Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "R. Manmatha"
download as .bib file
@article{DBLP:journals/pami/ZhuZWZHZMLS24,
author = {Yi Zhu and
Zhongyue Zhang and
Chongruo Wu and
Zhi Zhang and
Tong He and
Hang Zhang and
R. Manmatha and
Mu Li and
Alexander J. Smola},
title = {Improving Semantic Segmentation via Efficient Self-Training},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {46},
number = {3},
pages = {1589--1602},
year = {2024},
url = {https://doi.org/10.1109/TPAMI.2021.3138337},
doi = {10.1109/TPAMI.2021.3138337},
timestamp = {Thu, 29 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pami/ZhuZWZHZMLS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/AppalarajuTDSZM24,
author = {Srikar Appalaraju and
Peng Tang and
Qi Dong and
Nishant Sankaran and
Yichu Zhou and
R. Manmatha},
editor = {Michael J. Wooldridge and
Jennifer G. Dy and
Sriraam Natarajan},
title = {DocFormerv2: Local Features for Document Understanding},
booktitle = {Thirty-Eighth {AAAI} Conference on Artificial Intelligence, {AAAI}
2024, Thirty-Sixth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2024, Fourteenth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2014, February 20-27, 2024, Vancouver,
Canada},
pages = {709--718},
publisher = {{AAAI} Press},
year = {2024},
url = {https://doi.org/10.1609/aaai.v38i2.27828},
doi = {10.1609/AAAI.V38I2.27828},
timestamp = {Tue, 02 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/AppalarajuTDSZM24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ZhaoSATMMW24,
author = {Tianyang Zhao and
Kunwar Yashraj Singh and
Srikar Appalaraju and
Peng Tang and
Vijay Mahadevan and
R. Manmatha and
Ying Nian Wu},
editor = {Michael J. Wooldridge and
Jennifer G. Dy and
Sriraam Natarajan},
title = {No Head Left Behind - Multi-Head Alignment Distillation for Transformers},
booktitle = {Thirty-Eighth {AAAI} Conference on Artificial Intelligence, {AAAI}
2024, Thirty-Sixth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2024, Fourteenth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2014, February 20-27, 2024, Vancouver,
Canada},
pages = {7514--7524},
publisher = {{AAAI} Press},
year = {2024},
url = {https://doi.org/10.1609/aaai.v38i7.28583},
doi = {10.1609/AAAI.V38I7.28583},
timestamp = {Tue, 02 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/ZhaoSATMMW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-02883,
author = {Hao Li and
Yang Zou and
Ying Wang and
Orchid Majumder and
Yusheng Xie and
R. Manmatha and
Ashwin Swaminathan and
Zhuowen Tu and
Stefano Ermon and
Stefano Soatto},
title = {On the Scalability of Diffusion-based Text-to-Image Generation},
journal = {CoRR},
volume = {abs/2404.02883},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2404.02883},
doi = {10.48550/ARXIV.2404.02883},
eprinttype = {arXiv},
eprint = {2404.02883},
timestamp = {Mon, 13 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2404-02883.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-04469,
author = {Pei Wang and
Zhaowei Cai and
Hao Yang and
Ashwin Swaminathan and
R. Manmatha and
Stefano Soatto},
title = {Mixed-Query Transformer: {A} Unified Image Segmentation Architecture},
journal = {CoRR},
volume = {abs/2404.04469},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2404.04469},
doi = {10.48550/ARXIV.2404.04469},
eprinttype = {arXiv},
eprint = {2404.04469},
timestamp = {Wed, 15 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2404-04469.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/LiuDCZSMM23,
author = {Jiang Liu and
Hui Ding and
Zhaowei Cai and
Yuting Zhang and
Ravi Kumar Satzoda and
Vijay Mahadevan and
R. Manmatha},
title = {PolyFormer: Referring Image Segmentation as Sequential Polygon Generation},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023, Vancouver, BC, Canada, June 17-24, 2023},
pages = {18653--18663},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPR52729.2023.01789},
doi = {10.1109/CVPR52729.2023.01789},
timestamp = {Tue, 29 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/LiuDCZSMM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/LiaoRLBZTSMM23,
author = {Haofu Liao and
Aruni RoyChowdhury and
Weijian Li and
Ankan Bansal and
Yuting Zhang and
Zhuowen Tu and
Ravi Kumar Satzoda and
R. Manmatha and
Vijay Mahadevan},
title = {DocTr: Document Transformer for Structured Information Extraction
in Documents},
booktitle = {{IEEE/CVF} International Conference on Computer Vision, {ICCV} 2023,
Paris, France, October 1-6, 2023},
pages = {19527--19537},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCV51070.2023.01794},
doi = {10.1109/ICCV51070.2023.01794},
timestamp = {Tue, 23 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccv/LiaoRLBZTSMM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-03432,
author = {Yash Patel and
Yusheng Xie and
Yi Zhu and
Srikar Appalaraju and
R. Manmatha},
title = {SimCon Loss with Multiple Views for Text Supervised Semantic Segmentation},
journal = {CoRR},
volume = {abs/2302.03432},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.03432},
doi = {10.48550/ARXIV.2302.03432},
eprinttype = {arXiv},
eprint = {2302.03432},
timestamp = {Fri, 10 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-03432.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-07387,
author = {Jiang Liu and
Hui Ding and
Zhaowei Cai and
Yuting Zhang and
Ravi Kumar Satzoda and
Vijay Mahadevan and
R. Manmatha},
title = {PolyFormer: Referring Image Segmentation as Sequential Polygon Generation},
journal = {CoRR},
volume = {abs/2302.07387},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.07387},
doi = {10.48550/ARXIV.2302.07387},
eprinttype = {arXiv},
eprint = {2302.07387},
timestamp = {Mon, 20 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-07387.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-01733,
author = {Srikar Appalaraju and
Peng Tang and
Qi Dong and
Nishant Sankaran and
Yichu Zhou and
R. Manmatha},
title = {DocFormerv2: Local Features for Document Understanding},
journal = {CoRR},
volume = {abs/2306.01733},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.01733},
doi = {10.48550/ARXIV.2306.01733},
eprinttype = {arXiv},
eprint = {2306.01733},
timestamp = {Mon, 12 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-01733.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-07929,
author = {Haofu Liao and
Aruni RoyChowdhury and
Weijian Li and
Ankan Bansal and
Yuting Zhang and
Zhuowen Tu and
Ravi Kumar Satzoda and
R. Manmatha and
Vijay Mahadevan},
title = {DocTr: Document Transformer for Structured Information Extraction
in Documents},
journal = {CoRR},
volume = {abs/2307.07929},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.07929},
doi = {10.48550/ARXIV.2307.07929},
eprinttype = {arXiv},
eprint = {2307.07929},
timestamp = {Tue, 25 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-07929.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-02662,
author = {Arijit Ghosh and
Chandrima Kayal and
Manaswi Paraashar and
Manmatha Roy},
title = {Linear isomorphism testing of Boolean functions with small approximate
spectral norm},
journal = {CoRR},
volume = {abs/2308.02662},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.02662},
doi = {10.48550/ARXIV.2308.02662},
eprinttype = {arXiv},
eprint = {2308.02662},
timestamp = {Mon, 21 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-02662.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-08622,
author = {Peng Tang and
Srikar Appalaraju and
R. Manmatha and
Yusheng Xie and
Vijay Mahadevan},
title = {Multiple-Question Multiple-Answer Text-VQA},
journal = {CoRR},
volume = {abs/2311.08622},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.08622},
doi = {10.48550/ARXIV.2311.08622},
eprinttype = {arXiv},
eprint = {2311.08622},
timestamp = {Tue, 21 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-08622.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-08623,
author = {Peng Tang and
Pengkai Zhu and
Tian Li and
Srikar Appalaraju and
Vijay Mahadevan and
R. Manmatha},
title = {{DEED:} Dynamic Early Exit on Decoder for Accelerating Encoder-Decoder
Transformer Models},
journal = {CoRR},
volume = {abs/2311.08623},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.08623},
doi = {10.48550/ARXIV.2311.08623},
eprinttype = {arXiv},
eprint = {2311.08623},
timestamp = {Tue, 21 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-08623.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/ChattopadhyayMMRT23,
author = {Anupam Chattopadhyay and
Subhamoy Maitra and
Bimal Mandal and
Manmatha Roy and
Deng Tang},
title = {Efficient Hardware Implementation for Maiorana-McFarland type Functions},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {1970},
year = {2023},
url = {https://eprint.iacr.org/2023/1970},
timestamp = {Wed, 10 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iacr/ChattopadhyayMMRT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/0005WZZLZSHMMLS22,
author = {Hang Zhang and
Chongruo Wu and
Zhongyue Zhang and
Yi Zhu and
Haibin Lin and
Zhi Zhang and
Yue Sun and
Tong He and
Jonas Mueller and
R. Manmatha and
Mu Li and
Alexander J. Smola},
title = {ResNeSt: Split-Attention Networks},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition Workshops,
{CVPR} Workshops 2022, New Orleans, LA, USA, June 19-20, 2022},
pages = {2735--2745},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/CVPRW56347.2022.00309},
doi = {10.1109/CVPRW56347.2022.00309},
timestamp = {Wed, 10 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/0005WZZLZSHMMLS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/BitenLXAM22,
author = {Ali Furkan Biten and
Ron Litman and
Yusheng Xie and
Srikar Appalaraju and
R. Manmatha},
title = {LaTr: Layout-Aware Transformer for Scene-Text {VQA}},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2022, New Orleans, LA, USA, June 18-24, 2022},
pages = {16527--16537},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/CVPR52688.2022.01605},
doi = {10.1109/CVPR52688.2022.01605},
timestamp = {Wed, 05 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/BitenLXAM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/KittenplonLFBMP22,
author = {Yair Kittenplon and
Inbal Lavi and
Sharon Fogel and
Yarin Bar and
R. Manmatha and
Pietro Perona},
title = {Towards Weakly-Supervised Text Spotting using a Multi-Task Transformer},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2022, New Orleans, LA, USA, June 18-24, 2022},
pages = {4594--4603},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/CVPR52688.2022.00456},
doi = {10.1109/CVPR52688.2022.00456},
timestamp = {Tue, 04 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/KittenplonLFBMP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/HoAJMV22,
author = {Chih{-}Hui Ho and
Srikar Appalaraju and
Bhavan Jasani and
R. Manmatha and
Nuno Vasconcelos},
editor = {Leonid Karlinsky and
Tomer Michaeli and
Ko Nishino},
title = {{YORO} - Lightweight End to End Visual Grounding},
booktitle = {Computer Vision - {ECCV} 2022 Workshops - Tel Aviv, Israel, October
23-27, 2022, Proceedings, Part {VIII}},
series = {Lecture Notes in Computer Science},
volume = {13808},
pages = {3--23},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-25085-9\_1},
doi = {10.1007/978-3-031-25085-9\_1},
timestamp = {Thu, 16 Feb 2023 11:51:10 +0100},
biburl = {https://dblp.org/rec/conf/eccv/HoAJMV22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/RonenTALMM22,
author = {Roi Ronen and
Shahar Tsiper and
Oron Anschel and
Inbal Lavi and
Amir Markovitz and
R. Manmatha},
editor = {Shai Avidan and
Gabriel J. Brostow and
Moustapha Ciss{\'{e}} and
Giovanni Maria Farinella and
Tal Hassner},
title = {{GLASS:} Global to Local Attention for Scene-Text Spotting},
booktitle = {Computer Vision - {ECCV} 2022 - 17th European Conference, Tel Aviv,
Israel, October 23-27, 2022, Proceedings, Part {XXVIII}},
series = {Lecture Notes in Computer Science},
volume = {13688},
pages = {249--266},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-19815-1\_15},
doi = {10.1007/978-3-031-19815-1\_15},
timestamp = {Sun, 13 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eccv/RonenTALMM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/SlossbergAMLATMWM22,
author = {Ron Slossberg and
Oron Anschel and
Amir Markovitz and
Ron Litman and
Aviad Aberdam and
Shahar Tsiper and
Shai Mazor and
Jon Wu and
R. Manmatha},
editor = {Leonid Karlinsky and
Tomer Michaeli and
Ko Nishino},
title = {On Calibration of Scene-Text Recognition Models},
booktitle = {Computer Vision - {ECCV} 2022 Workshops - Tel Aviv, Israel, October
23-27, 2022, Proceedings, Part {IV}},
series = {Lecture Notes in Computer Science},
volume = {13804},
pages = {263--279},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-25069-9\_18},
doi = {10.1007/978-3-031-25069-9\_18},
timestamp = {Mon, 20 Feb 2023 17:49:54 +0100},
biburl = {https://dblp.org/rec/conf/eccv/SlossbergAMLATMWM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/indocrypt/MaitraMR22,
author = {Subhamoy Maitra and
Bimal Mandal and
Manmatha Roy},
editor = {Takanori Isobe and
Santanu Sarkar},
title = {Modifying Bent Functions to Obtain the Balanced Ones with High Nonlinearity},
booktitle = {Progress in Cryptology - {INDOCRYPT} 2022 - 23rd International Conference
on Cryptology in India, Kolkata, India, December 11-14, 2022, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13774},
pages = {449--470},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-22912-1\_20},
doi = {10.1007/978-3-031-22912-1\_20},
timestamp = {Mon, 09 Jan 2023 17:58:33 +0100},
biburl = {https://dblp.org/rec/conf/indocrypt/MaitraMR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2202-05508,
author = {Yair Kittenplon and
Inbal Lavi and
Sharon Fogel and
Yarin Bar and
R. Manmatha and
Pietro Perona},
title = {Towards Weakly-Supervised Text Spotting using a Multi-Task Transformer},
journal = {CoRR},
volume = {abs/2202.05508},
year = {2022},
url = {https://arxiv.org/abs/2202.05508},
eprinttype = {arXiv},
eprint = {2202.05508},
timestamp = {Fri, 18 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2202-05508.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-03364,
author = {Roi Ronen and
Shahar Tsiper and
Oron Anschel and
Inbal Lavi and
Amir Markovitz and
R. Manmatha},
title = {{GLASS:} Global to Local Attention for Scene-Text Spotting},
journal = {CoRR},
volume = {abs/2208.03364},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2208.03364},
doi = {10.48550/ARXIV.2208.03364},
eprinttype = {arXiv},
eprint = {2208.03364},
timestamp = {Wed, 10 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2208-03364.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-07912,
author = {Chih{-}Hui Ho and
Srikar Appalaraju and
Bhavan Jasani and
R. Manmatha and
Nuno Vasconcelos},
title = {{YORO} - Lightweight End to End Visual Grounding},
journal = {CoRR},
volume = {abs/2211.07912},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.07912},
doi = {10.48550/ARXIV.2211.07912},
eprinttype = {arXiv},
eprint = {2211.07912},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-07912.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/AberdamLTASMMP21,
author = {Aviad Aberdam and
Ron Litman and
Shahar Tsiper and
Oron Anschel and
Ron Slossberg and
Shai Mazor and
R. Manmatha and
Pietro Perona},
title = {Sequence-to-Sequence Contrastive Learning for Text Recognition},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
2021, virtual, June 19-25, 2021},
pages = {15302--15312},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2021},
url = {https://openaccess.thecvf.com/content/CVPR2021/html/Aberdam\_Sequence-to-Sequence\_Contrastive\_Learning\_for\_Text\_Recognition\_CVPR\_2021\_paper.html},
doi = {10.1109/CVPR46437.2021.01505},
timestamp = {Mon, 18 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/AberdamLTASMMP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/AppalarajuJKXM21,
author = {Srikar Appalaraju and
Bhavan Jasani and
Bhargava Urala Kota and
Yusheng Xie and
R. Manmatha},
title = {DocFormer: End-to-End Transformer for Document Understanding},
booktitle = {2021 {IEEE/CVF} International Conference on Computer Vision, {ICCV}
2021, Montreal, QC, Canada, October 10-17, 2021},
pages = {973--983},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICCV48922.2021.00103},
doi = {10.1109/ICCV48922.2021.00103},
timestamp = {Fri, 11 Mar 2022 10:01:27 +0100},
biburl = {https://dblp.org/rec/conf/iccv/AppalarajuJKXM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/PatelAM21,
author = {Yash Patel and
Srikar Appalaraju and
R. Manmatha},
title = {Saliency Driven Perceptual Image Compression},
booktitle = {{IEEE} Winter Conference on Applications of Computer Vision, {WACV}
2021, Waikoloa, HI, USA, January 3-8, 2021},
pages = {227--236},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/WACV48630.2021.00027},
doi = {10.1109/WACV48630.2021.00027},
timestamp = {Fri, 18 Jun 2021 10:51:54 +0200},
biburl = {https://dblp.org/rec/conf/wacv/PatelAM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-11539,
author = {Srikar Appalaraju and
Bhavan Jasani and
Bhargava Urala Kota and
Yusheng Xie and
R. Manmatha},
title = {DocFormer: End-to-End Transformer for Document Understanding},
journal = {CoRR},
volume = {abs/2106.11539},
year = {2021},
url = {https://arxiv.org/abs/2106.11539},
eprinttype = {arXiv},
eprint = {2106.11539},
timestamp = {Wed, 30 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-11539.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-12494,
author = {Ali Furkan Biten and
Ron Litman and
Yusheng Xie and
Srikar Appalaraju and
R. Manmatha},
title = {LaTr: Layout-Aware Transformer for Scene-Text {VQA}},
journal = {CoRR},
volume = {abs/2112.12494},
year = {2021},
url = {https://arxiv.org/abs/2112.12494},
eprinttype = {arXiv},
eprint = {2112.12494},
timestamp = {Tue, 04 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-12494.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/LitmanATLMM20,
author = {Ron Litman and
Oron Anschel and
Shahar Tsiper and
Roee Litman and
Shai Mazor and
R. Manmatha},
title = {{SCATTER:} Selective Context Attentional Scene Text Recognizer},
booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2020, Seattle, WA, USA, June 13-19, 2020},
pages = {11959--11969},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020},
url = {https://openaccess.thecvf.com/content\_CVPR\_2020/html/Litman\_SCATTER\_Selective\_Context\_Attentional\_Scene\_Text\_Recognizer\_CVPR\_2020\_paper.html},
doi = {10.1109/CVPR42600.2020.01198},
timestamp = {Tue, 31 Aug 2021 14:00:04 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/LitmanATLMM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/space/MaitraMRT20,
author = {Subhamoy Maitra and
Bimal Mandal and
Manmatha Roy and
Deng Tang},
editor = {Lejla Batina and
Stjepan Picek and
Mainack Mondal},
title = {Experimental Results on Higher-Order Differential Spectra of 6 and
8-bit Invertible S-Boxes},
booktitle = {Security, Privacy, and Applied Cryptography Engineering - 10th International
Conference, {SPACE} 2020, Kolkata, India, December 17-21, 2020, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {12586},
pages = {226--237},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-66626-2\_12},
doi = {10.1007/978-3-030-66626-2\_12},
timestamp = {Tue, 05 Jan 2021 17:43:06 +0100},
biburl = {https://dblp.org/rec/conf/space/MaitraMRT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2002-04988,
author = {Yash Patel and
Srikar Appalaraju and
R. Manmatha},
title = {Hierarchical Auto-Regressive Model for Image Compression Incorporating
Object Saliency and a Deep Perceptual Loss},
journal = {CoRR},
volume = {abs/2002.04988},
year = {2020},
url = {https://arxiv.org/abs/2002.04988},
eprinttype = {arXiv},
eprint = {2002.04988},
timestamp = {Fri, 14 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2002-04988.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2003-11288,
author = {Ron Litman and
Oron Anschel and
Shahar Tsiper and
Roee Litman and
Shai Mazor and
R. Manmatha},
title = {{SCATTER:} Selective Context Attentional Scene Text Recognizer},
journal = {CoRR},
volume = {abs/2003.11288},
year = {2020},
url = {https://arxiv.org/abs/2003.11288},
eprinttype = {arXiv},
eprint = {2003.11288},
timestamp = {Wed, 01 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2003-11288.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-08955,
author = {Hang Zhang and
Chongruo Wu and
Zhongyue Zhang and
Yi Zhu and
Zhi Zhang and
Haibin Lin and
Yue Sun and
Tong He and
Jonas Mueller and
R. Manmatha and
Mu Li and
Alexander J. Smola},
title = {ResNeSt: Split-Attention Networks},
journal = {CoRR},
volume = {abs/2004.08955},
year = {2020},
url = {https://arxiv.org/abs/2004.08955},
eprinttype = {arXiv},
eprint = {2004.08955},
timestamp = {Wed, 10 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2004-08955.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-14960,
author = {Yi Zhu and
Zhongyue Zhang and
Chongruo Wu and
Zhi Zhang and
Tong He and
Hang Zhang and
R. Manmatha and
Mu Li and
Alexander J. Smola},
title = {Improving Semantic Segmentation via Self-Training},
journal = {CoRR},
volume = {abs/2004.14960},
year = {2020},
url = {https://arxiv.org/abs/2004.14960},
eprinttype = {arXiv},
eprint = {2004.14960},
timestamp = {Wed, 10 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2004-14960.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2007-00398,
author = {Minesh Mathew and
Dimosthenis Karatzas and
R. Manmatha and
C. V. Jawahar},
title = {DocVQA: {A} Dataset for {VQA} on Document Images},
journal = {CoRR},
volume = {abs/2007.00398},
year = {2020},
url = {https://arxiv.org/abs/2007.00398},
eprinttype = {arXiv},
eprint = {2007.00398},
timestamp = {Mon, 06 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2007-00398.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-08899,
author = {Minesh Mathew and
Rub{\`{e}}n Tito and
Dimosthenis Karatzas and
R. Manmatha and
C. V. Jawahar},
title = {Document Visual Question Answering Challenge 2020},
journal = {CoRR},
volume = {abs/2008.08899},
year = {2020},
url = {https://arxiv.org/abs/2008.08899},
eprinttype = {arXiv},
eprint = {2008.08899},
timestamp = {Fri, 21 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2008-08899.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2012-06567,
author = {Yi Zhu and
Xinyu Li and
Chunhui Liu and
Mohammadreza Zolfaghari and
Yuanjun Xiong and
Chongruo Wu and
Zhi Zhang and
Joseph Tighe and
R. Manmatha and
Mu Li},
title = {A Comprehensive Study of Deep Video Action Recognition},
journal = {CoRR},
volume = {abs/2012.06567},
year = {2020},
url = {https://arxiv.org/abs/2012.06567},
eprinttype = {arXiv},
eprint = {2012.06567},
timestamp = {Wed, 10 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2012-06567.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2012-10873,
author = {Aviad Aberdam and
Ron Litman and
Shahar Tsiper and
Oron Anschel and
Ron Slossberg and
Shai Mazor and
R. Manmatha and
Pietro Perona},
title = {Sequence-to-Sequence Contrastive Learning for Text Recognition},
journal = {CoRR},
volume = {abs/2012.10873},
year = {2020},
url = {https://arxiv.org/abs/2012.10873},
eprinttype = {arXiv},
eprint = {2012.10873},
timestamp = {Mon, 04 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2012-10873.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2012-12643,
author = {Ron Slossberg and
Oron Anschel and
Amir Markovitz and
Ron Litman and
Aviad Aberdam and
Shahar Tsiper and
Shai Mazor and
Jon Wu and
R. Manmatha},
title = {On Calibration of Scene-Text Recognition Models},
journal = {CoRR},
volume = {abs/2012.12643},
year = {2020},
url = {https://arxiv.org/abs/2012.12643},
eprinttype = {arXiv},
eprint = {2012.12643},
timestamp = {Tue, 05 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2012-12643.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jois/DixitRP19,
author = {Anil Kumar Dixit and
Manmatha K. Roul and
Bikash C. Panda},
title = {Mathematical Model Using Soft Computing Techniques for Different Thermal
Insulation Materials},
journal = {J. Intell. Syst.},
volume = {28},
number = {5},
pages = {821--833},
year = {2019},
url = {https://doi.org/10.1515/jisys-2017-0103},
doi = {10.1515/JISYS-2017-0103},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jois/DixitRP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/YalnizM19,
author = {Ismet Zeki Yalniz and
R. Manmatha},
title = {Dependence Models for Searching Text in Document Images},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {41},
number = {1},
pages = {49--63},
year = {2019},
url = {https://doi.org/10.1109/TPAMI.2017.2780108},
doi = {10.1109/TPAMI.2017.2780108},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pami/YalnizM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-02244,
author = {Son Tran and
Ming Du and
Sampath Chanda and
R. Manmatha and
Cj Taylor},
title = {Searching for Apparel Products from Images in the Wild},
journal = {CoRR},
volume = {abs/1907.02244},
year = {2019},
url = {http://arxiv.org/abs/1907.02244},
eprinttype = {arXiv},
eprint = {1907.02244},
timestamp = {Mon, 08 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1907-02244.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-08310,
author = {Yash Patel and
Srikar Appalaraju and
R. Manmatha},
title = {Deep Perceptual Compression},
journal = {CoRR},
volume = {abs/1907.08310},
year = {2019},
url = {http://arxiv.org/abs/1907.08310},
eprinttype = {arXiv},
eprint = {1907.08310},
timestamp = {Tue, 23 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1907-08310.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1908-04187,
author = {Yash Patel and
Srikar Appalaraju and
R. Manmatha},
title = {Human Perceptual Evaluations for Image Compression},
journal = {CoRR},
volume = {abs/1908.04187},
year = {2019},
url = {http://arxiv.org/abs/1908.04187},
eprinttype = {arXiv},
eprint = {1908.04187},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1908-04187.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/WuZHMSK18,
author = {Chao{-}Yuan Wu and
Manzil Zaheer and
Hexiang Hu and
R. Manmatha and
Alexander J. Smola and
Philipp Kr{\"{a}}henb{\"{u}}hl},
title = {Compressed Video Action Recognition},
booktitle = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2018, Salt Lake City, UT, USA, June 18-22, 2018},
pages = {6026--6035},
publisher = {Computer Vision Foundation / {IEEE} Computer Society},
year = {2018},
url = {http://openaccess.thecvf.com/content\_cvpr\_2018/html/Wu\_Compressed\_Video\_Action\_CVPR\_2018\_paper.html},
doi = {10.1109/CVPR.2018.00631},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/WuZHMSK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/ManmathaWSK17,
author = {R. Manmatha and
Chao{-}Yuan Wu and
Alexander J. Smola and
Philipp Kr{\"{a}}henb{\"{u}}hl},
title = {Sampling Matters in Deep Embedding Learning},
booktitle = {{IEEE} International Conference on Computer Vision, {ICCV} 2017, Venice,
Italy, October 22-29, 2017},
pages = {2859--2867},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/ICCV.2017.309},
doi = {10.1109/ICCV.2017.309},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccv/ManmathaWSK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/WuMSK17,
author = {Chao{-}Yuan Wu and
R. Manmatha and
Alexander J. Smola and
Philipp Kr{\"{a}}henb{\"{u}}hl},
title = {Sampling Matters in Deep Embedding Learning},
journal = {CoRR},
volume = {abs/1706.07567},
year = {2017},
url = {http://arxiv.org/abs/1706.07567},
eprinttype = {arXiv},
eprint = {1706.07567},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/WuMSK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1712-00636,
author = {Chao{-}Yuan Wu and
Manzil Zaheer and
Hexiang Hu and
R. Manmatha and
Alexander J. Smola and
Philipp Kr{\"{a}}henb{\"{u}}hl},
title = {Compressed Video Action Recognition},
journal = {CoRR},
volume = {abs/1712.00636},
year = {2017},
url = {http://arxiv.org/abs/1712.00636},
eprinttype = {arXiv},
eprint = {1712.00636},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1712-00636.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/MurthySCMC16,
author = {Venkatesh N. Murthy and
Vivek K. Singh and
Terrence Chen and
R. Manmatha and
Dorin Comaniciu},
title = {Deep Decision Network for Multi-class Image Classification},
booktitle = {2016 {IEEE} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2016, Las Vegas, NV, USA, June 27-30, 2016},
pages = {2240--2248},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/CVPR.2016.246},
doi = {10.1109/CVPR.2016.246},
timestamp = {Thu, 05 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/MurthySCMC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/YalnizGM16,
author = {Ismet Zeki Yalniz and
Douglas Gray and
R. Manmatha},
editor = {Gang Hua and
Herv{\'{e}} J{\'{e}}gou},
title = {Efficient Exploration of Text Regions in Natural Scene Images Using
Adaptive Image Sampling},
booktitle = {Computer Vision - {ECCV} 2016 Workshops - Amsterdam, The Netherlands,
October 8-10 and 15-16, 2016, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {9913},
pages = {427--439},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-46604-0\_31},
doi = {10.1007/978-3-319-46604-0\_31},
timestamp = {Tue, 14 May 2019 10:00:45 +0200},
biburl = {https://dblp.org/rec/conf/eccv/YalnizGM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mir/MurthySCM16,
author = {Venkatesh N. Murthy and
Avinash Sharma and
Visesh Chari and
R. Manmatha},
editor = {John R. Kender and
John R. Smith and
Jiebo Luo and
Susanne Boll and
Winston H. Hsu},
title = {Image Annotation using Multi-scale Hypergraph Heat Diffusion Framework},
booktitle = {Proceedings of the 2016 {ACM} on International Conference on Multimedia
Retrieval, {ICMR} 2016, New York, New York, USA, June 6-9, 2016},
pages = {299--303},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2911996.2912055},
doi = {10.1145/2911996.2912055},
timestamp = {Wed, 18 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mir/MurthySCM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HalveyMJRRMK15,
author = {Martin Halvey and
Philip J. McParlane and
Joemon M. Jose and
Keith van Rijsbergen and
Stefan M. R{\"{u}}ger and
R. Manmatha and
Mohan S. Kankanhalli},
title = {{ICMR} 2014: 4th {ACM} International Conference on Multimedia Retrieval},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {10--15},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795407},
doi = {10.1145/2795403.2795407},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HalveyMJRRMK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mir/MurthyMM15,
author = {Venkatesh N. Murthy and
Subhransu Maji and
R. Manmatha},
editor = {Alexander G. Hauptmann and
Chong{-}Wah Ngo and
Xiangyang Xue and
Yu{-}Gang Jiang and
Cees Snoek and
Nuno Vasconcelos},
title = {Automatic Image Annotation using Deep Learning Representations},
booktitle = {Proceedings of the 5th {ACM} on International Conference on Multimedia
Retrieval, Shanghai, China, June 23-26, 2015},
pages = {603--606},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2671188.2749391},
doi = {10.1145/2671188.2749391},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mir/MurthyMM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdar/SankarMJ14,
author = {K. Pramod Sankar and
R. Manmatha and
C. V. Jawahar},
title = {Large scale document image retrieval by automatic word annotation},
journal = {Int. J. Document Anal. Recognit.},
volume = {17},
number = {1},
pages = {1--17},
year = {2014},
url = {https://doi.org/10.1007/s10032-013-0207-2},
doi = {10.1007/S10032-013-0207-2},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijdar/SankarMJ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mva/MoeslundJJM14,
author = {Thomas B. Moeslund and
Omar Javed and
Yu{-}Gang Jiang and
R. Manmatha},
title = {Special issue on Multimedia Event Detection},
journal = {Mach. Vis. Appl.},
volume = {25},
number = {1},
pages = {1--4},
year = {2014},
url = {https://doi.org/10.1007/s00138-013-0586-x},
doi = {10.1007/S00138-013-0586-X},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mva/MoeslundJJM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/das/MotaMFL14,
author = {David Fern{\'{a}}ndez Mota and
R. Manmatha and
Alicia Forn{\'{e}}s and
Josep Llad{\'{o}}s},
editor = {Jean{-}Yves Ramel and
Marcus Liwicki and
Jean{-}Marc Ogier and
Koichi Kise and
Ray Smith},
title = {Sequential Word Spotting in Historical Handwritten Documents},
booktitle = {11th {IAPR} International Workshop on Document Analysis Systems, {DAS}
2014, Tours, France, April 7-10, 2014},
pages = {101--105},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/DAS.2014.18},
doi = {10.1109/DAS.2014.18},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/das/MotaMFL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mir/CanM14,
author = {Ethem F. Can and
R. Manmatha},
editor = {Mohan S. Kankanhalli and
Stefan M. R{\"{u}}ger and
R. Manmatha and
Joemon M. Jose and
Keith van Rijsbergen},
title = {Modeling Concept Dependencies for Event Detection},
booktitle = {International Conference on Multimedia Retrieval, {ICMR} '14, Glasgow,
United Kingdom - April 01 - 04, 2014},
pages = {289},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2578726.2578763},
doi = {10.1145/2578726.2578763},
timestamp = {Thu, 15 Jul 2021 17:18:30 +0200},
biburl = {https://dblp.org/rec/conf/mir/CanM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mir/MurthyCM14,
author = {Venkatesh N. Murthy and
Ethem F. Can and
R. Manmatha},
editor = {Mohan S. Kankanhalli and
Stefan M. R{\"{u}}ger and
R. Manmatha and
Joemon M. Jose and
Keith van Rijsbergen},
title = {A Hybrid Model for Automatic Image Annotation},
booktitle = {International Conference on Multimedia Retrieval, {ICMR} '14, Glasgow,
United Kingdom - April 01 - 04, 2014},
pages = {369},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2578726.2578774},
doi = {10.1145/2578726.2578774},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mir/MurthyCM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/CanCM14,
author = {Ethem F. Can and
W. Bruce Croft and
R. Manmatha},
editor = {Shlomo Geva and
Andrew Trotman and
Peter Bruza and
Charles L. A. Clarke and
Kalervo J{\"{a}}rvelin},
title = {Incorporating query-specific feedback into learning-to-rank models},
booktitle = {The 37th International {ACM} {SIGIR} Conference on Research and Development
in Information Retrieval, {SIGIR} '14, Gold Coast , QLD, Australia
- July 06 - 11, 2014},
pages = {1035--1038},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2600428.2609503},
doi = {10.1145/2600428.2609503},
timestamp = {Tue, 06 Nov 2018 11:07:24 +0100},
biburl = {https://dblp.org/rec/conf/sigir/CanCM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/mir/2014,
editor = {Mohan S. Kankanhalli and
Stefan M. R{\"{u}}ger and
R. Manmatha and
Joemon M. Jose and
Keith van Rijsbergen},
title = {International Conference on Multimedia Retrieval, {ICMR} '14, Glasgow,
United Kingdom - April 01 - 04, 2014},
publisher = {{ACM}},
year = {2014},
url = {http://dl.acm.org/citation.cfm?id=2578726},
isbn = {978-1-4503-2782-4},
timestamp = {Thu, 15 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mir/2014.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/CanOM13,
author = {Ethem F. Can and
H{\"{u}}seyin Oktay and
R. Manmatha},
editor = {Qi He and
Arun Iyengar and
Wolfgang Nejdl and
Jian Pei and
Rajeev Rastogi},
title = {Predicting retweet count using visual cues},
booktitle = {22nd {ACM} International Conference on Information and Knowledge Management,
CIKM'13, San Francisco, CA, USA, October 27 - November 1, 2013},
pages = {1481--1484},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2505515.2507824},
doi = {10.1145/2505515.2507824},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/CanOM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/CanM13,
author = {Ethem F. Can and
R. Manmatha},
title = {Formulating Action Recognition as a Ranking Problem},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
Workshops 2013, Portland, OR, USA, June 23-28, 2013},
pages = {251--256},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/CVPRW.2013.44},
doi = {10.1109/CVPRW.2013.44},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/CanM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/WemhoenerYM13,
author = {David Wemhoener and
Ismet Zeki Yalniz and
R. Manmatha},
title = {Creating an Improved Version Using Noisy {OCR} from Multiple Editions},
booktitle = {12th International Conference on Document Analysis and Recognition,
{ICDAR} 2013, Washington, DC, USA, August 25-28, 2013},
pages = {160--164},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/ICDAR.2013.39},
doi = {10.1109/ICDAR.2013.39},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdar/WemhoenerYM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trecvid/Allan0FMMW13,
author = {James Allan and
Jeff Dalton and
John Foley and
R. Manmatha and
Venkatesh N. Murthy and
David Wemhoener},
editor = {Paul Over and
Jon Fiscus and
Gregory A. Sanders and
Barbara Shaw and
George Awad and
Martial Michel and
Alan F. Smeaton and
Wessel Kraaij and
Georges Qu{\'{e}}not},
title = {Short Text Queries for Video Retrieval Multimedia event Detection
at {TRECVID} 2013},
booktitle = {2013 {TREC} Video Retrieval Evaluation, {TRECVID} 2013, Gaithersburg,
MD, USA, November 20-22, 2013},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2013},
url = {https://www-nlpir.nist.gov/projects/tvpubs/tv13.papers/umass.pdf},
timestamp = {Mon, 10 May 2021 15:09:49 +0200},
biburl = {https://dblp.org/rec/conf/trecvid/Allan0FMMW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trecvid/LiuCJYCZDSAMFSD13,
author = {Jingen Liu and
Hui Cheng and
Omar Javed and
Qian Yu and
Ishani Chakraborty and
Weiyu Zhang and
Ajay Divakaran and
Harpreet S. Sawhney and
James Allan and
R. Manmatha and
John Foley and
Mubarak Shah and
Afshin Dehghan and
Michael Witbrock and
Jon Curtis and
Gerald Friedland},
editor = {Paul Over and
Jon Fiscus and
Gregory A. Sanders and
Barbara Shaw and
George Awad and
Martial Michel and
Alan F. Smeaton and
Wessel Kraaij and
Georges Qu{\'{e}}not},
title = {SRI-Sarnoff {AURORA} System at {TRECVID} 2013 Multimedia Event Detection
and Recounting},
booktitle = {2013 {TREC} Video Retrieval Evaluation, {TRECVID} 2013, Gaithersburg,
MD, USA, November 20-22, 2013},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2013},
url = {https://www-nlpir.nist.gov/projects/tvpubs/tv13.papers/sriaurora\_med\_mer.pdf},
timestamp = {Tue, 07 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/trecvid/LiuCJYCZDSAMFSD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icdar/2013hip,
editor = {Volkmar Frinken and
Bill Barrett and
R. Manmatha and
Volker M{\"{a}}rgner},
title = {Proceedings of the 2nd International Workshop on Historical Document
Imaging and Processing, HIP@ICDAR 2013, Washington, DC, USA, August
24, 2013},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2501115},
doi = {10.1145/2501115},
isbn = {978-1-4503-2115-0},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdar/2013hip.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/FrinkenFMB12,
author = {Volkmar Frinken and
Andreas Fischer and
R. Manmatha and
Horst Bunke},
title = {A Novel Word Spotting Method Based on Recurrent Neural Networks},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {34},
number = {2},
pages = {211--224},
year = {2012},
url = {https://doi.org/10.1109/TPAMI.2011.113},
doi = {10.1109/TPAMI.2011.113},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pami/FrinkenFMB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/das/YalnizM12,
author = {Ismet Zeki Yalniz and
R. Manmatha},
editor = {Michael Blumenstein and
Umapada Pal and
Seiichi Uchida},
title = {An Efficient Framework for Searching Text in Noisy Document Images},
booktitle = {10th {IAPR} International Workshop on Document Analysis Systems, {DAS}
2012, Gold Coast, Queenslands, Australia, March 27-29, 2012},
pages = {48--52},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/DAS.2012.18},
doi = {10.1109/DAS.2012.18},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/das/YalnizM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icfhr/FernandezLFM12,
author = {David Fern{\'{a}}ndez and
Josep Llad{\'{o}}s and
Alicia Forn{\'{e}}s and
R. Manmatha},
title = {On Influence of Line Segmentation in Efficient Word Segmentation in
Old Manuscripts},
booktitle = {2012 International Conference on Frontiers in Handwriting Recognition,
{ICFHR} 2012, Bari, Italy, September 18-20, 2012},
pages = {763--768},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/ICFHR.2012.247},
doi = {10.1109/ICFHR.2012.247},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icfhr/FernandezLFM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/CartrightCDDGKWYAMS12,
author = {Marc{-}Allen Cartright and
Ethem F. Can and
William Dabney and
Jeff Dalton and
Logan Giorda and
Kriste Krstovski and
Xiaoye Wu and
Ismet Zeki Yalniz and
James Allan and
R. Manmatha and
David A. Smith},
editor = {William R. Hersh and
Jamie Callan and
Yoelle Maarek and
Mark Sanderson},
title = {A framework for manipulating and searching multiple retrieval types},
booktitle = {The 35th International {ACM} {SIGIR} conference on research and development
in Information Retrieval, {SIGIR} '12, Portland, OR, USA, August 12-16,
2012},
pages = {1001},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2348283.2348426},
doi = {10.1145/2348283.2348426},
timestamp = {Wed, 14 Nov 2018 10:58:10 +0100},
biburl = {https://dblp.org/rec/conf/sigir/CartrightCDDGKWYAMS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/YalnizM12,
author = {Ismet Zeki Yalniz and
R. Manmatha},
editor = {William R. Hersh and
Jamie Callan and
Yoelle Maarek and
Mark Sanderson},
title = {Finding translations in scanned book collections},
booktitle = {The 35th International {ACM} {SIGIR} conference on research and development
in Information Retrieval, {SIGIR} '12, Portland, OR, USA, August 12-16,
2012},
pages = {465--474},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2348283.2348347},
doi = {10.1145/2348283.2348347},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/YalnizM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trecvid/ChengLAJYTDSMAH12,
author = {Hui Cheng and
Jingen Liu and
Saad Ali and
Omar Javed and
Qian Yu and
Amir Tamrakar and
Ajay Divakaran and
Harpreet S. Sawhney and
R. Manmatha and
James Allan and
Alexander G. Hauptmann and
Mubarak Shah and
Subhabrata Bhattacharya and
Afshin Dehghan and
Gerald Friedland and
Benjamin Elizalde and
Trevor Darrell and
Michael Witbrock and
Jon Curtis},
editor = {Paul Over and
Jonathan G. Fiscus and
Gregory A. Sanders and
Barbara Shaw and
George Awad and
Martial Michel and
Alan F. Smeaton and
Wessel Kraaij and
Georges Qu{\'{e}}not},
title = {SRI-Sarnoff {AURORA} System at {TRECVID} 2012 Multimedia Event Detection
and Recounting},
booktitle = {2012 {TREC} Video Retrieval Evaluation, {TRECVID} 2012, Gaithersburg,
MD, USA, November 26-28, 2012},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2012},
url = {https://www-nlpir.nist.gov/projects/tvpubs/tv12.papers/aurora.pdf},
timestamp = {Sun, 05 Apr 2020 14:39:22 +0200},
biburl = {https://dblp.org/rec/conf/trecvid/ChengLAJYTDSMAH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/SmithMA11,
author = {David A. Smith and
R. Manmatha and
James Allan},
editor = {Gabriella Kazai and
Carsten Eickhoff and
Peter Brusilovsky},
title = {Mining relational structure from millions of books: position paper},
booktitle = {Proceedings of the 4th {ACM} Workshop on Online books, complementary
social media and crowdsourcing, BooksOnline 2011, Glasgow, United
Kingdom, October 24, 2011},
pages = {49--54},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2064058.2064069},
doi = {10.1145/2064058.2064069},
timestamp = {Wed, 04 May 2022 13:03:26 +0200},
biburl = {https://dblp.org/rec/conf/cikm/SmithMA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/YalnizCM11,
author = {Ismet Zeki Yalniz and
Ethem F. Can and
R. Manmatha},
editor = {Craig Macdonald and
Iadh Ounis and
Ian Ruthven},
title = {Partial duplicate detection for large book collections},
booktitle = {Proceedings of the 20th {ACM} Conference on Information and Knowledge
Management, {CIKM} 2011, Glasgow, United Kingdom, October 24-28, 2011},
pages = {469--474},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2063576.2063647},
doi = {10.1145/2063576.2063647},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/YalnizCM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/JainFJM11,
author = {Raman Jain and
Volkmar Frinken and
C. V. Jawahar and
Raghavan Manmatha},
title = {{BLSTM} Neural Network Based Word Retrieval for Hindi Documents},
booktitle = {2011 International Conference on Document Analysis and Recognition,
{ICDAR} 2011, Beijing, China, September 18-21, 2011},
pages = {83--87},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ICDAR.2011.26},
doi = {10.1109/ICDAR.2011.26},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdar/JainFJM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/YalnizM11,
author = {Ismet Zeki Yalniz and
Raghavan Manmatha},
title = {A Fast Alignment Scheme for Automatic {OCR} Evaluation of Books},
booktitle = {2011 International Conference on Document Analysis and Recognition,
{ICDAR} 2011, Beijing, China, September 18-21, 2011},
pages = {754--758},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ICDAR.2011.157},
doi = {10.1109/ICDAR.2011.157},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdar/YalnizM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trecvid/ChengTAYJLDSHSB11,
author = {Hui Cheng and
Amir Tamrakar and
Saad Ali and
Qian Yu and
Omar Javed and
Jingen Liu and
Ajay Divakaran and
Harpreet S. Sawhney and
Alexander G. Hauptmann and
Mubarak Shah and
Subhabrata Bhattacharya and
Michael Witbrock and
Jon Curtis and
Gerald Friedland and
Robert Mertens and
Trevor Darrell and
R. Manmatha and
James Allan},
editor = {Paul Over and
George Awad and
Jonathan G. Fiscus and
Brian Antonishek and
Martial Michel and
Alan F. Smeaton and
Wessel Kraaij and
Georges Qu{\'{e}}not},
title = {Team SRI-Sarnoff's {AURORA} System @ {TRECVID} 2011},
booktitle = {2011 {TREC} Video Retrieval Evaluation, {TRECVID} 2011, Gaithersburg,
MD, USA, December 5-7, 2011},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2011},
url = {https://www-nlpir.nist.gov/projects/tvpubs/tv11.papers/sri-aurora.pdf},
timestamp = {Thu, 11 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/trecvid/ChengTAYJLDSHSB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icdar/2011hip,
editor = {Bill Barrett and
Michael S. Brown and
R. Manmatha and
Jake Gehring},
title = {Proceedings of the 2011 Workshop on Historical Document Imaging and
Processing, HIP@ICDAR 2011, Beijing, China, September 16-17, 2011},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2037342},
doi = {10.1145/2037342},
isbn = {978-1-4503-0916-5},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdar/2011hip.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/civr/LlorenteMR10,
author = {Ainhoa Llorente and
Raghavan Manmatha and
Stefan M. R{\"{u}}ger},
editor = {Shipeng Li and
Xinbo Gao and
Nicu Sebe},
title = {Image retrieval using Markov Random Fields and global image features},
booktitle = {Proceedings of the 9th {ACM} International Conference on Image and
Video Retrieval, {CIVR} 2010, Xi'an, China, July 5-7, 2010},
pages = {243--250},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1816041.1816078},
doi = {10.1145/1816041.1816078},
timestamp = {Tue, 20 Apr 2021 16:59:22 +0200},
biburl = {https://dblp.org/rec/conf/civr/LlorenteMR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/das/SankarJM10,
author = {K. Pramod Sankar and
C. V. Jawahar and
Raghavan Manmatha},
editor = {David S. Doermann and
Venu Govindaraju and
Daniel P. Lopresti and
Premkumar Natarajan},
title = {Nearest neighbor based collection {OCR}},
booktitle = {The Ninth {IAPR} International Workshop on Document Analysis Systems,
{DAS} 2010, June 9-11, 2010, Boston, Massachusetts, {USA}},
series = {{ACM} International Conference Proceeding Series},
pages = {207--214},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1815330.1815357},
doi = {10.1145/1815330.1815357},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/das/SankarJM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icfhr/FrinkenFBM10,
author = {Volkmar Frinken and
Andreas Fischer and
Horst Bunke and
R. Manmatha},
title = {Adapting {BLSTM} Neural Network Based Keyword Spotting Trained on
Modern Data to Historical Documents},
booktitle = {International Conference on Frontiers in Handwriting Recognition,
{ICFHR} 2010, Kolkata, India, 16-18 November 2010},
pages = {352--357},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/ICFHR.2010.61},
doi = {10.1109/ICFHR.2010.61},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icfhr/FrinkenFBM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/HoweFM09,
author = {Nicholas R. Howe and
Shaolei Feng and
R. Manmatha},
title = {Finding words in alphabet soup: Inference on freeform character recognition
for historical scripts},
journal = {Pattern Recognit.},
volume = {42},
number = {12},
pages = {3338--3347},
year = {2009},
url = {https://doi.org/10.1016/j.patcog.2009.01.012},
doi = {10.1016/J.PATCOG.2009.01.012},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pr/HoweFM09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/RasagnaKJM09,
author = {Venkat Rasagna and
Anand Kumar and
C. V. Jawahar and
Raghavan Manmatha},
title = {Robust Recognition of Documents by Fusing Results of Word Clusters},
booktitle = {10th International Conference on Document Analysis and Recognition,
{ICDAR} 2009, Barcelona, Spain, 26-29 July 2009},
pages = {566--570},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ICDAR.2009.135},
doi = {10.1109/ICDAR.2009.135},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdar/RasagnaKJM09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/civr/FengM08,
author = {Shaolei Feng and
Raghavan Manmatha},
editor = {Jiebo Luo and
Ling Guan and
Alan Hanjalic and
Mohan S. Kankanhalli and
Ivan Lee},
title = {A discrete direct retrieval model for image and video retrieval},
booktitle = {Proceedings of the 7th {ACM} International Conference on Image and
Video Retrieval, {CIVR} 2008, Niagara Falls, Canada, July 7-9, 2008},
pages = {427--436},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1386352.1386407},
doi = {10.1145/1386352.1386407},
timestamp = {Wed, 26 Jun 2024 21:42:22 +0200},
biburl = {https://dblp.org/rec/conf/civr/FengM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sensys/YanGM08,
author = {Tingxin Yan and
Deepak Ganesan and
R. Manmatha},
editor = {Tarek F. Abdelzaher and
Margaret Martonosi and
Adam Wolisz},
title = {Distributed image search in camera sensor networks},
booktitle = {Proceedings of the 6th International Conference on Embedded Networked
Sensor Systems, SenSys 2008, Raleigh, NC, USA, November 5-7, 2008},
pages = {155--168},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1460412.1460428},
doi = {10.1145/1460412.1460428},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sensys/YanGM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/wiley/Manmatha08,
author = {R. Manmatha},
editor = {Benjamin W. Wah},
title = {Document Image Analysis and Recognition},
booktitle = {Wiley Encyclopedia of Computer Science and Engineering},
publisher = {John Wiley {\&} Sons, Inc.},
year = {2008},
url = {https://doi.org/10.1002/9780470050118.ecse667},
doi = {10.1002/9780470050118.ECSE667},
timestamp = {Tue, 16 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/reference/wiley/Manmatha08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdar/KornfieldMA07,
author = {E. Micah Kornfield and
R. Manmatha and
James Allan},
title = {Further explorations in text alignment with handwritten documents},
journal = {Int. J. Document Anal. Recognit.},
volume = {10},
number = {1},
pages = {39--52},
year = {2007},
url = {https://doi.org/10.1007/s10032-006-0019-8},
doi = {10.1007/S10032-006-0019-8},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijdar/KornfieldMA07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdar/RathM07,
author = {Toni M. Rath and
R. Manmatha},
title = {Word spotting for historical documents},
journal = {Int. J. Document Anal. Recognit.},
volume = {9},
number = {2-4},
pages = {139--152},
year = {2007},
url = {https://doi.org/10.1007/s10032-006-0027-8},
doi = {10.1007/S10032-006-0027-8},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijdar/RathM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdar/RathM07a,
author = {Toni M. Rath and
R. Manmatha},
title = {Word spotting for historical documents},
journal = {Int. J. Document Anal. Recognit.},
volume = {9},
number = {2-4},
pages = {299},
year = {2007},
url = {https://doi.org/10.1007/s10032-006-0035-8},
doi = {10.1007/S10032-006-0035-8},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijdar/RathM07a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/accv/KumarJM07,
author = {Anand Kumar and
C. V. Jawahar and
R. Manmatha},
editor = {Yasushi Yagi and
Sing Bing Kang and
In{-}So Kweon and
Hongbin Zha},
title = {Efficient Search in Document Image Collections},
booktitle = {Computer Vision - {ACCV} 2007, 8th Asian Conference on Computer Vision,
Tokyo, Japan, November 18-22, 2007, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {4843},
pages = {586--595},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-76386-4\_55},
doi = {10.1007/978-3-540-76386-4\_55},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/accv/KumarJM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/das/RothfederMR06,
author = {Jamie L. Rothfeder and
R. Manmatha and
Toni M. Rath},
editor = {Horst Bunke and
A. Lawrence Spitz},
title = {Aligning Transcripts to Automatically Segmented Handwritten Manuscripts},
booktitle = {Document Analysis Systems VII, 7th International Workshop, {DAS} 2006,
Nelson, New Zealand, February 13-15, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3872},
pages = {84--95},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11669487\_8},
doi = {10.1007/11669487\_8},
timestamp = {Tue, 14 May 2019 10:00:52 +0200},
biburl = {https://dblp.org/rec/conf/das/RothfederMR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dial/FengMM06,
author = {Shaolei Feng and
R. Manmatha and
Andrew McCallum},
title = {Exploring the Use of Conditional Random Field Models and HMMs for
Historical Handwritten Document Recognition},
booktitle = {Second International Workshop on Document Image Analysis for Libraries
{(DIAL} 2006), 27-28 April 2006, Lyon, France},
pages = {30--37},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/DIAL.2006.19},
doi = {10.1109/DIAL.2006.19},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dial/FengMM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dmin/XieNRH06,
author = {Ying Xie and
Manmathasivaram Nagarajan and
Vijay V. Raghavan and
Hisham Haddad},
editor = {Sven F. Crone and
Stefan Lessmann and
Robert Stahlbock},
title = {On Novelty Evaluation of Potentially Useful Patterns},
booktitle = {Proceedings of the 2006 International Conference on Data Mining, {DMIN}
2006, Las Vegas, Nevada, USA, June 26-29, 2006},
pages = {211--217},
publisher = {{CSREA} Press},
year = {2006},
timestamp = {Mon, 28 Sep 2015 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dmin/XieNRH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jcdl/FengM06,
author = {Shaolei Feng and
R. Manmatha},
editor = {Gary Marchionini and
Michael L. Nelson and
Catherine C. Marshall},
title = {A hierarchical, HMM-based automatic evaluation of {OCR} accuracy for
a digital library of books},
booktitle = {{ACM/IEEE} Joint Conference on Digital Libraries, {JCDL} 2006, Chapel
Hill, NC, USA, June 11-15, 2006, Proceedings},
pages = {109--118},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1141753.1141776},
doi = {10.1145/1141753.1141776},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/jcdl/FengM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/ManmathaR05,
author = {R. Manmatha and
Jamie L. Rothfeder},
title = {A Scale Space Approach for Automatically Segmenting Words from Historical
Handwritten Documents},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {27},
number = {8},
pages = {1212--1225},
year = {2005},
url = {https://doi.org/10.1109/TPAMI.2005.150},
doi = {10.1109/TPAMI.2005.150},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pami/ManmathaR05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ManmathaRH05,
author = {Raghavan Manmatha and
Stefan M. R{\"{u}}ger and
Alexander G. Hauptmann},
title = {Multimedia information retrieval: workshop report},
journal = {{SIGIR} Forum},
volume = {39},
number = {2},
pages = {40--41},
year = {2005},
url = {https://doi.org/10.1145/1113343.1113352},
doi = {10.1145/1113343.1113352},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ManmathaRH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/civr/MohantyRLM05,
author = {Natasha Mohanty and
Toni M. Rath and
Audrey Lee and
R. Manmatha},
editor = {Wee Kheng Leow and
Michael S. Lew and
Tat{-}Seng Chua and
Wei{-}Ying Ma and
Lekha Chaisorn and
Erwin M. Bakker},
title = {Learning Shapes for Image Classification and Retrieval},
booktitle = {Image and Video Retrieval, 4th International Conference, {CIVR} 2005,
Singapore, July 20-22, 2005, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3568},
pages = {589--598},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11526346\_62},
doi = {10.1007/11526346\_62},
timestamp = {Tue, 14 May 2019 10:00:44 +0200},
biburl = {https://dblp.org/rec/conf/civr/MohantyRLM05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/ChangMC05,
author = {Shih{-}Fu Chang and
R. Manmatha and
Tat{-}Seng Chua},
title = {Combining text and audio-visual features in video indexing},
booktitle = {2005 {IEEE} International Conference on Acoustics, Speech, and Signal
Processing, {ICASSP} '05, Philadelphia, Pennsylvania, USA, March 18-23,
2005},
pages = {1005--1008},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/ICASSP.2005.1416476},
doi = {10.1109/ICASSP.2005.1416476},
timestamp = {Mon, 22 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/ChangMC05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/FengM05,
author = {Shaolei Feng and
Raghavan Manmatha},
title = {Classification Models for Historical Manuscript Recognition},
booktitle = {Eighth International Conference on Document Analysis and Recognition
{(ICDAR} 2005), 29 August - 1 September 2005, Seoul, Korea},
pages = {528--532},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ICDAR.2005.73},
doi = {10.1109/ICDAR.2005.73},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdar/FengM05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/IyengarDFIKKKMNPPV05,
author = {Giridharan Iyengar and
Pinar Duygulu and
Shaolei Feng and
Pavel Ircing and
Sanjeev Khudanpur and
Dietrich Klakow and
M. R. Krause and
Raghavan Manmatha and
Harriet J. Nock and
D. Petkova and
Brock Pytlik and
Paola Virga},
editor = {HongJiang Zhang and
Tat{-}Seng Chua and
Ralf Steinmetz and
Mohan S. Kankanhalli and
Lynn Wilcox},
title = {Joint visual-text modeling for automatic retrieval of multimedia documents},
booktitle = {Proceedings of the 13th {ACM} International Conference on Multimedia,
Singapore, November 6-11, 2005},
pages = {21--30},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1101149.1101154},
doi = {10.1145/1101149.1101154},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mm/IyengarDFIKKKMNPPV05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/HoweRM05,
author = {Nicholas R. Howe and
Toni M. Rath and
R. Manmatha},
editor = {Ricardo A. Baeza{-}Yates and
Nivio Ziviani and
Gary Marchionini and
Alistair Moffat and
John Tait},
title = {Boosted decision trees for word recognition in handwritten document
retrieval},
booktitle = {{SIGIR} 2005: Proceedings of the 28th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, Salvador,
Brazil, August 15-19, 2005},
pages = {377--383},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1076034.1076099},
doi = {10.1145/1076034.1076099},
timestamp = {Tue, 06 Nov 2018 11:07:23 +0100},
biburl = {https://dblp.org/rec/conf/sigir/HoweRM05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/civr/JeonM04,
author = {Jiwoon Jeon and
R. Manmatha},
title = {Using Maximum Entropy for Automatic Image Annotation},
booktitle = {Image and Video Retrieval: Third International Conference, {CIVR}
2004, Dublin, Ireland, July 21-23, 2004. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3115},
pages = {24--32},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-27814-6\_7},
doi = {10.1007/978-3-540-27814-6\_7},
timestamp = {Tue, 14 May 2019 10:00:44 +0200},
biburl = {https://dblp.org/rec/conf/civr/JeonM04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/civr/MetzlerM04,
author = {Donald Metzler and
R. Manmatha},
title = {An Inference Network Approach to Image Retrieval},
booktitle = {Image and Video Retrieval: Third International Conference, {CIVR}
2004, Dublin, Ireland, July 21-23, 2004. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3115},
pages = {42--50},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-27814-6\_9},
doi = {10.1007/978-3-540-27814-6\_9},
timestamp = {Tue, 23 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/civr/MetzlerM04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/FengML04,
author = {Shaolei Feng and
Raghavan Manmatha and
Victor Lavrenko},
title = {Multiple Bernoulli Relevance Models for Image and Video Annotation},
booktitle = {2004 {IEEE} Computer Society Conference on Computer Vision and Pattern
Recognition {(CVPR} 2004), with CD-ROM, 27 June - 2 July 2004, Washington,
DC, {USA}},
pages = {1002--1009},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.ieeecomputersociety.org/10.1109/CVPR.2004.171},
doi = {10.1109/CVPR.2004.171},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/FengML04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dial/KornfieldMA04,
author = {E. Micah Kornfield and
R. Manmatha and
James Allan},
title = {Text Alignment with Handwritten Documents},
booktitle = {1st International Workshop on Document Image Analysis for Libraries
{(DIAL} 2004), 23-24 January 2004, Palo Alto, CA, {USA}},
pages = {195--211},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/DIAL.2004.1263249},
doi = {10.1109/DIAL.2004.1263249},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dial/KornfieldMA04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dial/LavrenkoRM04,
author = {Victor Lavrenko and
Toni M. Rath and
R. Manmatha},
title = {Holistic Word Recognition for Handwritten Historical Documents},
booktitle = {1st International Workshop on Document Image Analysis for Libraries
{(DIAL} 2004), 23-24 January 2004, Palo Alto, CA, {USA}},
pages = {278--287},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/DIAL.2004.1263256},
doi = {10.1109/DIAL.2004.1263256},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dial/LavrenkoRM04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/LavrenkoFM04,
author = {Victor Lavrenko and
Shaolei Feng and
Raghavan Manmatha},
title = {Statistical models for automatic video annotation and retrieval},
booktitle = {2004 {IEEE} International Conference on Acoustics, Speech, and Signal
Processing, {ICASSP} 2004, Montreal, Quebec, Canada, May 17-21, 2004},
pages = {1044--1047},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/ICASSP.2004.1326727},
doi = {10.1109/ICASSP.2004.1326727},
timestamp = {Mon, 22 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/LavrenkoFM04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/RathML04,
author = {Toni M. Rath and
R. Manmatha and
Victor Lavrenko},
editor = {Mark Sanderson and
Kalervo J{\"{a}}rvelin and
James Allan and
Peter Bruza},
title = {A search engine for historical manuscript images},
booktitle = {{SIGIR} 2004: Proceedings of the 27th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, Sheffield,
UK, July 25-29, 2004},
pages = {369--376},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/1008992.1009056},
doi = {10.1145/1008992.1009056},
timestamp = {Tue, 06 Nov 2018 11:07:22 +0100},
biburl = {https://dblp.org/rec/conf/sigir/RathML04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003},
url = {https://doi.org/10.1145/945546.945549},
doi = {10.1145/945546.945549},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/RathM03,
author = {Toni M. Rath and
R. Manmatha},
title = {Word Image Matching Using Dynamic Time Warping},
booktitle = {2003 {IEEE} Computer Society Conference on Computer Vision and Pattern
Recognition {(CVPR} 2003), 16-22 June 2003, Madison, WI, {USA}},
pages = {521--527},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/CVPR.2003.1211511},
doi = {10.1109/CVPR.2003.1211511},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/RathM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/RathM03,
author = {Toni M. Rath and
R. Manmatha},
title = {Features for Word Spotting in Historical Manuscripts},
booktitle = {7th International Conference on Document Analysis and Recognition
{(ICDAR} 2003), 2-Volume Set, 3-6 August 2003, Edinburgh, Scotland,
{UK}},
pages = {218--222},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/ICDAR.2003.1227662},
doi = {10.1109/ICDAR.2003.1227662},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdar/RathM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnp/HannaLM03,
author = {Katrina M. Hanna and
Brian Neil Levine and
R. Manmatha},
title = {Mobile Distributed Information Retrieval for Highly-Partitioned Networks},
booktitle = {11th {IEEE} International Conference on Network Protocols {(ICNP}
2003), 4-7 November 2003, Atlanta, GA, {USA}},
pages = {38},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/ICNP.2003.1249755},
doi = {10.1109/ICNP.2003.1249755},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icnp/HannaLM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LavrenkoMJ03,
author = {Victor Lavrenko and
R. Manmatha and
Jiwoon Jeon},
editor = {Sebastian Thrun and
Lawrence K. Saul and
Bernhard Sch{\"{o}}lkopf},
title = {A Model for Learning the Semantics of Pictures},
booktitle = {Advances in Neural Information Processing Systems 16 [Neural Information
Processing Systems, {NIPS} 2003, December 8-13, 2003, Vancouver and
Whistler, British Columbia, Canada]},
pages = {553--560},
publisher = {{MIT} Press},
year = {2003},
url = {https://proceedings.neurips.cc/paper/2003/hash/0bf727e907c5fc9d5356f11e4c45d613-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/LavrenkoMJ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/JeonLM03,
author = {Jiwoon Jeon and
Victor Lavrenko and
R. Manmatha},
editor = {Charles L. A. Clarke and
Gordon V. Cormack and
Jamie Callan and
David Hawking and
Alan F. Smeaton},
title = {Automatic image annotation and retrieval using cross-media relevance
models},
booktitle = {{SIGIR} 2003: Proceedings of the 26th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, July
28 - August 1, 2003, Toronto, Canada},
pages = {119--126},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/860435.860459},
doi = {10.1145/860435.860459},
timestamp = {Tue, 06 Nov 2018 11:07:23 +0100},
biburl = {https://dblp.org/rec/conf/sigir/JeonLM03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/ManmathaFA02,
author = {R. Manmatha and
Ao Feng and
James Allan},
editor = {Kalervo J{\"{a}}rvelin and
Micheline Beaulieu and
Ricardo A. Baeza{-}Yates and
Sung{-}Hyon Myaeng},
title = {A critical examination of TDT's cost function},
booktitle = {{SIGIR} 2002: Proceedings of the 25th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, August
11-15, 2002, Tampere, Finland},
pages = {403--404},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/564376.564465},
doi = {10.1145/564376.564465},
timestamp = {Wed, 07 Nov 2018 14:52:44 +0100},
biburl = {https://dblp.org/rec/conf/sigir/ManmathaFA02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/DasM01,
author = {Madirakshi Das and
R. Manmatha},
title = {Automatic Segmentation and Indexing in a Database of Bird Images},
booktitle = {Proceedings of the Eighth International Conference On Computer Vision
(ICCV-01), Vancouver, British Columbia, Canada, July 7-14, 2001 -
Volume 2},
pages = {351--358},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/ICCV.2001.937647},
doi = {10.1109/ICCV.2001.937647},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccv/DasM01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/ManmathaRF01,
author = {R. Manmatha and
Toni M. Rath and
Fangfang Feng},
editor = {W. Bruce Croft and
David J. Harper and
Donald H. Kraft and
Justin Zobel},
title = {Modeling Score Distributions for Combining the Outputs of Search Engines},
booktitle = {{SIGIR} 2001: Proceedings of the 24th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, September
9-13, 2001, New Orleans, Louisiana, {USA}},
pages = {267--275},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/383952.384005},
doi = {10.1145/383952.384005},
timestamp = {Tue, 06 Nov 2018 11:07:24 +0100},
biburl = {https://dblp.org/rec/conf/sigir/ManmathaRF01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/expert/DasMR99,
author = {Madirakshi Das and
R. Manmatha and
Edward M. Riseman},
title = {Indexing Flower Patent Images Using Domain Knowledge},
journal = {{IEEE} Intell. Syst.},
volume = {14},
number = {5},
pages = {24--33},
year = {1999},
url = {https://doi.org/10.1109/5254.796084},
doi = {10.1109/5254.796084},
timestamp = {Fri, 06 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/expert/DasMR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/WuMR99,
author = {Victor Wu and
R. Manmatha and
Edward M. Riseman},
title = {TextFinder: An Automatic System to Detect and Recognize Text In Images},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {21},
number = {11},
pages = {1224--1229},
year = {1999},
url = {https://doi.org/10.1109/34.809116},
doi = {10.1109/34.809116},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pami/WuMR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SrihariZMR99,
author = {Rohini K. Srihari and
Zhongfei Zhang and
R. Manmatha and
Chandu Ravela},
title = {Indexing and Retrieval, SIGIR'99 Workshop Summary},
journal = {{SIGIR} Forum},
volume = {33},
number = {1},
pages = {34--35},
year = {1999},
url = {https://doi.org/10.1145/331403.331412},
doi = {10.1145/331403.331412},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SrihariZMR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scalespace/ManmathaS99,
author = {R. Manmatha and
Nitin Srimal},
editor = {Mads Nielsen and
Peter Johansen and
Ole Fogh Olsen and
Joachim Weickert},
title = {Scale Space Technique for Word Segmentation in Handwritten Documents},
booktitle = {Scale-Space Theories in Computer Vision, Second International Conference,
Scale-Space'99, Corfu, Greece, September 26-27, 1999, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1682},
pages = {22--33},
publisher = {Springer},
year = {1999},
url = {https://doi.org/10.1007/3-540-48236-9\_3},
doi = {10.1007/3-540-48236-9\_3},
timestamp = {Tue, 14 May 2019 10:00:52 +0200},
biburl = {https://dblp.org/rec/conf/scalespace/ManmathaS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SrihariZMR98,
author = {Rohini K. Srihari and
Zhongfei Zhang and
R. Manmatha and
Chandu Ravela},
title = {Multimedia Indexing and Retrieval, Summary Report},
journal = {{SIGIR} Forum},
volume = {32},
number = {2},
pages = {29--30},
year = {1998},
url = {https://doi.org/10.1145/305110.305130},
doi = {10.1145/305110.305130},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SrihariZMR98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/drr/WuM98,
author = {Victor Wu and
Raghavan Manmatha},
editor = {Daniel P. Lopresti and
Jiangying Zhou},
title = {Document image cleanup and binarization},
booktitle = {Document Recognition V, San Jose, CA, USA, January 24, 1998},
series = {{SPIE} Proceedings},
volume = {3305},
pages = {263},
publisher = {{SPIE}},
year = {1998},
url = {https://doi.org/10.1117/12.304638},
doi = {10.1117/12.304638},
timestamp = {Wed, 24 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/drr/WuM98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hvei/ManmathaRC98,
author = {Raghavan Manmatha and
S. Chandu Ravela and
Y. Chitti},
editor = {Bernice E. Rogowitz and
Thrasyvoulos N. Pappas},
title = {Computing local and global similarity in images},
booktitle = {Human Vision and Electronic Imaging III, San Jose, CA, USA, January
24, 1998},
series = {{SPIE} Proceedings},
volume = {3299},
pages = {540--551},
publisher = {{SPIE}},
year = {1998},
url = {https://doi.org/10.1117/12.320145},
doi = {10.1117/12.320145},
timestamp = {Sun, 21 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hvei/ManmathaRC98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/RavelaM98,
author = {Srinivas Ravela and
R. Manmatha},
title = {Retrieving Images by Appearance},
booktitle = {Proceedings of the Sixth International Conference on Computer Vision
(ICCV-98), Bombay, India, January 4-7, 1998},
pages = {608--613},
publisher = {{IEEE} Computer Society},
year = {1998},
url = {https://doi.org/10.1109/ICCV.1998.710780},
doi = {10.1109/ICCV.1998.710780},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccv/RavelaM98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/DasMR98,
author = {Madirakshi Das and
Raghavan Manmatha and
Edward M. Riseman},
title = {Indexing flowers by color names using domain knowledge-driven segmentation},
booktitle = {Proceedings Fourth {IEEE} Workshop on Applications of Computer Vision,
{WACV} 1998, October 19-21, 1998, Princeton, New Jersey, {USA}},
pages = {94--99},
publisher = {{IEEE} Computer Society},
year = {1998},
url = {https://doi.org/10.1109/ACV.1998.732864},
doi = {10.1109/ACV.1998.732864},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wacv/DasMR98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/RavelaM98,
author = {Srinivas Ravela and
Raghavan Manmatha},
title = {On computing global similarity in images},
booktitle = {Proceedings Fourth {IEEE} Workshop on Applications of Computer Vision,
{WACV} 1998, October 19-21, 1998, Princeton, New Jersey, {USA}},
pages = {82--87},
publisher = {{IEEE} Computer Society},
year = {1998},
url = {https://doi.org/10.1109/ACV.1998.732862},
doi = {10.1109/ACV.1998.732862},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wacv/RavelaM98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dl/WuMR97,
author = {Victor Wu and
R. Manmatha and
Edward M. Riseman},
title = {Finding Text in Images},
booktitle = {Proceedings of the 2nd {ACM} International Conference on Digital Libraries,
July 25-28, 1997, Philadelphia, PA, {USA}},
pages = {3--12},
publisher = {{ACM}},
year = {1997},
url = {https://doi.org/10.1145/263690.263766},
doi = {10.1145/263690.263766},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dl/WuMR97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hvei/ManmathaR97,
author = {Raghavan Manmatha and
S. Chandu Ravela},
editor = {Bernice E. Rogowitz and
Thrasyvoulos N. Pappas},
title = {Syntactic characterization of appearance and its application to image
retrieval},
booktitle = {Human Vision and Electronic Imaging II, San Jose, CA, USA, February
8, 1997},
series = {{SPIE} Proceedings},
volume = {3016},
pages = {484--495},
publisher = {{SPIE}},
year = {1997},
url = {https://doi.org/10.1117/12.274546},
doi = {10.1117/12.274546},
timestamp = {Sun, 21 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hvei/ManmathaR97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/RavelaM97,
author = {Srinivas Ravela and
R. Manmatha},
editor = {Nicholas J. Belkin and
Arcot Desai Narasimhalu and
Peter Willett and
William R. Hersh and
Fazli Can and
Ellen M. Voorhees},
title = {Image Retrieval by Appearance},
booktitle = {{SIGIR} '97: Proceedings of the 20th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, July
27-31, 1997, Philadelphia, PA, {USA}},
pages = {278--285},
publisher = {{ACM}},
year = {1997},
url = {https://doi.org/10.1145/258525.258589},
doi = {10.1145/258525.258589},
timestamp = {Tue, 19 Sep 2023 11:58:25 +0200},
biburl = {https://dblp.org/rec/conf/sigir/RavelaM97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ManmathaHR96,
author = {R. Manmatha and
Chengfeng Han and
Edward M. Riseman},
title = {Word Spotting: {A} New Approach to Indexing Handwriting},
booktitle = {1996 Conference on Computer Vision and Pattern Recognition {(CVPR}
'96), June 18-20, 1996 San Francisco, CA, {USA}},
pages = {631--637},
publisher = {{IEEE} Computer Society},
year = {1996},
url = {https://doi.org/10.1109/CVPR.1996.517139},
doi = {10.1109/CVPR.1996.517139},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/ManmathaHR96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dl/ManmathaHRC96,
author = {R. Manmatha and
Chengfeng Han and
Edward M. Riseman and
W. Bruce Croft},
title = {Indexing Handwriting Using Word Matching},
booktitle = {Proceedings of the 1st {ACM} International Conference on Digital Libraries,
March 20-23, 1996, Bethesda, Maryland, {USA}},
pages = {151--159},
publisher = {{ACM}},
year = {1996},
url = {https://doi.org/10.1145/226931.226960},
doi = {10.1145/226931.226960},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dl/ManmathaHRC96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/RavelaMR96,
author = {Srinivas Ravela and
R. Manmatha and
Edward M. Riseman},
editor = {Bernard F. Buxton and
Roberto Cipolla},
title = {Image Retrieval Using Scale-Space Matching},
booktitle = {Computer Vision - ECCV'96, 4th European Conference on Computer Vision,
Cambridge, UK, April 15-18, 1996, Proceedings, Volume {I}},
series = {Lecture Notes in Computer Science},
volume = {1064},
pages = {273--282},
publisher = {Springer},
year = {1996},
url = {https://doi.org/10.1007/BFb0015543},
doi = {10.1007/BFB0015543},
timestamp = {Tue, 14 May 2019 10:00:45 +0200},
biburl = {https://dblp.org/rec/conf/eccv/RavelaMR96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/Manmatha94,
author = {R. Manmatha},
title = {A framework for recovering affine transforms using points, lines or
image brightnesses},
booktitle = {Conference on Computer Vision and Pattern Recognition, {CVPR} 1994,
21-23 June, 1994, Seattle, WA, {USA}},
pages = {141--146},
publisher = {{IEEE}},
year = {1994},
url = {https://doi.org/10.1109/CVPR.1994.323821},
doi = {10.1109/CVPR.1994.323821},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/Manmatha94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/Manmatha94,
author = {R. Manmatha},
editor = {Jan{-}Olof Eklundh},
title = {Measuring the Affine Transform Using Gaussian Filters},
booktitle = {Computer Vision - ECCV'94, Third European Conference on Computer Vision,
Stockholm, Sweden, May 2-6, 1994, Proceedings, Volume {II}},
series = {Lecture Notes in Computer Science},
volume = {801},
pages = {159--164},
publisher = {Springer},
year = {1994},
url = {https://doi.org/10.1007/BFb0028346},
doi = {10.1007/BFB0028346},
timestamp = {Tue, 14 May 2019 10:00:45 +0200},
biburl = {https://dblp.org/rec/conf/eccv/Manmatha94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ManmathaO93,
author = {Raghavan Manmatha and
John Oliensis},
title = {Extracting affine deformations from image patches. I. Finding scale
and rotation},
booktitle = {Conference on Computer Vision and Pattern Recognition, {CVPR} 1993,
15-17 June, 1993, New York, NY, {USA}},
pages = {754--755},
publisher = {{IEEE}},
year = {1993},
url = {https://doi.org/10.1109/CVPR.1993.341158},
doi = {10.1109/CVPR.1993.341158},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/ManmathaO93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/DuttaMWR89,
author = {Rabindranath Dutta and
R. Manmatha and
Lance R. Williams and
Edward M. Riseman},
title = {A data set for quantitative motion analysis},
booktitle = {{IEEE} Computer Society Conference on Computer Vision and Pattern
Recognition, {CVPR} 1989, 4-8 June, 1989, San Diego, CA, {USA}},
pages = {159--164},
publisher = {{IEEE}},
year = {1989},
url = {https://doi.org/10.1109/CVPR.1989.37844},
doi = {10.1109/CVPR.1989.37844},
timestamp = {Tue, 30 Mar 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/DuttaMWR89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-07-09 17:46 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
