Security and Privacy
in Computing and Communications, TrustCom 2011, Changsha, China, 16-18
November, 2011},
pages = {991--998},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/TrustCom.2011.136},
doi = {10.1109/TRUSTCOM.2011.136},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/trustcom/ZhouBFCMM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/siam/11/KepnerBBBFHGR11,
author = {Jeremy Kepner and
David A. Bader and
Robert Bond and
Nadya T. Bliss and
Christos Faloutsos and
Bruce Hendrickson and
John R. Gilbert and
Eric Robinson},
editor = {Jeremy Kepner and
John R. Gilbert},
title = {Fundamental Questions in the Analysis of Large Graphs},
booktitle = {Graph Algorithms in the Language of Linear Algebra},
series = {Software, environments, tools},
volume = {22},
pages = {353--357},
publisher = {{SIAM}},
year = {2011},
url = {https://doi.org/10.1137/1.9780898719918.ch16},
doi = {10.1137/1.9780898719918.CH16},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/siam/11/KepnerBBBFHGR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/parallel/NieplochaKPTHC11,
author = {Jarek Nieplocha and
Manojkumar Krishnan and
Bruce J. Palmer and
Vinod Tipparaju and
Robert J. Harrison and
Daniel G. Chavarr{\'{\i}}a{-}Miranda},
editor = {David A. Padua},
title = {Global Arrays Parallel Programming Toolkit},
booktitle = {Encyclopedia of Parallel Computing},
pages = {779--787},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-0-387-09766-4\_403},
doi = {10.1007/978-0-387-09766-4\_403},
timestamp = {Wed, 12 Jul 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/reference/parallel/NieplochaKPTHC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/daglib/0028059,
author = {Michael Sperber and
R. Kent Dybvig and
Matthew Flatt and
Anton van Straaten and
Robert Bruce Findler and
Jacob Matthews},
title = {Revised6 Report on the Algorithmic Language Scheme},
publisher = {Cambridge University Press},
year = {2010},
isbn = {978-0-521-19399-3},
timestamp = {Tue, 19 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/daglib/0028059.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbir/CoghlanDKLLNPW10,
author = {Thomas Coghlan and
George Diehl and
Eric J. Karson and
Matthew J. Liberatore and
Wenhong Luo and
Robert L. Nydick and
Bruce Pollack{-}Johnson and
William P. Wagner},
title = {The Current State of Analytics in the Corporation: The View from Industry
Leaders},
journal = {Int. J. Bus. Intell. Res.},
volume = {1},
number = {2},
pages = {1--8},
year = {2010},
url = {https://doi.org/10.4018/jbir.2010040101},
doi = {10.4018/JBIR.2010040101},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbir/CoghlanDKLLNPW10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/itd/BrechbuhlBDJ10,
author = {Hans Brechb{\"{u}}hl and
Robert Bruce and
Scott Dynes and
M. Eric Johnson},
title = {Protecting Critical Information Infrastructure: Developing Cybersecurity
Policy},
journal = {Inf. Technol. Dev.},
volume = {16},
number = {1},
pages = {83--91},
year = {2010},
url = {https://doi.org/10.1002/itdj.20096},
doi = {10.1002/ITDJ.20096},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/itd/BrechbuhlBDJ10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jeric/BruceCD10,
author = {Kim B. Bruce and
Robert D. Cupper and
Robert L. Scot Drysdale},
title = {A History of the Liberal Arts Computer Science Consortium and its
Model Curricula},
journal = {{ACM} Trans. Comput. Educ.},
volume = {10},
number = {1},
pages = {3:1--3:12},
year = {2010},
url = {https://doi.org/10.1145/1731041.1731044},
doi = {10.1145/1731041.1731044},
timestamp = {Fri, 06 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jeric/BruceCD10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmis/BriggsR10,
author = {Robert O. Briggs and
Bruce A. Reinig},
title = {Bounded Ideation Theory},
journal = {J. Manag. Inf. Syst.},
volume = {27},
number = {1},
pages = {123--144},
year = {2010},
url = {https://doi.org/10.2753/mis0742-1222270106},
doi = {10.2753/MIS0742-1222270106},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmis/BriggsR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HansenTHE10,
author = {Bruce C. Hansen and
Benjamin Thompson and
Robert F. Hess and
Dave Ellemberg},
title = {Extracting the internal representation of faces from human brain activity:
An analogue to reverse correlation},
journal = {NeuroImage},
volume = {51},
number = {1},
pages = {373--390},
year = {2010},
url = {https://doi.org/10.1016/j.neuroimage.2010.02.021},
doi = {10.1016/J.NEUROIMAGE.2010.02.021},
timestamp = {Wed, 19 Dec 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/HansenTHE10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/KremenOPPEEEHFFGHJJJLLMNSTTDF10,
author = {William S. Kremen and
Robert C. O'Brien and
Matthew S. Panizzon and
Elizabeth Prom{-}Wormley and
Lindon J. Eaves and
Seth A. Eisen and
Lisa T. Eyler and
Richard L. Hauger and
Christine Fennema{-}Notestine and
Bruce Fischl and
Michael D. Grant and
Dirk H. Hellhammer and
Amy J. Jak and
Kristen C. Jacobson and
Terry L. Jernigan and
Sonia J. Lupien and
Michael J. Lyons and
Sally P. Mendoza and
Michael C. Neale and
Larry J. Seidman and
Heidi W. Thermenos and
Ming T. Tsuang and
Anders M. Dale and
Carol E. Franz},
title = {Salivary cortisol and prefrontal cortical thickness in middle-aged
men: {A} twin study},
journal = {NeuroImage},
volume = {53},
number = {3},
pages = {1093--1102},
year = {2010},
url = {https://doi.org/10.1016/j.neuroimage.2010.02.026},
doi = {10.1016/J.NEUROIMAGE.2010.02.026},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/KremenOPPEEEHFFGHJJJLLMNSTTDF10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nms/EtlingKFP10,
author = {Bruce Etling and
John Kelly and
Robert Faris and
John Palfrey},
title = {Mapping the Arabic blogosphere: politics and dissent online},
journal = {New Media Soc.},
volume = {12},
number = {8},
pages = {1225--1243},
year = {2010},
url = {https://doi.org/10.1177/1461444810385096},
doi = {10.1177/1461444810385096},
timestamp = {Thu, 17 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nms/EtlingKFP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/ArcherRTHLR10,
author = {John P. Archer and
Andrew Rambaut and
Bruce E. Taillon and
P. Richard Harrigan and
Marilyn Lewis and
David L. Robertson},
title = {The Evolutionary Analysis of Emerging Low Frequency {HIV-1} {CXCR4}
Using Variants through Time - An Ultra-Deep Approach},
journal = {PLoS Comput. Biol.},
volume = {6},
number = {12},
year = {2010},
url = {https://doi.org/10.1371/journal.pcbi.1001022},
doi = {10.1371/JOURNAL.PCBI.1001022},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/ArcherRTHLR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/RaeYMGRGGDH10,
author = {Bruce Rae and
Jingbin Yang and
Jonathan McKendry and
Zheng Gong and
David Renshaw and
John M. Girkin and
Erdan Gu and
Martin D. Dawson and
Robert K. Henderson},
title = {A Vertically Integrated {CMOS} Microsystem for Time-Resolved Fluorescence
Analysis},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {4},
number = {6},
pages = {437--444},
year = {2010},
url = {https://doi.org/10.1109/TBCAS.2010.2077290},
doi = {10.1109/TBCAS.2010.2077290},
timestamp = {Tue, 05 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbcas/RaeYMGRGGDH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/LeeCC10,
author = {Hyunjin Lee and
Sangyeun Cho and
Bruce R. Childers},
title = {{PERFECTORY:} {A} Fault-Tolerant Directory Memory Architecture},
journal = {{IEEE} Trans. Computers},
volume = {59},
number = {5},
pages = {638--650},
year = {2010},
url = {https://doi.org/10.1109/TC.2009.138},
doi = {10.1109/TC.2009.138},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/LeeCC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/toplas/HuangCS10,
author = {Yuqiang Huang and
Bruce R. Childers and
Mary Lou Soffa},
title = {Detecting bugs in register allocation},
journal = {{ACM} Trans. Program. Lang. Syst.},
volume = {32},
number = {4},
pages = {15:1--15:36},
year = {2010},
url = {https://doi.org/10.1145/1734206.1734212},
doi = {10.1145/1734206.1734212},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/toplas/HuangCS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/FerreiraZBCMM10,
author = {Alexandre Peixoto Ferreira and
Miao Zhou and
Santiago Bock and
Bruce R. Childers and
Rami G. Melhem and
Daniel Moss{\'{e}}},
editor = {Giovanni De Micheli and
Bashir M. Al{-}Hashimi and
Wolfgang M{\"{u}}ller and
Enrico Macii},
title = {Increasing {PCM} main memory lifetime},
booktitle = {Design, Automation and Test in Europe, {DATE} 2010, Dresden, Germany,
March 8-12, 2010},
pages = {914--919},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/DATE.2010.5456923},
doi = {10.1109/DATE.2010.5456923},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/date/FerreiraZBCMM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/ReinigP10,
author = {Bruce A. Reinig and
Robert K. Plice},
title = {Modeling Software Piracy in Developed and Emerging Economies},
booktitle = {43rd Hawaii International International Conference on Systems Science
{(HICSS-43} 2010), Proceedings, 5-8 January 2010, Koloa, Kauai, HI,
{USA}},
pages = {1--8},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/HICSS.2010.276},
doi = {10.1109/HICSS.2010.276},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/ReinigP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/LeeCC10,
author = {Hyunjin Lee and
Sangyeun Cho and
Bruce R. Childers},
editor = {Matthew T. Jacob and
Chita R. Das and
Pradip Bose},
title = {StimulusCache: Boosting performance of chip multiprocessors with excess
cache},
booktitle = {16th International Conference on High-Performance Computer Architecture
{(HPCA-16} 2010), 9-14 January 2010, Bangalore, India},
pages = {1--12},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/HPCA.2010.5416644},
doi = {10.1109/HPCA.2010.5416644},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpca/LeeCC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpdc/LynnesOFVWS10,
author = {Christopher Lynnes and
Edward Olsen and
Peter Fox and
Bruce Vollmer and
Robert E. Wolfe and
Shahin Samadi},
editor = {Salim Hariri and
Kate Keahey},
title = {A quality screening service for remote sensing data},
booktitle = {Proceedings of the 19th {ACM} International Symposium on High Performance
Distributed Computing, {HPDC} 2010, Chicago, Illinois, USA, June 21-25,
2010},
pages = {554--559},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1851476.1851557},
doi = {10.1145/1851476.1851557},
timestamp = {Mon, 01 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpdc/LynnesOFVWS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/RittnerLCP10,
author = {Let{\'{\i}}cia Rittner and
Roberto A. Lotufo and
Jennifer S. W. Campbell and
G. Bruce Pike},
title = {Segmentation of thalamic nuclei based on tensorial morphological gradient
of diffusion tensor fields},
booktitle = {Proceedings of the 2010 {IEEE} International Symposium on Biomedical
Imaging: From Nano to Macro, Rotterdam, The Netherlands, 14-17 April,
2010},
pages = {1173--1176},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ISBI.2010.5490203},
doi = {10.1109/ISBI.2010.5490203},
timestamp = {Tue, 24 Dec 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isbi/RittnerLCP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/CameronCRMHC10,
author = {Katherine L. Cameron and
Thomas F. Clayton and
Bruce Rae and
Alan F. Murray and
Robert K. Henderson and
Edoardo Charbon},
title = {Poisson distributed noise generation for spiking neural applications},
booktitle = {International Symposium on Circuits and Systems {(ISCAS} 2010), May
30 - June 2, 2010, Paris, France},
pages = {365--368},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ISCAS.2010.5537767},
doi = {10.1109/ISCAS.2010.5537767},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/CameronCRMHC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/Khaki-FiroozCJKSSCLLBGDS10,
author = {Ali Khaki{-}Firooz and
Kangguo Cheng and
Basanth Jagannathan and
Pranita Kulkarni and
Jeffrey W. Sleight and
Davood Shahrjerdi and
Josephine B. Chang and
Sungjae Lee and
Junjun Li and
Huiming Bu and
Robert Gauthier and
Bruce Doris and
Ghavam G. Shahidi},
title = {Fully depleted extremely thin {SOI} for mainstream 20nm low-power
technology and beyond},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2010,
Digest of Technical Papers, San Francisco, CA, USA, 7-11 February,
2010},
pages = {152--153},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ISSCC.2010.5434014},
doi = {10.1109/ISSCC.2010.5434014},
timestamp = {Thu, 02 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/Khaki-FiroozCJKSSCLLBGDS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/RaeMGGRDH10,
author = {Bruce Rae and
Jonathan McKendry and
Zheng Gong and
Erdan Gu and
David Renshaw and
Martin D. Dawson and
Robert K. Henderson},
title = {A 200MHz 300ps 0.5pJ/ns optical pulse generator array in 0.35{\(\mathrm{\mu}\)}m
{CMOS}},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2010,
Digest of Technical Papers, San Francisco, CA, USA, 7-11 February,
2010},
pages = {322--323},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ISSCC.2010.5433904},
doi = {10.1109/ISSCC.2010.5433904},
timestamp = {Tue, 05 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/RaeMGGRDH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/BlackBN10,
author = {Andrew P. Black and
Kim B. Bruce and
James Noble},
editor = {William R. Cook and
Siobh{\'{a}}n Clarke and
Martin C. Rinard},
title = {Panel: designing the next educational programming language},
booktitle = {Companion to the 25th Annual {ACM} {SIGPLAN} Conference on Object-Oriented
Programming, Systems, Languages, and Applications, {OOPSLA} 2010,
part of {SPLASH} 2010, October 17-21, 2010, Reno/Tahoe, Nevada, {USA}},
pages = {201--204},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1869542.1869574},
doi = {10.1145/1869542.1869574},
timestamp = {Fri, 11 Feb 2022 14:04:22 +0100},
biburl = {https://dblp.org/rec/conf/oopsla/BlackBN10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/KleinFF10,
author = {Casey Klein and
Matthew Flatt and
Robert Bruce Findler},
editor = {William R. Cook and
Siobh{\'{a}}n Clarke and
Martin C. Rinard},
title = {Random testing for higher-order, stateful programs},
booktitle = {Proceedings of the 25th Annual {ACM} {SIGPLAN} Conference on Object-Oriented
Programming, Systems, Languages, and Applications, {OOPSLA} 2010,
October 17-21, 2010, Reno/Tahoe, Nevada, {USA}},
pages = {555--566},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1869459.1869505},
doi = {10.1145/1869459.1869505},
timestamp = {Tue, 22 Jun 2021 17:10:56 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/KleinFF10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/SwaineTDFF10,
author = {James Swaine and
Kevin Tew and
Peter A. Dinda and
Robert Bruce Findler and
Matthew Flatt},
editor = {William R. Cook and
Siobh{\'{a}}n Clarke and
Martin C. Rinard},
title = {Back to the futures: incremental parallelization of existing sequential
runtime systems},
booktitle = {Proceedings of the 25th Annual {ACM} {SIGPLAN} Conference on Object-Oriented
Programming, Systems, Languages, and Applications, {OOPSLA} 2010,
October 17-21, 2010, Reno/Tahoe, Nevada, {USA}},
pages = {583--597},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1869459.1869507},
doi = {10.1145/1869459.1869507},
timestamp = {Tue, 22 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/SwaineTDFF10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rtas/FerreiraCMMY10,
author = {Alexandre Peixoto Ferreira and
Bruce R. Childers and
Rami G. Melhem and
Daniel Moss{\'{e}} and
Mazin Yousif},
editor = {Marco Caccamo},
title = {Using {PCM} in Next-generation Embedded Space Applications},
booktitle = {16th {IEEE} Real-Time and Embedded Technology and Applications Symposium,
{RTAS} 2010, Stockholm, Sweden, April 12-15, 2010},
pages = {153--162},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/RTAS.2010.40},
doi = {10.1109/RTAS.2010.40},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/rtas/FerreiraCMMY10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rv/RahmanCC10,
author = {Musfiq Rahman and
Bruce R. Childers and
Sangyeun Cho},
editor = {Howard Barringer and
Yli{\`{e}}s Falcone and
Bernd Finkbeiner and
Klaus Havelund and
Insup Lee and
Gordon J. Pace and
Grigore Rosu and
Oleg Sokolsky and
Nikolai Tillmann},
title = {StealthWorks: Emulating Memory Errors},
booktitle = {Runtime Verification - First International Conference, {RV} 2010,
St. Julians, Malta, November 1-4, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6418},
pages = {360--367},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-16612-9\_27},
doi = {10.1007/978-3-642-16612-9\_27},
timestamp = {Thu, 26 Jan 2023 14:05:55 +0100},
biburl = {https://dblp.org/rec/conf/rv/RahmanCC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/KayBCDGR10,
author = {David G. Kay and
Kim B. Bruce and
Michael J. Clancy and
Nell B. Dale and
Mark Guzdial and
Eric Roberts},
editor = {Gary Lewandowski and
Steven A. Wolfman and
Thomas J. Cortina and
Ellen Lowenfeld Walker},
title = {Recognizing the most influential {CS} education papers},
booktitle = {Proceedings of the 41st {ACM} technical symposium on Computer science
education, {SIGCSE} 2010, Milwaukee, Wisconsin, USA, March 10-13,
2010},
pages = {196--197},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1734263.1734331},
doi = {10.1145/1734263.1734331},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigcse/KayBCDGR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/hotnets/2010,
editor = {Geoffrey G. Xie and
Robert Beverly and
Robert Tappan Morris and
Bruce Davie},
title = {Proceedings of the 9th {ACM} Workshop on Hot Topics in Networks. HotNets
2010, Monterey, CA, {USA} - October 20 - 21, 2010},
publisher = {{ACM}},
year = {2010},
isbn = {978-1-4503-0409-2},
timestamp = {Tue, 24 Oct 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hotnets/2010.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/lctrts/2010,
editor = {Jaejin Lee and
Bruce R. Childers},
title = {Proceedings of the {ACM} {SIGPLAN/SIGBED} 2010 conference on Languages,
compilers, and tools for embedded systems, {LCTES} 2010, Stockholm,
Sweden, April 13-15, 2010},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1755888},
doi = {10.1145/1755888},
isbn = {978-1-60558-953-4},
timestamp = {Tue, 22 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lctrts/2010.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1011-5294,
author = {Daniel S. Katz and
G. Bruce Berriman and
Robert G. Mann},
title = {Collaborative Astronomical Image Mosaics},
journal = {CoRR},
volume = {abs/1011.5294},
year = {2010},
url = {http://arxiv.org/abs/1011.5294},
eprinttype = {arXiv},
eprint = {1011.5294},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1011-5294.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/daglib/0023092,
author = {Matthias Felleisen and
Robert Bruce Findler and
Matthew Flatt},
title = {Semantics Engineering with {PLT} Redex},
publisher = {{MIT} Press},
year = {2009},
url = {http://mitpress.mit.edu/catalog/item/default.asp?ttype=2\&tid=11885},
isbn = {978-0-262-06275-6},
timestamp = {Wed, 09 Feb 2011 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/daglib/0023092.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/NunamakerRB09,
author = {Jay F. Nunamaker Jr. and
Bruce A. Reinig and
Robert O. Briggs},
title = {Principles for effective virtual teamwork},
journal = {Commun. {ACM}},
volume = {52},
number = {4},
pages = {113--117},
year = {2009},
url = {https://doi.org/10.1145/1498765.1498797},
doi = {10.1145/1498765.1498797},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/NunamakerRB09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dhq/Robertson09,
author = {Bruce Robertson},
title = {Exploring Historical {RDF} with Heml},
journal = {Digit. Humanit. Q.},
volume = {3},
number = {1},
year = {2009},
url = {http://www.digitalhumanities.org/dhq/vol/3/1/000026/000026.html},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dhq/Robertson09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fi/BatchellerGD09,
author = {James K. Batcheller and
Bruce M. Gittings and
Robert I. Dunfey},
title = {A Method for Automating Geospatial Dataset Metadata},
journal = {Future Internet},
volume = {1},
number = {1},
pages = {28--46},
year = {2009},
url = {https://doi.org/10.3390/fi1010028},
doi = {10.3390/FI1010028},
timestamp = {Tue, 14 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fi/BatchellerGD09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijec/ReinigBV09,
author = {Bruce A. Reinig and
Robert O. Briggs and
Gert{-}Jan de Vreede},
title = {Satisfaction as a Function of Perceived Change in Likelihood of Goal
Attainment: {A} Cross-Cultural Study},
journal = {Int. J. e Collab.},
volume = {5},
number = {2},
pages = {61--74},
year = {2009},
url = {https://doi.org/10.4018/jec.2009040104},
doi = {10.4018/JEC.2009040104},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijec/ReinigBV09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/BrooksBMNPRWABBCCCDFFGHIKLMOPPPPSTVWWYYK09,
author = {Bernard R. Brooks and
Charles L. Brooks III and
Alexander D. MacKerell Jr. and
Lennart Nilsson and
Robert J. Petrella and
Beno{\^{\i}}t Roux and
Y. Won and
G. Archontis and
Christian Bartels and
Stefan Boresch and
Amedeo Caflisch and
Leo S. D. Caves and
Qiang Cui and
Aaron R. Dinner and
Michael Feig and
S. Fischer and
Jiali Gao and
Milan Hodoscek and
Wonpil Im and
Krzysztof Kuczera and
Themis Lazaridis and
J. Ma and
Victor Ovchinnikov and
Emanuele Paci and
Richard W. Pastor and
C. B. Post and
J. Z. Pu and
Michael Schaefer and
Bruce Tidor and
Richard M. Venable and
H. Lee Woodcock III and
X. Wu and
W. Yang and
Darrin M. York and
Martin Karplus},
title = {{CHARMM:} The biomolecular simulation program},
journal = {J. Comput. Chem.},
volume = {30},
number = {10},
pages = {1545--1614},
year = {2009},
url = {https://doi.org/10.1002/jcc.21287},
doi = {10.1002/JCC.21287},
timestamp = {Thu, 08 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcc/BrooksBMNPRWABBCCCDFFGHIKLMOPPPPSTVWWYYK09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jdi/VendtMBKPBCD09,
author = {Bruce A. Vendt and
Robert C. McKinstry and
William S. Ball and
Michael A. Kraut and
Fred W. Prior and
Bruce Barton and
James F. Casella and
Michael R. DeBaun},
title = {Silent Cerebral Infarct Transfusion {(SIT)} Trial Imaging Core: Application
of Novel Imaging Information Technology for Rapid and Central Review
of {MRI} of the Brain},
journal = {J. Digit. Imaging},
volume = {22},
number = {3},
pages = {326--343},
year = {2009},
url = {https://doi.org/10.1007/s10278-008-9114-3},
doi = {10.1007/S10278-008-9114-3},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jdi/VendtMBKPBCD09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WiserZSW09,
author = {Robert F. Wiser and
Masoud Zargari and
David K. Su and
Bruce A. Wooley},
title = {A 5-GHz Wireless {LAN} Transmitter with Integrated Tunable High-Q
{RF} Filter},
journal = {{IEEE} J. Solid State Circuits},
volume = {44},
number = {8},
pages = {2114--2125},
year = {2009},
url = {https://doi.org/10.1109/JSSC.2009.2022920},
doi = {10.1109/JSSC.2009.2022920},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WiserZSW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/RaeMGMGGRDH09,
author = {Bruce Rae and
Keith R. Muir and
Zheng Gong and
Jonathan McKendry and
John M. Girkin and
Erdan Gu and
David Renshaw and
Martin D. Dawson and
Robert K. Henderson},
title = {A {CMOS} Time-Resolved Fluorescence Lifetime Analysis Micro-System},
journal = {Sensors},
volume = {9},
number = {11},
pages = {9255--9274},
year = {2009},
url = {https://doi.org/10.3390/s91109255},
doi = {10.3390/S91109255},
timestamp = {Tue, 05 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/RaeMGMGGRDH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/VannanCHODW09,
author = {Suresh K. Santhana Vannan and
Robert B. Cook and
Susan K. Holladay and
Lisa Mai Olsen and
Upendra Dadi and
Bruce E. Wilson},
title = {A Web-Based Subsetting Service for Regional Scale {MODIS} Land Products},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {2},
number = {4},
pages = {319--328},
year = {2009},
url = {https://doi.org/10.1109/JSTARS.2009.2036585},
doi = {10.1109/JSTARS.2009.2036585},
timestamp = {Tue, 31 Mar 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/VannanCHODW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/technometrics/BayarriBCDLPPSW09,
author = {Maria J. Bayarri and
James O. Berger and
Eliza S. Calder and
Keith Dalbey and
Simon Lunagomez and
Abani K. Patra and
E. Bruce Pitman and
Elaine T. Spiller and
Robert L. Wolpert},
title = {Using Statistical and Computer Models to Quantify Volcanic Hazards},
journal = {Technometrics},
volume = {51},
number = {4},
pages = {402--413},
year = {2009},
url = {https://doi.org/10.1198/TECH.2009.08018},
doi = {10.1198/TECH.2009.08018},
timestamp = {Thu, 08 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/technometrics/BayarriBCDLPPSW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/toplas/MatthewsF09,
author = {Jacob Matthews and
Robert Bruce Findler},
title = {Operational semantics for multi-language programs},
journal = {{ACM} Trans. Program. Lang. Syst.},
volume = {31},
number = {3},
pages = {12:1--12:44},
year = {2009},
url = {https://doi.org/10.1145/1498926.1498930},
doi = {10.1145/1498926.1498930},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/toplas/MatthewsF09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/RobertsonMW09,
author = {Cindy M. Robertson and
Blair MacIntyre and
Bruce N. Walker},
title = {An Evaluation of Graphical Context as a Means for Ameliorating the
Effects of Registration Error},
journal = {{IEEE} Trans. Vis. Comput. Graph.},
volume = {15},
number = {2},
pages = {179--192},
year = {2009},
url = {https://doi.org/10.1109/TVCG.2008.100},
doi = {10.1109/TVCG.2008.100},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvcg/RobertsonMW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/3dic/ChenYKCOMDSSBBHWKS09,
author = {Chang{-}Lee Chen and
D.{-}R. Yost and
Jeffrey M. Knecht and
David C. Chapman and
Douglas C. Oakley and
Leonard J. Mahoney and
Joseph P. Donnelly and
Antonio M. Soares and
Vyshnavi Suntharalingam and
Robert Berger and
V. Bolkhovsky and
W. Hu and
Bruce D. Wheeler and
Craig L. Keast and
David C. Shaver},
title = {Wafer-scale 3D integration of InGaAs image sensors with Si readout
circuits},
booktitle = {{IEEE} International Conference on 3D System Integration, 3DIC 2009,
San Francisco, California, USA, 28-30 September 2009},
pages = {1--4},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/3DIC.2009.5306556},
doi = {10.1109/3DIC.2009.5306556},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/3dic/ChenYKCOMDSSBBHWKS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cc/ZhaoCS09,
author = {Min Zhao and
Bruce R. Childers and
Mary Lou Soffa},
editor = {Oege de Moor and
Michael I. Schwartzbach},
title = {A Framework for Exploring Optimization Properties},
booktitle = {Compiler Construction, 18th International Conference, {CC} 2009, Held
as Part of the Joint European Conferences on Theory and Practice of
Software, {ETAPS} 2009, York, UK, March 22-29, 2009. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5501},
pages = {32--47},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-00722-4\_4},
doi = {10.1007/978-3-642-00722-4\_4},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/cc/ZhaoCS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cgo/KumarCS09,
author = {Naveen Kumar and
Bruce R. Childers and
Mary Lou Soffa},
title = {Transparent Debugging of Dynamically Optimized Code},
booktitle = {Proceedings of the {CGO} 2009, The Seventh International Symposium
on Code Generation and Optimization, Seattle, Washington, USA, March
22-25, 2009},
pages = {275--286},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/CGO.2009.28},
doi = {10.1109/CGO.2009.28},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cgo/KumarCS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/GruensteinOLRZRMSGC09,
author = {Alexander Gruenstein and
Jarrod Orszulak and
Sean Liu and
Shannon C. Roberts and
Jeff Zabel and
Bryan Reimer and
Bruce Mehler and
Stephanie Seneff and
James R. Glass and
Joseph F. Coughlin},
editor = {Dan R. Olsen Jr. and
Richard B. Arthur and
Ken Hinckley and
Meredith Ringel Morris and
Scott E. Hudson and
Saul Greenberg},
title = {City browser: developing a conversational automotive {HMI}},
booktitle = {Proceedings of the 27th International Conference on Human Factors
in Computing Systems, {CHI} 2009, Extended Abstracts Volume, Boston,
MA, USA, April 4-9, 2009},
pages = {4291--4296},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1520340.1520655},
doi = {10.1145/1520340.1520655},
timestamp = {Fri, 14 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/GruensteinOLRZRMSGC09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/LokeDOWLWHTGALWF09,
author = {Alvin Leng Sun Loke and
Bruce Andrew Doyle and
Michael M. Oshima and
Wade L. Williams and
Robert G. Lewis and
Charles Lin Wang and
Audie Hanpachern and
Karen M. Tucker and
Prashanth Gurunath and
Gladney C. Asada and
Chad O. Lackey and
Tin Tin Wee and
Emerson S. Fang},
title = {Loopback architecture for wafer-level at-speed testing of embedded
HyperTransport\({}^{\mbox{TM}}\) processor links},
booktitle = {{IEEE} Custom Integrated Circuits Conference, {CICC} 2009, San Jose,
California, USA, 13-16 September, 2009, Proceedings},
pages = {605--608},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/CICC.2009.5280778},
doi = {10.1109/CICC.2009.5280778},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cicc/LokeDOWLWHTGALWF09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/BaiocchiC09,
author = {Jos{\'{e}} Baiocchi and
Bruce R. Childers},
title = {Heterogeneous code cache: using scratchpad and main memory in dynamic
binary translators},
booktitle = {Proceedings of the 46th Design Automation Conference, {DAC} 2009,
San Francisco, CA, USA, July 26-31, 2009},
pages = {744--749},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1629911.1630103},
doi = {10.1145/1629911.1630103},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dac/BaiocchiC09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dcoss/LiZC09,
author = {Weijia Li and
Youtao Zhang and
Bruce R. Childers},
editor = {Bhaskar Krishnamachari and
Subhash Suri and
Wendi Rabiner Heinzelman and
Urbashi Mitra},
title = {{MCP:} An Energy-Efficient Code Distribution Protocol for Multi-Application
WSNs},
booktitle = {Distributed Computing in Sensor Systems, 5th {IEEE} International
Conference, {DCOSS} 2009, Marina del Rey, CA, USA, June 8-10, 2009.
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5516},
pages = {259--272},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-02085-8\_19},
doi = {10.1007/978-3-642-02085-8\_19},
timestamp = {Tue, 14 May 2019 10:00:38 +0200},
biburl = {https://dblp.org/rec/conf/dcoss/LiZC09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/drcn/DoverspikeC09,
author = {Robert D. Doverspike and
Bruce Cortez},
title = {Restoration in carrier networks},
booktitle = {7th International Workshop on Design of Reliable Communication Networks,
{DRCN} 2009, Washington, DC, USA, October 25-28, 2009},
pages = {45--54},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/DRCN.2009.5340025},
doi = {10.1109/DRCN.2009.5340025},
timestamp = {Thu, 20 Oct 2022 10:45:43 +0200},
biburl = {https://dblp.org/rec/conf/drcn/DoverspikeC09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecctd/LeleSWM09,
author = {Sneha Lele and
Robert Sobot and
Matthew Waxer and
J. Bruce Morton},
title = {Steady-state visually evoked {EEG} signal processing with tuneable
continuous-time bandpass sigma-delta modulators},
booktitle = {19th European Conference on Circuit Theory and Design, {ECCTD} 2009,
Antalya, Turkey, August 23-27, 2009},
pages = {433--436},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/ECCTD.2009.5275014},
doi = {10.1109/ECCTD.2009.5275014},
timestamp = {Fri, 13 Nov 2020 09:23:49 +0100},
biburl = {https://dblp.org/rec/conf/ecctd/LeleSWM09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/AhmedFMW09,
author = {Amal Ahmed and
Robert Bruce Findler and
Jacob Matthews and
Philip Wadler},
editor = {Tobias Wrigstad and
Nate Nystrom and
Jan Vitek},
title = {Blame for all},
booktitle = {Proceedings for the 1st workshop on Script to Program Evolution, {STOP}
'09, Genova, Italy, July 6, 2009},
pages = {1--13},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1570506.1570507},
doi = {10.1145/1570506.1570507},
timestamp = {Tue, 05 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ecoop/AhmedFMW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/Tobin-Hochstadt09,
author = {Sam Tobin{-}Hochstadt and
Robert Bruce Findler},
editor = {Tobias Wrigstad and
Nate Nystrom and
Jan Vitek},
title = {Cycles without pollution: a gradual typing poem},
booktitle = {Proceedings for the 1st workshop on Script to Program Evolution, {STOP}
'09, Genova, Italy, July 6, 2009},
pages = {47--57},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1570506.1570512},
doi = {10.1145/1570506.1570512},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ecoop/Tobin-Hochstadt09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esop/WadlerF09,
author = {Philip Wadler and
Robert Bruce Findler},
editor = {Giuseppe Castagna},
title = {Well-Typed Programs Can't Be Blamed},
booktitle = {Programming Languages and Systems, 18th European Symposium on Programming,
{ESOP} 2009, Held as Part of the Joint European Conferences on Theory
and Practice of Software, {ETAPS} 2009, York, UK, March 22-29, 2009.
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5502},
pages = {1--16},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-00590-9\_1},
doi = {10.1007/978-3-642-00590-9\_1},
timestamp = {Tue, 14 May 2019 10:00:41 +0200},
biburl = {https://dblp.org/rec/conf/esop/WadlerF09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fusion/WaxmanFIASKMGTBLJVABHEHC09,
author = {Allen M. Waxman and
David A. Fay and
Paul Ilardi and
Pablo O. Arambel and
Xinzhuo Shen and
John Krant and
Timothy Moore and
Brian Gorin and
Scott Tilden and
Bruce Baron and
James Lobowiecki and
Robert Jelavic and
Cliff Verbiar and
John Antoniades and
Mark Baumback and
Daniel Hass and
Jonathan Edwards and
Samuel Henderson and
Dave Chester},
title = {Fused {EO/IR} detection {\&} tracking of surface targets: Flight
demonstrations},
booktitle = {12th International Conference on Information Fusion, {FUSION} '09,
Seattle, Washington, USA, July 6-9, 2009},
pages = {1439--1443},
publisher = {{IEEE}},
year = {2009},
url = {https://ieeexplore.ieee.org/document/5203852/},
timestamp = {Mon, 09 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fusion/WaxmanFIASKMGTBLJVABHEHC09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icas/OkumuraCM09,
author = {Takashi Okumura and
Bruce R. Childers and
Daniel Moss{\'{e}}},
editor = {Radu Calinescu and
Fidel Liberal and
Mauricio Mar{\'{\i}}n and
Lourdes Pe{\~{n}}alver Herrero and
Carlos Turro and
Manuela Popescu},
title = {Network {I/O} Extensibility without Administrator Privilege},
booktitle = {Fifth International Conference on Autonomic and Autonomous Systems,
{ICAS} 2009, Valencia, Spain, 20-25 April 2009},
pages = {168--173},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ICAS.2009.12},
doi = {10.1109/ICAS.2009.12},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icas/OkumuraCM09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icfp/FelleisenFFK09,
author = {Matthias Felleisen and
Robert Bruce Findler and
Matthew Flatt and
Shriram Krishnamurthi},
editor = {Graham Hutton and
Andrew P. Tolmach},
title = {A functional {I/O} system or, fun for freshman kids},
booktitle = {Proceeding of the 14th {ACM} {SIGPLAN} international conference on
Functional programming, {ICFP} 2009, Edinburgh, Scotland, UK, August
31 - September 2, 2009},
pages = {47--58},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1596550.1596561},
doi = {10.1145/1596550.1596561},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icfp/FelleisenFFK09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icfp/FlattBF09,
author = {Matthew Flatt and
Eli Barzilay and
Robert Bruce Findler},
editor = {Graham Hutton and
Andrew P. Tolmach},
title = {Scribble: closing the book on ad hoc documentation tools},
booktitle = {Proceeding of the 14th {ACM} {SIGPLAN} international conference on
Functional programming, {ICFP} 2009, Edinburgh, Scotland, UK, August
31 - September 2, 2009},
pages = {109--120},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1596550.1596569},
doi = {10.1145/1596550.1596569},
timestamp = {Fri, 25 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icfp/FlattBF09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icis/HeckWWBKBSCSKW09,
author = {Eric van Heck and
Dongjun Wu and
Bruce W. Weber and
Yannis Bakos and
Chris F. Kemerer and
Erik Brynjolfsson and
Abraham Seidmann and
Eric K. Clemons and
Sandra Slaughter and
Robert J. Kauffman and
Andrew B. Whinston},
editor = {Jay F. Nunamaker Jr. and
Wendy L. Currie},
title = {Are We Wise About Sub-Fields in IS? Lessons from Forming and Sustaining
a Research Community},
booktitle = {Proceedings of the International Conference on Information Systems,
{ICIS} 2009, Phoenix, Arizona, USA, December 15-18, 2009},
pages = {187},
publisher = {Association for Information Systems},
year = {2009},
url = {http://aisel.aisnet.org/icis2009/187},
timestamp = {Fri, 15 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icis/HeckWWBKBSCSKW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/LiWRRBRH09,
author = {Day{-}Uei Li and
Richard Walker and
Justin A. Richardson and
Bruce Rae and
Alex Buts and
David Renshaw and
Robert K. Henderson},
title = {{FPGA} Implementation of a Video-rate Fluorescence Lifetime Imaging
System with a 32{\texttimes}32 {CMOS} Single-photon Avalanche Diode
Array},
booktitle = {International Symposium on Circuits and Systems {(ISCAS} 2009), 24-17
May 2009, Taipei, Taiwan},
pages = {3082--3085},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/ISCAS.2009.5118454},
doi = {10.1109/ISCAS.2009.5118454},
timestamp = {Tue, 05 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iscas/LiWRRBRH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lctrts/MooreBCDH09,
author = {Ryan W. Moore and
Jos{\'{e}} Baiocchi and
Bruce R. Childers and
Jack W. Davidson and
Jason Hiser},
editor = {Christoph M. Kirsch and
Mahmut T. Kandemir},
title = {Addressing the challenges of {DBT} for the {ARM} architecture},
booktitle = {Proceedings of the 2009 {ACM} {SIGPLAN/SIGBED} conference on Languages,
compilers, and tools for embedded systems, {LCTES} 2009, Dublin, Ireland,
June 19-20, 2009},
pages = {147--156},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1542452.1542472},
doi = {10.1145/1542452.1542472},
timestamp = {Fri, 25 Jun 2021 14:48:54 +0200},
biburl = {https://dblp.org/rec/conf/lctrts/MooreBCDH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/BaileyBFHR09,
author = {Mark W. Bailey and
Kim B. Bruce and
Kathleen Fisher and
Robert Harper and
Stuart Reges},
editor = {Sue Fitzgerald and
Mark Guzdial and
Gary Lewandowski and
Steven A. Wolfman},
title = {Report of the 2008 {SIGPLAN} programming languages curriculum workshop:
preliminary report},
booktitle = {Proceedings of the 40th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 2009, Chattanooga, TN, USA, March 4-7, 2009},
pages = {132--133},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1508865.1508913},
doi = {10.1145/1508865.1508913},
timestamp = {Tue, 09 Mar 2021 15:32:12 +0100},
biburl = {https://dblp.org/rec/conf/sigcse/BaileyBFHR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aslib/LaurieR08,
author = {Bruce A. E. Laurie and
Stephen Andrew Roberts},
title = {The convergence of information systems and information management:
Environmental changes and pedagogical challenges},
journal = {Aslib Proc.},
volume = {60},
number = {6},
pages = {661--671},
year = {2008},
url = {https://doi.org/10.1108/00012530810924320},
doi = {10.1108/00012530810924320},
timestamp = {Sat, 05 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aslib/LaurieR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cl/ChildersK08,
author = {Bruce R. Childers and
Mahmut T. Kandemir},
title = {Preface},
journal = {Comput. Lang. Syst. Struct.},
volume = {34},
number = {4},
pages = {151--152},
year = {2008},
url = {https://doi.org/10.1016/j.cl.2007.07.002},
doi = {10.1016/J.CL.2007.07.002},
timestamp = {Tue, 11 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cl/ChildersK08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/BradshawBCDDDHHKKMR08,
author = {Paul L. Bradshaw and
Karen Brannon and
Thomas Clark and
Kirby G. Dahman and
Sangeeta Doraiswamy and
Linda Duyanovich and
Bruce Light Hillsberg and
Wayne Hineman and
Michael Kaczmarski and
Bernhard J. Klingenberg and
Xiaonan Ma and
Robert M. Rees},
title = {Archive storage system design for long-term storage of massive amounts
of data},
journal = {{IBM} J. Res. Dev.},
volume = {52},
number = {4-5},
pages = {379--388},
year = {2008},
url = {https://doi.org/10.1147/rd.524.0379},
doi = {10.1147/RD.524.0379},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/BradshawBCDDDHHKKMR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/ZhouEHGRB08,
author = {Ruhong Zhou and
Maria Eleftheriou and
Chung{-}Chau Hon and
Robert S. Germain and
Ajay K. Royyuru and
Bruce J. Berne},
title = {Massively parallel molecular dynamics simulations of lysozyme unfolding},
journal = {{IBM} J. Res. Dev.},
volume = {52},
number = {1-2},
pages = {19--30},
year = {2008},
url = {https://doi.org/10.1147/rd.521.0019},
doi = {10.1147/RD.521.0019},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/ZhouEHGRB08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpca/SupinskiSB08,
author = {Bronis R. de Supinski and
Martin Schulz and
Vasily V. Bulatov and
William H. Cabot and
Bor Chan and
Andrew W. Cook and
Erik W. Draeger and
James N. Glosli and
Jeffrey A. Greenough and
Keith W. Henderson and
Alison Kubota and
Steve Louis and
Brian J. Miller and
Mehul V. Patel and
Thomas E. Spelce and
Frederick H. Streitz and
Peter L. Williams and
Robert K. Yates and
Andy Yoo and
George Alm{\'{a}}si and
Gyan Bhanot and
Alan Gara and
John A. Gunnels and
Manish Gupta and
Jos{\'{e}} E. Moreira and
James C. Sexton and
Robert Walkup and
Charles Archer and
Fran{\c{c}}ois Gygi and
Timothy C. Germann and
Kai Kadau and
Peter S. Lomdahl and
Charles A. Rendleman and
Michael L. Welcome and
William McLendon and
Bruce Hendrickson and
Franz Franchetti and
Stefan Kral and
Juergen Lorenz and
Christoph W. {\"{U}}berhuber and
Edmond Chow and
{\"{U}}mit V. {\c{C}}ataly{\"{u}}rek},
title = {BlueGene/L applications: Parallelism On a Massive Scale},
journal = {Int. J. High Perform. Comput. Appl.},
volume = {22},
number = {1},
pages = {33--51},
year = {2008},
url = {https://doi.org/10.1177/1094342007085025},
doi = {10.1177/1094342007085025},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhpca/SupinskiSB08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/integration/BrandonHBGCHGBGZRBES08,
author = {Tyler L. Brandon and
Robert Hang and
Gary Block and
Vincent C. Gaudet and
Bruce F. Cockburn and
Sheryl L. Howard and
Christian Giasson and
Keith Boyle and
Paul Goud and
Siavash Sheikh Zeinoddin and
Anthony Rapley and
Stephen Bates and
Duncan G. Elliott and
Christian Schlegel},
title = {A scalable {LDPC} decoder {ASIC} architecture with bit-serial message
exchange},
journal = {Integr.},
volume = {41},
number = {3},
pages = {385--398},
year = {2008},
url = {https://doi.org/10.1016/j.vlsi.2007.07.003},
doi = {10.1016/J.VLSI.2007.07.003},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/integration/BrandonHBGCHGBGZRBES08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jais/BriggsRV08,
author = {Robert O. Briggs and
Bruce A. Reinig and
Gert{-}Jan de Vreede},
title = {The Yield Shift Theory of Satisfaction and Its Application to the
{IS/IT} Domain},
journal = {J. Assoc. Inf. Syst.},
volume = {9},
number = {5},
pages = {14},
year = {2008},
url = {https://doi.org/10.17705/1jais.00160},
doi = {10.17705/1JAIS.00160},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jais/BriggsRV08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jct/BrownLR08,
author = {Tom C. Brown and
Bruce M. Landman and
Aaron Robertson},
title = {Bounds on some van der Waerden numbers},
journal = {J. Comb. Theory {A}},
volume = {115},
number = {7},
pages = {1304--1309},
year = {2008},
url = {https://doi.org/10.1016/j.jcta.2008.01.005},
doi = {10.1016/J.JCTA.2008.01.005},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jct/BrownLR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfp/MatthewsF08,
author = {Jacob Matthews and
Robert Bruce Findler},
title = {An operational semantics for Scheme},
journal = {J. Funct. Program.},
volume = {18},
number = {1},
pages = {47--86},
year = {2008},
url = {https://doi.org/10.1017/S0956796807006478},
doi = {10.1017/S0956796807006478},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfp/MatthewsF08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/KonstanceEASCHMSK08,
author = {Richard P. Konstance and
Eric L. Eisenstein and
Kevin J. Anstrom and
Linda K. Shaw and
Robert M. Califf and
Robert A. Harrington and
David Bruce Matchar and
Kevin A. Schulman and
David F. Kong},
title = {Outcomes of Second Revascularization Procedures after Stent Implantation},
journal = {J. Medical Syst.},
volume = {32},
number = {2},
pages = {177--186},
year = {2008},
url = {https://doi.org/10.1007/s10916-007-9120-x},
doi = {10.1007/S10916-007-9120-X},
timestamp = {Sat, 19 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jms/KonstanceEASCHMSK08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/BindewaldHYKS08,
author = {Eckart Bindewald and
Robert Hayes and
Yaroslava G. Yingling and
Wojciech Kasprzak and
Bruce A. Shapiro},
title = {RNAJunction: a database of {RNA} junctions and kissing loops for three-dimensional
structural analysis and nanodesign},
journal = {Nucleic Acids Res.},
volume = {36},
number = {Database-Issue},
pages = {392--397},
year = {2008},
url = {https://doi.org/10.1093/nar/gkm842},
doi = {10.1093/NAR/GKM842},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/BindewaldHYKS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmetrics/CurryKMSTAW08,
author = {Roger Curry and
Cameron Kiddle and
Nayden Markatchev and
Rob Simmonds and
Tingxi Tan and
Martin F. Arlitt and
Bruce Walker},
title = {Running applications efficiently in online social networks},
journal = {{SIGMETRICS} Perform. Evaluation Rev.},
volume = {36},
number = {2},
pages = {71--74},
year = {2008},
url = {https://doi.org/10.1145/1453175.1453188},
doi = {10.1145/1453175.1453188},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigmetrics/CurryKMSTAW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmetrics/TanSAAW08,
author = {Tingxi Tan and
Rob Simmonds and
Bradley Arlt and
Martin F. Arlitt and
Bruce Walker},
title = {Image management in a virtualized data center},
journal = {{SIGMETRICS} Perform. Evaluation Rev.},
volume = {36},
number = {2},
pages = {4--9},
year = {2008},
url = {https://doi.org/10.1145/1453175.1453177},
doi = {10.1145/1453175.1453177},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigmetrics/TanSAAW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigplan/AllenBBBFFHKKLLLPRRSTW08,
author = {Eric Allen and
Mark W. Bailey and
Rastislav Bod{\'{\i}}k and
Kim B. Bruce and
Kathleen Fisher and
Stephen N. Freund and
Robert Harper and
Chandra Krintz and
Shriram Krishnamurthi and
James R. Larus and
Doug Lea and
Gary T. Leavens and
Lori L. Pollock and
Stuart Reges and
Martin C. Rinard and
Mark A. Sheldon and
Franklyn A. Turbak and
Mitchell Wand},
title = {{SIGPLAN} programming language curriculum workshop: Discussion Summaries
and recommendations},
journal = {{ACM} {SIGPLAN} Notices},
volume = {43},
number = {11},
pages = {6--29},
year = {2008},
url = {https://doi.org/10.1145/1480828.1480831},
doi = {10.1145/1480828.1480831},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigplan/AllenBBBFFHKKLLLPRRSTW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/WesselFFHPSTB08,
author = {John E. Wessel and
Robert W. Farley and
Alfred Fote and
Ye Hong and
Gene A. Poe and
Steven D. Swadley and
Bruce Thomas and
Donald J. Boucher},
title = {Calibration and Validation of {DMSP} {SSMIS} Lower Atmospheric Sounding
Channels},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {46},
number = {4},
pages = {946--961},
year = {2008},
url = {https://doi.org/10.1109/TGRS.2008.917132},
doi = {10.1109/TGRS.2008.917132},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/WesselFFHPSTB08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/webology/000208,
author = {Robert Bruce},
title = {Descriptor and Folksonomy Concurrence in Education Related Scholarly
Research},
journal = {Webology},
volume = {5},
number = {3},
year = {2008},
url = {https://www.webology.org/abstract.php?id=143},
timestamp = {Thu, 20 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/webology/000208.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/GlassP08,
author = {Michael Robert Glass and
Bruce W. Porter},
title = {Improving Semantic Integration by Learning Semantic Interpretation
Rules},
booktitle = {Semantic Scientific Knowledge Integration, Papers from the 2008 {AAAI}
Spring Symposium, Technical Report SS-08-05, Stanford, California,
USA, March 26-28, 2008},
pages = {24--28},
publisher = {{AAAI}},
year = {2008},
url = {http://www.aaai.org/Library/Symposia/Spring/2008/ss08-05-006.php},
timestamp = {Thu, 12 Jul 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaaiss/GlassP08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcis/JinR08,
author = {Leigh Jin and
Bruce Robertson},
editor = {Izak Benbasat and
Ali R. Montazemi},
title = {Lessons Learned from the Development and Marketing of Mozilla Firefox
Browser},
booktitle = {Learning from the past {\&} charting the future of the discipline.
14th Americas Conference on Information Systems, {AMCIS} 2008, Toronto,
Ontario, Canada, August 14-17, 2008},
pages = {279},
publisher = {Association for Information Systems},
year = {2008},
url = {http://aisel.aisnet.org/amcis2008/279},
timestamp = {Tue, 03 Jan 2012 16:36:36 +0100},
biburl = {https://dblp.org/rec/conf/amcis/JinR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcis/VreedeRB08,
author = {Gert{-}Jan de Vreede and
Bruce A. Reinig and
Robert O. Briggs},
editor = {Izak Benbasat and
Ali R. Montazemi},
title = {e-Collaboration Satisfaction: Empirical Field Studies of Disconfirmation
Theory Across Two Cultures},
booktitle = {Learning from the past {\&} charting the future of the discipline.
14th Americas Conference on Information Systems, {AMCIS} 2008, Toronto,
Ontario, Canada, August 14-17, 2008},
pages = {298},
publisher = {Association for Information Systems},
year = {2008},
url = {http://aisel.aisnet.org/amcis2008/298},
timestamp = {Tue, 03 Jan 2012 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/amcis/VreedeRB08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biostec/LiRRHB08,
author = {Day{-}Uei Li and
Bruce Rae and
David Renshaw and
Robert K. Henderson and
Eleanor Bonnist},
editor = {Pedro Encarna{\c{c}}{\~{a}}o and
Ant{\'{o}}nio P. Veloso},
title = {On-Chip Fluorescence Lifetime Extraction using Synchronous Gating
Scheme - Theoretical Error Analysis and Practical Implementation},
booktitle = {Proceedings of the First International Conference on Biomedical Electronics
and Devices, {BIOSIGNALS} 2008, Funchal, Madeira, Portugal, January
28-31, 2008, Volume 2},
pages = {171--176},
publisher = {{INSTICC} - Institute for Systems and Technologies of Information,
Control and Communication},
year = {2008},
timestamp = {Tue, 05 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/biostec/LiRRHB08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biostec/McCormickKEMBGNHBLV08,
author = {Daniel McCormick and
Robert Kirton and
Alan Easteal and
Simon Malpas and
Carolyn J. Barrett and
Sarah Jane Guild and
Poul M. F. Nielsen and
Aiguo Patrick Hu and
David Budgett and
Matthew Lim and
Bruce van Vliet},
editor = {Teodiano Freire Bastos{-}Filho and
Hugo Gamboa},
title = {Simultaneous Wireless Measurement of Blood Pressure and Sympathetic
Nerve Activity - a System for Investigating Neural Control Mechanisms
in Long Term Blood Pressure Regulation},
booktitle = {Proceedings of the First International Conference on Biomedical Electronics
and Devices, {BIODEVICES} 2008, Funchal, Madeira, Portugal, January
28-31, 2008, Volume 2},
pages = {204--209},
publisher = {{INSTICC} - Institute for Systems and Technologies of Information,
Control and Communication},
year = {2008},
timestamp = {Mon, 30 Sep 2024 21:31:02 +0200},
biburl = {https://dblp.org/rec/conf/biostec/McCormickKEMBGNHBLV08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cases/BaiocchiCDH08,
author = {Jos{\'{e}} Baiocchi and
Bruce R. Childers and
Jack W. Davidson and
Jason Hiser},
editor = {Erik R. Altman},
title = {Reducing pressure in bounded {DBT} code caches},
booktitle = {Proceedings of the 2008 International Conference on Compilers, Architecture,
and Synthesis for Embedded Systems, {CASES} 2008, Atlanta, GA, USA,
October 19-24, 2008},
pages = {109--118},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1450095.1450114},
doi = {10.1145/1450095.1450114},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cases/BaiocchiCDH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/WiserZSW08,
author = {Robert F. Wiser and
Masoud Zargari and
David K. Su and
Bruce A. Wooley},
title = {A 5-GHz wireless {LAN} transmitter with integrated tunable high-Q
{RF} filter},
booktitle = {Proceedings of the {IEEE} 2008 Custom Integrated Circuits Conference,
{CICC} 2008, DoubleTree Hotel, San Jose, California, USA, September
21-24, 2008},
pages = {607--610},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/CICC.2008.4672159},
doi = {10.1109/CICC.2008.4672159},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cicc/WiserZSW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/CurryKMSTAW08,
author = {Roger Curry and
Cameron Kiddle and
Nayden Markatchev and
Rob Simmonds and
Tingxi Tan and
Martin F. Arlitt and
Bruce Walker},
title = {Facebook Meets the Virtualized Enterprise},
booktitle = {12th International {IEEE} Enterprise Distributed Object Computing
Conference, {ECOC} 2008, 15-19 September 2008, Munich, Germany},
pages = {286--292},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/EDOC.2008.19},
doi = {10.1109/EDOC.2008.19},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/edoc/CurryKMSTAW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euc/LiDZCZY08,
author = {Weijia Li and
Yu Du and
Youtao Zhang and
Bruce R. Childers and
Ping Zhou and
Jun Yang},
editor = {Cheng{-}Zhong Xu and
Minyi Guo},
title = {Adaptive Buffer Management for Efficient Code Dissemination in Multi-Application
Wireless Sensor Networks},
booktitle = {2008 {IEEE/IPIP} International Conference on Embedded and Ubiquitous
Computing {(EUC} 2008), Shanghai, China, December 17-20, 2008, Volume
{I}},
pages = {295--301},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/EUC.2008.160},
doi = {10.1109/EUC.2008.160},
timestamp = {Thu, 14 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/euc/LiDZCZY08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/ReinigBV08,
author = {Bruce A. Reinig and
Robert O. Briggs and
Gert{-}Jan de Vreede},
title = {A Cross-Cultural Investigation of the Goal-Attainment-Likelihood Construct
and Its Effect on Satisfaction with Technology Supported Collaboration},
booktitle = {41st Hawaii International International Conference on Systems Science
{(HICSS-41} 2008), Proceedings, 7-10 January 2008, Waikoloa, Big Island,
HI, {USA}},
pages = {13},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/HICSS.2008.14},
doi = {10.1109/HICSS.2008.14},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/ReinigBV08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hipeac/AbouGhazalehCMM08,
author = {Nevine AbouGhazaleh and
Bruce R. Childers and
Daniel Moss{\'{e}} and
Rami G. Melhem},
editor = {Per Stenstr{\"{o}}m and
Michel Dubois and
Manolis Katevenis and
Rajiv Gupta and
Theo Ungerer},
title = {Integrated {CPU} Cache Power Management in Multiple Clock Domain Processors},
booktitle = {High Performance Embedded Architectures and Compilers, Third International
Conference, HiPEAC 2008, G{\"{o}}teborg, Sweden, January 27-29,
2008, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4917},
pages = {209--223},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-77560-7\_15},
doi = {10.1007/978-3-540-77560-7\_15},
timestamp = {Mon, 06 Dec 2021 16:37:01 +0100},
biburl = {https://dblp.org/rec/conf/hipeac/AbouGhazalehCMM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismar/RobertsonMW08,
author = {Cindy M. Robertson and
Blair MacIntyre and
Bruce N. Walker},
title = {An evaluation of graphical context when the graphics are outside of
the task area},
booktitle = {7th {IEEE} and {ACM} International Symposium on Mixed and Augmented
Reality, {ISMAR} 2008, Cambridge, UK, 15-18th September 2008},
pages = {73--76},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ISMAR.2008.4637328},
doi = {10.1109/ISMAR.2008.4637328},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ismar/RobertsonMW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/RaeGMGGRCDH08,
author = {Bruce Rae and
Chris Griffin and
Keith R. Muir and
John M. Girkin and
Erdan Gu and
David R. Renshaw and
Edoardo Charbon and
Martin D. Dawson and
Robert K. Henderson},
title = {A Microsystem for Time-Resolved Fluorescence Analysis using {CMOS}
Single-Photon Avalanche Diodes and Micro-LEDs},
booktitle = {2008 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2008, Digest of Technical Papers, San Francisco, CA, USA, February
3-7, 2008},
pages = {166--167},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/ISSCC.2008.4523109},
doi = {10.1109/ISSCC.2008.4523109},
timestamp = {Tue, 05 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/RaeGMGGRCDH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vee/OkumuraCM08,
author = {Takashi Okumura and
Bruce R. Childers and
Daniel Moss{\'{e}}},
editor = {David Gregg and
Vikram S. Adve and
Brian N. Bershad},
title = {Running a Java {VM} inside an operating system kernel},
booktitle = {Proceedings of the 4th International Conference on Virtual Execution
Environments, {VEE} 2008, Seattle, WA, USA, March 5-7, 2008},
pages = {161--170},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1346256.1346279},
doi = {10.1145/1346256.1346279},
timestamp = {Mon, 12 Jul 2021 15:34:15 +0200},
biburl = {https://dblp.org/rec/conf/vee/OkumuraCM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/dagstuhl/2008P8441,
editor = {Bruce R. Childers and
Jack W. Davidson and
Koen De Bosschere and
Mary Lou Soffa},
title = {Emerging Uses and Paradigms for Dynamic Binary Translation, 26.10.
- 31.10.2008},
series = {Dagstuhl Seminar Proceedings},
volume = {08441},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik, Germany},
year = {2008},
url = {http://drops.dagstuhl.de/portals/08441/},
timestamp = {Thu, 10 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dagstuhl/2008P8441.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dagstuhl/AltmanCCDBSEFGH08,
author = {Erik R. Altman and
Bruce R. Childers and
Robert S. Cohn and
Jack W. Davidson and
Koen De Bosschere and
Bjorn De Sutter and
M. Anton Ertl and
Michael Franz and
Yuan Xiang Gu and
Matthias Hauswirth and
Thomas Heinz and
Wei{-}Chung Hsu and
Jens Knoop and
Andreas Krall and
Naveen Kumar and
Jonas Maebe and
Robert Muth and
Xavier Rival and
Erven Rohou and
Roni Rosner and
Mary Lou Soffa and
Jens Tr{\"{o}}ger and
Christopher A. Vick},
editor = {Bruce R. Childers and
Jack W. Davidson and
Koen De Bosschere and
Mary Lou Soffa},
title = {08441 Final Report - Emerging Uses and Paradigms for Dynamic Binary
Translation},
booktitle = {Emerging Uses and Paradigms for Dynamic Binary Translation, 26.10.
- 31.10.2008},
series = {Dagstuhl Seminar Proceedings},
volume = {08441},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik, Germany},
year = {2008},
url = {http://drops.dagstuhl.de/opus/volltexte/2009/1888/},
timestamp = {Thu, 10 Jun 2021 13:02:07 +0200},
biburl = {https://dblp.org/rec/conf/dagstuhl/AltmanCCDBSEFGH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dagstuhl/ChildersDBS08,
author = {Bruce R. Childers and
Jack W. Davidson and
Koen De Bosschere and
Mary Lou Soffa},
editor = {Bruce R. Childers and
Jack W. Davidson and
Koen De Bosschere and
Mary Lou Soffa},
title = {08441 Abstracts Collection - Emerging Uses and Paradigms for Dynamic
Binary Translation},
booktitle = {Emerging Uses and Paradigms for Dynamic Binary Translation, 26.10.
- 31.10.2008},
series = {Dagstuhl Seminar Proceedings},
volume = {08441},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik, Germany},
year = {2008},
url = {http://drops.dagstuhl.de/opus/volltexte/2009/1889/},
timestamp = {Thu, 23 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dagstuhl/ChildersDBS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/FreueHSZBSMKMN07,
author = {Gabriela V. Cohen Freue and
Zsuzsanna Hollander and
Enqing Shen and
Ruben H. Zamar and
Robert Balshaw and
Andreas Scherer and
Bruce McManus and
Paul Keown and
W. Robert McMaster and
Raymond T. Ng},
title = {{MDQC:} a new quality assessment method for microarrays based on quality
control reports},
journal = {Bioinform.},
volume = {23},
number = {23},
pages = {3162--3169},
year = {2007},
url = {https://doi.org/10.1093/bioinformatics/btm487},
doi = {10.1093/BIOINFORMATICS/BTM487},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/FreueHSZBSMKMN07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/TaylorRWCMS07,
author = {Bruce Taylor and
David Robertson and
Nirmalie Wiratunga and
Susan Craw and
Dawn Mitchell and
Elaine Stewart},
title = {Using computer aided case based reasoning to support clinical reasoning
in community occupational therapy},
journal = {Comput. Methods Programs Biomed.},
volume = {87},
number = {2},
pages = {170--179},
year = {2007},
url = {https://doi.org/10.1016/j.cmpb.2007.05.007},
doi = {10.1016/J.CMPB.2007.05.007},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cmpb/TaylorRWCMS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/NandaMHGDDK07,
author = {Ashwini K. Nanda and
J. Randal Moulic and
Robert E. Hanson and
Gottfried Goldrian and
Michael N. Day and
Bruce D. D'Amora and
Sreeni Kesavarapu},
title = {Cell/B.E. blades: Building blocks for scalable, real-time, interactive,
and digital media servers},
journal = {{IBM} J. Res. Dev.},
volume = {51},
number = {5},
pages = {573--582},
year = {2007},
url = {https://doi.org/10.1147/rd.515.0573},
doi = {10.1147/RD.515.0573},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/NandaMHGDDK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijes/AbouGhazalehCMM07,
author = {Nevine AbouGhazaleh and
Bruce R. Childers and
Daniel Moss{\'{e}} and
Rami G. Melhem},
title = {Power management in external memory using {PA-CDRAM}},
journal = {Int. J. Embed. Syst.},
volume = {3},
number = {1/2},
pages = {65--72},
year = {2007},
url = {https://doi.org/10.1504/IJES.2007.016034},
doi = {10.1504/IJES.2007.016034},
timestamp = {Fri, 11 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijes/AbouGhazalehCMM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpsa/PillaCFCN07,
author = {Maur{\'{\i}}cio L. Pilla and
Bruce R. Childers and
Felipe Maia Galv{\~{a}}o Fran{\c{c}}a and
Amarildo T. da Costa and
Philippe Olivier Alexandre Navaux},
title = {Limits for a feasible speculative trace reuse implementation},
journal = {Int. J. High Perform. Syst. Archit.},
volume = {1},
number = {1},
pages = {69--76},
year = {2007},
url = {https://doi.org/10.1504/IJHPSA.2007.013293},
doi = {10.1504/IJHPSA.2007.013293},
timestamp = {Tue, 24 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijhpsa/PillaCFCN07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ivs/BurkhardAADKKPBEHMGLPWMHBFB07,
author = {Remo Aslak Burkhard and
Gennady L. Andrienko and
Natalia V. Andrienko and
Jason Dykes and
Alexander Koutamanis and
Wolfgang Kienreich and
Robert Phaal and
Alan F. Blackwell and
Martin J. Eppler and
Jeffrey Huang and
Mark Meagher and
Armin Gr{\"{u}}n and
Silke Lang and
Daniel Perrin and
Wibke Weber and
Andrew Vande Moere and
Bruce W. Herr and
Katy B{\"{o}}rner and
Jean{-}Daniel Fekete and
Dominique Brodbeck},
title = {Visualization Summit 2007: ten research goals for 2010},
journal = {Inf. Vis.},
volume = {6},
number = {3},
pages = {169--188},
year = {2007},
url = {https://doi.org/10.1057/palgrave.ivs.9500158},
doi = {10.1057/PALGRAVE.IVS.9500158},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ivs/BurkhardAADKKPBEHMGLPWMHBFB07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jais/LewisTL07,
author = {Bruce R. Lewis and
Gary F. Templeton and
Xin (Robert) Luo},
title = {A Scientometric Investigation into the Validity of {IS} Journal Quality
Measures},
journal = {J. Assoc. Inf. Syst.},
volume = {8},
number = {12},
pages = {35},
year = {2007},
url = {https://doi.org/10.17705/1jais.00145},
doi = {10.17705/1JAIS.00145},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jais/LewisTL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/GreenesBE07,
author = {Robert A. Greenes and
Bruce G. Buchanan and
Donald Ellison},
title = {Special Feature: Presentation of the 2006 Morris F. Collen Award to
Edward H. (Ted) Shortliffe},
journal = {J. Am. Medical Informatics Assoc.},
volume = {14},
number = {3},
pages = {376--385},
year = {2007},
url = {https://doi.org/10.1197/jamia.M2374},
doi = {10.1197/JAMIA.M2374},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/GreenesBE07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcis/PliceR07,
author = {Robert K. Plice and
Bruce A. Reinig},
title = {Aligning the Information Systems Curriculum with the Needs of Industry
and Graduates},
journal = {J. Comput. Inf. Syst.},
volume = {48},
number = {1},
pages = {22--30},
year = {2007},
url = {https://www.tandfonline.com/doi/abs/10.1080/08874417.2007.11645992},
doi = {10.1080/08874417.2007.11645992},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcis/PliceR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmis/ReinigBN07,
author = {Bruce A. Reinig and
Robert O. Briggs and
Jay F. Nunamaker Jr.},
title = {On the Measurement of Ideation Quality},
journal = {J. Manag. Inf. Syst.},
volume = {23},
number = {4},
pages = {143--161},
year = {2007},
url = {http://www.jmis-web.org/articles/821},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmis/ReinigBN07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/McNeilRABCDEGHKMMMOOOPPPPRSVVZXZOS07,
author = {Leslie Klis McNeil and
Claudia Reich and
Ramy K. Aziz and
Daniela Bartels and
Matthew Cohoon and
Terry Disz and
Robert A. Edwards and
Svetlana Gerdes and
Kaitlyn Hwang and
Michael Kubal and
Gohar Rem Margaryan and
Folker Meyer and
William Mihalo and
Gary J. Olsen and
Robert Olson and
Andrei Osterman and
Daniel Paarmann and
Tobias Paczian and
Bruce D. Parrello and
Gordon D. Pusch and
Dmitry A. Rodionov and
Xinghua Shi and
Olga Vassieva and
Veronika Vonstein and
Olga Zagnitko and
Fangfang Xia and
Jenifer Zinner and
Ross A. Overbeek and
Rick Stevens},
title = {The National Microbial Pathogen Database Resource {(NMPDR):} a genomics
platform based on subsystem annotation},
journal = {Nucleic Acids Res.},
volume = {35},
number = {Database-Issue},
pages = {347--353},
year = {2007},
url = {https://doi.org/10.1093/nar/gkl947},
doi = {10.1093/NAR/GKL947},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nar/McNeilRABCDEGHKMMMOOOPPPPRSVVZXZOS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/BiswasMRFGQHCGN07,
author = {Abhijit Biswas and
Bruce E. Moision and
William T. Roberts and
William H. Farr and
Andrew Gray and
Kevin Quirk and
Jon Hamkins and
Michael K. Cheng and
Jonathan Gin and
Michael A. Nakashima and
Gerardo G. Ortiz and
Sabino Piazzolla and
Carl Christian Liebe and
David L. Losh},
title = {Palomar Receive Terminal {(PRT)} for the Mars Laser Communication
Demonstration {(MLCD)} Project},
journal = {Proc. {IEEE}},
volume = {95},
number = {10},
pages = {2045--2058},
year = {2007},
url = {https://doi.org/10.1109/JPROC.2007.905054},
doi = {10.1109/JPROC.2007.905054},
timestamp = {Fri, 02 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pieee/BiswasMRFGQHCGN07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamdm/LandmanR07,
author = {Bruce M. Landman and
Aaron Robertson},
title = {Avoiding Monochromatic Sequences With Special Gaps},
journal = {{SIAM} J. Discret. Math.},
volume = {21},
number = {3},
pages = {794--801},
year = {2007},
url = {https://doi.org/10.1137/S0895480103422196},
doi = {10.1137/S0895480103422196},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamdm/LandmanR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/AbouGhazalehCMM07,
author = {Nevine AbouGhazaleh and
Bruce R. Childers and
Daniel Moss{\'{e}} and
Rami G. Melhem},
title = {Near-Memory Caching for Improved Energy Consumption},
journal = {{IEEE} Trans. Computers},
volume = {56},
number = {11},
pages = {1441--1455},
year = {2007},
url = {https://doi.org/10.1109/TC.2007.70740},
doi = {10.1109/TC.2007.70740},
timestamp = {Mon, 13 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/AbouGhazalehCMM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/BarkerACFFGHHIKMPPTY07,
author = {Ken Barker and
Bhalchandra Agashe and
Shaw Yi Chaw and
James Fan and
Noah S. Friedland and
Michael Robert Glass and
Jerry R. Hobbs and
Eduard H. Hovy and
David J. Israel and
Doo Soon Kim and
Rutu Mulkar{-}Mehta and
Sourabh Patwardhan and
Bruce W. Porter and
Dan Tecuci and
Peter Z. Yeh},
title = {Learning by Reading: {A} Prototype System, Performance Baseline and
Lessons Learned},
booktitle = {Proceedings of the Twenty-Second {AAAI} Conference on Artificial Intelligence,
July 22-26, 2007, Vancouver, British Columbia, Canada},
pages = {280--286},
publisher = {{AAAI} Press},
year = {2007},
url = {http://www.aaai.org/Library/AAAI/2007/aaai07-043.php},
timestamp = {Tue, 05 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/BarkerACFFGHHIKMPPTY07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cases/BaiocchiCDHM07,
author = {Jos{\'{e}} Baiocchi and
Bruce R. Childers and
Jack W. Davidson and
Jason Hiser and
Jonathan Misurda},
editor = {Taewhan Kim and
Pascal Sainrat and
Steven S. Lumetta and
Nacho Navarro},
title = {Fragment cache management for dynamic binary translators in embedded
systems with scratchpad},
booktitle = {Proceedings of the 2007 International Conference on Compilers, Architecture,
and Synthesis for Embedded Systems, {CASES} 2007, Salzburg, Austria,
September 30 - October 3, 2007},
pages = {75--84},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1289881.1289898},
doi = {10.1145/1289881.1289898},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cases/BaiocchiCDHM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cgo/HiserWHDMC07,
author = {Jason Hiser and
Daniel W. Williams and
Wei Hu and
Jack W. Davidson and
Jason Mars and
Bruce R. Childers},
title = {Evaluating Indirect Branch Handling Mechanisms in Software Dynamic
Translation Systems},
booktitle = {Fifth International Symposium on Code Generation and Optimization
{(CGO} 2007), 11-14 March 2007, San Jose, California, {USA}},
pages = {61--73},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/CGO.2007.10},
doi = {10.1109/CGO.2007.10},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cgo/HiserWHDMC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dls/GuhaMFK07,
author = {Arjun Guha and
Jacob Matthews and
Robert Bruce Findler and
Shriram Krishnamurthi},
editor = {Pascal Costanza and
Robert Hirschfeld},
title = {Relationally-parametric polymorphic contracts},
booktitle = {Proceedings of the 2007 Symposium on Dynamic Languages, {DLS} 2007,
October 22, 2007, Montreal, Quebec, Canada},
pages = {29--40},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1297081.1297089},
doi = {10.1145/1297081.1297089},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dls/GuhaMFK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esop/KuanMF07,
author = {George Kuan and
David MacQueen and
Robert Bruce Findler},
editor = {Rocco De Nicola},
title = {A Rewriting Semantics for Type Inference},
booktitle = {Programming Languages and Systems, 16th European Symposium on Programming,
{ESOP} 2007, Held as Part of the Joint European Conferences on Theory
and Practics of Software, {ETAPS} 2007, Braga, Portugal, March 24
- April 1, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4421},
pages = {426--440},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-71316-6\_29},
doi = {10.1007/978-3-540-71316-6\_29},
timestamp = {Tue, 14 May 2019 10:00:41 +0200},
biburl = {https://dblp.org/rec/conf/esop/KuanMF07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/BriggsR07,
author = {Robert O. Briggs and
Bruce A. Reinig},
title = {Bounded Ideation Theory: {A} New Model of the Relationship Between
Ideaquantity and Idea-quality during Ideation},
booktitle = {40th Hawaii International International Conference on Systems Science
{(HICSS-40} 2007), {CD-ROM} / Abstracts Proceedings, 3-6 January 2007,
Waikoloa, Big Island, HI, {USA}},
pages = {16},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/HICSS.2007.108},
doi = {10.1109/HICSS.2007.108},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/BriggsR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iasam/PariseNM07,
author = {Giuseppe Parise and
Robert E. Nabours and
Bruce McClung},
title = {Relevance of Competence in Risk Reduction for Electrical Safety},
booktitle = {Conference Record of the 2007 {IEEE} Industry Applications Conference
Forty-Second {IAS} Annual Meeting, New Orleans, LA, USA, September
23-27, 2007},
pages = {2110--2114},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/07IAS.2007.319},
doi = {10.1109/07IAS.2007.319},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iasam/PariseNM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccd/LeeCC07,
author = {Hyunjin Lee and
Sangyeun Cho and
Bruce R. Childers},
title = {Exploring the interplay of yield, area, and performance in processor
caches},
booktitle = {25th International Conference on Computer Design, {ICCD} 2007, 7-10
October 2007, Lake Tahoe, CA, USA, Proceedings},
pages = {216--223},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/ICCD.2007.4601905},
doi = {10.1109/ICCD.2007.4601905},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccd/LeeCC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icfp/FlattYFF07,
author = {Matthew Flatt and
Gang Yu and
Robert Bruce Findler and
Matthias Felleisen},
editor = {Ralf Hinze and
Norman Ramsey},
title = {Adding delimited and composable control to a production programming
environment},
booktitle = {Proceedings of the 12th {ACM} {SIGPLAN} International Conference on
Functional Programming, {ICFP} 2007, Freiburg, Germany, October 1-3,
2007},
pages = {165--176},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1291151.1291178},
doi = {10.1145/1291151.1291178},
timestamp = {Fri, 25 Jun 2021 14:48:54 +0200},
biburl = {https://dblp.org/rec/conf/icfp/FlattYFF07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifl/FindlerGR07,
author = {Robert Bruce Findler and
Shu{-}yu Guo and
Anne Rogers},
editor = {Olaf Chitil and
Zolt{\'{a}}n Horv{\'{a}}th and
Vikt{\'{o}}ria Zs{\'{o}}k},
title = {Lazy Contract Checking for Immutable Data Structures},
booktitle = {Implementation and Application of Functional Languages, 19th International
Workshop, {IFL} 2007, Freiburg, Germany, September 27-29, 2007. Revised
Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {5083},
pages = {111--128},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-85373-2\_7},
doi = {10.1007/978-3-540-85373-2\_7},
timestamp = {Mon, 03 Jan 2022 22:26:05 +0100},
biburl = {https://dblp.org/rec/conf/ifl/FindlerGR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/GuhaHKYZZCDHS07,
author = {Apala Guha and
Jason Hiser and
Naveen Kumar and
Jing Yang and
Min Zhao and
Shukang Zhou and
Bruce R. Childers and
Jack W. Davidson and
Kim M. Hazelwood and
Mary Lou Soffa},
title = {Virtual Execution Environments: Support and Tools},
booktitle = {21th International Parallel and Distributed Processing Symposium {(IPDPS}
2007), Proceedings, 26-30 March 2007, Long Beach, California, {USA}},
pages = {1--6},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/IPDPS.2007.370489},
doi = {10.1109/IPDPS.2007.370489},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/GuhaHKYZZCDHS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isvlsi/LeeCC07,
author = {Hyunjin Lee and
Sangyeun Cho and
Bruce R. Childers},
title = {Performance of Graceful Degradation for Cache Faults},
booktitle = {2007 {IEEE} Computer Society Annual Symposium on {VLSI} {(ISVLSI}
2007), May 9-11, 2007, Porto Alegre, Brazil},
pages = {409--415},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/ISVLSI.2007.81},
doi = {10.1109/ISVLSI.2007.81},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isvlsi/LeeCC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lctrts/AbouGhazalehFRXLCMM07,
author = {Nevine AbouGhazaleh and
Alexandre Peixoto Ferreira and
Cosmin Rusu and
Ruibin Xu and
Frank Liberato and
Bruce R. Childers and
Daniel Moss{\'{e}} and
Rami G. Melhem},
editor = {Santosh Pande and
Zhiyuan Li},
title = {Integrated {CPU} and l2 cache voltage scaling using machine learning},
booktitle = {Proceedings of the 2007 {ACM} {SIGPLAN/SIGBED} Conference on Languages,
Compilers, and Tools for Embedded Systems (LCTES'07), San Diego, California,
USA, June 13-15, 2007},
pages = {41--50},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1254766.1254773},
doi = {10.1145/1254766.1254773},
timestamp = {Sun, 02 Oct 2022 16:11:14 +0200},
biburl = {https://dblp.org/rec/conf/lctrts/AbouGhazalehFRXLCMM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/popl/MatthewsF07,
author = {Jacob Matthews and
Robert Bruce Findler},
editor = {Martin Hofmann and
Matthias Felleisen},
title = {Operational semantics for multi-language programs},
booktitle = {Proceedings of the 34th {ACM} {SIGPLAN-SIGACT} Symposium on Principles
of Programming Languages, {POPL} 2007, Nice, France, January 17-19,
2007},
pages = {3--10},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1190216.1190220},
doi = {10.1145/1190216.1190220},
timestamp = {Fri, 25 Jun 2021 14:48:54 +0200},
biburl = {https://dblp.org/rec/conf/popl/MatthewsF07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/crc/ChildersMZM07,
author = {Bruce R. Childers and
Daniel Moss{\'{e}} and
Dakai Zhu and
Rami G. Melhem},
editor = {Sanguthevar Rajasekaran and
John H. Reif},
title = {Power Aware Mapping of Real-Time Tasks to Multiprocessors},
booktitle = {Handbook of Parallel Computing - Models, Algorithms and Applications},
publisher = {Chapman and Hall/CRC},
year = {2007},
url = {https://doi.org/10.1201/9781420011296.ch40},
doi = {10.1201/9781420011296.CH40},
timestamp = {Mon, 24 Jul 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/reference/crc/ChildersMZM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aam/FrantzikinakisL06,
author = {Nikos Frantzikinakis and
Bruce M. Landman and
Aaron Robertson},
title = {On the degree of regularity of generalized van der Waerden triples},
journal = {Adv. Appl. Math.},
volume = {37},
number = {1},
pages = {124--128},
year = {2006},
url = {https://doi.org/10.1016/j.aam.2005.08.003},
doi = {10.1016/J.AAM.2005.08.003},
timestamp = {Mon, 05 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aam/FrantzikinakisL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/electronicmarkets/WeinhardtWHNS06,
author = {Christof Weinhardt and
Bruce W. Weber and
Terrence Hendershott and
Dirk Neumann and
Robert A. Schwartz},
title = {Preface to the Focus Theme Section: 'Financial Market Engineering'},
journal = {Electron. Mark.},
volume = {16},
number = {2},
pages = {98--100},
year = {2006},
url = {https://doi.org/10.1080/10196780600643506},
doi = {10.1080/10196780600643506},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/electronicmarkets/WeinhardtWHNS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gandc/DunfeyGB06,
author = {Robert I. Dunfey and
Bruce M. Gittings and
James K. Batcheller},
title = {Towards an open architecture for vector {GIS}},
journal = {Comput. Geosci.},
volume = {32},
number = {10},
pages = {1720--1732},
year = {2006},
url = {https://doi.org/10.1016/j.cageo.2006.04.004},
doi = {10.1016/J.CAGEO.2006.04.004},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/gandc/DunfeyGB06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iam/ByrdLB06,
author = {Terry Anthony Byrd and
Bruce R. Lewis and
Robert W. Bryan},
title = {The leveraging influence of strategic alignment on {IT} investment:
An empirical examination},
journal = {Inf. Manag.},
volume = {43},
number = {3},
pages = {308--321},
year = {2006},
url = {https://doi.org/10.1016/j.im.2005.07.002},
doi = {10.1016/J.IM.2005.07.002},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iam/ByrdLB06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfp/FindlerF06,
author = {Robert Bruce Findler and
Matthew Flatt},
title = {Slideshow: functional presentations},
journal = {J. Funct. Program.},
volume = {16},
number = {4-5},
pages = {583--619},
year = {2006},
url = {https://doi.org/10.1017/S0956796806006010},
doi = {10.1017/S0956796806006010},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfp/FindlerF06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/orgsci/MehraDBR06,
author = {Ajay Mehra and
Andrea L. Dixon and
Daniel J. Brass and
Bruce Robertson},
title = {The Social Network Ties of Group Leaders: Implications for Group Performance
and Leader Reputation},
journal = {Organ. Sci.},
volume = {17},
number = {1},
pages = {64--79},
year = {2006},
url = {https://doi.org/10.1287/orsc.1050.0158},
doi = {10.1287/ORSC.1050.0158},
timestamp = {Thu, 16 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/orgsci/MehraDBR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigplan/Findler06,
author = {Robert Bruce Findler},
title = {Scheme and Functional Programming 2006: paper abstracts},
journal = {{ACM} {SIGPLAN} Notices},
volume = {41},
number = {8},
pages = {6--9},
year = {2006},
url = {https://doi.org/10.1145/1163566.1163568},
doi = {10.1145/1163566.1163568},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigplan/Findler06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taco/ZhaoCS06,
author = {Min Zhao and
Bruce R. Childers and
Mary Lou Soffa},
title = {An approach toward profit-driven optimization},
journal = {{ACM} Trans. Archit. Code Optim.},
volume = {3},
number = {3},
pages = {231--262},
year = {2006},
url = {https://doi.org/10.1145/1162690.1162691},
doi = {10.1145/1162690.1162691},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/taco/ZhaoCS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tecs/AbouGhazalehMCM06,
author = {Nevine AbouGhazaleh and
Daniel Moss{\'{e}} and
Bruce R. Childers and
Rami G. Melhem},
title = {Collaborative operating system and compiler power management for real-time
applications},
journal = {{ACM} Trans. Embed. Comput. Syst.},
volume = {5},
number = {1},
pages = {82--115},
year = {2006},
url = {https://doi.org/10.1145/1132357.1132361},
doi = {10.1145/1132357.1132361},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tecs/AbouGhazalehMCM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/SaitwalMRD06,
author = {Kishor Saitwal and
Anthony A. Maciejewski and
Rodney G. Roberts and
Bruce A. Draper},
title = {Using the low-resolution properties of correlated images to improve
the computational efficiency of eigenspace decomposition},
journal = {{IEEE} Trans. Image Process.},
volume = {15},
number = {8},
pages = {2376--2387},
year = {2006},
url = {https://doi.org/10.1109/TIP.2006.875231},
doi = {10.1109/TIP.2006.875231},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tip/SaitwalMRD06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aplas/FlattFF06,
author = {Matthew Flatt and
Robert Bruce Findler and
Matthias Felleisen},
editor = {Naoki Kobayashi},
title = {Scheme with Classes, Mixins, and Traits},
booktitle = {Programming Languages and Systems, 4th Asian Symposium, {APLAS} 2006,
Sydney, Australia, November 8-10, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4279},
pages = {270--289},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11924661\_17},
doi = {10.1007/11924661\_17},
timestamp = {Tue, 14 May 2019 10:00:41 +0200},
biburl = {https://dblp.org/rec/conf/aplas/FlattFF06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/flops/FindlerB06,
author = {Robert Bruce Findler and
Matthias Blume},
editor = {Masami Hagiya and
Philip Wadler},
title = {Contracts as Pairs of Projections},
booktitle = {Functional and Logic Programming, 8th International Symposium, {FLOPS}
2006, Fuji-Susono, Japan, April 24-26, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3945},
pages = {226--241},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11737414\_16},
doi = {10.1007/11737414\_16},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/flops/FindlerB06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/ReinigB06,
author = {Bruce A. Reinig and
Robert O. Briggs},
title = {Measuring the Quality of Ideation Technology and Techniques},
booktitle = {39th Hawaii International International Conference on Systems Science
{(HICSS-39} 2006), {CD-ROM} / Abstracts Proceedings, 4-7 January 2006,
Kauai, HI, {USA}},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/HICSS.2006.270},
doi = {10.1109/HICSS.2006.270},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/ReinigB06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/MurphyGIJOIH06,
author = {Robert E. Murphy and
Bruce Guenther and
Justin Ip and
John Jackson and
Debra Olenijczak and
Barbara Iisager and
Keith Hutchison},
title = {Update on the Algorithmic Basis and Predicted Performance of Selected
{VIIRS} Environmental Data Records},
booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
{IGARSS} 2006, July 31 - August 4, 2006, Denver, Colorado, USA, Proceedings},
pages = {266--269},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/IGARSS.2006.73},
doi = {10.1109/IGARSS.2006.73},
timestamp = {Tue, 20 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/MurphyGIJOIH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/TreuhaftCSDGFMG06,
author = {Robert N. Treuhaft and
Bruce D. Chapman and
Jo{\~{a}}o Roberto dos Santos and
Luciano Vieira Dutra and
F{\'{a}}bio Guimar{\~{a}}es Gon{\c{c}}alves and
Corina da Costa Freitas and
Jos{\'{e}} C. Mura and
P. M. A. de Graca and
J. B. Drake},
title = {Tropical-Forest Density Profiles from Multibaseline Interferometric
{SAR}},
booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
{IGARSS} 2006, July 31 - August 4, 2006, Denver, Colorado, USA, Proceedings},
pages = {2205--2207},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/IGARSS.2006.570},
doi = {10.1109/IGARSS.2006.570},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/TreuhaftCSDGFMG06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/HiserKZZCDS06,
author = {Jason Hiser and
Naveen Kumar and
Min Zhao and
Shukang Zhou and
Bruce R. Childers and
Jack W. Davidson and
Mary Lou Soffa},
title = {Techniques and tools for dynamic optimization},
booktitle = {20th International Parallel and Distributed Processing Symposium {(IPDPS}
2006), Proceedings, 25-29 April 2006, Rhodes Island, Greece},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/IPDPS.2006.1639569},
doi = {10.1109/IPDPS.2006.1639569},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/HiserKZZCDS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/SanchezJRMMCBHM06,
author = {H{\'{e}}ctor S{\'{a}}nchez and
Bill Johnstone and
Doug Roberts and
Om Mandhana and
Brad Melnick and
Muhsin Celik and
Mike Baker and
Jim Hayden and
Byoung Min and
John Edgerton and
Bruce White},
title = {Increasing Microprocessor Speed by Massive Application of On-Die High-K
{MIM} Decoupling Capacitors},
booktitle = {2006 {IEEE} International Solid State Circuits Conference, {ISSCC}
2006, Digest of Technical Papers, an Francisco, CA, USA, February
6-9, 2006},
pages = {2190--2199},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/ISSCC.2006.1696280},
doi = {10.1109/ISSCC.2006.1696280},
timestamp = {Mon, 09 Aug 2021 14:54:04 +0200},
biburl = {https://dblp.org/rec/conf/isscc/SanchezJRMMCBHM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/popl/MeunierFF06,
author = {Philippe Meunier and
Robert Bruce Findler and
Matthias Felleisen},
editor = {J. Gregory Morrisett and
Simon L. Peyton Jones},
title = {Modular set-based analysis from contracts},
booktitle = {Proceedings of the 33rd {ACM} {SIGPLAN-SIGACT} Symposium on Principles
of Programming Languages, {POPL} 2006, Charleston, South Carolina,
USA, January 11-13, 2006},
pages = {218--231},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1111037.1111057},
doi = {10.1145/1111037.1111057},
timestamp = {Fri, 25 Jun 2021 14:48:54 +0200},
biburl = {https://dblp.org/rec/conf/popl/MeunierFF06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sas/HuangCS06,
author = {Yuqiang Huang and
Bruce R. Childers and
Mary Lou Soffa},
editor = {Kwangkeun Yi},
title = {Catching and Identifying Bugs in Register Allocation},
booktitle = {Static Analysis, 13th International Symposium, {SAS} 2006, Seoul,
Korea, August 29-31, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4134},
pages = {281--300},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11823230\_19},
doi = {10.1007/11823230\_19},
timestamp = {Tue, 14 May 2019 10:00:52 +0200},
biburl = {https://dblp.org/rec/conf/sas/HuangCS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbac-pad/PillaCCFN06,
author = {Maur{\'{\i}}cio L. Pilla and
Bruce R. Childers and
Amarildo T. da Costa and
Felipe M. G. Fran{\c{c}}a and
Philippe Olivier Alexandre Navaux},
title = {A Speculative Trace Reuse Architecture with Reduced Hardware Requirements},
booktitle = {18th Symposium on Computer Architecture and High Performance Computing
{(SBAC-PAD} 2006), 17-20 October 2006, Ouro Preto, Minas Gerais, Brazil},
pages = {47--54},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/SBAC-PAD.2006.7},
doi = {10.1109/SBAC-PAD.2006.7},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sbac-pad/PillaCCFN06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/RobertsBCCGKRTUY06,
author = {Eric S. Roberts and
Kim B. Bruce and
James H. Cross II and
Robb Cutler and
Scott Grissom and
Karl J. Klee and
Susan H. Rodger and
Fran Trees and
Ian Utting and
Frank Yellin},
editor = {Doug Baldwin and
Paul T. Tymann and
Susan M. Haller and
Ingrid Russell},
title = {The {ACM} java task force: final report},
booktitle = {Proceedings of the 37th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 2006, Houston, Texas, USA, March 3-5, 2006},
pages = {131--132},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1121341.1121384},
doi = {10.1145/1121341.1121384},
timestamp = {Mon, 30 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigcse/RobertsBCCGKRTUY06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vee/HiserWFDC06,
author = {Jason Hiser and
Daniel W. Williams and
Adrian Filipi and
Jack W. Davidson and
Bruce R. Childers},
editor = {Hans{-}Juergen Boehm and
David Grove},
title = {Evaluating fragment construction policies for {SDT} systems},
booktitle = {Proceedings of the 2nd International Conference on Virtual Execution
Environments, {VEE} 2006, Ottawa, Ontario, Canada, June 14-16, 2006},
pages = {122--132},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1134760.1134778},
doi = {10.1145/1134760.1134778},
timestamp = {Mon, 12 Jul 2021 15:34:15 +0200},
biburl = {https://dblp.org/rec/conf/vee/HiserWFDC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsi/HendersonRRC06,
author = {Robert K. Henderson and
Bruce Rae and
David Renshaw and
Edoardo Charbon},
title = {Oversampled Time Estimation Techniques for Precision Photonic Detectors},
booktitle = {{IFIP} VLSI-SoC 2006, {IFIP} {WG} 10.5 International Conference on
Very Large Scale Integration of System-on-Chip, Nice, France, 16-18
October 2006},
pages = {48--51},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/VLSISOC.2006.313202},
doi = {10.1109/VLSISOC.2006.313202},
timestamp = {Tue, 05 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsi/HendersonRRC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsi/HendersonRRC06a,
author = {Robert K. Henderson and
Bruce Rae and
David Renshaw and
Edoardo Charbon},
editor = {Giovanni De Micheli and
Salvador Mir and
Ricardo Reis},
title = {Oversampled Time Estimation Techniques for Precision Photonic Detectors},
booktitle = {VLSI-SoC: Research Trends in {VLSI} and Systems on Chip - Fourteenth
International Conference on Very Large Scale Integration of System
on Chip (VLSI-SoC2006), October 16-18, 2006, Nice, France},
series = {{IFIP}},
volume = {249},
pages = {25--35},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/978-0-387-74909-9\_2},
doi = {10.1007/978-0-387-74909-9\_2},
timestamp = {Tue, 05 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsi/HendersonRRC06a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/SmithSTC06,
author = {V. Devon Smith and
Donald G. Searles and
Bruce M. Thompson and
Robert M. Cranwell},
editor = {L. Felipe Perrone and
Barry Lawson and
Jason Liu and
Frederick P. Wieland},
title = {{SEM:} enterprise modeling of {JSF} global sustainment},
booktitle = {Proceedings of the Winter Simulation Conference {WSC} 2006, Monterey,
California, USA, December 3-6, 2006},
pages = {1324--1331},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/WSC.2006.323231},
doi = {10.1109/WSC.2006.323231},
timestamp = {Mon, 29 Apr 2024 16:19:40 +0200},
biburl = {https://dblp.org/rec/conf/wsc/SmithSTC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/Robertson06,
author = {Bruce G. Robertson},
editor = {Les Carr and
David De Roure and
Arun Iyengar and
Carole A. Goble and
Michael Dahlin},
title = {Visualizing an historical semantic web with Heml},
booktitle = {Proceedings of the 15th international conference on World Wide Web,
{WWW} 2006, Edinburgh, Scotland, UK, May 23-26, 2006},
pages = {1051--1052},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1135777.1136010},
doi = {10.1145/1135777.1136010},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/www/Robertson06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/siam/06/AlmasiBCGG0HMSWCABCCBCHP06,
author = {George S. Alm{\'{a}}si and
Gyan Bhanot and
Siddhartha Chatterjee and
Alan Gara and
John A. Gunnels and
Manish Gupta and
Amy Henning and
Jos{\'{e}} E. Moreira and
James C. Sexton and
Bob Walkup and
Alessandro Curioni and
Charles Archer and
Leonardo R. Bachega and
Bor Chan and
Bruce Curtis and
Sharon Brunett and
Giri Chukkapalli and
Robert Harkness and
Wayne Pfeiffer},
editor = {Michael A. Heroux and
Padma Raghavan and
Horst D. Simon},
title = {Achieving High Performance on the BlueGene/L Supercomputer},
booktitle = {Parallel Processing for Scientific Computing},
series = {Software, Environments, Tools},
volume = {20},
pages = {59--75},
publisher = {{SIAM}},
year = {2006},
url = {https://doi.org/10.1137/1.9780898718133.ch4},
doi = {10.1137/1.9780898718133.CH4},
timestamp = {Mon, 16 Sep 2019 14:43:13 +0200},
biburl = {https://dblp.org/rec/books/siam/06/AlmasiBCGG0HMSWCABCCBCHP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ccr/ClarkPBDFJKMRRSWZ05,
author = {David D. Clark and
Craig Partridge and
Robert Braden and
Bruce S. Davie and
Sally Floyd and
Van Jacobson and
Dina Katabi and
Greg Minshall and
K. K. Ramakrishnan and
Timothy Roscoe and
Ion Stoica and
John Wroclawski and
Lixia Zhang},
title = {Making the world (of communications) a different place},
journal = {Comput. Commun. Rev.},
volume = {35},
number = {3},
pages = {91--96},
year = {2005},
url = {https://doi.org/10.1145/1070873.1070887},
doi = {10.1145/1070873.1070887},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ccr/ClarkPBDFJKMRRSWZ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dss/BlanningR05,
author = {Robert W. Blanning and
Bruce A. Reinig},
title = {A framework for conducting political event analysis using group support
systems},
journal = {Decis. Support Syst.},
volume = {38},
number = {4},
pages = {511--527},
year = {2005},
url = {https://doi.org/10.1016/j.dss.2003.09.006},
doi = {10.1016/J.DSS.2003.09.006},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dss/BlanningR05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijpp/KumarCWDS05,
author = {Naveen Kumar and
Bruce R. Childers and
Daniel W. Williams and
Jack W. Davidson and
Mary Lou Soffa},
title = {Compile-Time Planning for Overhead Reduction in Software Dynamic Translators},
journal = {Int. J. Parallel Program.},
volume = {33},
number = {2-3},
pages = {103--114},
year = {2005},
url = {https://doi.org/10.1007/s10766-005-3573-7},
doi = {10.1007/S10766-005-3573-7},
timestamp = {Wed, 01 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijpp/KumarCWDS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/HsuHKFMSO05,
author = {John Hsu and
Jie Huang and
James Kinsman and
Bruce Fireman and
Robert Miller and
Joseph Selby and
Eduardo Ortiz},
title = {Research Paper: Use of e-Health Services between 1999 and 2002: {A}
Growing Digital Divide},
journal = {J. Am. Medical Informatics Assoc.},
volume = {12},
number = {2},
pages = {164--171},
year = {2005},
url = {https://doi.org/10.1197/jamia.M1672},
doi = {10.1197/JAMIA.M1672},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/HsuHKFMSO05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/BanksBCCDFFHMMMPRZBFGL05,
author = {Jay L. Banks and
Hege S. Beard and
Yixiang X. Cao and
Art E. Cho and
Wolfgang Damm and
Ramy Farid and
Anthony K. Felts and
Thomas A. Halgren and
Daniel T. Mainz and
Jon R. Maple and
Robert B. Murphy and
Dean M. Philipp and
Matthew P. Repasky and
Linda Yu Zhang and
Bruce J. Berne and
Richard A. Friesner and
Emilio Gallicchio and
Ronald M. Levy},
title = {Integrated Modeling Program, Applied Chemical Theory {(IMPACT)}},
journal = {J. Comput. Chem.},
volume = {26},
number = {16},
pages = {1752--1780},
year = {2005},
url = {https://doi.org/10.1002/jcc.20292},
doi = {10.1002/JCC.20292},
timestamp = {Wed, 01 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcc/BanksBCCDFFHMMMPRZBFGL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/GdanitzBLPS05,
author = {Robert J. Gdanitz and
Gary D. Black and
Carina Lansing and
Bruce J. Palmer and
Karen Schuchardt},
title = {Registering the Amica electronic structure code in the Extensible
Computational Chemistry Environment},
journal = {J. Comput. Chem.},
volume = {26},
number = {3},
pages = {214--225},
year = {2005},
url = {https://doi.org/10.1002/jcc.20152},
doi = {10.1002/JCC.20152},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcc/GdanitzBLPS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jct/Addario-BerryADR05,
author = {Louigi Addario{-}Berry and
Robert E. L. Aldred and
Ketan Dalal and
Bruce A. Reed},
title = {Vertex colouring edge partitions},
journal = {J. Comb. Theory {B}},
volume = {94},
number = {2},
pages = {237--244},
year = {2005},
url = {https://doi.org/10.1016/j.jctb.2005.01.001},
doi = {10.1016/J.JCTB.2005.01.001},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jct/Addario-BerryADR05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jct/RichterSJTW05,
author = {R. Bruce Richter and
Jozef Sir{\'{a}}n and
Robert Jajcay and
Thomas W. Tucker and
Mark E. Watkins},
title = {Cayley maps},
journal = {J. Comb. Theory {B}},
volume = {95},
number = {2},
pages = {189--245},
year = {2005},
url = {https://doi.org/10.1016/j.jctb.2005.04.007},
doi = {10.1016/J.JCTB.2005.04.007},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jct/RichterSJTW05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jeim/CampbellKA05,
author = {Bruce Campbell and
Robert Kay and
David E. Avison},
title = {Strategic alignment: a practitioner's perspective},
journal = {J. Enterp. Inf. Manag.},
volume = {18},
number = {6},
pages = {653--664},
year = {2005},
url = {https://doi.org/10.1108/17410390510628364},
doi = {10.1108/17410390510628364},
timestamp = {Wed, 26 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jeim/CampbellKA05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lisp/MeunierFSW05,
author = {Philippe Meunier and
Robert Bruce Findler and
Paul Steckler and
Mitchell Wand},
title = {Selectors Make Set-Based Analysis Too Hard},
journal = {High. Order Symb. Comput.},
volume = {18},
number = {3-4},
pages = {245--269},
year = {2005},
url = {https://doi.org/10.1007/s10990-005-4876-5},
doi = {10.1007/S10990-005-4876-5},
timestamp = {Thu, 05 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/lisp/MeunierFSW05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mam/ChildersD05,
author = {Bruce R. Childers and
Jack W. Davidson},
title = {An infrastructure for designing custom embedded wide counterflow pipelines},
journal = {Microprocess. Microsystems},
volume = {29},
number = {1},
pages = {27--40},
year = {2005},
url = {https://doi.org/10.1016/j.micpro.2004.07.002},
doi = {10.1016/J.MICPRO.2004.07.002},
timestamp = {Mon, 18 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mam/ChildersD05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/polibits/EstebanCBA05,
author = {Bruce Leroy Luna Esteban and
Juan Manuel Mendoza Campa and
Roberto Parra Bautista and
Mar{\'{\i}}a Elena Aguilar{-}J{\'{a}}uregui},
title = {Una T{\'{e}}cnica para la Localizaci{\'{o}}n de Ojos Humanos
en una Imagen Bidimensional},
journal = {Polibits},
volume = {31},
pages = {49--52},
year = {2005},
url = {https://doi.org/10.17562/PB-31-8},
doi = {10.17562/PB-31-8},
timestamp = {Mon, 16 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/polibits/EstebanCBA05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/MundtMUBTTRDCCRSHK05,
author = {Carsten W. Mundt and
Kevin N. Montgomery and
Usen E. Udoh and
Valerie N. Barker and
Guillaume C. Thonier and
Arnaud M. Tellier and
Robert D. Ricks and
R. Bruce Darling and
Yvonne D. Cagle and
N. A. Cabrol and
S. J. Ruoss and
J. L. Swain and
J. W. Hines and
Gregory T. A. Kovacs},
title = {A multiparameter wearable physiologic monitoring system for space
and terrestrial applications},
journal = {{IEEE} Trans. Inf. Technol. Biomed.},
volume = {9},
number = {3},
pages = {382--391},
year = {2005},
url = {https://doi.org/10.1109/TITB.2005.854509},
doi = {10.1109/TITB.2005.854509},
timestamp = {Wed, 13 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/titb/MundtMUBTTRDCCRSHK05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/WitbrockMBKFL05,
author = {Michael Witbrock and
Cynthia Matuszek and
Antoine Brusseau and
Robert C. Kahlert and
C. Bruce Fraser and
Douglas B. Lenat},
title = {Knowledge Begets Knowledge: Steps towards Assisted Knowledge Acquisition
in Cyc},
booktitle = {Knowledge Collection from Volunteer Contributors, Papers from the
2005 {AAAI} Spring Symposium, Technical Report SS-05-03, Stanford,
California, USA, March 21-23, 2005},
pages = {99--105},
publisher = {{AAAI}},
year = {2005},
url = {http://www.aaai.org/Library/Symposia/Spring/2005/ss05-03-015.php},
timestamp = {Tue, 18 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaaiss/WitbrockMBKFL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aadebug/KumarCS05,
author = {Naveen Kumar and
Bruce R. Childers and
Mary Lou Soffa},
editor = {Clinton Jeffery and
Jong{-}Deok Choi and
Raimondas Lencevicius},
title = {Tdb: a source-level debugger for dynamically translated programs},
booktitle = {Proceedings of the Sixth International Workshop on Automated Debugging,
{AADEBUG} 2005, Monterey, California, USA, September 19-21, 2005},
pages = {123--132},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1085130.1085147},
doi = {10.1145/1085130.1085147},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aadebug/KumarCS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cc/MisurdaCRCS05,
author = {Jonathan Misurda and
James A. Clause and
Juliya L. Reed and
Bruce R. Childers and
Mary Lou Soffa},
editor = {Rastislav Bod{\'{\i}}k},
title = {Jazz: {A} Tool for Demand-Driven Structural Testing},
booktitle = {Compiler Construction, 14th International Conference, {CC} 2005, Held
as Part of the Joint European Conferences on Theory and Practice of
Software, {ETAPS} 2005, Edinburgh, UK, April 4-8, 2005, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3443},
pages = {242--245},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/978-3-540-31985-6\_17},
doi = {10.1007/978-3-540-31985-6\_17},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/cc/MisurdaCRCS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cgo/ZhaoCS05,
author = {Min Zhao and
Bruce R. Childers and
Mary Lou Soffa},
title = {Model-Based Framework: An Approach for Profit-Driven Optimization},
booktitle = {3nd {IEEE} / {ACM} International Symposium on Code Generation and
Optimization {(CGO} 2005), 20-23 March 2005, San Jose, CA, {USA}},
pages = {317--327},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/CGO.2005.2},
doi = {10.1109/CGO.2005.2},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cgo/ZhaoCS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hoti/DrostFGHKCCTZCLS05,
author = {Robert J. Drost and
Craig Forrest and
Bruce Guenin and
Ron Ho and
Ashok V. Krishnamoorthy and
Danny Cohen and
John E. Cunningham and
Bernard Tourancheau and
Arthur Zingher and
Alex Chow and
Gary Lauterbach and
Ivan E. Sutherland},
title = {Challenges in Building a Flat-Bandwidth Memory Hierarchy for a Large-Scale
Computer with Proximity Communication},
booktitle = {13th Annual {IEEE} Symposium on High Performance Interconnects {(HOTIC}
2005), 17-19 August 2005, Stanford, CA, {USA}},
pages = {13--22},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/CONECT.2005.12},
doi = {10.1109/CONECT.2005.12},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hoti/DrostFGHKCCTZCLS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccd/AbouGhazalehCMM05,
author = {Nevine AbouGhazaleh and
Bruce R. Childers and
Daniel Moss{\'{e}} and
Rami G. Melhem},
title = {Near-memory Caching for Improved Energy Consumption},
booktitle = {23rd International Conference on Computer Design {(ICCD} 2005), 2-5
October 2005, San Jose, CA, {USA}},
pages = {105--110},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ICCD.2005.79},
doi = {10.1109/ICCD.2005.79},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccd/AbouGhazalehCMM05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/MisurdaCRCS05,
author = {Jonathan Misurda and
James A. Clause and
Juliya L. Reed and
Bruce R. Childers and
Mary Lou Soffa},
editor = {Gruia{-}Catalin Roman and
William G. Griswold and
Bashar Nuseibeh},
title = {Demand-driven structural testing with dynamic instrumentation},
booktitle = {27th International Conference on Software Engineering {(ICSE} 2005),
15-21 May 2005, St. Louis, Missouri, {USA}},
pages = {156--165},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1062455.1062496},
doi = {10.1145/1062455.1062496},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icse/MisurdaCRCS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ism/Roberts05,
author = {Bruce Roberts},
title = {Who Are You?},
booktitle = {Seventh {IEEE} International Symposium on Multimedia {(ISM} 2005),
12-14 December 2005, Irvine, CA, {USA}},
pages = {3},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ISM.2005.125},
doi = {10.1109/ISM.2005.125},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ism/Roberts05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/GrayFF05,
author = {Kathryn E. Gray and
Robert Bruce Findler and
Matthew Flatt},
editor = {Ralph E. Johnson and
Richard P. Gabriel},
title = {Fine-grained interoperability through mirrors and contracts},
booktitle = {Proceedings of the 20th Annual {ACM} {SIGPLAN} Conference on Object-Oriented
Programming, Systems, Languages, and Applications, {OOPSLA} 2005,
October 16-20, 2005, San Diego, CA, {USA}},
pages = {231--245},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1094811.1094830},
doi = {10.1145/1094811.1094830},
timestamp = {Fri, 25 Jun 2021 14:48:54 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/GrayFF05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/paste/KumarCS05,
author = {Naveen Kumar and
Bruce R. Childers and
Mary Lou Soffa},
editor = {Michael D. Ernst and
Thomas P. Jensen},
title = {Low overhead program monitoring and profiling},
booktitle = {Proceedings of the 2005 {ACM} {SIGPLAN-SIGSOFT} Workshop on Program
Analysis For Software Tools and Engineering, PASTE'05, Lisbon, Portugal,
September 5-6, 2005},
pages = {28--34},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1108792.1108801},
doi = {10.1145/1108792.1108801},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/paste/KumarCS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/RobertsBCCGKRTUY05,
author = {Eric S. Roberts and
Kim B. Bruce and
Robb Cutler and
James H. Cross II and
Scott B. Grissom and
Karl J. Klee and
Susan H. Rodger and
Fran Trees and
Ian Utting and
Frank Yellin},
editor = {Wanda P. Dann and
Thomas L. Naps and
Paul T. Tymann and
Doug Baldwin},
title = {The {ACM} java task force: status report},
booktitle = {Proceedings of the 36th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 2005, St. Louis, Missouri, USA, February 23-27,
2005},
pages = {46--47},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1047344.1047348},
doi = {10.1145/1047344.1047348},
timestamp = {Mon, 30 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigcse/RobertsBCCGKRTUY05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vee/ZhouCS05,
author = {Shukang Zhou and
Bruce R. Childers and
Mary Lou Soffa},
editor = {Michael Hind and
Jan Vitek},
title = {Planning for code buffer management in distributed virtual execution
environments},
booktitle = {Proceedings of the 1st International Conference on Virtual Execution
Environments, {VEE} 2005, Chicago, IL, USA, June 11-12, 2005},
pages = {100--109},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1064979.1064994},
doi = {10.1145/1064979.1064994},
timestamp = {Mon, 12 Jul 2021 15:34:15 +0200},
biburl = {https://dblp.org/rec/conf/vee/ZhouCS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icfp/2005fdpe,
editor = {Robby Bruce Findler and
Michael Hanus and
Simon Thompson},
title = {Proceedings of the 2005 workshop on Functional and Declarative Programming
in Education, FDPE@ICFP 2005, Tallinn, Estonia, September 25 - 25,
2005},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1085114},
doi = {10.1145/1085114},
isbn = {1-59593-067-1},
timestamp = {Tue, 15 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icfp/2005fdpe.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/idea/encyclopedia2005/ChenHS05,
author = {Jason C. H. Chen and
Robert W. Holt and
D. Bruce Sun},
editor = {Mehdi Khosrow{-}Pour},
title = {Organization and Management Issues of End User Computing},
booktitle = {Encyclopedia of Information Science and Technology {(5} Volumes)},
pages = {2230--2235},
publisher = {Idea Group},
year = {2005},
url = {http://www.igi-global.com/Bookstore/Chapter.aspx?TitleId=14590},
timestamp = {Sun, 09 Jul 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/idea/encyclopedia2005/ChenHS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dagstuhl/MosseACM05,
author = {Daniel Moss{\'{e}} and
Nevine AbouGhazaleh and
Bruce R. Childers and
Rami G. Melhem},
editor = {Luca Benini and
Ulrich Kremer and
Christian W. Probst and
Peter Schelkens},
title = {Energy Conservation in Memory Hierarchies using Power-Aware Cached-DRAM},
booktitle = {Power-aware Computing Systems, 3.-8. April 2005},
series = {Dagstuhl Seminar Proceedings},
volume = {05141},
publisher = {Internationales Begegnungs- und Forschungszentrum f{\"{u}}r Informatik
(IBFI), Schloss Dagstuhl, Germany},
year = {2005},
url = {http://drops.dagstuhl.de/opus/volltexte/2005/304},
timestamp = {Thu, 10 Jun 2021 13:02:09 +0200},
biburl = {https://dblp.org/rec/conf/dagstuhl/MosseACM05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/daglib/0011561,
author = {Robert Bruce Thompson and
Barbara Fritchman Thompson},
title = {Building the perfect {PC}},
publisher = {O'Reilly},
year = {2004},
url = {http://www.oreilly.de/catalog/buildpc/index.html},
isbn = {978-0-596-00663-1},
timestamp = {Wed, 25 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/daglib/0011561.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ase/MatthewsFGKF04,
author = {Jacob Matthews and
Robert Bruce Findler and
Paul T. Graunke and
Shriram Krishnamurthi and
Matthias Felleisen},
title = {Automatically Restructuring Programs for the Web},
journal = {Autom. Softw. Eng.},
volume = {11},
number = {4},
pages = {337--364},
year = {2004},
url = {https://doi.org/10.1023/B:AUSE.0000038936.09009.69},
doi = {10.1023/B:AUSE.0000038936.09009.69},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ase/MatthewsFGKF04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csedu/FelleisenFFK04,
author = {Matthias Felleisen and
Robert Bruce Findler and
Matthew Flatt and
Shriram Krishnamurthi},
title = {The TeachScheme! Project: Computing and Programming for Every Student},
journal = {Comput. Sci. Educ.},
volume = {14},
number = {1},
pages = {55--77},
year = {2004},
url = {https://doi.org/10.1076/csed.14.1.55.23499},
doi = {10.1076/CSED.14.1.55.23499},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/csedu/FelleisenFFK04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/VenkatapathyMB04,
author = {Raghuraman Venkatapathy and
Chandrika J. Moudgal and
Robert M. Bruce},
title = {Assessment of the Oral Rat Chronic Lowest Observed Adverse Effect
Level Model in TOPKAT, a {QSAR} Software Package for Toxicity Prediction},
journal = {J. Chem. Inf. Model.},
volume = {44},
number = {5},
pages = {1623--1629},
year = {2004},
url = {https://doi.org/10.1021/ci049903s},
doi = {10.1021/CI049903S},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/VenkatapathyMB04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfp/FelleisenFFK04,
author = {Matthias Felleisen and
Robert Bruce Findler and
Matthew Flatt and
Shriram Krishnamurthi},
title = {The structure and interpretation of the computer science curriculum},
journal = {J. Funct. Program.},
volume = {14},
number = {4},
pages = {365--378},
year = {2004},
url = {https://doi.org/10.1017/S0956796804005076},
doi = {10.1017/S0956796804005076},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jfp/FelleisenFFK04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/DrostW04,
author = {Robert J. Drost and
Bruce A. Wooley},
title = {An 8-Gb/s/pin simultaneously bidirectional transceiver in 0.35-{\(\mu\)}m
{CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {39},
number = {11},
pages = {1894--1908},
year = {2004},
url = {https://doi.org/10.1109/JSSC.2004.835837},
doi = {10.1109/JSSC.2004.835837},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/DrostW04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/StudholmeCBSRMW04,
author = {Colin Studholme and
Valerie Cardenas and
Robert S. Blumenfeld and
Norbert Schuff and
Howard J. Rosen and
Bruce L. Miller and
Michael Weiner},
title = {Deformation tensor morphometry of semantic dementia with quantitative
validation},
journal = {NeuroImage},
volume = {21},
number = {4},
pages = {1387--1398},
year = {2004},
url = {https://doi.org/10.1016/j.neuroimage.2003.12.009},
doi = {10.1016/J.NEUROIMAGE.2003.12.009},
timestamp = {Tue, 17 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/StudholmeCBSRMW04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/ChildersD04,
author = {Bruce R. Childers and
Jack W. Davidson},
title = {Custom Wide Counterflow Pipelines for High-Performance Embedded Applications},
journal = {{IEEE} Trans. Computers},
volume = {53},
number = {2},
pages = {141--158},
year = {2004},
url = {https://doi.org/10.1109/TC.2004.1261825},
doi = {10.1109/TC.2004.1261825},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/ChildersD04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/te/BruceHR04,
author = {Jerry W. Bruce and
James C. Harden and
Robert B. Reese},
title = {Cooperative and progressive design experience for embedded systems},
journal = {{IEEE} Trans. Educ.},
volume = {47},
number = {1},
pages = {83--92},
year = {2004},
url = {https://doi.org/10.1109/TE.2003.817618},
doi = {10.1109/TE.2003.817618},
timestamp = {Sun, 28 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/te/BruceHR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tis/Bruce04,
author = {Bertram C. Bruce},
title = {Digital Developments in Higher Education: Theory and Practice, edited
by Peter Roberts and Mark Chambers, Cambridge, {UK:} Taylor Graham
Publishing, 2001, 190 pp, {ISBN} 0-947568-78-6},
journal = {Inf. Soc.},
volume = {20},
number = {3},
pages = {231--232},
year = {2004},
url = {https://doi.org/10.1080/01972240490456971},
doi = {10.1080/01972240490456971},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tis/Bruce04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/ShoganC04,
author = {Stacey Shogan and
Bruce R. Childers},
title = {Compact Binaries with Code Compression in a Software Dynamic Translator},
booktitle = {2004 Design, Automation and Test in Europe Conference and Exposition
{(DATE} 2004), 16-20 February 2004, Paris, France},
pages = {1052--1059},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/DATE.2004.1269032},
doi = {10.1109/DATE.2004.1269032},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/date/ShoganC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/ZhouCK04,
author = {Shukang Zhou and
Bruce R. Childers and
Naveen Kumar},
title = {Profile Guided Management of Code Partitions for Embedded Systems},
booktitle = {2004 Design, Automation and Test in Europe Conference and Exposition
{(DATE} 2004), 16-20 February 2004, Paris, France},
pages = {1396--1399},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/DATE.2004.1269105},
doi = {10.1109/DATE.2004.1269105},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/date/ZhouCK04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/FindlerFF04,
author = {Robert Bruce Findler and
Matthew Flatt and
Matthias Felleisen},
editor = {Martin Odersky},
title = {Semantic Casts: Contracts and Structural Subtyping in a Nominal World},
booktitle = {{ECOOP} 2004 - Object-Oriented Programming, 18th European Conference,
Oslo, Norway, June 14-18, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3086},
pages = {364--388},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-24851-4\_17},
doi = {10.1007/978-3-540-24851-4\_17},
timestamp = {Sun, 02 Jun 2019 21:16:57 +0200},
biburl = {https://dblp.org/rec/conf/ecoop/FindlerFF04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/BriggsQR04,
author = {Robert O. Briggs and
Sajda Qureshi and
Bruce A. Reinig},
title = {Satisfaction Attainment Theory as a Model for Value Creation},
booktitle = {37th Hawaii International Conference on System Sciences {(HICSS-37}
2004), {CD-ROM} / Abstracts Proceedings, 5-8 January 2004, Big Island,
HI, {USA}},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/HICSS.2004.1265063},
doi = {10.1109/HICSS.2004.1265063},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/BriggsQR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icfp/FindlerF04,
author = {Robert Bruce Findler and
Matthew Flatt},
editor = {Chris Okasaki and
Kathleen Fisher},
title = {Slideshow: functional presentations},
booktitle = {Proceedings of the Ninth {ACM} {SIGPLAN} International Conference
on Functional Programming, {ICFP} 2004, Snow Bird, UT, USA, September
19-21, 2004},
pages = {224--235},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/1016850.1016880},
doi = {10.1145/1016850.1016880},
timestamp = {Fri, 25 Jun 2021 14:48:54 +0200},
biburl = {https://dblp.org/rec/conf/icfp/FindlerF04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/imc/FeldmannKMMPS04,
author = {Anja Feldmann and
Nils Kammenhuber and
Olaf Maennel and
Bruce M. Maggs and
Roberto De Prisco and
Ravi Sundaram},
editor = {Alfio Lombardo and
James F. Kurose},
title = {A methodology for estimating interdomain web traffic demand},
booktitle = {Proceedings of the 4th {ACM} {SIGCOMM} Internet Measurement Conference,
{IMC} 2004, Taormina, Sicily, Italy, October 25-27, 2004},
pages = {322--335},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/1028788.1028833},
doi = {10.1145/1028788.1028833},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/imc/FeldmannKMMPS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/imc/PangHAPMS04,
author = {Jeffrey Pang and
James Hendricks and
Aditya Akella and
Roberto De Prisco and
Bruce M. Maggs and
Srinivasan Seshan},
editor = {Alfio Lombardo and
James F. Kurose},
title = {Availability, usage, and deployment characteristics of the domain
name system},
booktitle = {Proceedings of the 4th {ACM} {SIGCOMM} Internet Measurement Conference,
{IMC} 2004, Taormina, Sicily, Italy, October 25-27, 2004},
pages = {1--14},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/1028788.1028790},
doi = {10.1145/1028788.1028790},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/imc/PangHAPMS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/ScottKCDS04,
author = {Kevin Scott and
Naveen Kumar and
Bruce R. Childers and
Jack W. Davidson and
Mary Lou Soffa},
title = {Overhead Reduction Techniques for Software Dynamic Translation},
booktitle = {18th International Parallel and Distributed Processing Symposium {(IPDPS}
2004), {CD-ROM} / Abstracts Proceedings, 26-30 April 2004, Santa Fe,
New Mexico, {USA}},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/IPDPS.2004.1303224},
doi = {10.1109/IPDPS.2004.1303224},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/ScottKCDS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isit/HamkinsKMM04,
author = {Jon Hamkins and
Matthew Klimesh and
Robert J. McEliece and
Bruce E. Moision},
title = {Capacity of the generalized {PPM} channel},
booktitle = {Proceedings of the 2004 {IEEE} International Symposium on Information
Theory, {ISIT} 2004, Chicago Downtown Marriott, Chicago, Illinois,
USA, June 27 - July 2, 2004},
pages = {337},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/ISIT.2004.1365371},
doi = {10.1109/ISIT.2004.1365371},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/isit/HamkinsKMM04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medinfo/DolinMCCWHLBSAC04,
author = {Robert H. Dolin and
John E. Mattison and
Simon P. Cohn and
Keith E. Campbell and
Andrew M. Wiesenthal and
Brad Hochhalter and
Diane Laberge and
Rita Barsoum and
James Shalaby and
Alan Abilla and
Robert J. Clements and
Carol M. Correia and
Diane Esteva and
John M. Fedack and
Bruce J. Goldberg and
Sridhar Gopalarao and
Eza Hafeza and
Peter Hendler and
Enrique Hernandez and
Ron Kamangar and
Rafique A. Khan and
Georgina Kurtovich and
Gerry Lazzareschi and
Moon H. Lee and
Tracy Lee and
David H. Levy and
Jonathan Y. Lukoff and
Cyndie Lundberg and
Michael P. Madden and
Trongtu L. Ngo and
Ben T. Nguyen and
Nikhilkumar P. Patel and
Jim Resneck and
David E. Ross and
Kathleen M. Schwarz and
Charles C. Selhorst and
Aaron Snyder and
Mohamed I. Umarji and
Max Vilner and
Roy Zer{-}Chen and
Chris Zingo},
editor = {Marius Fieschi and
Enrico W. Coiera and
Yu{-}Chuan (Jack) Li},
title = {Kaiser Permanente's Convergent Medical Terminology},
booktitle = {{MEDINFO} 2004 - Proceedings of the 11th World Congress on Medical
Informatics, San Francisco, California, USA, September 7-11, 2004},
series = {Studies in Health Technology and Informatics},
volume = {107},
pages = {346--350},
publisher = {{IOS} Press},
year = {2004},
url = {https://doi.org/10.3233/978-1-60750-949-3-346},
doi = {10.3233/978-1-60750-949-3-346},
timestamp = {Wed, 17 Aug 2022 16:35:51 +0200},
biburl = {https://dblp.org/rec/conf/medinfo/DolinMCCWHLBSAC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/GoldbergFF04,
author = {David S. Goldberg and
Robert Bruce Findler and
Matthew Flatt},
editor = {John M. Vlissides and
Douglas C. Schmidt},
title = {Super and inner: together at last!},
booktitle = {Proceedings of the 19th Annual {ACM} {SIGPLAN} Conference on Object-Oriented
Programming, Systems, Languages, and Applications, {OOPSLA} 2004,
October 24-28, 2004, Vancouver, BC, Canada},
pages = {116--129},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/1028976.1028987},
doi = {10.1145/1028976.1028987},
timestamp = {Fri, 25 Jun 2021 14:51:50 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/GoldbergFF04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pldi/FlattF04,
author = {Matthew Flatt and
Robert Bruce Findler},
editor = {William W. Pugh and
Craig Chambers},
title = {Kill-safe synchronization abstractions},
booktitle = {Proceedings of the {ACM} {SIGPLAN} 2004 Conference on Programming
Language Design and Implementation 2004, Washington, DC, USA, June
9-11, 2004},
pages = {47--58},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/996841.996849},
doi = {10.1145/996841.996849},
timestamp = {Mon, 04 Apr 2022 21:23:55 +0200},
biburl = {https://dblp.org/rec/conf/pldi/FlattF04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rta/MatthewsFFF04,
author = {Jacob Matthews and
Robert Bruce Findler and
Matthew Flatt and
Matthias Felleisen},
editor = {Vincent van Oostrom},
title = {A Visual Environment for Developing Context-Sensitive Term Rewriting
Systems},
booktitle = {Rewriting Techniques and Applications, 15th International Conference,
{RTA} 2004, Aachen, Germany, June 3-5, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3091},
pages = {301--311},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-25979-4\_21},
doi = {10.1007/978-3-540-25979-4\_21},
timestamp = {Mon, 16 Sep 2019 15:32:17 +0200},
biburl = {https://dblp.org/rec/conf/rta/MatthewsFFF04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbac-pad/PillaNCCF04,
author = {Maur{\'{\i}}cio L. Pilla and
Philippe Olivier Alexandre Navaux and
Bruce R. Childers and
Amarildo T. da Costa and
Felipe Maia Galv{\~{a}}o Fran{\c{c}}a},
title = {Value Predictors for Reuse through Speculation on Traces},
booktitle = {16th Symposium on Computer Architecture and High Performance Computing
{(SBAC-PAD} 2004), 27-29 October 2004, Foz do Iguacu, Brazil},
pages = {48--55},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/SBAC-PAD.2004.42},
doi = {10.1109/SBAC-PAD.2004.42},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sbac-pad/PillaNCCF04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/BradyBNTW04,
author = {Alyce Brady and
Kim B. Bruce and
Robert E. Noonan and
Allen B. Tucker and
Henry MacKay Walker},
editor = {Daniel T. Joyce and
Deborah Knox and
Wanda P. Dann and
Thomas L. Naps},
title = {The 2003 model curriculum for a liberal arts degree in computer science:
preliminary report},
booktitle = {Proceedings of the 35th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 2004, Norfolk, Virginia, USA, March 3-7, 2004},
pages = {282--283},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/971300.971400},
doi = {10.1145/971300.971400},
timestamp = {Thu, 10 Jun 2021 16:43:03 +0200},
biburl = {https://dblp.org/rec/conf/sigcse/BradyBNTW04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sma/LangbeinGMMM04,
author = {Frank C. Langbein and
C. H. Gao and
Bruce I. Mills and
A. David Marshall and
Ralph R. Martin},
editor = {Gershon Elber and
Nicholas M. Patrikalakis and
Pere Brunet},
title = {Topological and geometric beautification of reverse engineered geometric
models},
booktitle = {Proceedings of the Ninth {ACM} Symposium on Solid Modeling and Applications,
Genova, Italy, June 09-11, 2004},
pages = {255--260},
publisher = {{ACM}},
year = {2004},
url = {https://dl.acm.org/citation.cfm?id=1217915},
timestamp = {Wed, 26 Jun 2019 20:28:09 +0200},
biburl = {https://dblp.org/rec/conf/sma/LangbeinGMMM04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/woss/KumarMCS04,
author = {Naveen Kumar and
Jonathan Misurda and
Bruce R. Childers and
Mary Lou Soffa},
editor = {David Garlan and
Jeff Kramer and
Alexander L. Wolf},
title = {Instrumentation in software dynamic translators for self-managed systems},
booktitle = {Proceedings of the 1st {ACM} {SIGSOFT} Workshop on Self-Managed Systems,
{WOSS} 2004, Newport Beach, California, USA, October 31 - November
1, 2004},
pages = {90--94},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/1075405.1075423},
doi = {10.1145/1075405.1075423},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/woss/KumarMCS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/daglib/0009432,
author = {Robert Bruce Thompson and
Barbara Fritchman Thompson},
title = {{PC} hardware in a nutshell - a desktop quick reference: covers Windows
and Linux {(3.} ed.)},
publisher = {O'Reilly},
year = {2003},
url = {http://www.oreilly.de/catalog/pchardnut3/index.html},
isbn = {978-0-596-00513-9},
timestamp = {Wed, 25 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/daglib/0009432.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/BuchananRF03,
author = {Bruce G. Buchanan and
Thomas C. Rindfleisch and
Edward A. Feigenbaum},
title = {In Memoriam: Robert Engelmore},
journal = {{AI} Mag.},
volume = {24},
number = {2},
pages = {15--20},
year = {2003},
url = {https://doi.org/10.1609/aimag.v24i2.1699},
doi = {10.1609/AIMAG.V24I2.1699},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/BuchananRF03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/SimmonsGGMRSUSAAABCMPHZKWMM03,
author = {Reid G. Simmons and
Dani Goldberg and
Adam Goode and
Michael Montemerlo and
Nicholas Roy and
Brennan Sellner and
Chris Urmson and
Alan C. Schultz and
Myriam Abramson and
William Adams and
Amin Atrash and
Magdalena D. Bugajska and
Michael J. Coblenz and
Matt MacMahon and
Dennis Perzanowski and
Ian Horswill and
Robert Zubek and
David Kortenkamp and
Bryn Wolfe and
Tod Milam and
Bruce A. Maxwell},
title = {{GRACE:} An Autonomous Robot for the {AAAI} Robot Challenge},
journal = {{AI} Mag.},
volume = {24},
number = {2},
pages = {51--72},
year = {2003},
url = {https://doi.org/10.1609/aimag.v24i2.1704},
doi = {10.1609/AIMAG.V24I2.1704},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/SimmonsGGMRSUSAAABCMPHZKWMM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/BruceDKT03,
author = {Kim B. Bruce and
Robert L. Scot Drysdale and
Charles Kelemen and
Allen B. Tucker},
title = {Why math?},
journal = {Commun. {ACM}},
volume = {46},
number = {9},
pages = {40--44},
year = {2003},
url = {https://doi.org/10.1145/903893.903918},
doi = {10.1145/903893.903918},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/BruceDKT03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/NajjarBDHRBCR03,
author = {Walid A. Najjar and
A. P. Wim B{\"{o}}hm and
Bruce A. Draper and
Jeffrey Hammes and
Robert Rinker and
J. Ross Beveridge and
Monica Chawathe and
Charles Ross},
title = {High-Level Language Abstraction for Reconfigurable Computing},
journal = {Computer},
volume = {36},
number = {8},
pages = {63--69},
year = {2003},
url = {https://doi.org/10.1109/MC.2003.1220583},
doi = {10.1109/MC.2003.1220583},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/computer/NajjarBDHRBCR03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmsj/MenonPRDH03,
author = {Jai Menon and
David A. Pease and
Robert M. Rees and
Linda Duyanovich and
Bruce Light Hillsberg},
title = {{IBM} Storage Tank - {A} heterogeneous scalable {SAN} file system},
journal = {{IBM} Syst. J.},
volume = {42},
number = {2},
pages = {250--267},
year = {2003},
url = {https://doi.org/10.1147/sj.422.0250},
doi = {10.1147/SJ.422.0250},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmsj/MenonPRDH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcb/LangmeadYMD03,
author = {Christopher James Langmead and
Anthony K. Yan and
C. Robertson McClung and
Bruce Randall Donald},
title = {Phase-Independent Rhythmic Analysis of Genome-Wide Expression Patterns},
journal = {J. Comput. Biol.},
volume = {10},
number = {3/4},
pages = {521--536},
year = {2003},
url = {https://doi.org/10.1089/10665270360688165},
doi = {10.1089/10665270360688165},
timestamp = {Wed, 19 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcb/LangmeadYMD03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jgo/MeyerDFT03,
author = {Robert R. Meyer and
Warren D. D'Souza and
Michael C. Ferris and
Bruce R. Thomadsen},
title = {{MIP} Models and {BB} Strategies in Brachytherapy Treatment Optimization},
journal = {J. Glob. Optim.},
volume = {25},
number = {1},
pages = {23--42},
year = {2003},
url = {https://doi.org/10.1023/A:1021386030224},
doi = {10.1023/A:1021386030224},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jgo/MeyerDFT03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/misq/DehningRZ03,
author = {Bruce Dehning and
Vernon J. Richardson and
Robert W. Zmud},
title = {The Value Relevance of Announcements of Transformational Information
Technology Investments},
journal = {{MIS} Q.},
volume = {27},
number = {4},
pages = {637--656},
year = {2003},
url = {http://misq.org/the-value-relevance-of-announcements-of-transformational-information-technology-investments.html},
timestamp = {Fri, 15 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/misq/DehningRZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mj/ZhangPBRLZWYG03,
author = {Hongguo Zhang and
Praka Punchaipet and
E. G. Bruce and
W. M. Robert and
Longtu Li and
Ji Zhou and
Yongli Wang and
Zhenxing Yue and
Zhilun Gui},
title = {Microstructure study and hyper frequency electromagnetic characterization
of novel hexagonal compounds},
journal = {Microelectron. J.},
volume = {34},
number = {4},
pages = {281--287},
year = {2003},
url = {https://doi.org/10.1016/S0026-2692(02)00193-3},
doi = {10.1016/S0026-2692(02)00193-3},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mj/ZhangPBRLZWYG03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/RowePSWD03,
author = {William J. Rowe and
Bruce M. Paine and
Adele E. Schmitz and
Robert H. Walden and
Michael J. Delaney},
title = {Reliability of 100 nm silicon nitride capacitors in an InP {HEMT}
{MMIC} process},
journal = {Microelectron. Reliab.},
volume = {43},
number = {6},
pages = {845--851},
year = {2003},
url = {https://doi.org/10.1016/S0026-2714(03)00069-6},
doi = {10.1016/S0026-2714(03)00069-6},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/RowePSWD03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/ZhangGSMWGS03,
author = {Hongguo Zhang and
Pant Gurang and
Nihdi Sigh and
Quvdo Manuel and
Robert M. Wallace and
Bruce Gnade and
Kevin Stokes},
title = {The effect of small-signal {AC} voltages on {C-V} characterization
and parameter extraction of SiO\({}_{\mbox{2}}\) thin films},
journal = {Microelectron. Reliab.},
volume = {43},
number = {12},
pages = {1981--1985},
year = {2003},
url = {https://doi.org/10.1016/S0026-2714(03)00370-6},
doi = {10.1016/S0026-2714(03)00370-6},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/ZhangGSMWGS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003},
url = {https://doi.org/10.1145/945546.945549},
doi = {10.1145/945546.945549},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/toplas/BruceSGF03,
author = {Kim B. Bruce and
Angela Schuett and
Robert van Gent and
Adrian Fiech},
title = {PolyTOIL: {A} type-safe polymorphic object-oriented language},
journal = {{ACM} Trans. Program. Lang. Syst.},
volume = {25},
number = {2},
pages = {225--290},
year = {2003},
url = {https://doi.org/10.1145/641888.641891},
doi = {10.1145/641888.641891},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/toplas/BruceSGF03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tpds/ZhuMC03,
author = {Dakai Zhu and
Rami G. Melhem and
Bruce R. Childers},
title = {Scheduling with Dynamic Voltage/Speed Adjustment Using Slack Reclamation
in Multiprocessor Real-Time Systems},
journal = {{IEEE} Trans. Parallel Distributed Syst.},
volume = {14},
number = {7},
pages = {686--700},
year = {2003},
url = {https://doi.org/10.1109/TPDS.2003.1214320},
doi = {10.1109/TPDS.2003.1214320},
timestamp = {Fri, 02 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tpds/ZhuMC03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cgo/ScottKVCDS03,
author = {Kevin Scott and
Naveen Kumar and
S. Velusamy and
Bruce R. Childers and
Jack W. Davidson and
Mary Lou Soffa},
editor = {Richard Johnson and
Tom Conte and
Wen{-}mei W. Hwu},
title = {Retargetable and Reconfigurable Software Dynamic Translation},
booktitle = {1st {IEEE} / {ACM} International Symposium on Code Generation and
Optimization {(CGO} 2003), 23-26 March 2003, San Francisco, CA, {USA}},
pages = {36--47},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/CGO.2003.1191531},
doi = {10.1109/CGO.2003.1191531},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cgo/ScottKVCDS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/OsterwilSBCMBSSS03,
author = {Lee Osterwil and
Norman K. Sondheimer and
Anthony Butterfield and
Lori A. Clarke and
Robert Marx and
Matthew P. Billmers and
Joel Sieh and
Bruce Southard and
David Su},
editor = {Yigal Arens and
Eduard H. Hovy and
Peggy Agouris},
title = {Trust Resource Management in Digital Government Through Process Modeling},
booktitle = {Proceedings of the 2003 Annual National Conference on Digital Government
Research, {DG.O} 2003, Boston, MA, USA, 2003},
series = {{ACM} International Conference Proceeding Series},
publisher = {Digital Government Research Center},
year = {2003},
url = {http://dl.acm.org/citation.cfm?id=1123310},
timestamp = {Sat, 07 Jul 2018 14:14:28 +0200},
biburl = {https://dblp.org/rec/conf/dgo/OsterwilSBCMBSSS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/drcn/YuSDCS03,
author = {Fang Yu and
Rakesh K. Sinha and
Robert D. Doverspike and
Bruce Cortez and
John Strand},
title = {Link selection schemes for avoiding channel contention},
booktitle = {Proceedings of the Fourth International Workshop on Design of Reliable
Communication Networks, {DRCN} 2003, Banff, Alberta, Canada, October
19-22, 2003},
pages = {288--295},
publisher = {{IEEE}},
year = {2003},
url = {https://doi.org/10.1109/DRCN.2003.1275368},
doi = {10.1109/DRCN.2003.1275368},
timestamp = {Mon, 17 Oct 2022 16:47:45 +0200},
biburl = {https://dblp.org/rec/conf/drcn/YuSDCS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esop/GraunkeFKF03,
author = {Paul T. Graunke and
Robert Bruce Findler and
Shriram Krishnamurthi and
Matthias Felleisen},
editor = {Pierpaolo Degano},
title = {Modeling Web Interactions},
booktitle = {Programming Languages and Systems, 12th European Symposium on Programming,
{ESOP} 2003, Held as Part of the Joint European Conferences on Theory
and Practice of Software, {ETAPS} 2003, Warsaw, Poland, April 7-11,
2003, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2618},
pages = {238--252},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/3-540-36575-3\_17},
doi = {10.1007/3-540-36575-3\_17},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esop/GraunkeFKF03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/BriggsVR03,
author = {Robert O. Briggs and
Gert{-}Jan de Vreede and
Bruce A. Reinig},
title = {A Theory and Measurement of Meeting Satisfaction},
booktitle = {36th Hawaii International Conference on System Sciences {(HICSS-36}
2003), {CD-ROM} / Abstracts Proceedings, January 6-9, 2003, Big Island,
HI, {USA}},
pages = {25},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/HICSS.2003.1173677},
doi = {10.1109/HICSS.2003.1173677},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/BriggsVR03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/ReinigM03,
author = {Bruce A. Reinig and
Roberto J. Mejias},
title = {An Investigation of the Influence of National Culture and Group Support
Systems on Group Processes and Outcomes},
booktitle = {36th Hawaii International Conference on System Sciences {(HICSS-36}
2003), {CD-ROM} / Abstracts Proceedings, January 6-9, 2003, Big Island,
HI, {USA}},
pages = {42},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/HICSS.2003.1173774},
doi = {10.1109/HICSS.2003.1173774},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/ReinigM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iaai/BarkerBBCCCFFGKKKMMMOPSUUY03,
author = {Kim Barker and
Jim Blythe and
Gary C. Borchardt and
Vinay K. Chaudhri and
Peter Clark and
Paul R. Cohen and
Julie Fitzgerald and
Kenneth D. Forbus and
Yolanda Gil and
Boris Katz and
Jihie Kim and
Gary W. King and
Sunil Mishra and
Clayton T. Morrison and
Kenneth S. Murray and
Charley Otstott and
Bruce W. Porter and
Robert Schrag and
Tom{\'{a}}s E. Uribe and
Jeffrey M. Usher and
Peter Z. Yeh},
editor = {John Riedl and
Randall W. Hill Jr.},
title = {A Knowledge Acquisition Tool for Course of Action Analysis},
booktitle = {Proceedings of the Fifteenth Conference on Innovative Applications
of Artificial Intelligence, August 12-14, 2003, Acapulco, Mexico},
pages = {43--50},
publisher = {{AAAI}},
year = {2003},
url = {http://www.aaai.org/Library/IAAI/2003/iaai03-006.php},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iaai/BarkerBBCCCFFGKKKMMMOPSUUY03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/GuentherXBM03,
author = {Bruce Guenther and
Xiaoxiong Xiong and
William L. Barnes and
Robert E. Murphy},
title = {A calibration algorithm design and analysis for {VIIRS} Thermal Emissive
Bands based on the {EOS} {MODIS} approach},
booktitle = {2003 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2003, Toulouse, France, July 21-15, 2003},
pages = {3036--3038},
publisher = {{IEEE}},
year = {2003},
url = {https://doi.org/10.1109/IGARSS.2003.1294674},
doi = {10.1109/IGARSS.2003.1294674},
timestamp = {Fri, 07 May 2021 10:04:02 +0200},
biburl = {https://dblp.org/rec/conf/igarss/GuentherXBM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/HerwitzDSHJZSBL03,
author = {Stanley R. Herwitz and
Stephen E. Dunagan and
Don V. Sullivan and
Robert G. Higgins and
Lee F. Johnson and
Jian Zheng and
Robert E. Slye and
James A. Brass and
Joe G. Leung and
Bruce Gallmeyer and
Michio Aoyagi},
title = {Solar-powered {UAV} mission for agricultural decision support},
booktitle = {2003 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2003, Toulouse, France, July 21-15, 2003},
pages = {1692--1694},
publisher = {{IEEE}},
year = {2003},
url = {https://doi.org/10.1109/IGARSS.2003.1294219},
doi = {10.1109/IGARSS.2003.1294219},
timestamp = {Fri, 07 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/HerwitzDSHJZSBL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/MurphyHWGK03,
author = {Robert E. Murphy and
Joy M. Henegar and
S. Wharton and
Bruce Guenther and
P. M. Kealy},
title = {Extending climate data records from the {EOS} era into the {NPOESS}
era},
booktitle = {2003 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2003, Toulouse, France, July 21-15, 2003},
pages = {1332--1334},
publisher = {{IEEE}},
year = {2003},
url = {https://doi.org/10.1109/IGARSS.2003.1294099},
doi = {10.1109/IGARSS.2003.1294099},
timestamp = {Fri, 07 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/MurphyHWGK03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/RaneyLCJG03,
author = {R. Keith Raney and
Carlton J. Leuschen and
R. D. Chapman and
J. Robert Jensen and
Bruce L. Gotwols},
title = {LaRA-2002: results of the airborne laser and radar altimeter campaign
over Greenland, Svalbard, and Arctic sea ice},
booktitle = {2003 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2003, Toulouse, France, July 21-15, 2003},
pages = {4392--4394},
publisher = {{IEEE}},
year = {2003},
url = {https://doi.org/10.1109/IGARSS.2003.1295526},
doi = {10.1109/IGARSS.2003.1295526},
timestamp = {Fri, 07 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/RaneyLCJG03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/XiongMSEBG03,
author = {Xiaoxiong Xiong and
Robert E. Murphy and
Junqiang Sun and
Joseph Esposito and
William L. Barnes and
Bruce Guenther},
title = {The impact of solar diffuser screen on the radiometric calibration
of remote sensing systems},
booktitle = {2003 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2003, Toulouse, France, July 21-15, 2003},
pages = {3043--3045},
publisher = {{IEEE}},
year = {2003},
url = {https://doi.org/10.1109/IGARSS.2003.1294677},
doi = {10.1109/IGARSS.2003.1294677},
timestamp = {Wed, 15 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/XiongMSEBG03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/ChildersDS03,
author = {Bruce R. Childers and
Jack W. Davidson and
Mary Lou Soffa},
title = {Continuous Compilation: {A} New Approach to Aggressive and Adaptive
Code Transformation},
booktitle = {17th International Parallel and Distributed Processing Symposium {(IPDPS}
2003), 22-26 April 2003, Nice, France, CD-ROM/Abstracts Proceedings},
pages = {205},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/IPDPS.2003.1213375},
doi = {10.1109/IPDPS.2003.1213375},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/ChildersDS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iticse/CeraCHLNPZ03,
author = {Christopher D. Cera and
Bruce W. Char and
Nira Herrmann and
Robert N. Lass and
Aparna Nanjappa and
Jeffrey L. Popyack and
Paul Zoski},
editor = {Vassilios Dagdilelis and
Maya Satratzemi and
David Finkel and
Roger D. Boyle and
Georgios Evangelidis},
title = {High-tech dishonesty: cheating, plagiarism and detection},
booktitle = {Proceedings of the 8th Annual {SIGCSE} Conference on Innovation and
Technology in Computer Science Education, ITiCSE 2003, Thessaloniki,
Greece, June 30 - July 2, 2003},
pages = {244},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/961511.961603},
doi = {10.1145/961511.961603},
timestamp = {Tue, 09 Mar 2021 16:21:56 +0100},
biburl = {https://dblp.org/rec/conf/iticse/CeraCHLNPZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iticse/CeraCHLNPZ03a,
author = {Christopher D. Cera and
Bruce W. Char and
Nira Herrmann and
Robert N. Lass and
Aparna Nanjappa and
Jeffrey L. Popyack and
Paul Zoski},
editor = {Vassilios Dagdilelis and
Maya Satratzemi and
David Finkel and
Roger D. Boyle and
Georgios Evangelidis},
title = {The {DUPLEX} project},
booktitle = {Proceedings of the 8th Annual {SIGCSE} Conference on Innovation and
Technology in Computer Science Education, ITiCSE 2003, Thessaloniki,
Greece, June 30 - July 2, 2003},
pages = {259},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/961511.961619},
doi = {10.1145/961511.961619},
timestamp = {Tue, 09 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iticse/CeraCHLNPZ03a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iticse/LassCBCPHZ03,
author = {Robert N. Lass and
Christopher D. Cera and
Nathaniel T. Bomberger and
Bruce W. Char and
Jeffrey L. Popyack and
Nira Herrmann and
Paul Zoski},
editor = {Vassilios Dagdilelis and
Maya Satratzemi and
David Finkel and
Roger D. Boyle and
Georgios Evangelidis},
title = {Tools and techniques for large scale grading using Web-based commercial
off-the-shelf software},
booktitle = {Proceedings of the 8th Annual {SIGCSE} Conference on Innovation and
Technology in Computer Science Education, ITiCSE 2003, Thessaloniki,
Greece, June 30 - July 2, 2003},
pages = {168--172},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/961511.961558},
doi = {10.1145/961511.961558},
timestamp = {Tue, 09 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iticse/LassCBCPHZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lctrts/AbouGhazalehCMMC03,
author = {Nevine AbouGhazaleh and
Bruce R. Childers and
Daniel Moss{\'{e}} and
Rami G. Melhem and
Matthew Craven},
editor = {Frank Mueller and
Ulrich Kremer},
title = {Energy management for real-time embedded applications with compiler
support},
booktitle = {Proceedings of the 2003 Conference on Languages, Compilers, and Tools
for Embedded Systems (LCTES'03). San Diego, California, USA, June
11-13, 2003},
pages = {284--293},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/780732.780771},
doi = {10.1145/780732.780771},
timestamp = {Sat, 21 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lctrts/AbouGhazalehCMMC03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lctrts/ZhaoCS03,
author = {Min Zhao and
Bruce R. Childers and
Mary Lou Soffa},
editor = {Frank Mueller and
Ulrich Kremer},
title = {Predicting the impact of optimizations for embedded systems},
booktitle = {Proceedings of the 2003 Conference on Languages, Compilers, and Tools
for Embedded Systems (LCTES'03). San Diego, California, USA, June
11-13, 2003},
pages = {1--11},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/780732.780734},
doi = {10.1145/780732.780734},
timestamp = {Fri, 25 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lctrts/ZhaoCS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/metmbs/KimJSC03,
author = {Moon K. Kim and
Robert L. Jernigan and
Bruce A. Shapiro and
Gregory S. Chirikjian},
editor = {Faramarz Valafar and
Homayoun Valafar},
title = {A Study of Conformational Changes in Macromolecules: The Coarse-Grained
Elastic Network Interpolation Method},
booktitle = {Proceedings of the International Conference on Mathematics and Engineering
Techniques in Medicine and Biological Scienes, {METMBS} '03, June
23 - 26, 2003, Las Vegas, Nevada, {USA}},
pages = {140--145},
publisher = {{CSREA} Press},
year = {2003},
timestamp = {Thu, 23 Jun 2016 15:53:27 +0200},
biburl = {https://dblp.org/rec/conf/metmbs/KimJSC03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mrc/SimmonsBGGMRSUSABMMPRTHZKWMM03,
author = {Reid G. Simmons and
Allison Bruce and
Dani Goldberg and
Adam Goode and
Michael Montemerlo and
Nicholas Roy and
Brennan Sellner and
Chris Urmson and
Alan C. Schultz and
William Adams and
Magdalena D. Bugajska and
Matt MacMahon and
Jessica Mink and
Dennis Perzanowski and
Stephanie Rosenthal and
Scott Thomas and
Ian Horswill and
Robert Zubek and
David Kortenkamp and
Bryn Wolfe and
Tod Milam and
Bruce A. Maxwell},
editor = {William D. Smart and
Bill Smart and
Magdalena D. Bugajska},
title = {{GRACE} and {GEORGE:} Autonomous Robots for the {AAAI} Robot Challenge},
booktitle = {{AAAI} Mobile Robot Competition 2003, Papers from the {AAAI} Workshop},
series = {{AAAI} Technical Report},
volume = {{WS-03-01}},
pages = {52},
publisher = {{AAAI} Press},
year = {2003},
timestamp = {Mon, 12 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mrc/SimmonsBGGMRSUSABMMPRTHZKWMM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mse/KourtevHLCCCL03,
author = {Ivan S. Kourtev and
Raymond R. Hoare and
Steven P. Levitan and
Tom Cain and
Bruce R. Childers and
Donald M. Chiarulli and
David L. Landis},
title = {Short Courses in System-on-a-Chip (SoC) Design},
booktitle = {2003 International Conference on Microelectronics Systems Education,
{MSE} 2003, Educating Tomorrow's Microsystems Designers, Anaheim,
CA, USA, June 1-2, 2003},
pages = {126--127},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/MSE.2003.1205285},
doi = {10.1109/MSE.2003.1205285},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mse/KourtevHLCCCL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/ChildersSBBCKLM03,
author = {Bruce R. Childers and
Mary Lou Soffa and
Jon Beaver and
Lidiya Ber and
Kevin Cammarata and
Tom Kane and
Juliya Litman and
Jonathan Misurda},
editor = {Michael G. Burke},
title = {SoftTest: a framework for software testing of Java programs},
booktitle = {Proceedings of the 2003 {OOPSLA} Workshop on Eclipse Technology eXchange,
October 2003, Anaheim, CA, {USA}},
pages = {79--83},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/965660.965677},
doi = {10.1145/965660.965677},
timestamp = {Mon, 14 Feb 2022 14:38:20 +0100},
biburl = {https://dblp.org/rec/conf/oopsla/ChildersSBBCKLM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rtas/AbouGhazalehMCMC03,
author = {Nevine AbouGhazaleh and
Daniel Moss{\'{e}} and
Bruce R. Childers and
Rami G. Melhem and
Matthew Craven},
title = {Collaborative Operating System and Compiler Power Management for Real-Time
Applications},
booktitle = {Proceedings of the 9th {IEEE} Real-Time and Embedded Technology and
Applications Symposium {(RTAS} 2003), May 27-30, 2003, Toronto, Canada},
pages = {133},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/RTTAS.2003.1203045},
doi = {10.1109/RTTAS.2003.1203045},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/rtas/AbouGhazalehMCMC03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbac-pad/PillaCFCS03,
author = {Maur{\'{\i}}cio L. Pilla and
Amarildo T. da Costa and
Felipe M. G. Fran{\c{c}}a and
Bruce R. Childers and
Mary Lou Soffa},
title = {The Limits of Speculative Trace Reuse on Deeply Pipelined Processors},
booktitle = {15th Symposium on Computer Architecture and High Performance Computing
{(SBAC-PAD} 2003), 10-12 November 2003, Sao Paulo, Brazil},
pages = {36--45},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/CAHPC.2003.1250319},
doi = {10.1109/CAHPC.2003.1250319},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sbac-pad/PillaCFCS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/HerrmannPCZCLN03,
author = {Nira Herrmann and
Jeffrey L. Popyack and
Bruce W. Char and
Paul Zoski and
Christopher D. Cera and
Robert N. Lass and
Aparna Nanjappa},
editor = {Scott Grissom and
Deborah Knox and
Daniel T. Joyce and
Wanda P. Dann},
title = {Redesigning introductory computer programming using multi-level online
modules for a mixed audience},
booktitle = {Proceedings of the 34th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 2003, Reno, Nevada, USA, February 19-23, 2003},
pages = {196--200},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/611892.611967},
doi = {10.1145/611892.611967},
timestamp = {Thu, 10 Jun 2021 16:43:03 +0200},
biburl = {https://dblp.org/rec/conf/sigcse/HerrmannPCZCLN03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/PopyackHZCCL03,
author = {Jeffrey L. Popyack and
Nira Herrmann and
Paul Zoski and
Bruce W. Char and
Christopher D. Cera and
Robert N. Lass},
editor = {Scott Grissom and
Deborah Knox and
Daniel T. Joyce and
Wanda P. Dann},
title = {Academic dishonesty in a high-tech environment},
booktitle = {Proceedings of the 34th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 2003, Reno, Nevada, USA, February 19-23, 2003},
pages = {357--358},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/611892.611916},
doi = {10.1145/611892.611916},
timestamp = {Wed, 10 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigcse/PopyackHZCCL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/auic/2003,
editor = {Robert Biddle and
Bruce H. Thomas},
title = {User Interfaces 2003, Fourth Australasian User Interface Conference
(AUIC2003), Adelaide, South Australia, February 2003},
series = {{CRPIT}},
volume = {18},
publisher = {Australian Computer Society},
year = {2003},
isbn = {0-909-92596-8},
timestamp = {Tue, 24 Aug 2004 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/auic/2003.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/daglib/0006600,
author = {Robert Bruce Thompson and
Barbara Fritchman Thompson},
title = {{PC} hardware in a nutshell - a desktop quick reference {(2.} ed.)},
publisher = {O'Reilly},
year = {2002},
isbn = {978-0-596-00353-1},
timestamp = {Tue, 12 Apr 2011 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/daglib/0006600.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cse/DevineBHHV02,
author = {Karen D. Devine and
Erik G. Boman and
Robert T. Heaphy and
Bruce Hendrickson and
Courtenay T. Vaughan},
title = {Zoltan data management services for parallel dynamic applications},
journal = {Comput. Sci. Eng.},
volume = {4},
number = {2},
pages = {90--96},
year = {2002},
url = {https://doi.org/10.1109/5992.988653},
doi = {10.1109/5992.988653},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cse/DevineBHHV02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/King02,
author = {R. B. King},
title = {Novel highly symmetrical trivalent graphs which lead to negative curvature
carbon and boron nitride chemical structures},
journal = {Discret. Math.},
volume = {244},
number = {1-3},
pages = {203--210},
year = {2002},
url = {https://doi.org/10.1016/S0012-365X(01)00067-X},
doi = {10.1016/S0012-365X(01)00067-X},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dm/King02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/LandmanR02,
author = {Bruce M. Landman and
Aaron Robertson},
title = {On generalized van der Waerden triples},
journal = {Discret. Math.},
volume = {256},
number = {1-2},
pages = {279--290},
year = {2002},
url = {https://doi.org/10.1016/S0012-365X(01)00436-8},
doi = {10.1016/S0012-365X(01)00436-8},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dm/LandmanR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dsp/CohenGHHLS02,
author = {Leon Cohen and
Lorenzo Galleani and
Robert A. Hedges and
David Hughes and
Patrick J. Loughlin and
Bruce W. Suter},
title = {Time-Frequency Analysis of a Variable Stiffness Model for Fault Development},
journal = {Digit. Signal Process.},
volume = {12},
number = {2-3},
pages = {429--440},
year = {2002},
url = {https://doi.org/10.1006/dspr.2002.0458},
doi = {10.1006/DSPR.2002.0458},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dsp/CohenGHHLS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dsp/HedgesS02,
author = {Robert A. Hedges and
Bruce W. Suter},
title = {Numerical Spread: Quantifying Local Stationarity},
journal = {Digit. Signal Process.},
volume = {12},
number = {4},
pages = {628--643},
year = {2002},
url = {https://doi.org/10.1006/dspr.2002.0428},
doi = {10.1006/DSPR.2002.0428},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dsp/HedgesS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/LukLDCCA02,
author = {Robert W. P. Luk and
Hong Va Leong and
Tharam S. Dillon and
Alvin T. S. Chan and
W. Bruce Croft and
James Allan},
title = {A survey in indexing and searching {XML} documents},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {53},
number = {6},
pages = {415--437},
year = {2002},
url = {https://doi.org/10.1002/asi.10056},
doi = {10.1002/ASI.10056},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasis/LukLDCCA02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcc/KaminskiSBFCMZH02,
author = {George A. Kaminski and
Harry A. Stern and
Bruce J. Berne and
Richard A. Friesner and
Yixiang X. Cao and
Robert B. Murphy and
Ruhong Zhou and
Thomas A. Halgren},
title = {Development of a polarizable force field for proteins via ab initio
quantum chemistry: First generation model and gas phase tests},
journal = {J. Comput. Chem.},
volume = {23},
number = {16},
pages = {1515--1531},
year = {2002},
url = {https://doi.org/10.1002/jcc.10125},
doi = {10.1002/JCC.10125},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcc/KaminskiSBFCMZH02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfp/FindlerCFFKSF02,
author = {Robert Bruce Findler and
John Clements and
Cormac Flanagan and
Matthew Flatt and
Shriram Krishnamurthi and
Paul Steckler and
Matthias Felleisen},
title = {DrScheme: a programming environment for Scheme},
journal = {J. Funct. Program.},
volume = {12},
number = {2},
pages = {159--182},
year = {2002},
url = {https://doi.org/10.1017/S0956796801004208},
doi = {10.1017/S0956796801004208},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jfp/FindlerCFFKSF02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocec/BlanningR02,
author = {Robert W. Blanning and
Bruce A. Reinig},
title = {Multiperiod Scenario Development Using Group Support Systems: An Application
to the Future of Hong Kong},
journal = {J. Organ. Comput. Electron. Commer.},
volume = {12},
number = {2},
pages = {105--119},
year = {2002},
url = {https://doi.org/10.1207/S15327744JOCE1202\_01},
doi = {10.1207/S15327744JOCE1202\_01},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jocec/BlanningR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocec/KauffmanW02,
author = {Robert J. Kauffman and
Bruce W. Weber},
title = {Introduction to the Special Issue on Advances in Research on Information
Technologies in the Financial Services Industry},
journal = {J. Organ. Comput. Electron. Commer.},
volume = {12},
number = {1},
pages = {1--4},
year = {2002},
url = {https://doi.org/10.1207/S15327744JOCE1201\_01},
doi = {10.1207/S15327744JOCE1201\_01},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jocec/KauffmanW02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WuHACCHLLMOSTVYZB03,
author = {Cathy H. Wu and
Hongzhan Huang and
Leslie Arminski and
Jorge Castro{-}Alvear and
Yongxing Chen and
Zhang{-}Zhi Hu and
Robert S. Ledley and
Kali C. Lewis and
Hans{-}Werner Mewes and
Bruce C. Orcutt and
Baris E. Suzek and
Akira Tsugita and
Cholanayakanahalli R. Vinayaka and
Lai{-}Su L. Yeh and
Jian Zhang and
Winona C. Barker},
title = {The Protein Information Resource: an integrated public resource of
functional annotation of proteins},
journal = {Nucleic Acids Res.},
volume = {30},
number = {1},
pages = {35--37},
year = {2002},
url = {https://doi.org/10.1093/nar/30.1.35},
doi = {10.1093/NAR/30.1.35},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/WuHACCHLLMOSTVYZB03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/ChalamalaLRG02,
author = {Babu Chalamala and
Frank E. Libsch and
Robert H. Reuss and
Bruce E. Gnade},
title = {Scanning the issue - special issue on flat-panel display technology},
journal = {Proc. {IEEE}},
volume = {90},
number = {4},
pages = {447--452},
year = {2002},
url = {https://doi.org/10.1109/JPROC.2002.1002519},
doi = {10.1109/JPROC.2002.1002519},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pieee/ChalamalaLRG02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/KemerleyWY02,
author = {Robert T. Kemerley and
H. Bruce Wallace and
Max N. Yoder},
title = {Impact of wide bandgap microwave devices on DoD systems},
journal = {Proc. {IEEE}},
volume = {90},
number = {6},
pages = {1059--1064},
year = {2002},
url = {https://doi.org/10.1109/JPROC.2002.1021570},
doi = {10.1109/JPROC.2002.1021570},
timestamp = {Tue, 17 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pieee/KemerleyWY02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tjs/BohmHDCRRN02,
author = {A. P. Wim B{\"{o}}hm and
Jeffrey Hammes and
Bruce A. Draper and
Monica Chawathe and
Charlie Ross and
Robert Rinker and
Walid A. Najjar},
title = {Mapping a Single Assignment Programming Language to Reconfigurable
Systems},
journal = {J. Supercomput.},
volume = {21},
number = {2},
pages = {117--130},
year = {2002},
url = {https://doi.org/10.1023/A:1013623303037},
doi = {10.1023/A:1013623303037},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tjs/BohmHDCRRN02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atal/BurkeB02,
author = {Robert C. Burke and
Bruce Blumberg},
title = {Using an ethologically-inspired model to learn apparent temporal causality
for planning in synthetic creatures},
booktitle = {The First International Joint Conference on Autonomous Agents {\&}
Multiagent Systems, {AAMAS} 2002, July 15-19, 2002, Bologna, Italy,
Proceedings},
pages = {326--333},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/544741.544820},
doi = {10.1145/544741.544820},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/atal/BurkeB02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csb/LangmeadMD02,
author = {Christopher James Langmead and
C. Robertson McClung and
Bruce Randall Donald},
title = {A Maximum Entropy Algorithm for Rhythmic Analysis of Genome-Wide Expression
Patterns},
booktitle = {1st {IEEE} Computer Society Bioinformatics Conference, {CSB} 2002,
Stanford, CA, USA, August 14-16, 2002},
pages = {237--245},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/CSB.2002.1039346},
doi = {10.1109/CSB.2002.1039346},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/csb/LangmeadMD02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icfp/FindlerF02,
author = {Robert Bruce Findler and
Matthias Felleisen},
editor = {Mitchell Wand and
Simon L. Peyton Jones},
title = {Contracts for higher-order functions},
booktitle = {Proceedings of the Seventh {ACM} {SIGPLAN} International Conference
on Functional Programming {(ICFP} '02), Pittsburgh, Pennsylvania,
USA, October 4-6, 2002},
pages = {48--59},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/581478.581484},
doi = {10.1145/581478.581484},
timestamp = {Wed, 07 Jul 2021 17:30:33 +0200},
biburl = {https://dblp.org/rec/conf/icfp/FindlerF02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mrc/SimmonsGGMRSUSAAABCMPHZKWMM02,
author = {Reid G. Simmons and
Dani Goldberg and
Adam Goode and
Michael Montemerlo and
Nicholas Roy and
Brennan Sellner and
Chris Urmson and
Alan C. Schultz and
Myriam Abramson and
William Adams and
Amin Atrash and
Magdalena D. Bugajska and
Michael J. Coblenz and
Matt MacMahon and
Dennis Perzanowski and
Ian Horswill and
Robert Zubek and
David Kortenkamp and
Bryn Wolfe and
Tod Milam and
Bruce A. Maxwell},
editor = {William D. Smart and
Tucker R. Balch and
Holly A. Yanco},
title = {{GRACE:} An Autonomous Robot for the {AAAI} Robot Challenge},
booktitle = {{AAAI} Mobile Robot Competition 2002, Papers from the {AAAI} Workshop,
28 July - 1 August 2002, Edmonton, Alberta, Canada},
series = {{AAAI} Technical Report},
volume = {{WS-02-18}},
pages = {1--14},
publisher = {{AAAI} Press},
year = {2002},
timestamp = {Fri, 09 Feb 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mrc/SimmonsGGMRSUSAAABCMPHZKWMM02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/recomb/LangmeadYMD02,
author = {Christopher James Langmead and
Anthony K. Yan and
C. Robertson McClung and
Bruce Randall Donald},
editor = {Gene Myers and
Sridhar Hannenhalli and
David Sankoff and
Sorin Istrail and
Pavel A. Pevzner and
Michael S. Waterman},
title = {Phase-independent rhythmic analysis of genome-wide expression patterns},
booktitle = {Proceedings of the Sixth Annual International Conference on Computational
Biology, {RECOMB} 2002, Washington, DC, USA, April 18-21, 2002},
pages = {205--215},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/565196.565223},
doi = {10.1145/565196.565223},
timestamp = {Wed, 19 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/recomb/LangmeadYMD02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wosp/AllenVCL02,
author = {Robert Allen and
Steve Vestal and
Dennis Cornhill and
Bruce A. Lewis},
title = {Using an architecture description language for quantitative analysis
of real-time systems},
booktitle = {Third International Workshop on Software and Performance, WOSP@ISSTA
2002, July 24-26, 2002, Rome, Italy},
pages = {203--210},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/584369.584399},
doi = {10.1145/584369.584399},
timestamp = {Sat, 03 Aug 2019 21:51:58 +0200},
biburl = {https://dblp.org/rec/conf/wosp/AllenVCL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmsj/AllenAA01,
author = {Frances E. Allen and
George S. Alm{\'{a}}si and
Wanda Andreoni and
Daniel K. Beece and
Bruce J. Berne and
Arthur A. Bright and
Jos{\'{e}} R. Brunheroto and
Calin Cascaval and
Jos{\'{e}} G. Casta{\~{n}}os and
Paul Coteus and
Paul Crumley and
Alessandro Curioni and
Monty Denneau and
Wilm E. Donath and
Maria Eleftheriou and
Blake G. Fitch and
Bruce M. Fleischer and
Christos J. Georgiou and
Robert S. Germain and
Mark Giampapa and
Donna L. Gresh and
Manish Gupta and
Ruud A. Haring and
C. T. Howard Ho and
Peter H. Hochschild and
Susan Flynn Hummel and
Tiziana Jonas and
Derek Lieber and
Glenn J. Martyna and
Kiran K. Maturu and
Jos{\'{e}} E. Moreira and
Dennis M. Newns and
Matthew Newton and
Robert Philhower and
Thomas Picunko and
Jed W. Pitera and
Michael Pitman and
Rick A. Rand and
Ajay K. Royyuru and
Valentina Salapura and
Alda Sanomiya and
Rahul S. Shah and
Yuk Yin Sham and
Sarabjeet Singh and
Marc Snir and
Frank Suits and
Richard A. Swetz and
William C. Swope and
Nagesh K. Vishnumurthy and
T. J. Christopher Ward and
Henry S. Warren Jr. and
Ruhong Zhou},
title = {Blue Gene: {A} vision for protein science using a petaflop supercomputer},
journal = {{IBM} Syst. J.},
volume = {40},
number = {2},
pages = {310--327},
year = {2001},
url = {https://doi.org/10.1147/sj.402.0310},
doi = {10.1147/SJ.402.0310},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ibmsj/AllenAA01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsm/LangbeinMMM01,
author = {Frank C. Langbein and
Bruce I. Mills and
A. David Marshall and
Ralph R. Martin},
title = {Approximate Geometric Regularities},
journal = {Int. J. Shape Model.},
volume = {7},
number = {2},
pages = {129--162},
year = {2001},
url = {https://doi.org/10.1142/S0218654301000096},
doi = {10.1142/S0218654301000096},
timestamp = {Thu, 09 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijsm/LangbeinMMM01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/King01,
author = {R. B. King},
title = {Aromaticity in Transition Metal Oxide Structures},
journal = {J. Chem. Inf. Comput. Sci.},
volume = {41},
number = {3},
pages = {517--526},
year = {2001},
url = {https://doi.org/10.1021/ci000074u},
doi = {10.1021/CI000074U},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/King01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcise/LangbeinMMM01,
author = {Frank C. Langbein and
Bruce I. Mills and
A. David Marshall and
Ralph R. Martin},
title = {Finding Approximate Shape Regularities for Reverse Engineering},
journal = {J. Comput. Inf. Sci. Eng.},
volume = {1},
number = {4},
pages = {282--290},
year = {2001},
url = {https://doi.org/10.1115/1.1430232},
doi = {10.1115/1.1430232},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcise/LangbeinMMM01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfp/IrwinRK01,
author = {Robert J. Irwin and
James S. Royer and
Bruce M. Kapron},
title = {On characterizations of the basic feasible functionals (Part {I)}},
journal = {J. Funct. Program.},
volume = {11},
number = {1},
pages = {117--153},
year = {2001},
url = {https://doi.org/10.1017/s0956796800003841},
doi = {10.1017/S0956796800003841},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfp/IrwinRK01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/PaineWSWNDH01,
author = {Bruce M. Paine and
Richard C. Wong and
Adele E. Schmitz and
Robert H. Walden and
Loi D. Nguyen and
Michael J. Delaney and
Kenny C. Hum},
title = {Ka-band InP high electron mobility transistor monolithic microwave
integrated circuit reliability},
journal = {Microelectron. Reliab.},
volume = {41},
number = {8},
pages = {1115--1122},
year = {2001},
url = {https://doi.org/10.1016/S0026-2714(01)00083-X},
doi = {10.1016/S0026-2714(01)00083-X},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/PaineWSWNDH01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/BarkerGHHLMMOPTVXYW01,
author = {Winona C. Barker and
John S. Garavelli and
Zhenglin Hou and
Hongzhan Huang and
Robert S. Ledley and
Peter B. McGarvey and
Hans{-}Werner Mewes and
Bruce C. Orcutt and
Friedhelm Pfeiffer and
Akira Tsugita and
Cholanayakanahalli R. Vinayaka and
Chunlin Xiao and
Lai{-}Su L. Yeh and
Cathy H. Wu},
title = {Protein Information Resource: a community resource for expert annotation
of protein data},
journal = {Nucleic Acids Res.},
volume = {29},
number = {1},
pages = {29--32},
year = {2001},
url = {https://doi.org/10.1093/nar/29.1.29},
doi = {10.1093/NAR/29.1.29},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nar/BarkerGHHLMMOPTVXYW01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tamm/DeardenMG01,
author = {Bruce Dearden and
Jerry Metzger and
Robert Gilmer},
title = {Invertible Matrices Modulo n: 10767},
journal = {Am. Math. Mon.},
volume = {108},
number = {8},
pages = {774},
year = {2001},
url = {http://www.jstor.org/stable/2695635},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tamm/DeardenMG01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/HursonC01,
author = {Ali R. Hurson and
Bruce R. Childers},
title = {Message from the Guest Editors},
journal = {{IEEE} Trans. Computers},
volume = {50},
number = {8},
pages = {767--768},
year = {2001},
url = {https://doi.org/10.1109/TC.2001.946997},
doi = {10.1109/TC.2001.946997},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/HursonC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/WoodleyHK01,
author = {Bruce R. Woodley and
Jonathan P. How and
Robert L. Kosut},
title = {Model free subspace based H\({}_{\mbox{{\(\infty\)}}}\) control},
booktitle = {American Control Conference, {ACC} 2001, Arlington, VA, USA, 25-27
June, 2001},
pages = {2712--2717},
publisher = {{IEEE}},
year = {2001},
url = {https://doi.org/10.1109/ACC.2001.946293},
doi = {10.1109/ACC.2001.946293},
timestamp = {Wed, 05 Jan 2022 10:14:49 +0100},
biburl = {https://dblp.org/rec/conf/amcc/WoodleyHK01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/DolinSACGKLL01,
author = {Robert H. Dolin and
Kent A. Spackman and
Alan Abilla and
Carol M. Correia and
Bruce Goldberg and
Debra J. Konicek and
Jonathan Lukoff and
Cynthia B. Lundberg},
title = {The {SNOMED} {RT} Procedure Model},
booktitle = {{AMIA} 2001, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 3-7, 2001},
publisher = {{AMIA}},
year = {2001},
url = {https://knowledge.amia.org/amia-55142-a2001a-1.597057/t-001-1.599654/f-001-1.599655/a-028-1.600053/a-029-1.600050},
timestamp = {Wed, 17 Apr 2024 11:48:39 +0200},
biburl = {https://dblp.org/rec/conf/amia/DolinSACGKLL01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/PatesSESSD01,
author = {Robert D. Pates and
Kenneth W. Scully and
Jonathan S. Einbinder and
George J. Stukenborg and
Thomas A. Spraggins and
Bruce P. Dembling},
title = {Enhancement of Clinical Data Repository by Linkage to State Mortality
Files},
booktitle = {{AMIA} 2001, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 3-7, 2001},
publisher = {{AMIA}},
year = {2001},
url = {https://knowledge.amia.org/amia-55142-a2001a-1.597057/t-002-1.598852/f-001-1.598853/a-346-1.599097/a-347-1.599094},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/PatesSESSD01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/avsp/GoeckeMZR01,
author = {Roland Goecke and
J. Bruce Millar and
Alexander Zelinsky and
Jordi Robert{-}Ribes},
editor = {Dominic W. Massaro and
Joanna Light and
Kristin Geraci},
title = {Analysis of audio-video correlation in vowels in Australian English},
booktitle = {Auditory-Visual Speech Processing, {AVSP} 2001, Aalborg, Denmark,
September 7-9, 2001},
pages = {115--120},
publisher = {{ISCA}},
year = {2001},
url = {https://www.isca-archive.org/avsp\_2001/goecke01\_avsp.html},
timestamp = {Thu, 01 Aug 2024 09:03:59 +0200},
biburl = {https://dblp.org/rec/conf/avsp/GoeckeMZR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/SmithDREM01,
author = {Robert E. Smith and
Bruce A. Dike and
B. Ravichandran and
Adel El{-}Fallah and
Raman K. Mehra},
editor = {Egbert J. W. Boers and
Jens Gottlieb and
Pier Luca Lanzi and
Robert E. Smith and
Stefano Cagnoni and
Emma Hart and
G{\"{u}}nther R. Raidl and
H. Tijink},
title = {Two-Sided, Genetics-Based Learning to Discover Novel Fighter Combat
Maneuvers},
booktitle = {Applications of Evolutionary Computing, EvoWorkshops 2001: EvoCOP,
EvoFlight, EvoIASP, EvoLearn, and EvoSTIM, Como, Italy, April 18-20,
2001, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2037},
pages = {233--242},
publisher = {Springer},
year = {2001},
url = {https://doi.org/10.1007/3-540-45365-2\_24},
doi = {10.1007/3-540-45365-2\_24},
timestamp = {Tue, 14 May 2019 10:00:37 +0200},
biburl = {https://dblp.org/rec/conf/evoW/SmithDREM01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fccm/BohmDNHRCR01,
author = {A. P. Wim B{\"{o}}hm and
Bruce A. Draper and
Walid A. Najjar and
Jeffrey Hammes and
Robert Rinker and
Monica Chawathe and
Charlie Ross},
title = {One-Step Compilation of Image Processing Applications to FPGAs},
booktitle = {The 9th Annual {IEEE} Symposium on Field-Programmable Custom Computing
Machines, {FCCM} 2001, Rohnert Park, California, USA, April 29 - May
2, 2001},
pages = {209--218},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.ieeecomputersociety.org/10.1109/FCCM.2001.32},
doi = {10.1109/FCCM.2001.32},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fccm/BohmDNHRCR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/IslaBDB01,
author = {Damian A. Isla and
Robert C. Burke and
Marc Downie and
Bruce Blumberg},
editor = {Bernhard Nebel},
title = {A Layered Brain Architecture for Synthetic Creatures},
booktitle = {Proceedings of the Seventeenth International Joint Conference on Artificial
Intelligence, {IJCAI} 2001, Seattle, Washington, USA, August 4-10,
2001},
pages = {1051--1058},
publisher = {Morgan Kaufmann},
year = {2001},
timestamp = {Tue, 20 Aug 2019 16:18:14 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/IslaBDB01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/HammesBRCDRN01,
author = {Jeffrey Hammes and
A. P. Wim B{\"{o}}hm and
Charlie Ross and
Monica Chawathe and
Bruce A. Draper and
Robert Rinker and
Walid A. Najjar},
title = {Loop fusion and temporal common subexpression elimination in window-based
loops},
booktitle = {Proceedings of the 15th International Parallel {\&} Distributed
Processing Symposium (IPDPS-01), San Francisco, CA, USA, April 23-27,
2001},
pages = {142},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/IPDPS.2001.925126},
doi = {10.1109/IPDPS.2001.925126},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/HammesBRCDRN01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kbse/GraunkeFKF01,
author = {Paul T. Graunke and
Robert Bruce Findler and
Shriram Krishnamurthi and
Matthias Felleisen},
title = {Automatically Restructuring Programs for the We},
booktitle = {16th {IEEE} International Conference on Automated Software Engineering
{(ASE} 2001), 26-29 November 2001, Coronado Island, San Diego, CA,
{USA}},
pages = {211--222},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/ASE.2001.989807},
doi = {10.1109/ASE.2001.989807},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/kbse/GraunkeFKF01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medinfo/PatesSEMSSRHD01,
author = {Robert D. Pates and
Kenneth W. Scully and
Jonathan S. Einbinder and
Richard L. Merkel and
George J. Stukenborg and
Thomas A. Spraggins and
Calvin Reynolds and
Ronald Hyman and
Bruce P. Dembling},
editor = {Vimla L. Patel and
Ray Rogers and
Reinhold Haux},
title = {Adding Value to Clinical Data By Linkage to a Public Death Registry},
booktitle = {{MEDINFO} 2001 - Proceedings of the 10th World Congress on Medical
Informatics, September 2-5, 2001, London, {UK}},
series = {Studies in Health Technology and Informatics},
volume = {84},
pages = {1384--1388},
publisher = {{IOS} Press},
year = {2001},
url = {https://doi.org/10.3233/978-1-60750-928-8-1384},
doi = {10.3233/978-1-60750-928-8-1384},
timestamp = {Wed, 03 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/medinfo/PatesSEMSSRHD01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/FindlerF01,
author = {Robert Bruce Findler and
Matthias Felleisen},
editor = {Linda M. Northrop and
John M. Vlissides},
title = {Contract Soundness for Object-Oriented Languages},
booktitle = {Proceedings of the 2001 {ACM} {SIGPLAN} Conference on Object-Oriented
Programming Systems, Languages and Applications, {OOPSLA} 2001, Tampa,
Florida, USA, October 14-18, 2001},
pages = {1--15},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/504282.504283},
doi = {10.1145/504282.504283},
timestamp = {Wed, 07 Jul 2021 17:30:33 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/FindlerF01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rtss/ZhuMC01,
author = {Dakai Zhu and
Rami G. Melhem and
Bruce R. Childers},
title = {Scheduling with Dynamic Voltage/Speed Adjustment Using Slack Reclamation
in Multi-Processor Real-Time Systems},
booktitle = {Proceedings of the 22nd {IEEE} Real-Time Systems Symposium {(RTSS}
2001), London, UK, 2-6 December 2001},
pages = {84--94},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/REAL.2001.990599},
doi = {10.1109/REAL.2001.990599},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/rtss/ZhuMC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigsoft/FindlerLF01,
author = {Robert Bruce Findler and
Mario Latendresse and
Matthias Felleisen},
editor = {A Min Tjoa and
Volker Gruhn},
title = {Behavioral contracts and behavioral subtyping},
booktitle = {Proceedings of the 8th European Software Engineering Conference held
jointly with 9th {ACM} {SIGSOFT} International Symposium on Foundations
of Software Engineering 2001, Vienna, Austria, September 10-14, 2001},
pages = {229--236},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/503209.503240},
doi = {10.1145/503209.503240},
timestamp = {Tue, 27 Jul 2021 17:16:40 +0200},
biburl = {https://dblp.org/rec/conf/sigsoft/FindlerLF01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sma/LangbeinMMM01,
author = {Frank C. Langbein and
Bruce I. Mills and
A. David Marshall and
Ralph R. Martin},
editor = {David C. Anderson and
Kunwoo Lee},
title = {Finding approximate shape regularities in reverse engineered solid
models bounded by simple surfaces},
booktitle = {Sixth {ACM} Symposium on Solid Modeling and Applications, Sheraton
Inn, Ann Arbor, Michigan, USA, June 4-8, 2001},
pages = {206--215},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/376957.376981},
doi = {10.1145/376957.376981},
timestamp = {Tue, 06 Nov 2018 11:07:49 +0100},
biburl = {https://dblp.org/rec/conf/sma/LangbeinMMM01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sma/MillsLMM01,
author = {Bruce I. Mills and
Frank C. Langbein and
A. David Marshall and
Ralph R. Martin},
editor = {David C. Anderson and
Kunwoo Lee},
title = {Approximate symmetry detection for reverse engineering},
booktitle = {Sixth {ACM} Symposium on Solid Modeling and Applications, Sheraton
Inn, Ann Arbor, Michigan, USA, June 4-8, 2001},
pages = {241--248},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/376957.376985},
doi = {10.1145/376957.376985},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sma/MillsLMM01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smi/LangbeinMMM01,
author = {Frank C. Langbein and
Bruce I. Mills and
A. David Marshall and
Ralph R. Martin},
title = {Recognizing Geometric Patterns for Beautification of Reconstructed
Solid Models},
booktitle = {2001 International Conference on Shape Modeling and Applications {(SMI}
2001), 7-11 May 2001, Genoa, Italy},
pages = {10--19},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/SMA.2001.923370},
doi = {10.1109/SMA.2001.923370},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/smi/LangbeinMMM01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/daglib/0002350,
author = {Robert Bruce Thompson and
Barbara Fritchman Thompson},
title = {{PC} hardware in a nutshell - a desktop quick reference},
publisher = {O'Reilly},
year = {2000},
isbn = {978-1-56592-599-1},
timestamp = {Tue, 12 Apr 2011 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/daglib/0002350.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aiedam/WolbrechtDPK00,
author = {Eric T. Wolbrecht and
Bruce D'Ambrosio and
Robert Paasch and
Doug Kirby},
title = {Monitoring and diagnosis of a multistage manufacturing process using
Bayesian networks},
journal = {Artif. Intell. Eng. Des. Anal. Manuf.},
volume = {14},
number = {1},
pages = {53--67},
year = {2000},
url = {http://journals.cambridge.org/action/displayAbstract?aid=38559},
timestamp = {Fri, 09 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aiedam/WolbrechtDPK00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ais/RobertsonM00,
author = {Bruce Robertson and
Mark Meadow},
title = {Microcosms: Objects of knowledge},
journal = {{AI} Soc.},
volume = {14},
number = {2},
pages = {223--229},
year = {2000},
url = {https://doi.org/10.1007/BF01205452},
doi = {10.1007/BF01205452},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ais/RobertsonM00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cse/RosnerCDFLNORTT00,
author = {Robert Rosner and
Alan C. Calder and
Jonathan Dursi and
Bruce Fryxell and
Donald Q. Lamb and
Jens C. Niemeyer and
Kevin Olson and
Paul M. Ricker and
Frank X. Timmes and
James W. Truran and
Henry M. Tufo and
Yuan{-}Nan Young and
Michael Zingale and
Ewing L. Lusk and
Rick Stevens},
title = {Flash code: studying astrophysical thermonuclear flashes},
journal = {Comput. Sci. Eng.},
volume = {2},
number = {2},
pages = {33--41},
year = {2000},
url = {https://doi.org/10.1109/5992.825747},
doi = {10.1109/5992.825747},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cse/RosnerCDFLNORTT00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/BarkerGHMOSXYLJPMTW00,
author = {Winona C. Barker and
John S. Garavelli and
Hongzhan Huang and
Peter B. McGarvey and
Bruce C. Orcutt and
Geetha Y. Srinivasarao and
Chunlin Xiao and
Lai{-}Su L. Yeh and
Robert S. Ledley and
Joseph F. Janda and
Friedhelm Pfeiffer and
Hans{-}Werner Mewes and
Akira Tsugita and
Cathy H. Wu},
title = {The Protein Information Resource {(PIR)}},
journal = {Nucleic Acids Res.},
volume = {28},
number = {1},
pages = {41--44},
year = {2000},
url = {https://doi.org/10.1093/nar/28.1.41},
doi = {10.1093/NAR/28.1.41},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nar/BarkerGHMOSXYLJPMTW00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tamm/BerndtR00,
author = {Bruce C. Berndt and
Robert A. Rankin},
title = {The Books Studied by Ramanujan in India},
journal = {Am. Math. Mon.},
volume = {107},
number = {7},
pages = {595--601},
year = {2000},
url = {http://www.jstor.org/stable/2589114},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tamm/BerndtR00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tamm/HelmboldKAAAAABBCDFGHMHHKKLLLMNPSSSSSTV00,
author = {Robert Helmbold and
Wook Kim and
Robert A. Agnew and
Zafar Ahmed and
Sa{\"{\i}}d Amghibech and
Kenneth F. Andersen and
P. J. Anderson and
G. Bower and
Bruce S. Burdick and
Robin J. Chapman and
Daniele Donini and
Patrick J. Fitzsimmons and
Richard A. Groeneveld and
V. Hernandez and
J. Martin and
Ellen Hertz and
Barthel Wayne Huff and
Gregory Keselman and
S. S. Kim and
R. A. Leslie and
John H. Lindsey II and
O. P. Lossers and
Reiner Martin and
Darryl K. Nester and
G. Peng and
Volkhard Schindler and
L. Scribani and
Heinz{-}J{\"{u}}rgen Seiffert and
Plamen Simeonov and
A. H. Stein and
Douglas B. Tyler and
Erik I. Verriest},
title = {The Variance of Logarithms: 10690},
journal = {Am. Math. Mon.},
volume = {107},
number = {2},
pages = {182},
year = {2000},
url = {http://www.jstor.org/stable/2589456},
timestamp = {Wed, 17 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tamm/HelmboldKAAAAABBCDFGHMHHKKLLLMNPSSSSSTV00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/ZhaoRWWB00,
author = {Shiying Zhao and
Douglas D. Robertson and
Ge Wang and
Bruce R. Whiting and
Kyongtae T. Bae},
title = {X-ray {CT} Metal Artifact Reduction Using Wavelets: An Application
for Imaging Total Hipt Prostheses},
journal = {{IEEE} Trans. Medical Imaging},
volume = {19},
number = {12},
pages = {1238--1247},
year = {2000},
url = {https://doi.org/10.1109/42.897816},
doi = {10.1109/42.897816},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmi/ZhaoRWWB00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEpact/ChildersD00,
author = {Bruce R. Childers and
Jack W. Davidson},
title = {Custom Wide Counterflow Pipelines for High-Performance Embedded Applications},
booktitle = {Proceedings of the 2000 International Conference on Parallel Architectures
and Compilation Techniques (PACT'00), Philadelphia, Pennsylvania,
USA, October 15-19, 2000},
pages = {57--70},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/PACT.2000.888331},
doi = {10.1109/PACT.2000.888331},
timestamp = {Tue, 31 May 2022 13:36:12 +0200},
biburl = {https://dblp.org/rec/conf/IEEEpact/ChildersD00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/YoonBBS00,
author = {Song{-}Yee Yoon and
Robert C. Burke and
Bruce Blumberg and
Gerald E. Schneider},
editor = {Henry A. Kautz and
Bruce W. Porter},
title = {Interactive Training for Synthetic Characters},
booktitle = {Proceedings of the Seventeenth National Conference on Artificial Intelligence
and Twelfth Conference on on Innovative Applications of Artificial
Intelligence, July 30 - August 3, 2000, Austin, Texas, {USA}},
pages = {249--254},
publisher = {{AAAI} Press / The {MIT} Press},
year = {2000},
url = {http://www.aaai.org/Library/AAAI/2000/aaai00-038.php},
timestamp = {Tue, 05 Sep 2023 09:10:47 +0200},
biburl = {https://dblp.org/rec/conf/aaai/YoonBBS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asap/RinkerHNBD00,
author = {Robert Rinker and
Jeffrey Hammes and
Walid A. Najjar and
A. P. Wim B{\"{o}}hm and
Bruce A. Draper},
title = {Compiling Image Processing Applications to Reconfigurable Hardware},
booktitle = {12th {IEEE} International Conference on Application-Specific Systems,
Architectures, and Processors {(ASAP} 2000), 10-12 July 2000, Boston,
MA, {USA}},
pages = {56--65},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/ASAP.2000.862378},
doi = {10.1109/ASAP.2000.862378},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/asap/RinkerHNBD00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/camp/DraperNBHRRCB00,
author = {Bruce A. Draper and
Walid A. Najjar and
A. P. Wim B{\"{o}}hm and
Jeffrey Hammes and
Robert Rinker and
Charlie Ross and
Monica Chawathe and
Jos{\'{e}} Bins},
title = {Compiling and Optimizing Image Processing Algorithms for FPGAs},
booktitle = {Fifth International Workshop on Computer Architectures for Machine
Perception {(CAMP} 2000), September 11-13, 2000, Padova, Italy},
pages = {222--231},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/CAMP.2000.875981},
doi = {10.1109/CAMP.2000.875981},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/camp/DraperNBHRRCB00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/drr/StalcupDD00,
author = {Bruce W. Stalcup and
Phillip W. Dennis and
Robert B. Dydyk},
editor = {Daniel P. Lopresti and
Jiangying Zhou},
title = {Imaged document information location and extraction using an optical
correlator},
booktitle = {Document Recognition and Retrieval VII, San Jose, CA, USA, January
22, 2000},
series = {{SPIE} Proceedings},
volume = {3967},
pages = {222--233},
publisher = {{SPIE}},
year = {2000},
url = {https://doi.org/10.1117/12.373497},
doi = {10.1117/12.373497},
timestamp = {Wed, 24 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/drr/StalcupDD00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/ChildersD00,
author = {Bruce R. Childers and
Jack W. Davidson},
title = {An Infrastructure for Designing Custom Embedded Counter-flow Pipelines},
booktitle = {33rd Annual Hawaii International Conference on System Sciences (HICSS-33),
4-7 January, 2000, Maui, Hawaii, {USA}},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/HICSS.2000.926966},
doi = {10.1109/HICSS.2000.926966},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/ChildersD00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lctrts/ChildersN00,
author = {Bruce R. Childers and
Tarun Nakra},
editor = {Jack W. Davidson and
Sang Lyul Min},
title = {Reordering Memory Bus Transactions for Reduced Power Consumption},
booktitle = {Languages, Compilers, and Tools for Embedded Systems, {ACM} {SIGPLAN}
Workshop {LCTES} 2000, Vancouver, BC, Canada, June 18, 2000, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1985},
pages = {146--161},
publisher = {Springer},
year = {2000},
url = {https://doi.org/10.1007/3-540-45245-1\_10},
doi = {10.1007/3-540-45245-1\_10},
timestamp = {Tue, 14 May 2019 10:00:51 +0200},
biburl = {https://dblp.org/rec/conf/lctrts/ChildersN00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pdpta/HammesRBND00,
author = {Jeffrey Hammes and
Robert Rinker and
A. P. Wim B{\"{o}}hm and
Walid A. Najjar and
Bruce A. Draper},
editor = {Hamid R. Arabnia},
title = {A High Level, Algorithmic Programming Language and Compiler for Reconfigurable
Systems},
booktitle = {Proceedings of the International Conference on Parallel and Distributed
Processing Techniques and Applications, {PDPTA} 2000, June 24-29,
2000, Las Vegas, Nevada, {USA}},
publisher = {{CSREA} Press},
year = {2000},
timestamp = {Mon, 08 Dec 2003 16:35:08 +0100},
biburl = {https://dblp.org/rec/conf/pdpta/HammesRBND00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/CalderCDFHMORRTTTZ00,
author = {Alan C. Calder and
Bruce C. Curtis and
L. J. Dursi and
Bruce Fryxell and
Greg Henry and
Peter MacNeice and
Kevin Olson and
Paul M. Ricker and
Robert Rosner and
Francis X. Timmes and
Henry M. Tufo and
J. W. Turan and
Michael Zingale},
editor = {Jed Donnelley},
title = {High Performance Reactive Fluid Flow Simulations Using Adaptive Mesh
Refinement on Thousands of Processors},
booktitle = {Proceedings Supercomputing 2000, November 4-10, 2000, Dallas, Texas,
{USA.} {IEEE} Computer Society, {CD-ROM}},
pages = {56},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/SC.2000.10010},
doi = {10.1109/SC.2000.10010},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/CalderCDFHMORRTTTZ00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmod/SalemBCL00,
author = {Kenneth Salem and
Kevin S. Beyer and
Roberta Cochrane and
Bruce G. Lindsay},
editor = {Weidong Chen and
Jeffrey F. Naughton and
Philip A. Bernstein},
title = {How To Roll a Join: Asynchronous Incremental View Maintenance},
booktitle = {Proceedings of the 2000 {ACM} {SIGMOD} International Conference on
Management of Data, May 16-18, 2000, Dallas, Texas, {USA}},
pages = {129--140},
publisher = {{ACM}},
year = {2000},
url = {https://doi.org/10.1145/342009.335393},
doi = {10.1145/342009.335393},
timestamp = {Fri, 12 Mar 2021 14:14:34 +0100},
biburl = {https://dblp.org/rec/conf/sigmod/SalemBCL00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc2998,
author = {Yoram Bernet and
Peter Ford and
Raj Yavatkar and
Fred Baker and
Lixia Zhang and
Michael Speer and
Robert Braden and
Bruce S. Davie and
John Wroclawski and
Eyal Felstaine},
title = {A Framework for Integrated Services Operation over Diffserv Networks},
journal = {{RFC}},
volume = {2998},
pages = {1--31},
year = {2000},
url = {https://doi.org/10.17487/RFC2998},
doi = {10.17487/RFC2998},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rfc/rfc2998.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/WanRBBA99,
author = {Ernest Wan and
Philip K. Robertson and
John Brook and
Stephen Bruce and
Kristine Armitage},
title = {Retaining Hyperlinks in Printed Hypermedia Document},
journal = {Comput. Networks},
volume = {31},
number = {11-16},
pages = {1509--1524},
year = {1999},
url = {https://doi.org/10.1016/S1389-1286(99)00049-3},
doi = {10.1016/S1389-1286(99)00049-3},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cn/WanRBBA99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cse/KuntzPDRS99,
author = {Matthew C. Kuntz and
Olga Perkovic and
Karin A. Dahmen and
Bruce W. Roberts and
James P. Sethna},
title = {Hysteresis, avalanches, and noise},
journal = {Comput. Sci. Eng.},
volume = {1},
number = {4},
pages = {73--81},
year = {1999},
url = {https://doi.org/10.1109/5992.774844},
doi = {10.1109/5992.774844},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cse/KuntzPDRS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmsj/BlasgenACGKLLMPPSSSSTWY99,
author = {Mike W. Blasgen and
Morton M. Astrahan and
Donald D. Chamberlin and
Jim Gray and
W. Frank King III and
Bruce G. Lindsay and
Raymond A. Lorie and
James W. Mehl and
Thomas G. Price and
Gianfranco R. Putzolu and
Mario Schkolnick and
Patricia G. Selinger and
Donald R. Slutz and
H. Raymond Strong and
Irving L. Traiger and
Bradford W. Wade and
Robert A. Yost},
title = {System {R:} An Architectural Overview},
journal = {{IBM} Syst. J.},
volume = {38},
number = {2/3},
pages = {375--396},
year = {1999},
url = {https://doi.org/10.1147/sj.382.0375},
doi = {10.1147/SJ.382.0375},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmsj/BlasgenACGKLLMPPSSSSTWY99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/interfaces/PerdueMKB99,
author = {Robert K. Perdue and
William J. McAllister and
Peter V. King and
Bruce G. Berkey},
title = {Valuation of {R} and {D} Projects Using Options Pricing and Decision
Analysis Models},
journal = {Interfaces},
volume = {29},
number = {6},
pages = {57--74},
year = {1999},
url = {https://doi.org/10.1287/inte.29.6.57},
doi = {10.1287/INTE.29.6.57},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/interfaces/PerdueMKB99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/BidgoodBBMSGJKDHB99,
author = {W. Dean Bidgood Jr. and
Bruce E. Bray and
Nicolas Brown and
Angelo Rossi Mori and
Kent A. Spackman and
Alan M. Golichowski and
Robert H. Jones and
Louis Y. Korman and
S. Brent Dove and
Lloyd Hildebrand and
Michael Berg},
title = {Research Paper: Image Acquisition Context: Procedure Description Attributes
for Clinically Relevant Indexing and Selective Retrieval of Biomedical
Images},
journal = {J. Am. Medical Informatics Assoc.},
volume = {6},
number = {1},
pages = {61--75},
year = {1999},
url = {https://doi.org/10.1136/jamia.1999.0060061},
doi = {10.1136/JAMIA.1999.0060061},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/BidgoodBBMSGJKDHB99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/King99,
author = {R. B. King},
title = {Chemical Structure and Superconductivity},
journal = {J. Chem. Inf. Comput. Sci.},
volume = {39},
number = {2},
pages = {180--191},
year = {1999},
url = {https://doi.org/10.1021/ci980050b},
doi = {10.1021/CI980050B},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/King99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/SlegelACGKKLLMM99,
author = {Timothy J. Slegel and
Robert M. Averill III and
Mark A. Check and
Bruce C. Giamei and
Barry Krumm and
Christopher A. Krygowski and
W. H. Li and
John S. Liptay and
John D. MacDougall and
Thomas J. McPherson and
Jennifer A. Navarro and
Eric M. Schwarz and
Chung{-}Lung Kevin Shum and
Charles F. Webb},
title = {IBM's {S/390} {G5} microprocessor design},
journal = {{IEEE} Micro},
volume = {19},
number = {2},
pages = {12--23},
year = {1999},
url = {https://doi.org/10.1109/40.755464},
doi = {10.1109/40.755464},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/SlegelACGKKLLMM99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/BarkerGMMOSYLMPTW99,
author = {Winona C. Barker and
John S. Garavelli and
Peter B. McGarvey and
Christopher R. Marzec and
Bruce C. Orcutt and
Geetha Y. Srinivasarao and
Lai{-}Su L. Yeh and
Robert S. Ledley and
Hans{-}Werner Mewes and
Friedhelm Pfeiffer and
Akira Tsugita and
Cathy H. Wu},
title = {The PIR-International Protein Sequence Database},
journal = {Nucleic Acids Res.},
volume = {27},
number = {1},
pages = {39--43},
year = {1999},
url = {https://doi.org/10.1093/nar/27.1.39},
doi = {10.1093/NAR/27.1.39},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nar/BarkerGMMOSYLMPTW99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/MaminRTR99,
author = {H. Jonathon Mamin and
Robert P. Ried and
Bruce D. Terris and
Daniel Rugar},
title = {Prolog to - High-density data storage based on the atomic force microscope},
journal = {Proc. {IEEE}},
volume = {87},
number = {6},
pages = {1012--1013},
year = {1999},
url = {https://doi.org/10.1109/jproc.1999.763313},
doi = {10.1109/JPROC.1999.763313},
timestamp = {Mon, 28 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pieee/MaminRTR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/MaminRTR99a,
author = {H. Jonathon Mamin and
Robert P. Ried and
Bruce D. Terris and
Daniel Rugar},
title = {High-density data storage based on the atomic force microscope},
journal = {Proc. {IEEE}},
volume = {87},
number = {6},
pages = {1014--1027},
year = {1999},
url = {https://doi.org/10.1109/5.763314},
doi = {10.1109/5.763314},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pieee/MaminRTR99a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamcomp/GhoshLMMPRRTZ99,
author = {Bhaskar Ghosh and
Frank Thomson Leighton and
Bruce M. Maggs and
S. Muthukrishnan and
C. Greg Plaxton and
Rajmohan Rajaraman and
Andr{\'{e}}a W. Richa and
Robert Endre Tarjan and
David Zuckerman},
title = {Tight Analyses of Two Local Load Balancing Algorithms},
journal = {{SIAM} J. Comput.},
volume = {29},
number = {1},
pages = {29--64},
year = {1999},
url = {https://doi.org/10.1137/S0097539795292208},
doi = {10.1137/S0097539795292208},
timestamp = {Mon, 10 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamcomp/GhoshLMMPRRTZ99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/HuangSCST99,
author = {Christie Q. Huang and
Robert K. Shepherd and
Paul M. Center and
Peter M. Seligman and
Bruce Tabor},
title = {Electrical stimulation of the auditory nerve: direct current measurement
in vivo},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {46},
number = {4},
pages = {461--469},
year = {1999},
url = {https://doi.org/10.1109/10.752943},
doi = {10.1109/10.752943},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/HuangSCST99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEpact/HammesRBNDB99,
author = {Jeffrey Hammes and
Robert Rinker and
A. P. Wim B{\"{o}}hm and
Walid A. Najjar and
Bruce A. Draper and
J. Ross Beveridge},
title = {Cameron: High level Language Compilation for Reconfigurable Systems},
booktitle = {Proceedings of the 1999 International Conference on Parallel Architectures
and Compilation Techniques, Newport Beach, California, USA, October
12-16, 1999},
pages = {236--244},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/PACT.1999.807557},
doi = {10.1109/PACT.1999.807557},
timestamp = {Mon, 30 May 2022 14:39:02 +0200},
biburl = {https://dblp.org/rec/conf/IEEEpact/HammesRBNDB99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/arvlsi/ChildersD99,
author = {Bruce R. Childers and
Jack W. Davidson},
title = {Architectural Considerations for Application-Specific Counterflow
Pipelines},
booktitle = {18th Conference on Advanced Research in {VLSI} {(ARVLSI} '99), 21-24
March 1999, Atlanta, GA, {USA}},
pages = {3--22},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/ARVLSI.1999.756034},
doi = {10.1109/ARVLSI.1999.756034},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/arvlsi/ChildersD99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/BriggsWRS99,
author = {Robert O. Briggs and
Bradley C. Wheeler and
Bruce A. Reinig and
Eric L. Santanen},
title = {Technology Supported Learning - Introduction},
booktitle = {32nd Annual Hawaii International Conference on System Sciences (HICSS-32),
January 5-8, 1999, Maui, Hawaii, {USA}},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/HICSS.1999.772806},
doi = {10.1109/HICSS.1999.772806},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/BriggsWRS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/ClemonsSW99,
author = {Eric K. Clemons and
Robert A. Schwartz and
Bruce W. Weber},
title = {Market Technostructure - Introduction},
booktitle = {32nd Annual Hawaii International Conference on System Sciences (HICSS-32),
January 5-8, 1999, Maui, Hawaii, {USA}},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/HICSS.1999.772764},
doi = {10.1109/HICSS.1999.772764},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/ClemonsSW99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icfp/FlattFKF99,
author = {Matthew Flatt and
Robert Bruce Findler and
Shriram Krishnamurthi and
Matthias Felleisen},
editor = {Didier R{\'{e}}my and
Peter Lee},
title = {Programming Languages as Operating Systems (or Revenge of the Son
of the Lisp Machine)},
booktitle = {Proceedings of the fourth {ACM} {SIGPLAN} International Conference
on Functional Programming {(ICFP} '99), Paris, France, September 27-29,
1999},
pages = {138--147},
publisher = {{ACM}},
year = {1999},
url = {https://doi.org/10.1145/317636.317793},
doi = {10.1145/317636.317793},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icfp/FlattFKF99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc/PyronAGJLMRT99,
author = {Carol Pyron and
Mike Alexander and
James Golab and
George Joos and
Bruce Long and
Robert F. Molyneaux and
Rajesh Raina and
Nandu Tendolkar},
title = {{DFT} advances in the Motorola's MPC7400, a PowerPC {G4} microprocessor},
booktitle = {Proceedings {IEEE} International Test Conference 1999, Atlantic City,
NJ, USA, 27-30 September 1999},
pages = {137--146},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/TEST.1999.805623},
doi = {10.1109/TEST.1999.805623},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/itc/PyronAGJLMRT99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwcc/JansonK99,
author = {Bruce Janson and
Bob Kummerfeld},
title = {Soda: {A} File System for a Multicomputer},
booktitle = {International Workshop on Cluster Computing {(IWCC} '99), 2-3 December
1999, Melbourne, Australia},
pages = {131--136},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/IWCC.1999.810817},
doi = {10.1109/IWCC.1999.810817},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iwcc/JansonK99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwcls/SmithDREM99,
author = {Robert E. Smith and
Bruce A. Dike and
B. Ravichandran and
Adel El{-}Fallah and
Raman K. Mehra},
editor = {Pier Luca Lanzi and
Wolfgang Stolzmann and
Stewart W. Wilson},
title = {The Fighter Aircraft {LCS:} {A} Case of Different {LCS} Goals and
Techniques},
booktitle = {Learning Classifier Systems, From Foundations to Applications},
series = {Lecture Notes in Computer Science},
volume = {1813},
pages = {283--300},
publisher = {Springer},
year = {1999},
url = {https://doi.org/10.1007/3-540-45027-0\_15},
doi = {10.1007/3-540-45027-0\_15},
timestamp = {Tue, 14 May 2019 10:00:49 +0200},
biburl = {https://dblp.org/rec/conf/iwcls/SmithDREM99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/crc/YellenPRATBS99,
author = {Jay Yellen and
Edward W. Packel and
Robert G. Rieper and
George E. Andrews and
Alan C. Tucker and
Edward A. Bender and
Bruce E. Sagan},
editor = {Kenneth H. Rosen and
John G. Michaels and
Jonathan L. Gross and
Jerrold W. Grossman and
Douglas R. Shier},
title = {Counting Methods},
booktitle = {Handbook of Discrete and Combinatorial Mathematics},
publisher = {{CRC} Press},
year = {1999},
url = {https://doi.org/10.1201/9781439832905.ch2},
doi = {10.1201/9781439832905.CH2},
timestamp = {Wed, 12 Jul 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/reference/crc/YellenPRATBS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/daglib/0095726,
author = {Craig Hunt and
Robert Bruce Thompson},
title = {Windows {NT} {TCP/IP} network administration - help for Windows {NT}
system administrators},
publisher = {O'Reilly},
year = {1998},
isbn = {978-1-56592-377-5},
timestamp = {Thu, 21 Apr 2011 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/daglib/0095726.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cvgip/FalcaoUSSHL98,
author = {Alexandre X. Falc{\~{a}}o and
Jayaram K. Udupa and
Supun Samarasekera and
Shoba Sharma and
Bruce Elliot Hirsch and
Roberto de Alencar Lotufo},
title = {User-Steered Image Segmentation Paradigms: Live Wire and Live Lane},
journal = {Graph. Model. Image Process.},
volume = {60},
number = {4},
pages = {233--260},
year = {1998},
url = {https://doi.org/10.1006/gmip.1998.0475},
doi = {10.1006/GMIP.1998.0475},
timestamp = {Tue, 24 Dec 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cvgip/FalcaoUSSHL98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/TsangFLHGW98,
author = {Ching H. Tsang and
Robert E. Fontana Jr. and
Tsann Lin and
David E. Heim and
Bruce A. Gurney and
Mason L. Williams III},
title = {Design, fabrication, and performance of spin-valve read heads for
magnetic recording applications},
journal = {{IBM} J. Res. Dev.},
volume = {42},
number = {1},
pages = {103--116},
year = {1998},
url = {https://doi.org/10.1147/rd.421.0103},
doi = {10.1147/RD.421.0103},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/TsangFLHGW98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/RobertsonGRW98,
author = {Steven J. Robertson and
Bruce L. Golden and
George C. Runger and
Edward A. Wasil},
title = {Neural network models for initial public offerings},
journal = {Neurocomputing},
volume = {18},
number = {1-3},
pages = {165--182},
year = {1998},
url = {https://doi.org/10.1016/S0925-2312(97)00077-5},
doi = {10.1016/S0925-2312(97)00077-5},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/RobertsonGRW98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/King98,
author = {R. B. King},
title = {Negative Curvature Surfaces in Chemical Structures},
journal = {J. Chem. Inf. Comput. Sci.},
volume = {38},
number = {2},
pages = {180--188},
year = {1998},
url = {https://doi.org/10.1021/ci970063\%2B},
doi = {10.1021/CI970063\%2B},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/King98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmis/ReinigBN98,
author = {Bruce A. Reinig and
Robert O. Briggs and
Jay F. Nunamaker Jr.},
title = {Flaming in the Electronic Classroom},
journal = {J. Manag. Inf. Syst.},
volume = {14},
number = {3},
pages = {45--60},
year = {1998},
url = {https://doi.org/10.1080/07421222.1997.11518174},
doi = {10.1080/07421222.1997.11518174},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmis/ReinigBN98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/BarkerGHHMOSYLMPT98,
author = {Winona C. Barker and
John S. Garavelli and
Daniel H. Haft and
Lois T. Hunt and
Christopher R. Marzec and
Bruce C. Orcutt and
Geetha Y. Srinivasarao and
Lai{-}Su L. Yeh and
Robert S. Ledley and
Hans{-}Werner Mewes and
Friedhelm Pfeiffer and
Akira Tsugita},
title = {The PIR-International Protein Sequence Database},
journal = {Nucleic Acids Res.},
volume = {26},
number = {1},
pages = {27--32},
year = {1998},
url = {https://doi.org/10.1093/nar/26.1.27},
doi = {10.1093/NAR/26.1.27},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/BarkerGHHMOSYLMPT98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigplan/FelleisenFFK98,
author = {Matthias Felleisen and
Robert Bruce Findler and
Matthew Flatt and
Shriram Krishnamurthi},
title = {The DrScheme Project: An Overview},
journal = {{ACM} {SIGPLAN} Notices},
volume = {33},
number = {6},
pages = {17--23},
year = {1998},
url = {https://doi.org/10.1145/284563.284566},
doi = {10.1145/284563.284566},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigplan/FelleisenFFK98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/LeeBBCPPPSTTW98,
author = {Robert B. Lee and
Bruce R. Barkstrom and
Herbert Bitting and
Dominique A. H. Crommelynck and
Jack Paden and
Dhirendra K. Pandey and
Kory J. Priestley and
G. Louis Smith and
Susan Thomas and
K. Lee Thornhill and
Robert S. Wilson},
title = {Prelaunch calibrations of the Clouds and the Earth's Radiant Energy
System {(CERES)} Tropical Rainfall Measuring Mission and Earth Observing
System morning {(EOS-AM1)} spacecraft thermistor bolometer sensors},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {36},
number = {4},
pages = {1173--1185},
year = {1998},
url = {https://doi.org/10.1109/36.701024},
doi = {10.1109/36.701024},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/LeeBBCPPPSTTW98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/WielickiBBCGKLMSWYCCCDKKMRRSW98,
author = {Bruce A. Wielicki and
Bruce R. Barkstrom and
Bryan A. Baum and
Thomas P. Charlock and
Richard N. Green and
David P. Kratz and
Robert B. Lee and
Patrick Minnis and
G. Louis Smith and
Takmeng Wong and
David F. Young and
Robert D. Cess and
James A. Coakley and
Dominique A. H. Crommelynck and
Leo Donner and
Robert Kandel and
Michael D. King and
Alvin J. Miller and
Veerabhadran Ramanathan and
David A. Randall and
Larry L. Stowe and
Ronald M. Welch},
title = {Clouds and the Earth's Radiant Energy System {(CERES):} algorithm
overview},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {36},
number = {4},
pages = {1127--1141},
year = {1998},
url = {https://doi.org/10.1109/36.701020},
doi = {10.1109/36.701020},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/WielickiBBCGKLMSWYCCCDKKMRRSW98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dimacs/King98,
author = {Robert Bruce King},
editor = {Pierre Hansen and
Patrick W. Fowler and
Maolin Zheng},
title = {Carbon networks on cubic infinite periodic minimal surfaces},
booktitle = {Discrete Mathematical Chemistry, Proceedings of a {DIMACS} Workshop,
New Brunswick, New Jersey, USA, 1998},
series = {{DIMACS} Series in Discrete Mathematics and Theoretical Computer Science},
volume = {51},
pages = {235--248},
publisher = {{DIMACS/AMS}},
year = {1998},
url = {https://doi.org/10.1090/dimacs/051/17},
doi = {10.1090/DIMACS/051/17},
timestamp = {Mon, 22 May 2023 16:07:35 +0200},
biburl = {https://dblp.org/rec/conf/dimacs/King98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/BriggsNRRS98,
author = {Robert O. Briggs and
Jay F. Nunamaker Jr. and
Bruce A. Reinig and
Nicholas C. Romano Jr. and
Ralph H. Sprague Jr.},
title = {Group Support Systems: {A} Cornucopia of Research Opportunities},
booktitle = {Thirty-First Annual Hawaii International Conference on System Sciences,
Kohala Coast, Hawaii, USA, January 6-9, 1998},
pages = {495--504},
publisher = {{IEEE} Computer Society},
year = {1998},
url = {https://doi.org/10.1109/HICSS.1998.653135},
doi = {10.1109/HICSS.1998.653135},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/BriggsNRRS98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/BriggsR98,
author = {Robert O. Briggs and
Bruce A. Reinig},
title = {{GSS} for Learning},
booktitle = {Thirty-First Annual Hawaii International Conference on System Sciences,
Kohala Coast, Hawaii, USA, January 6-9, 1998},
pages = {462},
publisher = {{IEEE} Computer Society},
year = {1998},
url = {https://doi.org/10.1109/HICSS.1998.653130},
doi = {10.1109/HICSS.1998.653130},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/BriggsR98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/ClemonsSW98,
author = {Eric K. Clemons and
Robert A. Schwartz and
Bruce W. Weber},
title = {Information Technology and Market Structure},
booktitle = {Thirty-First Annual Hawaii International Conference on System Sciences,
Kohala Coast, Hawaii, USA, January 6-9, 1998},
pages = {352},
publisher = {{IEEE} Computer Society},
year = {1998},
url = {https://doi.org/10.1109/HICSS.1998.655054},
doi = {10.1109/HICSS.1998.655054},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/ClemonsSW98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icfp/FindlerF98,
author = {Robert Bruce Findler and
Matthew Flatt},
editor = {Matthias Felleisen and
Paul Hudak and
Christian Queinnec},
title = {Modular Object-Oriented Programming with Units and Mixins},
booktitle = {Proceedings of the third {ACM} {SIGPLAN} International Conference
on Functional Programming {(ICFP} '98), Baltimore, Maryland, USA,
September 27-29, 1998},
pages = {94--104},
publisher = {{ACM}},
year = {1998},
url = {https://doi.org/10.1145/289423.289432},
doi = {10.1145/289423.289432},
timestamp = {Thu, 08 Jul 2021 16:04:01 +0200},
biburl = {https://dblp.org/rec/conf/icfp/FindlerF98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/its/RobertsPF98,
author = {Bruce Roberts and
Nicholas J. Pioch and
William Ferguson},
editor = {Barry P. Goettl and
Henry M. Halff and
Carol L. Redfield and
Valerie J. Shute},
title = {Verbal Coaching During a Real-Time Task},
booktitle = {Intelligent Tutoring Systems, 4th International Conference, {ITS}
'98, San Antonio, Texas, USA, August 16-19, 1998, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1452},
pages = {344--353},
publisher = {Springer},
year = {1998},
url = {https://doi.org/10.1007/3-540-68716-5\_40},
doi = {10.1007/3-540-68716-5\_40},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/its/RobertsPF98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lctrts/ChildersD98,
author = {Bruce R. Childers and
Jack W. Davidson},
editor = {Frank Mueller and
Azer Bestavros},
title = {A Design Environment for Counterflow Pipeline Synthesis},
booktitle = {Languages, Compilers, and Tools for Embedded Systems, {ACM} {SIGPLAN}
Workshop LCTES'98, Montreal, Canada, June 1998, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1474},
pages = {113--234},
publisher = {Springer},
year = {1998},
url = {https://doi.org/10.1007/BFb0057793},
doi = {10.1007/BFB0057793},
timestamp = {Mon, 22 Mar 2021 14:03:05 +0100},
biburl = {https://dblp.org/rec/conf/lctrts/ChildersD98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mammo/BeuvilleCCDH98,
author = {Eric Beuville and
Robert Cahn and
Bj{\"{o}}rn Cederstr{\"{o}}m and
Mats Danielsson and
Bruce Hasegawa},
editor = {Nico Karssemeijer and
Martin Thijssen and
Jan H. C. L. Hendriks and
Leon van Erning},
title = {High Resolution Mammography Using a Scanned Slit Silicon Strip Detector},
booktitle = {Digital Mammography, Fourth International Workshop on Digital Mammograph,
{IWDM} 1998, Nijmegen, The Netherlands, June 1998},
series = {Computational Imaging and Vision},
volume = {13},
pages = {27--30},
publisher = {Springer},
year = {1998},
url = {https://doi.org/10.1007/978-94-011-5318-8\_4},
doi = {10.1007/978-94-011-5318-8\_4},
timestamp = {Sat, 17 Feb 2018 13:32:17 +0100},
biburl = {https://dblp.org/rec/conf/mammo/BeuvilleCCDH98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pos/BretlOSSV98,
author = {Robert Bretl and
Allen Otis and
Marc San Soucie and
Bruce Schuchardt and
R. Venkatesh},
editor = {Ronald Morrison and
Mick J. Jordan and
Malcolm P. Atkinson},
title = {Persistent Java Objects in 3 Tier Architectures},
booktitle = {Advances in Persistent Object Systems, Proceedings of the 8th International
Workshop on Persistent Object Systems {(POS8)} and Proceedings of
the 3rd International Workshop on Persistence and Java (PJW3), Tiburon,
California, USA, 1998},
pages = {236--249},
publisher = {Morgan Kaufmann},
year = {1998},
timestamp = {Wed, 11 May 2022 08:53:26 +0200},
biburl = {https://dblp.org/rec/conf/pos/BretlOSSV98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cs-CY-9810004,
author = {Bruce R. Childers and
James P. Cohoon and
Jack W. Davidson and
Peter Valle},
title = {The Design of EzWindows: {A} Graphics {API} for an Introductory Programming
Course},
journal = {CoRR},
volume = {cs.CY/9810004},
year = {1998},
url = {https://arxiv.org/abs/cs/9810004},
timestamp = {Fri, 10 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/cs-CY-9810004.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc2309,
author = {Bob Braden and
David D. Clark and
Jon Crowcroft and
Bruce S. Davie and
Steve Deering and
Deborah Estrin and
Sally Floyd and
Van Jacobson and
Greg Minshall and
Craig Partridge and
Larry L. Peterson and
K. K. Ramakrishnan and
Scott Shenker and
John Wroclawski and
Lixia Zhang},
title = {Recommendations on Queue Management and Congestion Avoidance in the
Internet},
journal = {{RFC}},
volume = {2309},
pages = {1--17},
year = {1998},
url = {https://doi.org/10.17487/RFC2309},
doi = {10.17487/RFC2309},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rfc/rfc2309.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/daglib/0091270,
author = {Robert Bruce Thompson},
title = {Windows {NT} server 4.0 for NetWare administrators - mastering the
fundamentals of Windows {NT}},
publisher = {O'Reilly},
year = {1997},
isbn = {978-1-56592-280-8},
timestamp = {Tue, 26 Apr 2011 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/daglib/0091270.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/WileMHBLDKGLSWLA97,
author = {Bruce Wile and
Michael P. Mullen and
Cara Hanson and
Dean G. Bair and
Kevin M. Lasko and
Patrick J. Duffy and
Edward J. Kaminski Jr. and
Thomas E. Gilbert and
Steven M. Licker and
Robert G. Sheldon and
William D. Wollyung and
William J. Lewis and
Robert J. Adkins},
title = {Functional verification of the {CMOS} {S/390} Parallel Enterprise
Server {G4} system},
journal = {{IBM} J. Res. Dev.},
volume = {41},
number = {4{\&}5},
pages = {549--566},
year = {1997},
url = {https://doi.org/10.1147/rd.414.0549},
doi = {10.1147/RD.414.0549},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/WileMHBLDKGLSWLA97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmis/SchwartzW97,
author = {Robert A. Schwartz and
Bruce W. Weber},
title = {Next-Generation Securities Market Systems: An Experimental Investigation
of Quote-Driven and Order- Driven Trading},
journal = {J. Manag. Inf. Syst.},
volume = {14},
number = {2},
pages = {57--80},
year = {1997},
url = {https://doi.org/10.1080/07421222.1997.11518165},
doi = {10.1080/07421222.1997.11518165},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmis/SchwartzW97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WebbASSLWCKMCSF97,
author = {Charles F. Webb and
Carl J. Anderson and
Leon J. Sigal and
Kenneth L. Shepard and
John S. Liptay and
James D. Warnock and
Brian W. Curran and
Barry Krumm and
Mark D. Mayo and
Peter J. Camporese and
Eric M. Schwarz and
Mark S. Farrell and
Phillip J. Restle and
Robert M. Averill III and
Timothy J. Slegel and
William V. Huott and
Yuen H. Chan and
Bruce Wile and
Thao N. Nguyen and
Philip G. Emma and
Daniel K. Beece and
Ching{-}Te Chuang and
Cyril Price},
title = {A 4.1-ns compact 54{\texttimes}54-b multiplier utilizing sign-select
Booth encoders},
journal = {{IEEE} J. Solid State Circuits},
volume = {32},
number = {11},
pages = {1676--1682},
year = {1997},
url = {https://doi.org/10.1109/4.641687},
doi = {10.1109/4.641687},
timestamp = {Tue, 26 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WebbASSLWCKMCSF97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/GeorgeDGHHMOSSYALTB97,
author = {David G. George and
Robert J. Dodson and
John S. Garavelli and
Daniel H. Haft and
Lois T. Hunt and
Christopher R. Marzec and
Bruce C. Orcutt and
Kathryn E. Sidman and
Geetha Y. Srinivasarao and
Lai{-}Su L. Yeh and
Leslie Arminski and
Robert S. Ledley and
Akira Tsugita and
Winona C. Barker},
title = {The Protein Information Resource {(PIR)} and the PIR-International
Protein Sequence Database},
journal = {Nucleic Acids Res.},
volume = {25},
number = {1},
pages = {24--28},
year = {1997},
url = {https://doi.org/10.1093/nar/25.1.24},
doi = {10.1093/NAR/25.1.24},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/GeorgeDGHHMOSSYALTB97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pc/EldredgeHFRRH97,
author = {Michael Eldredge and
Thomas J. R. Hughes and
Robert M. Ferencz and
Steven M. Rifai and
Arthur Raefsky and
Bruce P. Herndon},
title = {High-Performance Parallel Computing in Industry},
journal = {Parallel Comput.},
volume = {23},
number = {9},
pages = {1217--1233},
year = {1997},
url = {https://doi.org/10.1016/S0167-8191(97)00049-5},
doi = {10.1016/S0167-8191(97)00049-5},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pc/EldredgeHFRRH97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigsoft/Kelsey97,
author = {Robert Bruce Kelsey},
title = {Integrating a defect typology with containment metrics},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {22},
number = {2},
pages = {64--67},
year = {1997},
url = {https://doi.org/10.1145/251880.251947},
doi = {10.1145/251880.251947},
timestamp = {Tue, 01 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigsoft/Kelsey97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigsoft/Kelsey97a,
author = {Robert Bruce Kelsey},
title = {Book Review: Education for an Information Age: Teaching in the Computerized
Classroom},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {22},
number = {2},
pages = {99},
year = {1997},
url = {https://doi.org/10.1145/251880.566086},
doi = {10.1145/251880.566086},
timestamp = {Tue, 01 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigsoft/Kelsey97a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/HarmsenZ97,
author = {Robert W. Harmsen and
Bruce D. Zimmerman},
title = {Dynamic Simulation of Hanford Tank Waste Remediation System},
journal = {Simul.},
volume = {68},
number = {2},
pages = {139--142},
year = {1997},
url = {https://doi.org/10.1177/003754979706800207},
doi = {10.1177/003754979706800207},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simulation/HarmsenZ97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/MyersMMFFKMKD97,
author = {Brad A. Myers and
Richard G. McDaniel and
Robert C. Miller and
Alan S. Ferrency and
Andrew Faulring and
Bruce D. Kyle and
Andrew Mickish and
Alex Klimovitski and
Patrick Doane},
title = {The Amulet Environment: New Models for Effective User Interface Software
Development},
journal = {{IEEE} Trans. Software Eng.},
volume = {23},
number = {6},
pages = {347--365},
year = {1997},
url = {https://doi.org/10.1109/32.601073},
doi = {10.1109/32.601073},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tse/MyersMMFFKMKD97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/BriggsRS97,
author = {Robert O. Briggs and
Bruce A. Reinig and
Morgan M. Shepherd},
title = {Quality as a Function of Quantity in Electronic Brainstorming},
booktitle = {30th Annual Hawaii International Conference on System Sciences (HICSS-30),
7-10 January 1997, Maui, Hawaii, {USA}},
pages = {94--103},
publisher = {{IEEE} Computer Society},
year = {1997},
url = {https://doi.org/10.1109/HICSS.1997.665465},
doi = {10.1109/HICSS.1997.665465},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/BriggsRS97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/ReinigBBN97,
author = {Bruce A. Reinig and
Robert O. Briggs and
Sheila A. Brandt and
Jay F. Nunamaker Jr.},
title = {The Electronic Classroom on Fire: Why it happens, and how to put out
the flames},
booktitle = {30th Annual Hawaii International Conference on System Sciences (HICSS-30),
7-10 January 1997, Maui, Hawaii, {USA}},
pages = {639--647},
publisher = {{IEEE} Computer Society},
year = {1997},
url = {https://doi.org/10.1109/HICSS.1997.665776},
doi = {10.1109/HICSS.1997.665776},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/ReinigBBN97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/SchwartzW97,
author = {Robert A. Schwartz and
Bruce W. Weber},
title = {Combining Quote-Driven and Order-Driven Trading Systems in Next-Generation
Stock Markets: An Experimental Investigation},
booktitle = {30th Annual Hawaii International Conference on System Sciences (HICSS-30),
7-10 January 1997, Maui, Hawaii, {USA}},
pages = {218--227},
publisher = {{IEEE} Computer Society},
year = {1997},
url = {https://doi.org/10.1109/HICSS.1997.661599},
doi = {10.1109/HICSS.1997.661599},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/SchwartzW97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/SerajiBS97,
author = {Homayoun Seraji and
Bruce Bon and
Robert D. Steele},
title = {Experiments in real-time collision avoidance for dexterous 7-DOF arms},
booktitle = {Proceedings of the 1997 {IEEE} International Conference on Robotics
and Automation, Albuquerque, New Mexico, USA, April 20-25, 1997},
pages = {569--574},
publisher = {{IEEE}},
year = {1997},
url = {https://doi.org/10.1109/ROBOT.1997.620097},
doi = {10.1109/ROBOT.1997.620097},
timestamp = {Fri, 13 Aug 2021 09:26:01 +0200},
biburl = {https://dblp.org/rec/conf/icra/SerajiBS97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/SerajiBS97,
author = {Homayoun Seraji and
Bruce Bon and
Robert D. Steele},
title = {Real-time collision avoidance for 7-DOF arms},
booktitle = {Proceedings of the 1997 {IEEE/RSJ} International Conference on Intelligent
Robot and Systems. Innovative Robotics for Real-World Applications.
{IROS} '97, September 7-11, 1997, Grenoble, France},
pages = {1694--1699},
publisher = {{IEEE}},
year = {1997},
url = {https://doi.org/10.1109/IROS.1997.656587},
doi = {10.1109/IROS.1997.656587},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/SerajiBS97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/irtaw/VestalGDML97,
author = {Steve Vestal and
Laurent Guerby and
Robert Dewar and
David J. McConnell and
Bruce A. Lewis},
editor = {Andy J. Wellings},
title = {Reimplementing a multiprocess distributed paradigm for real-time systems
in Ada 95},
booktitle = {Proceedings of the Eighth International Workshop on Real-Time Ada,
{IRTAW} 1997, Ravenscar, United Kingdom, 1997},
pages = {93--99},
publisher = {{ACM}},
year = {1997},
url = {https://doi.org/10.1145/271658.271716},
doi = {10.1145/271658.271716},
timestamp = {Wed, 20 Apr 2022 12:20:20 +0200},
biburl = {https://dblp.org/rec/conf/irtaw/VestalGDML97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pacis/ReinigB97,
author = {Bruce A. Reinig and
Robert O. Briggs},
title = {An Empirical Investigation of the Electronic Classroom},
booktitle = {The Third Pacific Asia Conference on Information Systems, {PACIS}
1997, Brisbane, Australia, April, 1-5, 1997},
pages = {35},
publisher = {AISeL},
year = {1997},
url = {http://aisel.aisnet.org/pacis1997/35},
timestamp = {Sat, 03 Mar 2012 13:54:18 +0100},
biburl = {https://dblp.org/rec/conf/pacis/ReinigB97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/plilp/FindlerFFKF97,
author = {Robert Bruce Findler and
Cormac Flanagan and
Matthew Flatt and
Shriram Krishnamurthi and
Matthias Felleisen},
editor = {Hugh Glaser and
Pieter H. Hartel and
Herbert Kuchen},
title = {DrScheme: {A} Pedagogic Programming Environment for Scheme},
booktitle = {Programming Languages: Implementations, Logics, and Programs, 9th
International Symposium, PLILP'97, Including a Special Trach on Declarative
Programming Languages in Education, Southampton, UK, September 3-5,
1997, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1292},
pages = {369--388},
publisher = {Springer},
year = {1997},
url = {https://doi.org/10.1007/BFb0033856},
doi = {10.1007/BFB0033856},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/plilp/FindlerFFKF97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ppsc/HendricksonLD97,
author = {Bruce Hendrickson and
Robert W. Leland and
Rafael Van Driessche},
title = {Skewed Graph Partitioning},
booktitle = {Proceedings of the Eighth {SIAM} Conference on Parallel Processing
for Scientific Computing, {PP} 1997, Hyatt Regency Minneapolis on
Nicollel Mall Hotel, Minneapolis, Minnesota, USA, March 14-17, 1997},
publisher = {{SIAM}},
year = {1997},
timestamp = {Wed, 03 Jul 2024 11:15:21 +0200},
biburl = {https://dblp.org/rec/conf/ppsc/HendricksonLD97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/combinatorica/ReedRST96,
author = {Bruce A. Reed and
Neil Robertson and
Paul D. Seymour and
Robin Thomas},
title = {Packing Directed Circuits},
journal = {Comb.},
volume = {16},
number = {4},
pages = {535--554},
year = {1996},
url = {https://doi.org/10.1007/BF01271272},
doi = {10.1007/BF01271272},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/combinatorica/ReedRST96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gis/WickhamROJW96,
author = {James D. Wickham and
Kurt H. Riitters and
Robert V. O'Neill and
K. Bruce Jones and
Timothy G. Wade},
title = {Landscape 'Contagion' in Raster and Vector Environments},
journal = {Int. J. Geogr. Inf. Sci.},
volume = {10},
number = {7},
pages = {891--899},
year = {1996},
url = {https://doi.org/10.1080/02693799608902115},
doi = {10.1080/02693799608902115},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/gis/WickhamROJW96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/hf/FlynnBGPB96,
author = {Elizabeth Allan Flynn and
Kenneth N. Barker and
J. Tyron Gibson and
Robert E. Pearson and
Bruce A. Berger},
title = {Relationships between Ambient Sounds and the Accuracy of Pharmacists'
Prescription-Filling Performance},
journal = {Hum. Factors},
volume = {38},
number = {4},
pages = {614--622},
year = {1996},
url = {https://doi.org/10.1518/001872096778827314},
doi = {10.1518/001872096778827314},
timestamp = {Thu, 04 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/hf/FlynnBGPB96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmis/ReinigBSYN96,
author = {Bruce A. Reinig and
Robert O. Briggs and
Morgan M. Shepherd and
Jerome Yen and
Jay F. Nunamaker Jr.},
title = {Affective Reward and the Adoption of Group Support Systems: Productivity
Is Not Always Enough},
journal = {J. Manag. Inf. Syst.},
volume = {12},
number = {3},
pages = {171--185},
year = {1996},
url = {https://doi.org/10.1080/07421222.1995.11518096},
doi = {10.1080/07421222.1995.11518096},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmis/ReinigBSYN96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmis/ShepherdBRYN96,
author = {Morgan M. Shepherd and
Robert O. Briggs and
Bruce A. Reinig and
Jerome Yen and
Jay F. Nunamaker Jr.},
title = {Invoking Social Comparison to Improve Electronic Brainstorming: Beyond
Anonymity},
journal = {J. Manag. Inf. Syst.},
volume = {12},
number = {3},
pages = {155--170},
year = {1996},
url = {https://doi.org/10.1080/07421222.1995.11518095},
doi = {10.1080/07421222.1995.11518095},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmis/ShepherdBRYN96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/GronowskiBDBCEL96,
author = {Paul E. Gronowski and
William J. Bowhill and
Dale R. Donchin and
Randel P. Blake{-}Campos and
David A. Carlson and
Edward R. Equi and
Bruce J. Loughlin and
Shekhar Mehta and
Robert O. Mueller and
Andy Olesin and
Date J. W. Noorlag and
Ronald P. Preston},
title = {A 433-MHz 64-b quad-issue {RISC} microprocessor},
journal = {{IEEE} J. Solid State Circuits},
volume = {31},
number = {11},
pages = {1687--1696},
year = {1996},
url = {https://doi.org/10.1109/JSSC.1996.542313},
doi = {10.1109/JSSC.1996.542313},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/GronowskiBDBCEL96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/PeaseBLB96,
author = {Robert A. Pease and
J. D. Bruce and
H. W. Li and
R. J. Baker},
title = {Comments on "Analog layout using ALAS!" [and reply]},
journal = {{IEEE} J. Solid State Circuits},
volume = {31},
number = {9},
pages = {1364--1365},
year = {1996},
url = {https://doi.org/10.1109/4.535427},
doi = {10.1109/4.535427},
timestamp = {Mon, 18 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/PeaseBLB96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigsoft/Kelsey96,
author = {Robert Bruce Kelsey},
title = {Bad fixes, change specifications, and linguistic constraints on problem
diagnosis},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {21},
number = {2},
pages = {74--78},
year = {1996},
url = {https://doi.org/10.1145/227531.227543},
doi = {10.1145/227531.227543},
timestamp = {Wed, 02 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigsoft/Kelsey96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigsoft/Kelsey96a,
author = {Robert Bruce Kelsey},
title = {Book Review: An {ISO} 9000 Approach To Building Quality Software},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {21},
number = {4},
pages = {97--98},
year = {1996},
url = {https://doi.org/10.1145/232069.565788},
doi = {10.1145/232069.565788},
timestamp = {Wed, 02 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigsoft/Kelsey96a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigsoft/Kelsey96b,
author = {Robert Bruce Kelsey},
title = {Book Review: {A} Quantitative Approach t o Software Management: The
ami Handbook},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {21},
number = {4},
pages = {98--99},
year = {1996},
url = {https://doi.org/10.1145/232069.565792},
doi = {10.1145/232069.565792},
timestamp = {Wed, 02 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigsoft/Kelsey96b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigsoft/Kelsey96c,
author = {Robert Bruce Kelsey},
title = {Book Review: {A} {MAP} For Software Acquisition},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {21},
number = {4},
pages = {99},
year = {1996},
url = {https://doi.org/10.1145/232069.565805},
doi = {10.1145/232069.565805},
timestamp = {Wed, 02 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigsoft/Kelsey96c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigsoft/Kelsey96d,
author = {Robert Bruce Kelsey},
title = {Book Review: How To Run Successful Projects},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {21},
number = {4},
pages = {99},
year = {1996},
url = {https://doi.org/10.1145/232069.565804},
doi = {10.1145/232069.565804},
timestamp = {Wed, 02 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigsoft/Kelsey96d.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/adl/ChoyDLABDGHJKMMMP96,
author = {David M. Choy and
Cynthia Dwork and
Jeffrey B. Lotspiech and
Laura C. Anderson and
Stephen K. Boyer and
Richard Dievendorff and
Thomas D. Griffin and
Bruce A. Hoenig and
M. J. Jackson and
W. Kaka and
James M. McCrossin and
Alex M. Miller and
Robert J. T. Morris and
Norman J. Pass},
title = {A Digital Library System for Periodicals Distribution},
booktitle = {Proceedings of the Third Forum on Research and Technology Advances
in Digital Library, {ADL} '96, Washington, DC, USA, May 13-15, 1996},
pages = {95--103},
publisher = {{IEEE} Computer Society},
year = {1996},
url = {https://doi.org/10.1109/ADL.1996.502520},
doi = {10.1109/ADL.1996.502520},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/adl/ChoyDLABDGHJKMMMP96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/HendricksonLD96,
author = {Bruce Hendrickson and
Robert W. Leland and
Rafael Van Driessche},
title = {Enhancing Data Locality by Using Terminal Propagation},
booktitle = {29th Annual Hawaii International Conference on System Sciences (HICSS-29),
January 3-6, 1996, Maui, Hawaii, {USA}},
pages = {565--574},
publisher = {{IEEE} Computer Society},
year = {1996},
url = {https://doi.org/10.1109/HICSS.1996.495507},
doi = {10.1109/HICSS.1996.495507},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/HendricksonLD96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aiedam/MittelstadtPD95,
author = {Daniel Mittelstadt and
Robert Paasch and
Bruce D'Ambrosio},
title = {Application of a Bayesian network to integrated circuit tester diagnosis},
journal = {Artif. Intell. Eng. Des. Anal. Manuf.},
volume = {9},
number = {1},
pages = {51--65},
year = {1995},
url = {https://doi.org/10.1017/S0890060400002080},
doi = {10.1017/S0890060400002080},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aiedam/MittelstadtPD95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dtj/BowhillBBBBCDEFGJKLLMMPSSST95,
author = {William J. Bowhill and
Shane L. Bell and
Bradley J. Benschneider and
Andrew J. Black and
Sharon M. Britton and
Ruben W. Castelino and
Dale R. Donchin and
John H. Edmondson and
Harry R. Fair III and
Paul E. Gronowski and
Anil K. Jain and
Patricia L. Kroesen and
Marc E. Lamere and
Bruce J. Loughlin and
Shekhar Mehta and
Robert O. Mueller and
Ronald P. Preston and
Sribalan Santhanam and
Timothy A. Shedd and
Michael J. Smith and
Stephen C. Thierauf},
title = {Circuit Implementation of a 300-MHz 64-bit Second-generation {CMOS}
Alpha {CPU}},
journal = {Digit. Tech. J.},
volume = {7},
number = {1},
year = {1995},
url = {https://www.hpl.hp.com/hpjournal/dtj/vol7num1/vol7num1art8.pdf},
timestamp = {Mon, 23 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dtj/BowhillBBBBCDEFGJKLLMMPSSST95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/hf/Burgess-LimerickANK95,
author = {Robin J. Burgess{-}Limerick and
Bruce Abernethy and
Robert J. Neal and
Vaughan Kippers},
title = {Self-Selected Manual Lifting Technique: Functional Consequences of
the Interjoint Coordination},
journal = {Hum. Factors},
volume = {37},
number = {2},
pages = {395--411},
year = {1995},
url = {https://doi.org/10.1518/001872095779064537},
doi = {10.1518/001872095779064537},
timestamp = {Thu, 04 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/hf/Burgess-LimerickANK95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/MaminTFHBR95,
author = {H. Jonathon Mamin and
Bruce D. Terris and
Long{-}Sheng Fan and
Storrs Hoen and
Robert C. Barrett and
Daniel Rugar},
title = {High-density data storage using proximal probe techniques},
journal = {{IBM} J. Res. Dev.},
volume = {39},
number = {6},
pages = {681--700},
year = {1995},
url = {https://doi.org/10.1147/rd.396.0681},
doi = {10.1147/RD.396.0681},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/MaminTFHBR95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhsc/HendricksonLP95,
author = {Bruce Hendrickson and
Robert W. Leland and
Steve Plimpton},
title = {An Efficient Parallel Algorithm for Matrix-Vector Multiplication},
journal = {Int. J. High Speed Comput.},
volume = {7},
number = {1},
pages = {73--88},
year = {1995},
url = {https://doi.org/10.1142/S0129053395000051},
doi = {10.1142/S0129053395000051},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhsc/HendricksonLP95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/HuffRBWH95,
author = {Stanley M. Huff and
Roberto A. Rocha and
Bruce E. Bray and
Homer R. Warner and
Peter J. Haug},
title = {Research Paper: An Event Model of Medical Information Representation},
journal = {J. Am. Medical Informatics Assoc.},
volume = {2},
number = {2},
pages = {116--134},
year = {1995},
url = {https://doi.org/10.1136/jamia.1995.95261905},
doi = {10.1136/JAMIA.1995.95261905},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/HuffRBWH95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jgt/FiedlerHRR95,
author = {J. R. Fiedler and
John Philip Huneke and
R. Bruce Richter and
Neil Robertson},
title = {Computing the orientable genus of projective graphs},
journal = {J. Graph Theory},
volume = {20},
number = {3},
pages = {297--308},
year = {1995},
url = {https://doi.org/10.1002/jgt.3190200305},
doi = {10.1002/JGT.3190200305},
timestamp = {Fri, 27 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jgt/FiedlerHRR95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LevCTDFSGWPAHRKSLAFBYMSNMRGL95,
author = {Lavi Lev and
Andy Charnas and
Marc Tremblay and
Alexander Dalal and
Bruce A. Frederick and
Chakra R. Srivatsa and
David Greenhill and
Dennis L. Wendell and
Duy Dinh Pham and
Eric Anderson and
Hemraj K. Hingarh and
Inayat Razzack and
James M. Kaku and
Ken Shin and
Marc E. Levitt and
Michael Allen and
Philip A. Ferolito and
Richard L. Bartolotti and
Robert K. Yu and
Ronald J. Melanson and
Shailesh I. Shah and
Sophie Nguyen and
Sundari S. Mitra and
Vinita Reddy and
Vidyasagar Ganesan and
Willem J. de Lange},
title = {A 64-b microprocessor with multimedia support},
journal = {{IEEE} J. Solid State Circuits},
volume = {30},
number = {11},
pages = {1227--1238},
year = {1995},
url = {https://doi.org/10.1109/4.475710},
doi = {10.1109/4.475710},
timestamp = {Wed, 03 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LevCTDFSGWPAHRKSLAFBYMSNMRGL95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamsc/HendricksonL95,
author = {Bruce Hendrickson and
Robert W. Leland},
title = {An Improved Spectral Graph Partitioning Algorithm for Mapping Parallel
Computations},
journal = {{SIAM} J. Sci. Comput.},
volume = {16},
number = {2},
pages = {452--469},
year = {1995},
url = {https://doi.org/10.1137/0916028},
doi = {10.1137/0916028},
timestamp = {Thu, 30 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamsc/HendricksonL95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigsoft/Kelsey95,
author = {Robert Bruce Kelsey},
title = {"A plea for tolerance in matters epistemological..."},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {20},
number = {5},
pages = {39},
year = {1995},
url = {https://doi.org/10.1145/217030.217036},
doi = {10.1145/217030.217036},
timestamp = {Thu, 03 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigsoft/Kelsey95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/adl/ChoyDDLMPABBGHMMPP95,
author = {David M. Choy and
Richard Dievendorff and
Cynthia Dwork and
Jeffrey B. Lotspiech and
Robert J. T. Morris and
Norman J. Pass and
Laura C. Anderson and
Alan E. Bell and
Stephen K. Boyer and
Thomas D. Griffin and
Bruce A. Hoenig and
James M. McCrossin and
Alex M. Miller and
Florian Pestoni and
Deidra S. Picciano},
editor = {Nabil R. Adam and
Bharat K. Bhargava and
Milton Halem and
Yelena Yesha},
title = {The Almaden Distributed Digital Library System},
booktitle = {Digital Libraries, Research and Technology Advances, {ADL} '95 Forum,
McLean, Virginia, USA, May 15-17, 1995, Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {1082},
pages = {203--220},
publisher = {Springer},
year = {1995},
url = {https://doi.org/10.1007/BFb0024613},
doi = {10.1007/BFB0024613},
timestamp = {Tue, 14 May 2019 10:00:37 +0200},
biburl = {https://dblp.org/rec/conf/adl/ChoyDDLMPABBGHMMPP95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dl/CroftCW95,
author = {W. Bruce Croft and
Robert Cook and
Dean Wilder},
title = {Providing Government Information on the Internet: Experiences with
{THOMAS}},
booktitle = {Proceedings of the Second Annual Conference on the Theory and Practice
of Digital Libraries, Hypermedia Research Lab, Computer Science Department,
Texas A{\&}M University, Austin, Texas, USAJune 11-13, 1995},
year = {1995},
url = {http://www.csdl.tamu.edu/DL95/papers/croft/croft.html},
timestamp = {Tue, 16 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dl/CroftCW95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/BruceSG95,
author = {Kim B. Bruce and
Angela Schuett and
Robert van Gent},
editor = {Walter G. Olthoff},
title = {PolyTOIL: {A} Type-Safe Polymorphic Object-Oriented Language},
booktitle = {ECOOP'95 - Object-Oriented Programming, 9th European Conference, {\AA}rhus,
Denmark, August 7-11, 1995, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {952},
pages = {27--51},
publisher = {Springer},
year = {1995},
url = {https://doi.org/10.1007/3-540-49538-X\_3},
doi = {10.1007/3-540-49538-X\_3},
timestamp = {Tue, 14 May 2019 10:00:54 +0200},
biburl = {https://dblp.org/rec/conf/ecoop/BruceSG95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/MaggsMT95,
author = {Bruce M. Maggs and
Lesley R. Matheson and
Robert Endre Tarjan},
title = {Models of parallel computation: a survey and synthesis},
booktitle = {28th Annual Hawaii International Conference on System Sciences (HICSS-28),
January 3-6, 1995, Kihei, Maui, Hawaii, {USA}},
pages = {61--72},
publisher = {{IEEE} Computer Society},
year = {1995},
url = {https://doi.org/10.1109/HICSS.1995.375476},
doi = {10.1109/HICSS.1995.375476},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/MaggsMT95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/ReinigBSYN95,
author = {Bruce A. Reinig and
Robert O. Briggs and
Morgan M. Shepherd and
Jerome Yen and
Jay F. Nunamaker Jr.},
title = {Developing and validating an instrument to measure the impact of group
support technology on affective reward},
booktitle = {28th Annual Hawaii International Conference on System Sciences (HICSS-28),
January 3-6, 1995, Kihei, Maui, Hawaii, {USA}},
pages = {798--807},
publisher = {{IEEE} Computer Society},
year = {1995},
url = {https://doi.org/10.1109/HICSS.1995.375668},
doi = {10.1109/HICSS.1995.375668},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/ReinigBSYN95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/SherpherdBRY95,
author = {Morgen M. Sherpherd and
Robert O. Briggs and
Bruce A. Reinig and
Jerome Yen},
title = {Social loafing in electronic brainstorming: invoking social comparison
through technology and facilitation techniques to improve group productivity},
booktitle = {28th Annual Hawaii International Conference on System Sciences (HICSS-28),
January 3-6, 1995, Kihei, Maui, Hawaii, {USA}},
pages = {523--532},
publisher = {{IEEE} Computer Society},
year = {1995},
url = {https://doi.org/10.1109/HICSS.1995.375697},
doi = {10.1109/HICSS.1995.375697},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/SherpherdBRY95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ppsc/DinizPHL95,
author = {Pedro C. Diniz and
Steve Plimpton and
Bruce Hendrickson and
Robert W. Leland},
editor = {David H. Bailey and
Petter E. Bj{\o}rstad and
John R. Gilbert and
Michael Mascagni and
Robert S. Schreiber and
Horst D. Simon and
Virginia Torczon and
Layne T. Watson},
title = {Parallel Algorithms for Dynamically Partitioning Unstructured Grids},
booktitle = {Proceedings of the Seventh {SIAM} Conference on Parallel Processing
for Scientific Computing, {PP} 1995, San Francisco, California, USA,
February 15-17, 1995},
pages = {615--620},
publisher = {{SIAM}},
year = {1995},
timestamp = {Wed, 03 Jul 2024 11:15:21 +0200},
biburl = {https://dblp.org/rec/conf/ppsc/DinizPHL95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ppsc/HerndonARGLD95,
author = {Bruce P. Herndon and
Narayan R. Aluru and
Arthur Raefsky and
Ronald J. G. Goossens and
Kincho H. Law and
Robert W. Dutton},
editor = {David H. Bailey and
Petter E. Bj{\o}rstad and
John R. Gilbert and
Michael Mascagni and
Robert S. Schreiber and
Horst D. Simon and
Virginia Torczon and
Layne T. Watson},
title = {A Methodology for Parallelizing {PDE} Solvers: Application to Semiconductor
Device Simulation},
booktitle = {Proceedings of the Seventh {SIAM} Conference on Parallel Processing
for Scientific Computing, {PP} 1995, San Francisco, California, USA,
February 15-17, 1995},
pages = {239--240},
publisher = {{SIAM}},
year = {1995},
timestamp = {Wed, 03 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ppsc/HerndonARGLD95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/SmithDS95,
author = {Robert E. Smith and
Bruce A. Dike and
S. A. Stegmann},
editor = {Jim Hightower and
Ed Deaton and
K. M. George and
Janice H. Carroll and
Dave Oppenheim},
title = {Fitness inheritance in genetic algorithms},
booktitle = {Proceedings of the 1995 {ACM} symposium on applied computing, SAC'95,
Nashville, TN, USA, February 26-28, 1995},
pages = {345--350},
publisher = {{ACM}},
year = {1995},
url = {https://doi.org/10.1145/315891.316014},
doi = {10.1145/315891.316014},
timestamp = {Tue, 06 Nov 2018 11:06:48 +0100},
biburl = {https://dblp.org/rec/conf/sac/SmithDS95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/HendricksonL95,
author = {Bruce Hendrickson and
Robert W. Leland},
editor = {Sidney Karin},
title = {A Multi-Level Algorithm For Partitioning Graphs},
booktitle = {Proceedings Supercomputing '95, San Diego, CA, USA, December 4-8,
1995},
pages = {28},
publisher = {{ACM}},
year = {1995},
url = {https://doi.org/10.1145/224170.224228},
doi = {10.1145/224170.224228},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/HendricksonL95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/stoc/GhoshLMMPRRTZ95,
author = {Bhaskar Ghosh and
Frank Thomson Leighton and
Bruce M. Maggs and
S. Muthukrishnan and
C. Greg Plaxton and
Rajmohan Rajaraman and
Andr{\'{e}}a W. Richa and
Robert Endre Tarjan and
David Zuckerman},
editor = {Frank Thomson Leighton and
Allan Borodin},
title = {Tight analyses of two local load balancing algorithms},
booktitle = {Proceedings of the Twenty-Seventh Annual {ACM} Symposium on Theory
of Computing, 29 May-1 June 1995, Las Vegas, Nevada, {USA}},
pages = {548--558},
publisher = {{ACM}},
year = {1995},
url = {https://doi.org/10.1145/225058.225272},
doi = {10.1145/225058.225272},
timestamp = {Mon, 10 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/stoc/GhoshLMMPRRTZ95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/FeigenbaumFJNSSE94,
author = {Edward A. Feigenbaum and
Peter Friedland and
Bruce B. Johnson and
H. Penny Nii and
Herbert Schorr and
Howard E. Shrobe and
Robert S. Engelmore},
title = {Knowledge-Based Systems Research and Applications in Japan, 1992},
journal = {{AI} Mag.},
volume = {15},
number = {2},
pages = {29--43},
year = {1994},
url = {https://doi.org/10.1609/aimag.v15i2.1089},
doi = {10.1609/AIMAG.V15I2.1089},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/FeigenbaumFJNSSE94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/CampPHL94,
author = {William J. Camp and
Steve Plimpton and
Bruce Hendrickson and
Robert W. Leland},
title = {Massively Parallel Methods for Engineering and Science Problems},
journal = {Commun. {ACM}},
volume = {37},
number = {4},
pages = {31--41},
year = {1994},
url = {https://doi.org/10.1145/175276.175279},
doi = {10.1145/175276.175279},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/CampPHL94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/FeigenbaumFJNSSE94,
author = {Edward A. Feigenbaum and
Peter Friedland and
Bruce B. Johnson and
H. Penny Nii and
Herbert Schorr and
Howard E. Shrobe and
Robert S. Engelmore},
title = {Knowledge-Based Systems in Japan (Report of the {JTEC} Panel)},
journal = {Commun. {ACM}},
volume = {37},
number = {1},
pages = {17--19},
year = {1994},
timestamp = {Fri, 08 Oct 2004 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cacm/FeigenbaumFJNSSE94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cm/ConnollyHHPR94,
author = {Keith Connolly and
Bruce E. Hess and
William A. Hoberg and
Thomas C. Pingel and
Robert K. Russell Jr.},
title = {Partnering for success: an overview of customer/supplier partnering},
journal = {{IEEE} Commun. Mag.},
volume = {32},
number = {10},
pages = {46--51},
year = {1994},
url = {https://doi.org/10.1109/35.329026},
doi = {10.1109/35.329026},
timestamp = {Wed, 05 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cm/ConnollyHHPR94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/GangerWHP94,
author = {Gregory R. Ganger and
Bruce L. Worthington and
Robert Y. Hou and
Yale N. Patt},
title = {Disk Arrays: High-Performance, High-Reliability Storage Subsystems},
journal = {Computer},
volume = {27},
number = {3},
pages = {30--36},
year = {1994},
url = {https://doi.org/10.1109/2.268882},
doi = {10.1109/2.268882},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/computer/GangerWHP94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dtj/KuhnLS94,
author = {Robert H. Kuhn and
Bruce Leasure and
Sanjiv Shah},
title = {The {KAP} Parallelizer for {DEC} Fortran and {DEC} {C} Programs},
journal = {Digit. Tech. J.},
volume = {6},
number = {3},
year = {1994},
url = {https://www.hpl.hp.com/hpjournal/dtj/vol6num3/vol6num3art5.pdf},
timestamp = {Mon, 23 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dtj/KuhnLS94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/SteadHFFTBFCBASGMJPA94,
author = {William W. Stead and
R. Brian Haynes and
Sherrilynne S. Fuller and
Charles P. Friedman and
Larry E. Travis and
J. Robert Beck and
Carol H. Fenichel and
B. Chandrasekaran and
Bruce G. Buchanan and
Enrique E. Abola and
MaryEllen C. Sievert and
Reed M. Gardner and
Judith Messerle and
Conrade C. Jaffe and
William R. Pearson and
Robert M. Abarbanel},
title = {White Paper: Designing Medical Informatics Research and Library-Resource
Projects to Increase What Is Learned},
journal = {J. Am. Medical Informatics Assoc.},
volume = {1},
number = {1},
pages = {28--33},
year = {1994},
url = {https://doi.org/10.1136/jamia.1994.95236134},
doi = {10.1136/JAMIA.1994.95236134},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jamia/SteadHFFTBFCBASGMJPA94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcamd/SheridanNB94,
author = {Robert P. Sheridan and
Robert B. Nachbar and
Bruce L. Bush},
title = {Extending the trend vector: The trend matrix and sample-based partial
least squares},
journal = {J. Comput. Aided Mol. Des.},
volume = {8},
number = {3},
pages = {323--340},
year = {1994},
url = {https://doi.org/10.1007/BF00126749},
doi = {10.1007/BF00126749},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcamd/SheridanNB94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/King94,
author = {R. B. King},
title = {The role of toroidal and cylindrical chemical bonding manifolds in
coinage metal and mercury clusters},
journal = {J. Chem. Inf. Comput. Sci.},
volume = {34},
number = {2},
pages = {410--417},
year = {1994},
url = {https://doi.org/10.1021/ci00018a030},
doi = {10.1021/CI00018A030},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/King94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsis/Rollier94,
author = {Bruce Rollier},
title = {Strategic information technology management: Perspectives on organizational
growth and competitive advantage: Rajiv {D} Banker, Robert {J} Kauffman
and Mo Adam Mahmood (eds) Idea Group Publishing Harrisburg {PA} {(1993)}
704 pp {\textdollar}84.95 {(+} {\textdollar}12 shipping to {UK)} {ISBN}
1 878289 16 0},
journal = {J. Strateg. Inf. Syst.},
volume = {3},
number = {2},
pages = {149--150},
year = {1994},
url = {https://doi.org/10.1016/0963-8687(94)90017-5},
doi = {10.1016/0963-8687(94)90017-5},
timestamp = {Tue, 25 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jsis/Rollier94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/robotica/BackesBLSBZ94,
author = {Paul G. Backes and
John Beahan and
Mark K. Long and
Robert D. Steele and
Bruce Bon and
Wayne Zimmerman},
title = {A prototype ground-remote telerobot control system},
journal = {Robotica},
volume = {12},
number = {6},
pages = {481--490},
year = {1994},
url = {https://doi.org/10.1017/S0263574700016829},
doi = {10.1017/S0263574700016829},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/robotica/BackesBLSBZ94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcst/SrinivasanBVRD94,
author = {Arvind Srinivasan and
Celal Batur and
Robert J. Veillette and
Bruce N. Rosenthal and
Walter M. B. Duval},
title = {Projective control design for multi-zone crystal growth furnace},
journal = {{IEEE} Trans. Control. Syst. Technol.},
volume = {2},
number = {2},
pages = {142--147},
year = {1994},
url = {https://doi.org/10.1109/87.294337},
doi = {10.1109/87.294337},
timestamp = {Mon, 21 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcst/SrinivasanBVRD94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/BohringerDMM94,
author = {Karl{-}Friedrich B{\"{o}}hringer and
Bruce Randall Donald and
Robert Mihailovich and
Noel C. MacDonald},
title = {Sensorless Manipulation Using Massively Parallel Microfabricated Actuator
Arrays},
booktitle = {Proceedings of the 1994 International Conference on Robotics and Automation,
San Diego, CA, USA, May 1994},
pages = {826--833},
publisher = {{IEEE} Computer Society},
year = {1994},
url = {https://doi.org/10.1109/ROBOT.1994.351386},
doi = {10.1109/ROBOT.1994.351386},
timestamp = {Fri, 13 Aug 2021 09:26:01 +0200},
biburl = {https://dblp.org/rec/conf/icra/BohringerDMM94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShadidHMHHL94,
author = {John N. Shadid and
Scott A. Hutchinson and
Harry Moffat and
Gary L. Hennigan and
Bruce Hendrickson and
Robert W. Leland},
editor = {Gary M. Johnson},
title = {A 65+ Gflops/s unstructured finite element simulation of chemically
reacting flows on the Intel Paragon},
booktitle = {Proceedings Supercomputing '94, Washington, DC, USA, November 14-18,
1994},
pages = {673--679},
publisher = {{IEEE} Computer Society},
year = {1994},
url = {https://doi.org/10.1109/SUPERC.1994.344332},
doi = {10.1109/SUPERC.1994.344332},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/ShadidHMHHL94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/CotaFS94,
author = {Bruce A. Cota and
Douglas G. Fritz and
Robert G. Sargent},
editor = {Deborah A. Sadowski and
Andrew F. Seila and
Mani S. Manivannan and
Jeffrey D. Tew},
title = {Control flow graphs as a representation language},
booktitle = {Proceedings of the 26th conference on Winter simulation, {WSC} 1994,
Lake Buena Vista, FL, USA, December 11-14, 1994},
pages = {555--559},
publisher = {{ACM}},
year = {1994},
url = {https://doi.org/10.1109/WSC.1994.717382},
doi = {10.1109/WSC.1994.717382},
timestamp = {Thu, 10 Jun 2021 22:20:12 +0200},
biburl = {https://dblp.org/rec/conf/wsc/CotaFS94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rfc/rfc1664,
author = {Claudio Allocchio and
Antonio Blasco Bonito and
Bruce Cole and
Silvia Giordano and
Robert A. Hagens},
title = {Using the Internet {DNS} to Distribute {RFC1327} Mail Address Mapping
Tables},
journal = {{RFC}},
volume = {1664},
pages = {1--23},
year = {1994},
url = {https://doi.org/10.17487/RFC1664},
doi = {10.17487/RFC1664},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rfc/rfc1664.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ai/LindsayBFL93,
author = {Robert K. Lindsay and
Bruce G. Buchanan and
Edward A. Feigenbaum and
Joshua Lederberg},
title = {{DENDRAL:} {A} Case Study of the First Expert System for Scientific
Hypothesis Formation},
journal = {Artif. Intell.},
volume = {61},
number = {2},
pages = {209--261},
year = {1993},
url = {https://doi.org/10.1016/0004-3702(93)90068-M},
doi = {10.1016/0004-3702(93)90068-M},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ai/LindsayBFL93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmms/PerrinVYH93,
author = {Bruce M. Perrin and
David S. Vaughan and
Robert M. Yadrick and
Peter D. Holden},
title = {Human Local Representations of Uncertainty: {A} Methodology for and
Results from Comparing Different Schemes for Representing Uncertainty},
journal = {Int. J. Man Mach. Stud.},
volume = {38},
number = {6},
pages = {923--947},
year = {1993},
url = {https://doi.org/10.1006/imms.1993.1043},
doi = {10.1006/IMMS.1993.1043},
timestamp = {Fri, 15 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmms/PerrinVYH93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcamd/BushN93,
author = {Bruce L. Bush and
Robert B. Nachbar},
title = {Sample-distance Partial Least Squares: {PLS} optimized for many variables,
with application to CoMFA},
journal = {J. Comput. Aided Mol. Des.},
volume = {7},
number = {5},
pages = {587--619},
year = {1993},
url = {https://doi.org/10.1007/BF00124364},
doi = {10.1007/BF00124364},
timestamp = {Thu, 16 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcamd/BushN93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/BushS93,
author = {Bruce L. Bush and
Robert P. Sheridan},
title = {{PATTY:} {A} programmable atom type and language for automatic classification
of atoms in molecular databases},
journal = {J. Chem. Inf. Comput. Sci.},
volume = {33},
number = {5},
pages = {756--762},
year = {1993},
url = {https://doi.org/10.1021/ci00015a015},
doi = {10.1021/CI00015A015},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/BushS93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfp/HarperDM93,
author = {Robert Harper and
Bruce F. Duba and
David B. MacQueen},
title = {Typing First-Class Continuations in {ML}},
journal = {J. Funct. Program.},
volume = {3},
number = {4},
pages = {465--484},
year = {1993},
url = {https://doi.org/10.1017/S095679680000085X},
doi = {10.1017/S095679680000085X},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfp/HarperDM93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/BruceCMGDM93,
author = {Kim B. Bruce and
Jonathan Crabtree and
Thomas P. Murtagh and
Robert van Gent and
Allyn Dimock and
Robert Muller},
editor = {Timlynn Babitsky and
Jim Salmons},
title = {Safe and Decidable Type Checking in an Object-Oriented Language},
booktitle = {Proceedings of the Eighth Annual Conference on Object-Oriented Programming
Systems, Languages, and Applications, {OOPSLA} 1993, Washington, DC,
USA, September 26 - October 1, 1993},
pages = {29--46},
publisher = {{ACM}},
year = {1993},
url = {https://doi.org/10.1145/165854.165865},
doi = {10.1145/165854.165865},
timestamp = {Wed, 30 Mar 2022 13:56:34 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/BruceCMGDM93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ppsc/HendricksonL93,
author = {Bruce Hendrickson and
Robert W. Leland},
editor = {Richard F. Sincovec and
David E. Keyes and
Michael R. Leuze and
Linda R. Petzold and
Daniel A. Reed},
title = {An Improved Spectral Load Balancing Method},
booktitle = {Proceedings of the Sixth {SIAM} Conference on Parallel Processing
for Scientific Computing, {PP} 1993, Norfolk, Virginia, USA, March
22-24, 1993},
pages = {953--961},
publisher = {{SIAM}},
year = {1993},
timestamp = {Wed, 03 Jul 2024 11:15:21 +0200},
biburl = {https://dblp.org/rec/conf/ppsc/HendricksonL93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dtj/DobberpuhlWAABBCCDGHHKLLMMMMPRSS92,
author = {Daniel W. Dobberpuhl and
Richard T. Witek and
Randy L. Allmon and
Robert Anglin and
David Bertucci and
Sharon M. Britton and
Linda Chao and
Robert A. Conrad and
Daniel E. Dever and
Bruce Gieseke and
Soha Hassoun and
Gregory W. Hoeppner and
Kathryn Kuchler and
Maureen Ladd and
Burton M. Leary and
Liam Madden and
Edward J. McLellan and
Derrick Meyer and
James Montanaro and
Donald A. Priore and
Vidya Rajagopalan and
Sridhar Samudrala and
Sribalan Santhanam},
title = {A 200-MHz 64-bit Dual-Issue {CMOS} Microprocessor},
journal = {Digit. Tech. J.},
volume = {4},
number = {4},
year = {1992},
url = {https://www.hpl.hp.com/hpjournal/dtj/vol4num4/vol4num4art2.pdf},
timestamp = {Mon, 23 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dtj/DobberpuhlWAABBCCDGHHKLLMMMMPRSS92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/King92,
author = {R. B. King},
title = {Applications of graph theory and topology for the study of aromaticity
in inorganic compounds},
journal = {J. Chem. Inf. Comput. Sci.},
volume = {32},
number = {1},
pages = {42--47},
year = {1992},
url = {https://doi.org/10.1021/ci00005a007},
doi = {10.1021/CI00005A007},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/King92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mscs/BruceCL92,
author = {Kim B. Bruce and
Roberto Di Cosmo and
Giuseppe Longo},
title = {Provable Isomorphisms of Types},
journal = {Math. Struct. Comput. Sci.},
volume = {2},
number = {2},
pages = {231--247},
year = {1992},
url = {https://doi.org/10.1017/S0960129500001444},
doi = {10.1017/S0960129500001444},
timestamp = {Wed, 01 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mscs/BruceCL92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tois/KrovetzC92,
author = {Robert Krovetz and
W. Bruce Croft},
title = {Lexical Ambiguity and Information Retrieval},
journal = {{ACM} Trans. Inf. Syst.},
volume = {10},
number = {2},
pages = {115--141},
year = {1992},
url = {https://doi.org/10.1145/146802.146810},
doi = {10.1145/146802.146810},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tois/KrovetzC92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tomacs/CotaS92,
author = {Bruce A. Cota and
Robert G. Sargent},
title = {A Modification of the Process Interaction World View},
journal = {{ACM} Trans. Model. Comput. Simul.},
volume = {2},
number = {2},
pages = {109--129},
year = {1992},
url = {https://doi.org/10.1145/137926.137927},
doi = {10.1145/137926.137927},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tomacs/CotaS92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vbc/UdupaHSG92,
author = {Jayaram K. Udupa and
Bruce Elliot Hirsch and
Supun Samarasekera and
Roberto J. Gon{\c{c}}alves},
editor = {Richard A. Robb},
title = {Joint kinematics via three-dimensional {MR} imaging},
booktitle = {Visualization in Biomedical Computing '92, Chapel Hill, NC, USA, 13-16
October 1992},
series = {{SPIE} Proceedings},
volume = {1808},
publisher = {{SPIE}},
year = {1992},
url = {https://doi.org/10.1117/12.131118},
doi = {10.1117/12.131118},
timestamp = {Thu, 23 Aug 2018 12:37:40 +0200},
biburl = {https://dblp.org/rec/conf/vbc/UdupaHSG92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/others/92/MacLeodM92,
author = {Bruce MacLeod and
Robert Moll},
editor = {Osman Balci and
Ramesh Sharda and
Stavros A. Zenios},
title = {A Principled Approach to Solving Complex Discrete Optimization Problems},
booktitle = {Computer Science and Operations Research},
pages = {3--21},
publisher = {Pergamon Press},
year = {1992},
url = {https://doi.org/10.1016/b978-0-08-040806-4.50006-x},
doi = {10.1016/B978-0-08-040806-4.50006-X},
timestamp = {Tue, 23 Jun 2020 13:38:08 +0200},
biburl = {https://dblp.org/rec/books/others/92/MacLeodM92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/MartinPB91,
author = {Bruce E. Martin and
Claus H. Pedersen and
James Bedford{-}Roberts},
title = {An Object-Based Taxonomy for Distributed Computing Systems},
journal = {Computer},
volume = {24},
number = {8},
pages = {17--27},
year = {1991},
url = {https://doi.org/10.1109/2.84873},
doi = {10.1109/2.84873},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/computer/MartinPB91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gst/ReedRSS91,
author = {Bruce A. Reed and
Neil Robertson and
Alexander Schrijver and
Paul D. Seymour},
editor = {Neil Robertson and
Paul D. Seymour},
title = {Finding disjoint trees in planar graphs in linear time},
booktitle = {Graph Structure Theory, Proceedings of a {AMS-IMS-SIAM} Joint Summer
Research Conference on Graph Minors held June 22 to July 5, 1991,
at the University of Washington, Seattle, {USA}},
series = {Contemporary Mathematics},
volume = {147},
pages = {295--301},
publisher = {American Mathematical Society},
year = {1991},
timestamp = {Fri, 27 Aug 2021 14:49:51 +0200},
biburl = {https://dblp.org/rec/conf/gst/ReedRSS91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccd/CoxJRSW91,
author = {Dennis T. Cox and
Charles L. Johnson and
Bruce G. Rudolph and
David W. Siljenberg and
Robert R. Williams},
title = {{IBM} {AS/400} Processor Technology},
booktitle = {Proceedings 1991 {IEEE} International Conference on Computer Design:
{VLSI} in Computer {\&} Processors, {ICCD} '91, Cambridge, MA,
USA, October 14-16, 1991},
pages = {448--452},
publisher = {{IEEE} Computer Society},
year = {1991},
url = {https://doi.org/10.1109/ICCD.1991.139944},
doi = {10.1109/ICCD.1991.139944},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccd/CoxJRSW91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/GrahamN91,
author = {Bruce Graham and
Robert B. Newell},
editor = {Dimiter Driankov and
Peter W. Eklund and
Anca L. Ralescu},
title = {An Adaptive Fuzzy Model-Based Controller},
booktitle = {Fuzzy Logic and Fuzzy Control, {IJCAI} '91, Workshops on Fuzzy Logic
and Fuzzy Control, Sydney, Australia, August 24, 1991, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {833},
pages = {56--66},
publisher = {Springer},
year = {1991},
url = {https://doi.org/10.1007/3-540-58279-7\_19},
doi = {10.1007/3-540-58279-7\_19},
timestamp = {Tue, 14 May 2019 10:00:47 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/GrahamN91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/popl/DubaHM91,
author = {Bruce F. Duba and
Robert Harper and
David B. MacQueen},
editor = {David S. Wise},
title = {Typing First-Class Continuations in {ML}},
booktitle = {Conference Record of the Eighteenth Annual {ACM} Symposium on Principles
of Programming Languages, Orlando, Florida, USA, January 21-23, 1991},
pages = {163--173},
publisher = {{ACM} Press},
year = {1991},
url = {https://doi.org/10.1145/99583.99608},
doi = {10.1145/99583.99608},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/popl/DubaHM91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/visualization/HaberLC91,
author = {Robert B. Haber and
Bruce Lucas and
Nancy S. Collins},
editor = {Gregory M. Nielson and
Lawrence J. Rosenblum},
title = {Data Model for Scientific Visualization with Provisions for Regular
and Irregular Grids},
booktitle = {2nd {IEEE} Visualization Conference, {IEEE} Vis 1991, San Diego, CA,
USA, October 22-25, 1991, Proceedings},
pages = {298--305},
publisher = {{IEEE} Computer Society Press},
year = {1991},
url = {https://doi.org/10.1109/VISUAL.1991.175818},
doi = {10.1109/VISUAL.1991.175818},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/visualization/HaberLC91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vldb/AgrawalCL91,
author = {Rakesh Agrawal and
Roberta Cochrane and
Bruce G. Lindsay},
editor = {Guy M. Lohman and
Am{\'{\i}}lcar Sernadas and
Rafael Camps},
title = {On Maintaining Priorities in a Production Rule System},
booktitle = {17th International Conference on Very Large Data Bases, September
3-6, 1991, Barcelona, Catalonia, Spain, Proceedings},
pages = {479--487},
publisher = {Morgan Kaufmann},
year = {1991},
url = {http://www.vldb.org/conf/1991/P479.PDF},
timestamp = {Tue, 07 Nov 2017 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vldb/AgrawalCL91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vldb/WidomCL91,
author = {Jennifer Widom and
Roberta Cochrane and
Bruce G. Lindsay},
editor = {Guy M. Lohman and
Am{\'{\i}}lcar Sernadas and
Rafael Camps},
title = {Implementing Set-Oriented Production Rules as an Extension to Starburst},
booktitle = {17th International Conference on Very Large Data Bases, September
3-6, 1991, Barcelona, Catalonia, Spain, Proceedings},
pages = {275--285},
publisher = {Morgan Kaufmann},
year = {1991},
url = {http://www.vldb.org/conf/1991/P275.PDF},
timestamp = {Wed, 29 Mar 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vldb/WidomCL91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TaylorT91,
author = {Robert Bruce Taylor and
Hamdy A. Taha},
editor = {Barry L. Nelson and
W. David Kelton and
Gordon M. Clark},
title = {Automatic generation of a class of simulation models from databases},
booktitle = {Proceedings of the 23th Winter Simulation Conference, Phoenix, Arizona,
USA, December 8-11, 1991},
pages = {1209--1217},
publisher = {{IEEE} Computer Society},
year = {1991},
url = {https://doi.org/10.1109/WSC.1991.185744},
doi = {10.1109/WSC.1991.185744},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wsc/TaylorT91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ai/PorterBH90,
author = {Bruce W. Porter and
Ray Bareiss and
Robert C. Holte},
title = {Concept Learning and Heuristic Classification in WeakTtheory Domains},
journal = {Artif. Intell.},
volume = {45},
number = {1-2},
pages = {229--263},
year = {1990},
url = {https://doi.org/10.1016/0004-3702(90)90041-W},
doi = {10.1016/0004-3702(90)90041-W},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ai/PorterBH90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/CroftKT90,
author = {W. Bruce Croft and
Robert Krovetz and
Howard R. Turtle},
title = {Interactive retrieval of complex documents},
journal = {Inf. Process. Manag.},
volume = {26},
number = {5},
pages = {593--613},
year = {1990},
url = {https://doi.org/10.1016/0306-4573(90)90104-A},
doi = {10.1016/0306-4573(90)90104-A},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ipm/CroftKT90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/ReddyCGC90,
author = {Narender P. Reddy and
Bruce R. Costarella and
Robert C. Grotz and
Enrique P. Canilang},
title = {Biomechanical measurements to characterize the oral phase of dysphagia},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {37},
number = {4},
pages = {392--397},
year = {1990},
url = {https://doi.org/10.1109/10.52346},
doi = {10.1109/10.52346},
timestamp = {Fri, 08 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbe/ReddyCGC90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/transci/JohnsonFLBHWHS90,
author = {Rubin Johnson and
Thomas A. Feo and
Bruce W. Lamar and
Peter B. Belobaba and
David A. Hensher and
Robert A. Wolfe and
Susan Hanson and
Ilan Solomon},
title = {Bibliographic Section},
journal = {Transp. Sci.},
volume = {24},
number = {2},
pages = {159--167},
year = {1990},
url = {https://doi.org/10.1287/trsc.24.2.159},
doi = {10.1287/TRSC.24.2.159},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/transci/JohnsonFLBHWHS90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsi/MacLeodM90,
author = {Bruce MacLeod and
Robert Moll},
editor = {Peter A. Ng and
C. V. Ramamoorthy and
Laurence C. Seifert and
Raymond T. Yeh},
title = {A Toolkit for Vehicle Routing},
booktitle = {Proceedings of the First International Conference on Systems Integration,
Morristown, NJ, USA, April 1990},
pages = {426--431},
publisher = {{IEEE} Computer Society},
year = {1990},
timestamp = {Tue, 26 Nov 2002 11:36:28 +0100},
biburl = {https://dblp.org/rec/conf/icsi/MacLeodM90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miip/GouldHDSH90,
author = {Robert G. Gould and
Bruce H. Hasegawa and
Sherman E. DeForest and
Gregory W. Schmidt and
Richard G. Hier},
editor = {Murray H. Loew},
title = {Optical compensation device for chest film radiography},
booktitle = {Medical Imaging {IV:} Image Processing, 1990, Newport Beach, CA, United
States, February 1990},
series = {{SPIE} Proceedings},
volume = {1233},
publisher = {{SPIE}},
year = {1990},
url = {https://doi.org/10.1117/12.18917},
doi = {10.1117/12.18917},
timestamp = {Wed, 27 Nov 2024 12:16:43 +0100},
biburl = {https://dblp.org/rec/conf/miip/GouldHDSH90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pldi/HenryWF90,
author = {Robert R. Henry and
Kenneth M. Whaley and
Bruce Forstall},
editor = {Bernard N. Fischer},
title = {The University of Washington Illustrating Compiler},
booktitle = {Proceedings of the {ACM} SIGPLAN'90 Conference on Programming Language
Design and Implementation (PLDI), White Plains, New York, USA, June
20-22, 1990},
pages = {223--233},
publisher = {{ACM}},
year = {1990},
url = {https://doi.org/10.1145/93542.93571},
doi = {10.1145/93542.93571},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pldi/HenryWF90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/CotaS90,
author = {Bruce A. Cota and
Robert G. Sargent},
editor = {Osman Balci},
title = {Simultaneous events and distributed simulation},
booktitle = {Proceedings of the 22th Winter Simulation Conference, New Orleans,
Louisiana, USA, December 9-12, 1990},
pages = {436--440},
publisher = {{IEEE} Computer Society},
year = {1990},
url = {https://doi.org/10.1109/WSC.1990.129556},
doi = {10.1109/WSC.1990.129556},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wsc/CotaS90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/TahaTY90,
author = {Hamdy A. Taha and
Robert Bruce Taylor and
Nazar Younis},
editor = {Osman Balci},
title = {Simulation and animation with {SIMNET} {II} and {ISES}},
booktitle = {Proceedings of the 22th Winter Simulation Conference, New Orleans,
Louisiana, USA, December 9-12, 1990},
pages = {99--105},
publisher = {{IEEE} Computer Society},
year = {1990},
url = {https://doi.org/10.1109/WSC.1990.129494},
doi = {10.1109/WSC.1990.129494},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wsc/TahaTY90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcv/DraperCBHR89,
author = {Bruce A. Draper and
Robert T. Collins and
John Brolio and
Allen R. Hanson and
Edward M. Riseman},
title = {The schema system},
journal = {Int. J. Comput. Vis.},
volume = {2},
number = {3},
pages = {209--250},
year = {1989},
url = {https://doi.org/10.1007/BF00158165},
doi = {10.1007/BF00158165},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijcv/DraperCBHR89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pc/HyattSN89,
author = {Robert M. Hyatt and
Bruce W. Suter and
Harry L. Nelson},
title = {A parallel alpha/beta tree searching algorithm},
journal = {Parallel Comput.},
volume = {10},
number = {3},
pages = {299--308},
year = {1989},
url = {https://doi.org/10.1016/0167-8191(89)90102-6},
doi = {10.1016/0167-8191(89)90102-6},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pc/HyattSN89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/KuoYDW89,
author = {James B. Kuo and
Tsen{-}Shau Yang and
Robert W. Dutton and
Bruce A. Wooley},
title = {Two-dimensional transient analysis of a collector-up {ECL} inverter},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {8},
number = {10},
pages = {1038--1045},
year = {1989},
url = {https://doi.org/10.1109/43.39065},
doi = {10.1109/43.39065},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcad/KuoYDW89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anss/CotaS89,
author = {Bruce A. Cota and
Robert G. Sargent},
editor = {Alan H. Rutan},
title = {An algorithm for parallel discrete event simulation using common memory},
booktitle = {Proceedings 22nd Annual Simulation Symposium {(ANSS-22} 1989), Tampa,
Florida, USA, 1989},
pages = {23--31},
publisher = {{IEEE} Computer Society},
year = {1989},
url = {https://doi.org/10.1109/SIMSYM.1989.748298},
doi = {10.1109/SIMSYM.1989.748298},
timestamp = {Mon, 09 Aug 2021 14:54:01 +0200},
biburl = {https://dblp.org/rec/conf/anss/CotaS89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/CornelissenKBRWEEVH89,
author = {Germaine Cornelissen and
Ricchard Kopher and
Paul Brat and
Joseph Rigatuso and
Bruce Work and
Dianne Eggen and
Stanley Einzig and
Robert Vernier and
Franz Halberg},
title = {Chronobiologic ambulatory cardiovascular monitoring during pregnancy
in Group Health of Minnesota},
booktitle = {Second Annual {IEEE} Symposium on Computer-Based Medical Systems (CBMS'89),
June 26-27, 1989, Minneapolis, MN, {USA}},
pages = {226--237},
publisher = {{IEEE}},
year = {1989},
url = {https://doi.org/10.1109/CBMSYS.1989.47382},
doi = {10.1109/CBMSYS.1989.47382},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/cbms/CornelissenKBRWEEVH89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/HolteAP89,
author = {Robert C. Holte and
Liane Acker and
Bruce W. Porter},
editor = {N. S. Sridharan},
title = {Concept Learning and the Problem of Small Disjuncts},
booktitle = {Proceedings of the 11th International Joint Conference on Artificial
Intelligence. Detroit, MI, USA, August 1989},
pages = {813--818},
publisher = {Morgan Kaufmann},
year = {1989},
url = {http://ijcai.org/Proceedings/89-1/Papers/130.pdf},
timestamp = {Tue, 20 Aug 2019 16:17:51 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/HolteAP89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lcn/AndersonL89,
author = {Bruce C. Anderson and
Robert N. Linebarger},
title = {A graphical representation for network management},
booktitle = {Proceedings of the 14th Conference on Local Computer Networks, {LCN}
1989, 1989, Minneapolis, Minnesota, {USA}},
pages = {106--124},
publisher = {{IEEE} Computer Society},
year = {1989},
url = {https://doi.org/10.1109/LCN.1989.65250},
doi = {10.1109/LCN.1989.65250},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/lcn/AndersonL89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/KrovetzC89,
author = {Robert Krovetz and
W. Bruce Croft},
editor = {Nicholas J. Belkin and
C. J. van Rijsbergen},
title = {Word Sense Disambiguation Using Machine-Readable Dictionaries},
booktitle = {SIGIR'89, 12th International Conference on Research and Development
in Information Retrieval, Cambridge, Massachusetts, USA, June 25-28,
1989, Proceedings},
pages = {127--136},
publisher = {{ACM}},
year = {1989},
url = {https://doi.org/10.1145/75334.75349},
doi = {10.1145/75334.75349},
timestamp = {Tue, 06 Nov 2018 11:07:23 +0100},
biburl = {https://dblp.org/rec/conf/sigir/KrovetzC89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uai/VaughanPYH89,
author = {David S. Vaughan and
Bruce M. Perrin and
Robert M. Yadrick and
Peter D. Holden},
editor = {Max Henrion and
Ross D. Shachter and
Laveen N. Kanal and
John F. Lemmer},
title = {Comparing Expert Systems Built Using Different Uncertain Inference
Systems},
booktitle = {{UAI} '89: Proceedings of the Fifth Annual Conference on Uncertainty
in Artificial Intelligence, Windsor, Ontario, Canada, August 18-20,
1989},
pages = {445--456},
publisher = {North-Holland},
year = {1989},
url = {https://dslpitt.org/uai/displayArticleDetails.jsp?mmnu=1\&smnu=2\&article\_id=1896\&proceeding\_id=1005},
timestamp = {Wed, 03 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uai/VaughanPYH89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/SomCS89,
author = {Tapas K. Som and
Bruce A. Cota and
Robert G. Sargent},
editor = {Edward A. MacNair and
Kenneth J. Musselman and
Philip Heidelberger},
title = {On analyzing events to estimate the possible speedup of parallel discrete
event simulation},
booktitle = {Proceedings of the 21st Winter Simulation Conference, Washington,
DC, USA, December 4-6, 1989},
pages = {729--737},
publisher = {{ACM} Press},
year = {1989},
url = {https://doi.org/10.1145/76738.76831},
doi = {10.1145/76738.76831},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wsc/SomCS89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/aw/kimL89/BretlMOPSSWW89,
author = {Robert Bretl and
David Maier and
Allen Otis and
D. Jason Penney and
Bruce Schuchardt and
Jacob Stein and
E. Harold Williams and
Monty Williams},
editor = {Won Kim and
Frederick H. Lochovsky},
title = {The GemStone Data Management System},
booktitle = {Object-Oriented Concepts, Databases, and Applications},
pages = {283--308},
publisher = {{ACM} Press and Addison-Wesley},
year = {1989},
url = {https://doi.org/10.1145/63320.66507},
doi = {10.1145/63320.66507},
timestamp = {Tue, 05 May 2020 15:56:30 +0200},
biburl = {https://dblp.org/rec/books/aw/kimL89/BretlMOPSSWW89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/Brown88,
author = {Robert Bruce Brown},
title = {Nonexistence of a regular graph design with upsilon = 17 and k = 6},
journal = {Discret. Math.},
volume = {68},
number = {2-3},
pages = {315--318},
year = {1988},
url = {https://doi.org/10.1016/0012-365X(88)90124-0},
doi = {10.1016/0012-365X(88)90124-0},
timestamp = {Sun, 08 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dm/Brown88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/DraperBCHR88,
author = {Bruce A. Draper and
John Brolio and
Robert T. Collins and
Allen R. Hanson and
Edward M. Riseman},
title = {Image interpretation by distributed cooperative processes},
booktitle = {{IEEE} Computer Society Conference on Computer Vision and Pattern
Recognition, {CVPR} 1988, 5-9 June, 1988, Ann Arbor, Michigan, {USA}},
pages = {129--135},
publisher = {{IEEE}},
year = {1988},
url = {https://doi.org/10.1109/CVPR.1988.196226},
doi = {10.1109/CVPR.1988.196226},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/DraperBCHR88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/group/CroftK88,
author = {W. Bruce Croft and
Robert Krovetz},
editor = {Robert B. Allen},
title = {Interactive retrieval office documents},
booktitle = {Proceedings of the {ACM} {SIGOIS} and {IEEECS} {TC-OA} 1988 Conference
on Office Information Systems, {COCS} 1988, Palo Alto, California,
USA, March 23-25, 1988},
pages = {228--235},
publisher = {{ACM}},
year = {1988},
url = {https://doi.org/10.1145/45410.45435},
doi = {10.1145/45410.45435},
timestamp = {Thu, 24 Mar 2022 13:40:14 +0100},
biburl = {https://dblp.org/rec/conf/group/CroftK88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ppopp/NotkinSSBFGGGHKLMN88,
author = {David Notkin and
Lawrence Snyder and
David Socha and
Mary L. Bailey and
Bruce Forstall and
Kevin Gates and
Raymond Greenlaw and
William G. Griswold and
Thomas J. Holman and
Richard Korry and
Gemini Lasswell and
Robert Mitchell and
Philip A. Nelson},
editor = {Richard L. Wexelblat},
title = {Experiences with Poker},
booktitle = {Proceedings of the {ACM/SIGPLAN} {PPEALS} 1988, Parallel Programming:
Experience with Applications, Languages and Systems, New Haven, Connecticut,
USA, July 19-21, 1988},
pages = {10--20},
publisher = {{ACM}},
year = {1988},
url = {https://doi.org/10.1145/62115.62118},
doi = {10.1145/62115.62118},
timestamp = {Mon, 29 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ppopp/NotkinSSBFGGGHKLMN88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cagd/BarnhillFJP87,
author = {Robert E. Barnhill and
Gerald E. Farin and
M. Jordan and
Bruce R. Piper},
title = {Surface/surface intersection},
journal = {Comput. Aided Geom. Des.},
volume = {4},
number = {1-2},
pages = {3--16},
year = {1987},
url = {https://doi.org/10.1016/0167-8396(87)90020-3},
doi = {10.1016/0167-8396(87)90020-3},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cagd/BarnhillFJP87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/CollinsFGM87,
author = {Bruce E. Collins and
Thomas R. Fischer and
Steven A. Gronemeyer and
Robert J. McGuire},
title = {Application of Coded Modulation to 1.544-Mbit/s Data-in-Voice Modems
for {FDM} {FM} and {SSB} Analog Radio Systems},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {5},
number = {3},
pages = {369--377},
year = {1987},
url = {https://doi.org/10.1109/JSAC.1987.1146560},
doi = {10.1109/JSAC.1987.1146560},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/CollinsFGM87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uai/WisePVY87,
author = {Ben P. Wise and
Bruce M. Perrin and
David S. Vaughan and
Robert M. Yadrick},
editor = {Laveen N. Kanal and
Tod S. Levitt and
John F. Lemmer},
title = {Evaluation of Uncertain Inference Models {III:} The Role of Tuning},
booktitle = {{UAI} '87: Proceedings of the Third Annual Conference on Uncertainty
in Artificial Intelligence, Seattle, WA, USA, July 10-12, 1987},
pages = {55--62},
publisher = {Elsevier},
year = {1987},
url = {https://dslpitt.org/uai/displayArticleDetails.jsp?mmnu=1\&smnu=2\&article\_id=1805\&proceeding\_id=1003},
timestamp = {Wed, 03 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uai/WisePVY87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/combinatorica/BenderRRW86,
author = {Edward A. Bender and
L. Bruce Richmond and
Robert W. Robinson and
Nicholas C. Wormald},
title = {The asymptotic number of acyclic diagraphs {I}},
journal = {Comb.},
volume = {6},
number = {1},
pages = {15--22},
year = {1986},
url = {https://doi.org/10.1007/BF02579404},
doi = {10.1007/BF02579404},
timestamp = {Wed, 22 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/combinatorica/BenderRRW86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mam/RobertsonC86,
author = {Philip J. Robertson and
Bruce Campbell},
title = {Example of the use of the {BBC} microcomputer for data collection},
journal = {Microprocess. Microsystems},
volume = {10},
number = {1},
pages = {33--37},
year = {1986},
url = {https://doi.org/10.1016/0141-9331(86)90007-4},
doi = {10.1016/0141-9331(86)90007-4},
timestamp = {Wed, 26 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mam/RobertsonC86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamcomp/WrightROM86,
author = {Robert Alan Wright and
L. Bruce Richmond and
Andrew M. Odlyzko and
Brendan D. McKay},
title = {Constant Time Generation of Free Trees},
journal = {{SIAM} J. Comput.},
volume = {15},
number = {2},
pages = {540--548},
year = {1986},
url = {https://doi.org/10.1137/0215039},
doi = {10.1137/0215039},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamcomp/WrightROM86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/MillsBRTWR86,
author = {Carol Bergfeld Mills and
Kevin F. Bury and
Teresa L. Roberts and
Bruce Tognazzini and
Anna M. Wichansky and
Paul Reed},
editor = {Marilyn M. Mantei and
Peter Orbeton},
title = {Usability testing in the real world},
booktitle = {Proceedings of the {SIGCHI} Conference on Human Factors in Computing
Systems, {CHI} 1886, Boston, Massachusetts, USA, April 13-17, 1986},
pages = {212--215},
publisher = {{ACM}},
year = {1986},
url = {https://doi.org/10.1145/22627.22373},
doi = {10.1145/22627.22373},
timestamp = {Wed, 21 Jul 2021 10:34:40 +0200},
biburl = {https://dblp.org/rec/conf/chi/MillsBRTWR86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gi/RhodesKRWBP86,
author = {Michael L. Rhodes and
Yu{-}Ming Kuo and
Stephen L. G. Rothman and
Charles Woznick and
Robert Bruce and
Clyde Pratt},
editor = {G{\"{u}}nter Hommel and
Sigram Schindler},
title = {3D - {A} Guide for Protheses},
booktitle = {{GI} - 16. Jahrestagung II, Berlin, 6.-10. Oktober 1986, Proceedings},
series = {Informatik-Fachberichte},
volume = {127},
pages = {637--647},
publisher = {Springer},
year = {1986},
url = {https://doi.org/10.1007/978-3-642-71389-7\_52},
doi = {10.1007/978-3-642-71389-7\_52},
timestamp = {Mon, 26 Feb 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gi/RhodesKRWBP86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/OwenM86,
author = {Robert E. Owen and
Bruce E. Miller},
title = {Architectural considerations for a sub 10 nanosecond {DSP} building
block family},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} 1986, Tokyo, Japan, April 7-11, 1986},
pages = {417--420},
publisher = {{IEEE}},
year = {1986},
url = {https://doi.org/10.1109/ICASSP.1986.1169048},
doi = {10.1109/ICASSP.1986.1169048},
timestamp = {Mon, 09 Aug 2021 14:54:02 +0200},
biburl = {https://dblp.org/rec/conf/icassp/OwenM86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lics/AmadioBL86,
author = {Roberto M. Amadio and
Kim B. Bruce and
Giuseppe Longo},
title = {The Finitary Projection Model for Second Order Lambda Calculus and
Solutions to Higher Order Domain Equations},
booktitle = {Proceedings of the Symposium on Logic in Computer Science {(LICS}
'86), Cambridge, Massachusetts, USA, June 16-18, 1986},
pages = {122--130},
publisher = {{IEEE} Computer Society},
year = {1986},
timestamp = {Thu, 22 Jan 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/lics/AmadioBL86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uai/YadrickPVHK86,
author = {Robert M. Yadrick and
Bruce M. Perrin and
David S. Vaughan and
Peter D. Holden and
Karl G. Kempf},
editor = {John F. Lemmer and
Laveen N. Kanal},
title = {Evaulation of uncertain inference models {I:} {PROSPECTOR}},
booktitle = {{UAI} '86: Proceedings of the Second Annual Conference on Uncertainty
in Artificial Intelligence, University of Pennsylvania, Philadelphia,
PA, USA, August 8-10, 1986},
pages = {77--88},
publisher = {Elsevier},
year = {1986},
url = {https://dslpitt.org/uai/displayArticleDetails.jsp?mmnu=1\&smnu=2\&article\_id=1770\&proceeding\_id=1002},
timestamp = {Wed, 03 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uai/YadrickPVHK86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cagd/BarnhillPS85,
author = {Robert E. Barnhill and
Bruce R. Piper and
S. E. Stead},
title = {A multidimensional surface problem: pressure on a wing},
journal = {Comput. Aided Geom. Des.},
volume = {2},
number = {1-3},
pages = {185--187},
year = {1985},
url = {https://doi.org/10.1016/0167-8396(85)90023-8},
doi = {10.1016/0167-8396(85)90023-8},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cagd/BarnhillPS85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mam/Campbell85b,
author = {Bruce Campbell},
title = {Micro troubleshooting techniques: Robert {G} Middleton 'New handbook
of troubleshooting techniques for microprocessors and microcomputers'
Prentice-Hall, Englewood Cliffs, NJ, {USA} (January 1985) {\textsterling}4.45
p xii + 435},
journal = {Microprocess. Microsystems},
volume = {9},
number = {6},
pages = {315},
year = {1985},
url = {https://doi.org/10.1016/0141-9331(85)90126-7},
doi = {10.1016/0141-9331(85)90126-7},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mam/Campbell85b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/vc/BarnhillPS85,
author = {Robert E. Barnhill and
Bruce R. Piper and
S. E. Stead},
title = {Surface representation for the graphical display of structured data},
journal = {Vis. Comput.},
volume = {1},
number = {2},
pages = {108--111},
year = {1985},
url = {https://doi.org/10.1007/BF01898353},
doi = {10.1007/BF01898353},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/vc/BarnhillPS85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/0001CHSTG85,
author = {Kim Bruce and
Robert D. Cupper and
Stuart Hirshfield and
Ted Sjoerdsma and
Allen B. Tucker and
Norman E. Gibbs},
editor = {Norman E. Gibbs and
Harriet G. Taylor and
Della T. Bonnette and
James E. Miller},
title = {A computer science curriculum for liberal arts colleges (panel session)},
booktitle = {Proceedings of the 16th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 1985, New Orleans, Louisiana USA, March 14-15,
1985},
pages = {115},
publisher = {{ACM}},
year = {1985},
url = {https://doi.org/10.1145/323287.323301},
doi = {10.1145/323287.323301},
timestamp = {Tue, 23 Mar 2021 12:04:03 +0100},
biburl = {https://dblp.org/rec/conf/sigcse/0001CHSTG85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/BarrettDL85,
author = {Robert A. Barrett and
Bruce C. Davis and
Robert R. Leeper},
editor = {Norman E. Gibbs and
Harriet G. Taylor and
Della T. Bonnette and
James E. Miller},
title = {A developmental computing course for computer technology majors},
booktitle = {Proceedings of the 16th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 1985, New Orleans, Louisiana USA, March 14-15,
1985},
pages = {152--154},
publisher = {{ACM}},
year = {1985},
url = {https://doi.org/10.1145/323287.323308},
doi = {10.1145/323287.323308},
timestamp = {Wed, 24 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigcse/BarrettDL85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uai/VaughanPYHK85,
author = {David S. Vaughan and
Bruce M. Perrin and
Robert M. Yadrick and
Peter D. Holden and
Karl G. Kempf},
editor = {Laveen N. Kanal and
John F. Lemmer},
title = {An Odds Ratio Based Inference Engine},
booktitle = {{UAI} '85: Proceedings of the First Annual Conference on Uncertainty
in Artificial Intelligence, Los Angeles, CA, USA, July 10-12, 1985},
pages = {383--392},
publisher = {Elsevier},
year = {1985},
url = {https://dslpitt.org/uai/displayArticleDetails.jsp?mmnu=1\&smnu=2\&article\_id=1753\&proceeding\_id=1001},
timestamp = {Wed, 03 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uai/VaughanPYHK85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mam/RobertsonC84,
author = {Philip J. Robertson and
Bruce Campbell},
title = {The {BBC} microcomputer as a data acquisition tool},
journal = {Microprocess. Microsystems},
volume = {8},
number = {3},
pages = {136--139},
year = {1984},
url = {https://doi.org/10.1016/0141-9331(84)90378-8},
doi = {10.1016/0141-9331(84)90378-8},
timestamp = {Wed, 26 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mam/RobertsonC84.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tocs/LindsayHMWY84,
author = {Bruce G. Lindsay and
Laura M. Haas and
C. Mohan and
Paul F. Wilms and
Robert A. Yost},
title = {Computation and Communication in R*: {A} Distributed Database Manager},
journal = {{ACM} Trans. Comput. Syst.},
volume = {2},
number = {1},
pages = {24--38},
year = {1984},
url = {https://doi.org/10.1145/2080.357390},
doi = {10.1145/2080.357390},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tocs/LindsayHMWY84.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bstj/SwartzW83,
author = {Robert G. Swartz and
Bruce A. Wooley},
title = {Stabilized biasing of semiconductor lasers},
journal = {Bell Syst. Tech. J.},
volume = {62},
number = {7},
pages = {1923--1936},
year = {1983},
url = {https://doi.org/10.1002/j.1538-7305.1983.tb03522.x},
doi = {10.1002/J.1538-7305.1983.TB03522.X},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bstj/SwartzW83.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/SelingerDHLNWY83,
author = {Patricia G. Selinger and
Dean Daniels and
Laura M. Haas and
Bruce G. Lindsay and
Pui Ng and
Paul F. Wilms and
Robert A. Yost},
title = {Site autonomy issues in R\({}^{\mbox{*}}\): {A} distributed database
management system},
journal = {Inf. Sci.},
volume = {29},
number = {2-3},
pages = {249--257},
year = {1983},
url = {https://doi.org/10.1016/0020-0255(83)90017-8},
doi = {10.1016/0020-0255(83)90017-8},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/isci/SelingerDHLNWY83.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/networks/Fourer83,
author = {Robert Fourer},
title = {Advanced linear programming: Computation and practice, by Bruce A.
Murtagh, McGraw-Hill, New York, 1981, 202 pp. Price: {\textdollar}39.50},
journal = {Networks},
volume = {13},
number = {2},
pages = {308--310},
year = {1983},
url = {https://doi.org/10.1002/net.3230130217},
doi = {10.1002/NET.3230130217},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/networks/Fourer83.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anlp/BiermannRBBBDFFGGH83,
author = {Alan W. Biermann and
Robert D. Rodman and
Bruce W. Ballard and
T. Betancourt and
Griff L. Bilbro and
Harriet Haynsworth Deas and
Linda Fineman and
Pamela E. Fink and
Kermit C. Gilbert and
Duncan Gregory and
J. Francis Heidlage},
title = {Interactive Natural Language Problem Solving: {A} Pragmatic Approach},
booktitle = {1st Applied Natural Language Processing Conference, {ANLP} 1983, Miramar-Sheraton
Hotel, Santa Monica, California, USA, February 1-3, 1983},
pages = {180--191},
publisher = {{ACL}},
year = {1983},
url = {https://aclanthology.org/A83-1031/},
doi = {10.3115/974194.974231},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/anlp/BiermannRBBBDFFGGH83.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sosp/LindsayHMWY83,
author = {Bruce G. Lindsay and
Laura M. Haas and
C. Mohan and
Paul F. Wilms and
Robert A. Yost},
editor = {Jerome H. Saltzer and
Roy Levin and
David D. Redell},
title = {Computation {\&} Communication in R*: {A} Distributed Database
Manager (Extended Abstract)},
booktitle = {Proceedings of the Ninth {ACM} Symposium on Operating System Principles,
{SOSP} 1983, Bretton Woods, New Hampshire, USA, October 10-13, 1983},
pages = {1--2},
publisher = {{ACM}},
year = {1983},
url = {https://doi.org/10.1145/800217.806608},
doi = {10.1145/800217.806608},
timestamp = {Tue, 06 Nov 2018 16:59:32 +0100},
biburl = {https://dblp.org/rec/conf/sosp/LindsayHMWY83.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sosp/WalkerPEKT83,
author = {Bruce J. Walker and
Gerald J. Popek and
Robert English and
Charles S. Kline and
Greg Thiel},
editor = {Jerome H. Saltzer and
Roy Levin and
David D. Redell},
title = {The {LOCUS} Distributed Operating System},
booktitle = {Proceedings of the Ninth {ACM} Symposium on Operating System Principles,
{SOSP} 1983, Bretton Woods, New Hampshire, USA, October 10-13, 1983},
pages = {49--70},
publisher = {{ACM}},
year = {1983},
url = {https://doi.org/10.1145/800217.806615},
doi = {10.1145/800217.806615},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sosp/WalkerPEKT83.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/wsc/1983,
editor = {Stephen D. Roberts and
Jerry Banks and
Bruce W. Schmeiser},
title = {Proceedings of the 15th conference on Winter simulation, {WSC} 1983,
Arlington, VA, USA, December 12-14, 1983},
publisher = {{ACM}},
year = {1983},
url = {http://dl.acm.org/citation.cfm?id=800043},
timestamp = {Thu, 10 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/1983.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/debu/HaasSBDLLMMNWY82,
author = {Laura M. Haas and
Patricia G. Selinger and
Elisa Bertino and
Dean Daniels and
Bruce G. Lindsay and
Guy M. Lohman and
Yoshifumi Masunaga and
C. Mohan and
Pui Ng and
Paul F. Wilms and
Robert A. Yost},
title = {R*: {A} Research Project on Distributed Relational {DBMS}},
journal = {{IEEE} Database Eng. Bull.},
volume = {5},
number = {4},
pages = {28--32},
year = {1982},
url = {http://sites.computer.org/debull/82DEC-CD.pdf},
timestamp = {Tue, 10 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/debu/HaasSBDLLMMNWY82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mam/CampbellR82,
author = {Bruce Campbell and
Philip J. Robertson},
title = {{IEEE-488} interface using parallel {I/O} ports},
journal = {Microprocess. Microsystems},
volume = {6},
number = {6},
pages = {281--285},
year = {1982},
url = {https://doi.org/10.1016/0141-9331(82)90137-5},
doi = {10.1016/0141-9331(82)90137-5},
timestamp = {Wed, 26 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mam/CampbellR82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigart/BiermannBFRR82,
author = {Alan W. Biermann and
Bruce W. Ballard and
Pamela K. Fink and
Robert D. Rodman and
David C. Rubin},
title = {Natural Language programming: Duke University},
journal = {{SIGART} Newsl.},
volume = {79},
pages = {50--51},
year = {1982},
url = {https://doi.org/10.1145/1056663.1056689},
doi = {10.1145/1056663.1056689},
timestamp = {Tue, 19 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigart/BiermannBFRR82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/RedinboCJ82,
author = {G. Robert Redinbo and
Dean O. Carhoun and
Bruce L. Johnson},
title = {Fast algorithms for signal processing using finite field operations},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} '82, Paris, France, May 3-5, 1982},
pages = {40--43},
publisher = {{IEEE}},
year = {1982},
url = {https://doi.org/10.1109/ICASSP.1982.1171654},
doi = {10.1109/ICASSP.1982.1171654},
timestamp = {Wed, 16 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/RedinboCJ82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jcdkb/WilliamsDHLLNOSWWY82,
author = {R. Williams and
Dean Daniels and
Laura M. Haas and
George Lapis and
Bruce G. Lindsay and
Pui Ng and
Ron Obermarck and
Patricia G. Selinger and
Adrian Walker and
Paul F. Wilms and
Robert A. Yost},
editor = {Peter Scheuermann},
title = {R*: An Overview of the Architecture},
booktitle = {Proceedings of the Second International Conference on Databases: Improving
Database Usability and Responsiveness, June 22-24, 1982, Jerusalem,
Israel},
pages = {1--27},
publisher = {Academic Press},
year = {1982},
timestamp = {Wed, 31 Jul 2019 08:44:53 +0200},
biburl = {https://dblp.org/rec/conf/jcdkb/WilliamsDHLLNOSWWY82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ChamberlinABGKLLMPPSSSTWY81,
author = {Donald D. Chamberlin and
Morton M. Astrahan and
Mike W. Blasgen and
Jim Gray and
W. Frank King III and
Bruce G. Lindsay and
Raymond A. Lorie and
James W. Mehl and
Thomas G. Price and
Gianfranco R. Putzolu and
Patricia G. Selinger and
Mario Schkolnick and
Donald R. Slutz and
Irving L. Traiger and
Bradford W. Wade and
Robert A. Yost},
title = {A History and Evaluation of System {R}},
journal = {Commun. {ACM}},
volume = {24},
number = {10},
pages = {632--646},
year = {1981},
url = {https://doi.org/10.1145/358769.358784},
doi = {10.1145/358769.358784},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/ChamberlinABGKLLMPPSSSTWY81.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmsj/BlasgenACGKLLMPPSSSSTWY81,
author = {Mike W. Blasgen and
Morton M. Astrahan and
Donald D. Chamberlin and
Jim Gray and
W. Frank King III and
Bruce G. Lindsay and
Raymond A. Lorie and
James W. Mehl and
Thomas G. Price and
Gianfranco R. Putzolu and
Mario Schkolnick and
Patricia G. Selinger and
Donald R. Slutz and
H. Raymond Strong and
Irving L. Traiger and
Bradford W. Wade and
Robert A. Yost},
title = {System {R:} An Architectural Overview},
journal = {{IBM} Syst. J.},
volume = {20},
number = {1},
pages = {41--62},
year = {1981},
url = {https://doi.org/10.1147/sj.201.0041},
doi = {10.1147/SJ.201.0041},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmsj/BlasgenACGKLLMPPSSSSTWY81.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmsj/JudischRD81,
author = {James Mann Judisch and
Bruce A. Rupp and
Robert A. Dassinger},
title = {Effects of Manual Style on Performance in Education and Machine Maintenance},
journal = {{IBM} Syst. J.},
volume = {20},
number = {2},
pages = {172--183},
year = {1981},
url = {https://doi.org/10.1147/sj.202.0172},
doi = {10.1147/SJ.202.0172},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmsj/JudischRD81.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/FugmannB81,
author = {Robert Fugmann and
Bruce C. Bennion},
title = {Performance testing of a book index},
journal = {J. Am. Soc. Inf. Sci.},
volume = {32},
number = {5},
pages = {334--335},
year = {1981},
url = {https://doi.org/10.1002/asi.4630320504},
doi = {10.1002/ASI.4630320504},
timestamp = {Wed, 13 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jasis/FugmannB81.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mlq/RoseW81,
author = {Bruce I. Rose and
Robert E. Woodrow},
title = {Ultrahomogeneous Structures},
journal = {Math. Log. Q.},
volume = {27},
number = {2-6},
pages = {23--30},
year = {1981},
url = {https://doi.org/10.1002/malq.19810270203},
doi = {10.1002/MALQ.19810270203},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mlq/RoseW81.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/popl/KuckKPLW81,
author = {David J. Kuck and
Robert H. Kuhn and
David A. Padua and
Bruce Leasure and
Michael Wolfe},
editor = {John White and
Richard J. Lipton and
Patricia C. Goldberg},
title = {Dependence Graphs and Compiler Optimizations},
booktitle = {Conference Record of the Eighth Annual {ACM} Symposium on Principles
of Programming Languages, Williamsburg, Virginia, USA, January 1981},
pages = {207--218},
publisher = {{ACM} Press},
year = {1981},
url = {https://doi.org/10.1145/567532.567555},
doi = {10.1145/567532.567555},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/popl/KuckKPLW81.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/RegazziBR80,
author = {John J. Regazzi and
Bruce Bennion and
Susan Roberts},
title = {On-line systems of disciplines and specialty areas in science and
technology},
journal = {J. Am. Soc. Inf. Sci.},
volume = {31},
number = {3},
pages = {161--170},
year = {1980},
url = {https://doi.org/10.1002/asi.4630310308},
doi = {10.1002/ASI.4630310308},
timestamp = {Wed, 13 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jasis/RegazziBR80.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ACMse/EastmanE80,
author = {Robert M. Eastman and
Bruce Edwards},
editor = {E. P. Miles Jr.},
title = {Computerized literature search experiences in mathematics and engineering},
booktitle = {Proceedings of the 18th Annual Southeast Regional Conference, 1980,
Tallahassee, Florida, USA, March 24-26, 1980},
pages = {48--50},
publisher = {{ACM}},
year = {1980},
url = {https://doi.org/10.1145/503838.503891},
doi = {10.1145/503838.503891},
timestamp = {Fri, 12 Mar 2021 15:27:48 +0100},
biburl = {https://dblp.org/rec/conf/ACMse/EastmanE80.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/AstrahanBCGKLLMPPSSSSTTWY79,
author = {Morton M. Astrahan and
Mike W. Blasgen and
Donald D. Chamberlin and
Jim Gray and
W. Frank King III and
Bruce G. Lindsay and
Raymond A. Lorie and
James W. Mehl and
Thomas G. Price and
Gianfranco R. Putzolu and
Mario Schkolnick and
Patricia G. Selinger and
Donald R. Slutz and
H. Raymond Strong and
Paolo Tiberio and
Irving L. Traiger and
Bradford W. Wade and
Robert A. Yost},
title = {System {R:} {A} Relational Data Base Management System},
journal = {Computer},
volume = {12},
number = {5},
pages = {42--48},
year = {1979},
url = {https://doi.org/10.1109/MC.1979.1658743},
doi = {10.1109/MC.1979.1658743},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/computer/AstrahanBCGKLLMPPSSSSTTWY79.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/RosenbergR79,
author = {Steve Rosenberg and
Bruce Roberts},
editor = {Bruce G. Buchanan},
title = {Coreference in a Frame Database},
booktitle = {Proceedings of the Sixth International Joint Conference on Artificial
Intelligence, {IJCAI} 79, Tokyo, Japan, August 20-23, 1979, 2 Volumes},
pages = {729--734},
publisher = {William Kaufmann},
year = {1979},
timestamp = {Tue, 20 Aug 2019 16:16:26 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/RosenbergR79.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/HansonD78,
author = {Bruce A. Hanson and
Robert W. Donaldson},
title = {Subjective Evaluation of an Adaptive Differential Voice Encoder with
Oversampling and Entropy Coding},
journal = {{IEEE} Trans. Commun.},
volume = {26},
number = {2},
pages = {201--208},
year = {1978},
url = {https://doi.org/10.1109/TCOM.1978.1094054},
doi = {10.1109/TCOM.1978.1094054},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcom/HansonD78.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sigir/78,
editor = {James A. Iverson and
Robert T. Dattola and
P. Bruce Berra},
title = {ACM-SIGIR, International Conference on Information Storage and Retrieval,
Rochester, New York, USA, May 10-12, 1978, Proceedings},
publisher = {{ACM}},
year = {1978},
url = {https://doi.org/10.1145/800096},
doi = {10.1145/800096},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/78.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cl/LedleyW76,
author = {Robert S. Ledley and
James Bruce Wilson},
title = {The Precise Handling of Qualitative Relationships},
journal = {Comput. Lang.},
volume = {1},
number = {1},
pages = {83--99},
year = {1976},
url = {https://doi.org/10.1016/0096-0551(75)90010-7},
doi = {10.1016/0096-0551(75)90010-7},
timestamp = {Thu, 18 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cl/LedleyW76.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/BarnesMOW76,
author = {Bruce H. Barnes and
Andrew R. Molnar and
Lawrence H. Oliver and
Robert F. Watson},
editor = {William G. Poole Jr. and
Norman E. Gibbs},
title = {National Science Foundation programs in computer science},
booktitle = {Proceedings of the 6th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 1976, Williamsburg, VA, USA, 1976},
pages = {1},
publisher = {{ACM}},
year = {1976},
url = {https://doi.org/10.1145/800144.804743},
doi = {10.1145/800144.804743},
timestamp = {Tue, 30 Mar 2021 10:49:20 +0200},
biburl = {https://dblp.org/rec/conf/sigcse/BarnesMOW76.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jct/Brown75a,
author = {Robert Bruce Brown},
title = {A New Nonextensible (16, 24, 9, 6, 3)-Design},
journal = {J. Comb. Theory {A}},
volume = {19},
number = {1},
pages = {115--116},
year = {1975},
url = {https://doi.org/10.1016/0097-3165(75)90097-7},
doi = {10.1016/0097-3165(75)90097-7},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jct/Brown75a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micro/ShriverEFRW75,
author = {Bruce D. Shriver and
John Ellenby and
Gideon Frieder and
Robert F. Rosin and
Wayne T. Wilner},
editor = {William P. Lidinsky and
Masahivo Tsuchiya and
Arvind},
title = {Significance, benefits and pitfalls of microprogramming (Panel Session)},
booktitle = {Proceedings of the 8th annual workshop on Microprogramming, {MICRO}
1975, Chicago, Illinois, USA, September 21-23, 1975},
pages = {45},
publisher = {{ACM}},
year = {1975},
url = {https://doi.org/10.1145/800148.804860},
doi = {10.1145/800148.804860},
timestamp = {Wed, 04 Aug 2021 12:34:41 +0200},
biburl = {https://dblp.org/rec/conf/micro/ShriverEFRW75.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acm/ReitmanKNRW74,
author = {Walter Reitman and
James Kerwin and
Robert Nado and
Judith Reitman and
Bruce Wilcox},
editor = {Roger C. Brown and
Donald E. Glaze},
title = {Goals and plans in a program for playing Go},
booktitle = {Proceedings of the 1974 {ACM} Annual Conference, San Diego, California,
USA, November 1974, Volume 1},
pages = {123--127},
publisher = {{ACM}},
year = {1974},
url = {https://doi.org/10.1145/800182.810391},
doi = {10.1145/800182.810391},
timestamp = {Wed, 14 Apr 2021 11:40:49 +0200},
biburl = {https://dblp.org/rec/conf/acm/ReitmanKNRW74.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dm/Brown73,
author = {Robert Bruce Brown},
title = {Sequences of functions of binomial type},
journal = {Discret. Math.},
volume = {6},
number = {4},
pages = {313--331},
year = {1973},
url = {https://doi.org/10.1016/0012-365X(73)90063-0},
doi = {10.1016/0012-365X(73)90063-0},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dm/Brown73.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/SklanskyCH72,
author = {Jack Sklansky and
Robert L. Chazin and
Bruce J. Hansen},
title = {Minimum-Perimeter Polygons of Digitized Silhouettes},
journal = {{IEEE} Trans. Computers},
volume = {21},
number = {3},
pages = {260--268},
year = {1972},
url = {https://doi.org/10.1109/TC.1972.5008948},
doi = {10.1109/TC.1972.5008948},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/SklanskyCH72.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/SimmonsB71,
author = {Robert F. Simmons and
Bertram C. Bruce},
editor = {D. C. Cooper},
title = {Some Relations Between Predicate Calculus and Semantic Net Representations
of Discourse},
booktitle = {Proceedings of the 2nd International Joint Conference on Artificial
Intelligence. London, UK, September 1-3, 1971},
pages = {524--530},
publisher = {William Kaufmann},
year = {1971},
url = {http://ijcai.org/Proceedings/71/Papers/047\%20A.pdf},
timestamp = {Tue, 20 Aug 2019 16:18:02 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/SimmonsB71.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/PosdamerSB71,
author = {Jeffrey L. Posdamer and
Robert G. Sargent and
P. Bruce Berra},
editor = {Michel Araten and
Joseph M. Sussman and
Leo J. Boelhouwer},
title = {The application of associative processing in discrete simulation},
booktitle = {Proceedings of the 5th conference on Winter simulation, {WSC} 1971,
New York, NY, USA, December 8-10, 1971},
pages = {428--433},
publisher = {{ACM}},
year = {1971},
url = {https://doi.org/10.1145/800294.811469},
doi = {10.1145/800294.811469},
timestamp = {Thu, 10 Jun 2021 16:58:01 +0200},
biburl = {https://dblp.org/rec/conf/wsc/PosdamerSB71.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ArdenGG69,
author = {Bruce W. Arden and
Bernard A. Galler and
Robert M. Graham},
title = {The {MAD} definition facility},
journal = {Commun. {ACM}},
volume = {12},
number = {8},
pages = {432--439},
year = {1969},
url = {https://doi.org/10.1145/363196.363203},
doi = {10.1145/363196.363203},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/ArdenGG69.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acm/ReitmanRSWL69,
author = {Walter Reitman and
R. Bruce Roberts and
Richard W. Sauvain and
Daniel D. Wheeler and
William E. Linn},
editor = {Solomon L. Pollack and
Thomas R. Dines and
Ward C. Sangren and
Norman R. Nielsen and
William G. Gerkin and
Alfred E. Corduan and
Len Nowak and
James L. Mueller and
Joseph Horner III and
Pasteur S. T. Yuen and
Jeffery Stein and
Margaret M. Mueller},
title = {{AUTONOTE:} {A} personal information storage and retrieval system},
booktitle = {Proceedings of the 24th national conference, {ACM} 1969, USA, 1969},
pages = {67--76},
publisher = {{ACM}},
year = {1969},
url = {https://doi.org/10.1145/800195.805918},
doi = {10.1145/800195.805918},
timestamp = {Fri, 16 Apr 2021 12:48:16 +0200},
biburl = {https://dblp.org/rec/conf/acm/ReitmanRSWL69.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/us/Parente66,
author = {Robert Bruce Parente},
title = {Functional analysis of systems characterized by nonlinear differential
equations},
school = {Massachusetts Institute of Technology, {USA}},
year = {1966},
url = {http://hdl.handle.net/1721.1/13466},
timestamp = {Fri, 05 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/us/Parente66.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/afips/LedleyRBJWG66,
author = {Robert S. Ledley and
Louis S. Rotolo and
Marilyn Belson and
John Jacobsen and
James Bruce Wilson and
Thomas J. Golab},
title = {Pattern recognition studies in the biomedical sciences},
booktitle = {American Federation of Information Processing Societies: Proceedings
of the {AFIPS} '66 Spring Joint Computer Conference, April 26-28,
1966, Boston, Massachusetts, {USA}},
series = {{AFIPS} Conference Proceedings},
volume = {28},
pages = {411--430},
publisher = {{AFIPS} / Spartan Books / {ACM}},
year = {1966},
url = {https://doi.org/10.1145/1464182.1464232},
doi = {10.1145/1464182.1464232},
timestamp = {Wed, 14 Apr 2021 16:50:07 +0200},
biburl = {https://dblp.org/rec/conf/afips/LedleyRBJWG66.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/LedleyW62,
author = {Robert S. Ledley and
James Bruce Wilson},
title = {Automatic-programming-language translation through syntactical analysis},
journal = {Commun. {ACM}},
volume = {5},
number = {3},
pages = {145--155},
year = {1962},
url = {https://doi.org/10.1145/366862.366872},
doi = {10.1145/366862.366872},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/LedleyW62.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jacm/ArdenGG62,
author = {Bruce W. Arden and
Bernard A. Galler and
Robert M. Graham},
title = {An Algorithm for Translating Boolean Expressions},
journal = {J. {ACM}},
volume = {9},
number = {2},
pages = {222--239},
year = {1962},
url = {https://doi.org/10.1145/321119.321121},
doi = {10.1145/321119.321121},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jacm/ArdenGG62.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ArdenGG61,
author = {Bruce W. Arden and
Bernard A. Galler and
Robert M. Graham},
title = {The internal organization of the {MAD} translator},
journal = {Commun. {ACM}},
volume = {4},
number = {1},
pages = {28--31},
year = {1961},
url = {https://doi.org/10.1145/366062.366079},
doi = {10.1145/366062.366079},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/ArdenGG61.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ArdenGG61a,
author = {Bruce W. Arden and
Bernard A. Galler and
Robert M. Graham},
title = {Letter to the editor: criticisms of {ALGOL} 60},
journal = {Commun. {ACM}},
volume = {4},
number = {7},
pages = {309},
year = {1961},
url = {https://doi.org/10.1145/366622.366625},
doi = {10.1145/366622.366625},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/ArdenGG61a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ArdenGG61b,
author = {Bruce W. Arden and
Bernard A. Galler and
Robert M. Graham},
title = {An algorithm for equivalence declarations},
journal = {Commun. {ACM}},
volume = {4},
number = {7},
pages = {310--314},
year = {1961},
url = {https://doi.org/10.1145/366622.366626},
doi = {10.1145/366622.366626},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/ArdenGG61b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/WilsonL61,
author = {James Bruce Wilson and
Robert S. Ledley},
title = {An Algorithm for Rapid Binary Division},
journal = {{IRE} Trans. Electron. Comput.},
volume = {10},
number = {4},
pages = {662--670},
year = {1961},
url = {https://doi.org/10.1109/TEC.1961.5219271},
doi = {10.1109/TEC.1961.5219271},
timestamp = {Mon, 25 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/WilsonL61.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ArdenGG60,
author = {Bruce W. Arden and
Bernard A. Galler and
Robert M. Graham},
title = {Letters},
journal = {Commun. {ACM}},
volume = {3},
number = {6},
pages = {13},
year = {1960},
url = {https://doi.org/10.1145/367297.367300},
doi = {10.1145/367297.367300},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/ArdenGG60.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ArdenG59,
author = {Bruce W. Arden and
Robert M. Graham},
title = {On {GAT} and the Construction of Translators},
journal = {Commun. {ACM}},
volume = {2},
number = {7},
pages = {24--26},
year = {1959},
url = {https://doi.org/10.1145/368370.368373},
doi = {10.1145/368370.368373},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/ArdenG59.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jacm/BrackenO56,
author = {Robert H. Bracken and
Bruce G. Oldfield},
title = {A General System for Handling Alphameric Information on the {IBM}
701 Computer},
journal = {J. {ACM}},
volume = {3},
number = {3},
pages = {175--180},
year = {1956},
url = {https://doi.org/10.1145/320831.320835},
doi = {10.1145/320831.320835},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jacm/BrackenO56.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jacm/MillerO56,
author = {Robert C. Miller Jr. and
Bruce G. Oldfield},
title = {Producing Computer Instructions for the {PACT} {I} Compiler},
journal = {J. {ACM}},
volume = {3},
number = {4},
pages = {288--291},
year = {1956},
url = {https://doi.org/10.1145/320843.320847},
doi = {10.1145/320843.320847},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jacm/MillerO56.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2025-01-13 12:37 CET from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
