default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Philip A. Lewis"
download as .bib file
@article{DBLP:journals/firstmonday/SchmidtLPID24,
author = {Gordon B. Schmidt and
Alexander Lewis and
Jestine Philip and
Sayeedul Islam and
Stephanie Van Dellen},
title = {An application of the {ASOA} framework in gig worker social media
usage},
journal = {First Monday},
volume = {29},
number = {9},
year = {2024},
url = {https://doi.org/10.5210/fm.v29i9.13575},
doi = {10.5210/FM.V29I9.13575},
timestamp = {Thu, 19 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/firstmonday/SchmidtLPID24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/LewisSLTMODGXPS24,
author = {Makayla Lewis and
Miriam Sturdee and
Denise Lengyel and
Mauro Toselli and
John Miers and
Violet Owen and
Josh Urban Davis and
Swen E. Gaudl and
Lanxi Xiao and
Ernesto Priego and
Kim Snooks and
Laia Turmo Vidal and
Eli Blevis and
Nicola Privato and
Patricia Piedade and
Corey J. Ford and
Nick Bryan{-}Kinns and
Beatriz Severes and
Kirsikka Kaipainen and
Caroline Claisse and
Raksanda Mehnaz Huq and
Mirjam Palosaari Eladhari and
Anna Troisi and
Ana O. Henriques and
Ar Grek and
Gareth McMurchy and
Ray LC and
Sara Nabil and
Jacinta Jardine and
Robert Collins and
Andrey Vlasov and
Yana Knight and
Michele Cremaschi and
Silvia Carderelli{-}Gronau and
Claudia N{\'{u}}{\~{n}}ez{-}Pacheco and
Gisela Reyes{-}Cruz and
Jean{-}Philippe Rivi{\`{e}}re},
editor = {Florian 'Floyd' Mueller and
Penny Kyburz and
Julie R. Williamson and
Corina Sas},
title = {Traveling Arts x {HCI} Sketchbook: Exploring the Intersection Between
Artistic Expression and Human-Computer Interaction},
booktitle = {Extended Abstracts of the {CHI} Conference on Human Factors in Computing
Systems, {CHI} {EA} 2024, Honolulu, HI, USA, May 11-16, 2024},
pages = {568:1--568:14},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3613905.3644069},
doi = {10.1145/3613905.3644069},
timestamp = {Mon, 24 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/LewisSLTMODGXPS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-07510,
author = {Sumeet Ramesh Motwani and
Mikhail Baranchuk and
Martin Strohmeier and
Vijay Bolina and
Philip H. S. Torr and
Lewis Hammond and
Christian Schr{\"{o}}der de Witt},
title = {Secret Collusion Among Generative {AI} Agents},
journal = {CoRR},
volume = {abs/2402.07510},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.07510},
doi = {10.48550/ARXIV.2402.07510},
eprinttype = {arXiv},
eprint = {2402.07510},
timestamp = {Mon, 19 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-07510.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-12025,
author = {Stephen R. Pfohl and
Heather Cole{-}Lewis and
Rory Sayres and
Darlene Neal and
Mercy Nyamewaa Asiedu and
Awa Dieng and
Nenad Tomasev and
Qazi Mamunur Rashid and
Shekoofeh Azizi and
Negar Rostamzadeh and
Liam G. McCoy and
Leo Anthony Celi and
Yun Liu and
Mike Schaekermann and
Alanna Walton and
Alicia Parrish and
Chirag Nagpal and
Preeti Singh and
Akeiylah Dewitt and
Philip Andrew Mansfield and
Sushant Prakash and
Katherine A. Heller and
Alan Karthikesalingam and
Christopher Semturs and
Joelle K. Barral and
Greg Corrado and
Yossi Matias and
Jamila Smith{-}Loud and
Ivor Horn and
Karan Singhal},
title = {A Toolbox for Surfacing Health Equity Harms and Biases in Large Language
Models},
journal = {CoRR},
volume = {abs/2403.12025},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.12025},
doi = {10.48550/ARXIV.2403.12025},
eprinttype = {arXiv},
eprint = {2403.12025},
timestamp = {Wed, 08 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-12025.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2406-08170,
author = {Philipp Schoenegger and
Spencer Greenberg and
Alexander Grishin and
Joshua Lewis and
Lucius Caviola},
title = {Can {AI} Understand Human Personality? - Comparing Human Experts and
{AI} Systems at Predicting Personality Correlations},
journal = {CoRR},
volume = {abs/2406.08170},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2406.08170},
doi = {10.48550/ARXIV.2406.08170},
eprinttype = {arXiv},
eprint = {2406.08170},
timestamp = {Tue, 09 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2406-08170.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/BarrisonFRCLBF23,
author = {Philip D. Barrison and
Allen J. Flynn and
Rachel L. Richesson and
Marisa Conte and
Zach Landis{-}Lewis and
Peter Boisvert and
Charles P. Friedman},
title = {Knowledge infrastructure: a priority to accelerate workflow automation
in health care},
journal = {J. Am. Medical Informatics Assoc.},
volume = {30},
number = {6},
pages = {1222--1223},
year = {2023},
url = {https://doi.org/10.1093/jamia/ocad026},
doi = {10.1093/JAMIA/OCAD026},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/BarrisonFRCLBF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/LewisWAFLPG23,
author = {Abigail E. Lewis and
Nicole Gray Weiskopf and
Zachary B. Abrams and
Randi E. Foraker and
Albert M. Lai and
Philip R. O. Payne and
Aditi Gupta},
title = {Electronic health record data quality assessment and tools: a systematic
review},
journal = {J. Am. Medical Informatics Assoc.},
volume = {30},
number = {10},
pages = {1730--1740},
year = {2023},
url = {https://doi.org/10.1093/jamia/ocad120},
doi = {10.1093/JAMIA/OCAD120},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/LewisWAFLPG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmlr/SrivastavaRRSAF23,
author = {Aarohi Srivastava and
Abhinav Rastogi and
Abhishek Rao and
Abu Awal Md Shoeb and
Abubakar Abid and
Adam Fisch and
Adam R. Brown and
Adam Santoro and
Aditya Gupta and
Adri{\`{a}} Garriga{-}Alonso and
Agnieszka Kluska and
Aitor Lewkowycz and
Akshat Agarwal and
Alethea Power and
Alex Ray and
Alex Warstadt and
Alexander W. Kocurek and
Ali Safaya and
Ali Tazarv and
Alice Xiang and
Alicia Parrish and
Allen Nie and
Aman Hussain and
Amanda Askell and
Amanda Dsouza and
Ambrose Slone and
Ameet Rahane and
Anantharaman S. Iyer and
Anders Andreassen and
Andrea Madotto and
Andrea Santilli and
Andreas Stuhlm{\"{u}}ller and
Andrew M. Dai and
Andrew La and
Andrew K. Lampinen and
Andy Zou and
Angela Jiang and
Angelica Chen and
Anh Vuong and
Animesh Gupta and
Anna Gottardi and
Antonio Norelli and
Anu Venkatesh and
Arash Gholamidavoodi and
Arfa Tabassum and
Arul Menezes and
Arun Kirubarajan and
Asher Mullokandov and
Ashish Sabharwal and
Austin Herrick and
Avia Efrat and
Aykut Erdem and
Ayla Karakas and
B. Ryan Roberts and
Bao Sheng Loe and
Barret Zoph and
Bartlomiej Bojanowski and
Batuhan {\"{O}}zyurt and
Behnam Hedayatnia and
Behnam Neyshabur and
Benjamin Inden and
Benno Stein and
Berk Ekmekci and
Bill Yuchen Lin and
Blake Howald and
Bryan Orinion and
Cameron Diao and
Cameron Dour and
Catherine Stinson and
Cedrick Argueta and
C{\`{e}}sar Ferri Ram{\'{\i}}rez and
Chandan Singh and
Charles Rathkopf and
Chenlin Meng and
Chitta Baral and
Chiyu Wu and
Chris Callison{-}Burch and
Chris Waites and
Christian Voigt and
Christopher D. Manning and
Christopher Potts and
Cindy Ramirez and
Clara E. Rivera and
Clemencia Siro and
Colin Raffel and
Courtney Ashcraft and
Cristina Garbacea and
Damien Sileo and
Dan Garrette and
Dan Hendrycks and
Dan Kilman and
Dan Roth and
Daniel Freeman and
Daniel Khashabi and
Daniel Levy and
Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and
Danielle Perszyk and
Danny Hernandez and
Danqi Chen and
Daphne Ippolito and
Dar Gilboa and
David Dohan and
David Drakard and
David Jurgens and
Debajyoti Datta and
Deep Ganguli and
Denis Emelin and
Denis Kleyko and
Deniz Yuret and
Derek Chen and
Derek Tam and
Dieuwke Hupkes and
Diganta Misra and
Dilyar Buzan and
Dimitri Coelho Mollo and
Diyi Yang and
Dong{-}Ho Lee and
Dylan Schrader and
Ekaterina Shutova and
Ekin Dogus Cubuk and
Elad Segal and
Eleanor Hagerman and
Elizabeth Barnes and
Elizabeth Donoway and
Ellie Pavlick and
Emanuele Rodol{\`{a}} and
Emma Lam and
Eric Chu and
Eric Tang and
Erkut Erdem and
Ernie Chang and
Ethan A. Chi and
Ethan Dyer and
Ethan J. Jerzak and
Ethan Kim and
Eunice Engefu Manyasi and
Evgenii Zheltonozhskii and
Fanyue Xia and
Fatemeh Siar and
Fernando Mart{\'{\i}}nez{-}Plumed and
Francesca Happ{\'{e}} and
Fran{\c{c}}ois Chollet and
Frieda Rong and
Gaurav Mishra and
Genta Indra Winata and
Gerard de Melo and
Germ{\'{a}}n Kruszewski and
Giambattista Parascandolo and
Giorgio Mariani and
Gloria Wang and
Gonzalo Jaimovitch{-}L{\'{o}}pez and
Gregor Betz and
Guy Gur{-}Ari and
Hana Galijasevic and
Hannah Kim and
Hannah Rashkin and
Hannaneh Hajishirzi and
Harsh Mehta and
Hayden Bogar and
Henry Shevlin and
Hinrich Sch{\"{u}}tze and
Hiromu Yakura and
Hongming Zhang and
Hugh Mee Wong and
Ian Ng and
Isaac Noble and
Jaap Jumelet and
Jack Geissinger and
Jackson Kernion and
Jacob Hilton and
Jaehoon Lee and
Jaime Fern{\'{a}}ndez Fisac and
James B. Simon and
James Koppel and
James Zheng and
James Zou and
Jan Kocon and
Jana Thompson and
Janelle Wingfield and
Jared Kaplan and
Jarema Radom and
Jascha Sohl{-}Dickstein and
Jason Phang and
Jason Wei and
Jason Yosinski and
Jekaterina Novikova and
Jelle Bosscher and
Jennifer Marsh and
Jeremy Kim and
Jeroen Taal and
Jesse H. Engel and
Jesujoba Alabi and
Jiacheng Xu and
Jiaming Song and
Jillian Tang and
Joan Waweru and
John Burden and
John Miller and
John U. Balis and
Jonathan Batchelder and
Jonathan Berant and
J{\"{o}}rg Frohberg and
Jos Rozen and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Joseph Boudeman and
Joseph Guerr and
Joseph Jones and
Joshua B. Tenenbaum and
Joshua S. Rule and
Joyce Chua and
Kamil Kanclerz and
Karen Livescu and
Karl Krauth and
Karthik Gopalakrishnan and
Katerina Ignatyeva and
Katja Markert and
Kaustubh D. Dhole and
Kevin Gimpel and
Kevin Omondi and
Kory Mathewson and
Kristen Chiafullo and
Ksenia Shkaruta and
Kumar Shridhar and
Kyle McDonell and
Kyle Richardson and
Laria Reynolds and
Leo Gao and
Li Zhang and
Liam Dugan and
Lianhui Qin and
Lidia Contreras Ochando and
Louis{-}Philippe Morency and
Luca Moschella and
Lucas Lam and
Lucy Noble and
Ludwig Schmidt and
Luheng He and
Luis Oliveros Col{\'{o}}n and
Luke Metz and
L{\"{u}}tfi Kerem Senel and
Maarten Bosma and
Maarten Sap and
Maartje ter Hoeve and
Maheen Farooqi and
Manaal Faruqui and
Mantas Mazeika and
Marco Baturan and
Marco Marelli and
Marco Maru and
Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and
Marie Tolkiehn and
Mario Giulianelli and
Martha Lewis and
Martin Potthast and
Matthew L. Leavitt and
Matthias Hagen and
M{\'{a}}ty{\'{a}}s Schubert and
Medina Baitemirova and
Melody Arnaud and
Melvin McElrath and
Michael A. Yee and
Michael Cohen and
Michael Gu and
Michael I. Ivanitskiy and
Michael Starritt and
Michael Strube and
Michal Swedrowski and
Michele Bevilacqua and
Michihiro Yasunaga and
Mihir Kale and
Mike Cain and
Mimee Xu and
Mirac Suzgun and
Mitch Walker and
Mo Tiwari and
Mohit Bansal and
Moin Aminnaseri and
Mor Geva and
Mozhdeh Gheini and
Mukund Varma T. and
Nanyun Peng and
Nathan A. Chi and
Nayeon Lee and
Neta Gur{-}Ari Krakover and
Nicholas Cameron and
Nicholas Roberts and
Nick Doiron and
Nicole Martinez and
Nikita Nangia and
Niklas Deckers and
Niklas Muennighoff and
Nitish Shirish Keskar and
Niveditha Iyer and
Noah Constant and
Noah Fiedel and
Nuan Wen and
Oliver Zhang and
Omar Agha and
Omar Elbaghdadi and
Omer Levy and
Owain Evans and
Pablo Antonio Moreno Casares and
Parth Doshi and
Pascale Fung and
Paul Pu Liang and
Paul Vicol and
Pegah Alipoormolabashi and
Peiyuan Liao and
Percy Liang and
Peter Chang and
Peter Eckersley and
Phu Mon Htut and
Pinyu Hwang and
Piotr Milkowski and
Piyush Patil and
Pouya Pezeshkpour and
Priti Oli and
Qiaozhu Mei and
Qing Lyu and
Qinlang Chen and
Rabin Banjade and
Rachel Etta Rudolph and
Raefer Gabriel and
Rahel Habacker and
Ramon Risco and
Rapha{\"{e}}l Milli{\`{e}}re and
Rhythm Garg and
Richard Barnes and
Rif A. Saurous and
Riku Arakawa and
Robbe Raymaekers and
Robert Frank and
Rohan Sikand and
Roman Novak and
Roman Sitelew and
Ronan LeBras and
Rosanne Liu and
Rowan Jacobs and
Rui Zhang and
Ruslan Salakhutdinov and
Ryan Chi and
Ryan Lee and
Ryan Stovall and
Ryan Teehan and
Rylan Yang and
Sahib Singh and
Saif M. Mohammad and
Sajant Anand and
Sam Dillavou and
Sam Shleifer and
Sam Wiseman and
Samuel Gruetter and
Samuel R. Bowman and
Samuel S. Schoenholz and
Sanghyun Han and
Sanjeev Kwatra and
Sarah A. Rous and
Sarik Ghazarian and
Sayan Ghosh and
Sean Casey and
Sebastian Bischoff and
Sebastian Gehrmann and
Sebastian Schuster and
Sepideh Sadeghi and
Shadi Hamdan and
Sharon Zhou and
Shashank Srivastava and
Sherry Shi and
Shikhar Singh and
Shima Asaadi and
Shixiang Shane Gu and
Shubh Pachchigar and
Shubham Toshniwal and
Shyam Upadhyay and
Shyamolima (Shammie) Debnath and
Siamak Shakeri and
Simon Thormeyer and
Simone Melzi and
Siva Reddy and
Sneha Priscilla Makini and
Soo{-}Hwan Lee and
Spencer Torene and
Sriharsha Hatwar and
Stanislas Dehaene and
Stefan Divic and
Stefano Ermon and
Stella Biderman and
Stephanie Lin and
Stephen Prasad and
Steven T. Piantadosi and
Stuart M. Shieber and
Summer Misherghi and
Svetlana Kiritchenko and
Swaroop Mishra and
Tal Linzen and
Tal Schuster and
Tao Li and
Tao Yu and
Tariq Ali and
Tatsu Hashimoto and
Te{-}Lin Wu and
Th{\'{e}}o Desbordes and
Theodore Rothschild and
Thomas Phan and
Tianle Wang and
Tiberius Nkinyili and
Timo Schick and
Timofei Kornev and
Titus Tunduny and
Tobias Gerstenberg and
Trenton Chang and
Trishala Neeraj and
Tushar Khot and
Tyler Shultz and
Uri Shaham and
Vedant Misra and
Vera Demberg and
Victoria Nyamai and
Vikas Raunak and
Vinay V. Ramasesh and
Vinay Uday Prabhu and
Vishakh Padmakumar and
Vivek Srikumar and
William Fedus and
William Saunders and
William Zhang and
Wout Vossen and
Xiang Ren and
Xiaoyu Tong and
Xinran Zhao and
Xinyi Wu and
Xudong Shen and
Yadollah Yaghoobzadeh and
Yair Lakretz and
Yangqiu Song and
Yasaman Bahri and
Yejin Choi and
Yichi Yang and
Yiding Hao and
Yifu Chen and
Yonatan Belinkov and
Yu Hou and
Yufang Hou and
Yuntao Bai and
Zachary Seid and
Zhuoye Zhao and
Zijian Wang and
Zijie J. Wang and
Zirui Wang and
Ziyi Wu},
title = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities
of language models},
journal = {Trans. Mach. Learn. Res.},
volume = {2023},
year = {2023},
url = {https://openreview.net/forum?id=uyTL5Bvosj},
timestamp = {Tue, 06 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmlr/SrivastavaRRSAF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-09617,
author = {Karan Singhal and
Tao Tu and
Juraj Gottweis and
Rory Sayres and
Ellery Wulczyn and
Le Hou and
Kevin Clark and
Stephen Pfohl and
Heather Cole{-}Lewis and
Darlene Neal and
Mike Schaekermann and
Amy Wang and
Mohamed Amin and
Sami Lachgar and
Philip Andrew Mansfield and
Sushant Prakash and
Bradley Green and
Ewa Dominowska and
Blaise Ag{\"{u}}era y Arcas and
Nenad Tomasev and
Yun Liu and
Renee Wong and
Christopher Semturs and
S. Sara Mahdavi and
Joelle K. Barral and
Dale R. Webster and
Gregory S. Corrado and
Yossi Matias and
Shekoofeh Azizi and
Alan Karthikesalingam and
Vivek Natarajan},
title = {Towards Expert-Level Medical Question Answering with Large Language
Models},
journal = {CoRR},
volume = {abs/2305.09617},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.09617},
doi = {10.48550/ARXIV.2305.09617},
eprinttype = {arXiv},
eprint = {2305.09617},
timestamp = {Tue, 11 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-09617.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-01765,
author = {Jonathan H. Jiang and
Anamaria Berea and
Heather Bowden and
Prithwis Das and
Kristen A. Fahy and
Robert Jew and
Xiaoming Jiang and
Arik Kershenbaum and
David Kipping and
Graham Lau and
Karen Lewis and
C. Isabel Nunez Lendo and
Philip E. Rosen and
Nick Searra and
Stuart F. Taylor and
John Traphagan},
title = {Message in a Bottle - An Update to the Golden Record},
journal = {CoRR},
volume = {abs/2306.01765},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.01765},
doi = {10.48550/ARXIV.2306.01765},
eprinttype = {arXiv},
eprint = {2306.01765},
timestamp = {Mon, 12 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-01765.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ncs/ZhaoWMLWAAAAAAA22,
author = {Jia Zhao and
Gefei Wang and
Jingsi Ming and
Zhixiang Lin and
Yang Wang and
Snigdha Agarwal and
Aditi Agrawal and
Ahmad Al{-}Moujahed and
Alina Alam and
Megan A. Albertelli and
Paul Allegakoen and
Thomas Ambrosi and
Jane Antony and
Steven Artandi and
Fabienne Aujard and
Kyle Awayan and
Ankit Baghel and
Isaac Bakerman and
Trygve E. Bakken and
Jalal Baruni and
Philip Beachy and
Biter Bilen and
Olga B. Botvinnik and
Scott D. Boyd and
Deviana Burhan and
Kerriann M. Casey and
Charles Chan and
Charles A. Chang and
Stephen Chang and
Ming Chen and
Michael F. Clarke and
Sheela Crasta and
Rebecca Culver and
Jessica D'Addabbo and
Spyros Darmanis and
Roozbeh Dehghannasiri and
Song{-}Lin Ding and
Connor V. Duffy and
Jacques Epelbaum and
F. Hern{\'{a}}n Espinoza and
Camille Ezran and
Jean Farup and
James E. Ferrell Jr and
Hannah K. Frank and
Margaret Fuller and
Astrid Gillich and
Elias Godoy and
Dita Gratzinger and
Lisbeth A. Guethlein and
Yan Hang and
Kazuteru Hasegawa and
Rebecca D. Hodge and
Malachia Hoover and
Franklin W. Huang and
Kerwyn Casey Huang and
Shelly Huynh and
Taichi Isobe and
Carly Israel and
Sori Jang and
Qiuyu Jing and
Robert C. Jones and
Jengmin Kang and
Caitlin J. Karanewsky and
Jim Karkanias and
Justus Kebschull and
Aaron Kershner and
Lily Kim and
Seung K. Kim and
E. Christopher Kirk and
Winston Koh and
Silvana Konermann and
William Kong and
Mark A. Krasnow and
Christin Kuo and
Corinne Lautier and
Song Eun Lee and
Ed S. Lein and
Rebecca Lewis and
Peng Li and
Shengda Lin and
Shixuan Liu and
Yin Liu and
Gabriel Loeb and
Jonathan Z. Long and
Wan{-}Jin Lu and
Katherine Lucot and
Liqun Luo and
Aaron McGeever and
Ross Metzger and
Jingsi Ming and
Thomas J. Montine and
Antoine de Morree and
Maurizio Morri and
Karim Mrouj and
Shravani Mukherjee and
Ahmad Nabhan and
Saba Nafees and
Norma Neff and
Patrick Neuh{\"{o}}fer and
Patricia Nguyen and
Jennifer Okamoto and
Julia Eve Olivieri and
Youcef Ouadah and
Honor Paine and
Peter Parham and
Jozeph L. Pendleton and
Lolita Penland and
Martine Perret and
Angela Oliveira Pisco and
Zhen Qi and
Stephen R. Quake and
Ute Radespiel and
Thomas A. Rando and
Hajanirina No{\"{e}}line Ravelonjanahary and
Andriamahery Razafindrakoto and
Julia Salzman and
Nicholas Schaum and
Robert Schopler and
Bronwyn Scott and
Liza Shapiro and
Hosu Sin and
Rahul Sinha and
Rene Sit and
Geoff Stanley and
Lubert Stryer and
Varun Ramanan Subramaniam and
Aditi Swarup and
Weilun Tan and
Alexander Tarashansky and
Aris Taychameekiatchai and
J{\'{e}}r{\'{e}}my Terrien and
Kyle J. Travaglini and
Andoni Urtasun and
Sivakamasundari and
Avin Veerakumar and
Venkata Naga Pranathi Vemuri and
Jean{-}Michel Verdier and
Iwijn De Vlaminck and
Douglas Vollrath and
Bo Wang and
Bruce Wang and
Gefei Wang and
Michael F. Z. Wang and
Sheng Wang and
James Webber and
Hannah Weinstein and
Irving L. Weissman and
Amanda L. Wiggenhorn and
Cathy V. Williams and
Patricia Wright and
Albert Y. Wu and
Angela Ruohao Wu and
Tony Wyss{-}Coray and
Bao Xiang and
Jia Yan and
Can Yang and
Jinxurong Yang and
Anne D. Yoder and
Brian Yu and
Andrea R. Yung and
Yue Zhang and
Jia Zhao and
Zicheng Zhao},
title = {Adversarial domain translation networks for integrating large-scale
atlas-level single-cell datasets},
journal = {Nat. Comput. Sci.},
volume = {2},
number = {5},
pages = {317--330},
year = {2022},
url = {https://doi.org/10.1038/s43588-022-00251-y},
doi = {10.1038/S43588-022-00251-Y},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ncs/ZhaoWMLWAAAAAAA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccnc/BanerjeeRSLBB22,
author = {Vijay Banerjee and
Ryan Rabinowitz and
Mark Stidd and
Rory A. Lewis and
Philip N. Brown and
Gedare Bloom},
title = {The Tragedy of the Miners},
booktitle = {19th {IEEE} Annual Consumer Communications {\&} Networking Conference,
{CCNC} 2022, Las Vegas, NV, USA, January 8-11, 2022},
pages = {760--765},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/CCNC49033.2022.9700705},
doi = {10.1109/CCNC49033.2022.9700705},
timestamp = {Mon, 24 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ccnc/BanerjeeRSLBB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdm/MalottLW22,
author = {Nicholas O. Malott and
Robert R. Lewis and
Philip A. Wilsey},
editor = {Xingquan Zhu and
Sanjay Ranka and
My T. Thai and
Takashi Washio and
Xindong Wu},
title = {Homology-Separating Triangulated Euler Characteristic Curve},
booktitle = {{IEEE} International Conference on Data Mining, {ICDM} 2022, Orlando,
FL, USA, November 28 - Dec. 1, 2022},
pages = {1089--1094},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICDM54844.2022.00136},
doi = {10.1109/ICDM54844.2022.00136},
timestamp = {Thu, 02 Feb 2023 13:50:02 +0100},
biburl = {https://dblp.org/rec/conf/icdm/MalottLW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/BethgeHGKCOS22,
author = {David Bethge and
Philipp Hallgarten and
Tobias Grosse{-}Puppendahl and
Mohamed Kari and
Lewis L. Chuang and
Ozan {\"{O}}zdenizci and
Albrecht Schmidt},
title = {EEG2Vec: Learning Affective {EEG} Representations via Variational
Autoencoders},
booktitle = {{IEEE} International Conference on Systems, Man, and Cybernetics,
{SMC} 2022, Prague, Czech Republic, October 9-12, 2022},
pages = {3150--3157},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/SMC53654.2022.9945517},
doi = {10.1109/SMC53654.2022.9945517},
timestamp = {Thu, 01 Dec 2022 15:59:35 +0100},
biburl = {https://dblp.org/rec/conf/smc/BethgeHGKCOS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-04615,
author = {Aarohi Srivastava and
Abhinav Rastogi and
Abhishek Rao and
Abu Awal Md Shoeb and
Abubakar Abid and
Adam Fisch and
Adam R. Brown and
Adam Santoro and
Aditya Gupta and
Adri{\`{a}} Garriga{-}Alonso and
Agnieszka Kluska and
Aitor Lewkowycz and
Akshat Agarwal and
Alethea Power and
Alex Ray and
Alex Warstadt and
Alexander W. Kocurek and
Ali Safaya and
Ali Tazarv and
Alice Xiang and
Alicia Parrish and
Allen Nie and
Aman Hussain and
Amanda Askell and
Amanda Dsouza and
Ambrose Slone and
Ameet Rahane and
Anantharaman S. Iyer and
Anders Andreassen and
Andrea Madotto and
Andrea Santilli and
Andreas Stuhlm{\"{u}}ller and
Andrew M. Dai and
Andrew La and
Andrew K. Lampinen and
Andy Zou and
Angela Jiang and
Angelica Chen and
Anh Vuong and
Animesh Gupta and
Anna Gottardi and
Antonio Norelli and
Anu Venkatesh and
Arash Gholamidavoodi and
Arfa Tabassum and
Arul Menezes and
Arun Kirubarajan and
Asher Mullokandov and
Ashish Sabharwal and
Austin Herrick and
Avia Efrat and
Aykut Erdem and
Ayla Karakas and
B. Ryan Roberts and
Bao Sheng Loe and
Barret Zoph and
Bartlomiej Bojanowski and
Batuhan {\"{O}}zyurt and
Behnam Hedayatnia and
Behnam Neyshabur and
Benjamin Inden and
Benno Stein and
Berk Ekmekci and
Bill Yuchen Lin and
Blake Howald and
Bryan Orinion and
Cameron Diao and
Cameron Dour and
Catherine Stinson and
Cedrick Argueta and
C{\`{e}}sar Ferri Ram{\'{\i}}rez and
Chandan Singh and
Charles Rathkopf and
Chenlin Meng and
Chitta Baral and
Chiyu Wu and
Chris Callison{-}Burch and
Chris Waites and
Christian Voigt and
Christopher D. Manning and
Christopher Potts and
Cindy Ramirez and
Clara E. Rivera and
Clemencia Siro and
Colin Raffel and
Courtney Ashcraft and
Cristina Garbacea and
Damien Sileo and
Dan Garrette and
Dan Hendrycks and
Dan Kilman and
Dan Roth and
Daniel Freeman and
Daniel Khashabi and
Daniel Levy and
Daniel Mosegu{\'{\i}} Gonz{\'{a}}lez and
Danielle Perszyk and
Danny Hernandez and
Danqi Chen and
Daphne Ippolito and
Dar Gilboa and
David Dohan and
David Drakard and
David Jurgens and
Debajyoti Datta and
Deep Ganguli and
Denis Emelin and
Denis Kleyko and
Deniz Yuret and
Derek Chen and
Derek Tam and
Dieuwke Hupkes and
Diganta Misra and
Dilyar Buzan and
Dimitri Coelho Mollo and
Diyi Yang and
Dong{-}Ho Lee and
Dylan Schrader and
Ekaterina Shutova and
Ekin Dogus Cubuk and
Elad Segal and
Eleanor Hagerman and
Elizabeth Barnes and
Elizabeth Donoway and
Ellie Pavlick and
Emanuele Rodol{\`{a}} and
Emma Lam and
Eric Chu and
Eric Tang and
Erkut Erdem and
Ernie Chang and
Ethan A. Chi and
Ethan Dyer and
Ethan J. Jerzak and
Ethan Kim and
Eunice Engefu Manyasi and
Evgenii Zheltonozhskii and
Fanyue Xia and
Fatemeh Siar and
Fernando Mart{\'{\i}}nez{-}Plumed and
Francesca Happ{\'{e}} and
Fran{\c{c}}ois Chollet and
Frieda Rong and
Gaurav Mishra and
Genta Indra Winata and
Gerard de Melo and
Germ{\'{a}}n Kruszewski and
Giambattista Parascandolo and
Giorgio Mariani and
Gloria Wang and
Gonzalo Jaimovitch{-}L{\'{o}}pez and
Gregor Betz and
Guy Gur{-}Ari and
Hana Galijasevic and
Hannah Kim and
Hannah Rashkin and
Hannaneh Hajishirzi and
Harsh Mehta and
Hayden Bogar and
Henry Shevlin and
Hinrich Sch{\"{u}}tze and
Hiromu Yakura and
Hongming Zhang and
Hugh Mee Wong and
Ian Ng and
Isaac Noble and
Jaap Jumelet and
Jack Geissinger and
Jackson Kernion and
Jacob Hilton and
Jaehoon Lee and
Jaime Fern{\'{a}}ndez Fisac and
James B. Simon and
James Koppel and
James Zheng and
James Zou and
Jan Kocon and
Jana Thompson and
Janelle Wingfield and
Jared Kaplan and
Jarema Radom and
Jascha Sohl{-}Dickstein and
Jason Phang and
Jason Wei and
Jason Yosinski and
Jekaterina Novikova and
Jelle Bosscher and
Jennifer Marsh and
Jeremy Kim and
Jeroen Taal and
Jesse H. Engel and
Jesujoba Alabi and
Jiacheng Xu and
Jiaming Song and
Jillian Tang and
Joan Waweru and
John Burden and
John Miller and
John U. Balis and
Jonathan Batchelder and
Jonathan Berant and
J{\"{o}}rg Frohberg and
Jos Rozen and
Jos{\'{e}} Hern{\'{a}}ndez{-}Orallo and
Joseph Boudeman and
Joseph Guerr and
Joseph Jones and
Joshua B. Tenenbaum and
Joshua S. Rule and
Joyce Chua and
Kamil Kanclerz and
Karen Livescu and
Karl Krauth and
Karthik Gopalakrishnan and
Katerina Ignatyeva and
Katja Markert and
Kaustubh D. Dhole and
Kevin Gimpel and
Kevin Omondi and
Kory Mathewson and
Kristen Chiafullo and
Ksenia Shkaruta and
Kumar Shridhar and
Kyle McDonell and
Kyle Richardson and
Laria Reynolds and
Leo Gao and
Li Zhang and
Liam Dugan and
Lianhui Qin and
Lidia Contreras Ochando and
Louis{-}Philippe Morency and
Luca Moschella and
Lucas Lam and
Lucy Noble and
Ludwig Schmidt and
Luheng He and
Luis Oliveros Col{\'{o}}n and
Luke Metz and
L{\"{u}}tfi Kerem Senel and
Maarten Bosma and
Maarten Sap and
Maartje ter Hoeve and
Maheen Farooqi and
Manaal Faruqui and
Mantas Mazeika and
Marco Baturan and
Marco Marelli and
Marco Maru and
Mar{\'{\i}}a Jos{\'{e}} Ram{\'{\i}}rez{-}Quintana and
Marie Tolkiehn and
Mario Giulianelli and
Martha Lewis and
Martin Potthast and
Matthew L. Leavitt and
Matthias Hagen and
M{\'{a}}ty{\'{a}}s Schubert and
Medina Baitemirova and
Melody Arnaud and
Melvin McElrath and
Michael A. Yee and
Michael Cohen and
Michael Gu and
Michael I. Ivanitskiy and
Michael Starritt and
Michael Strube and
Michal Swedrowski and
Michele Bevilacqua and
Michihiro Yasunaga and
Mihir Kale and
Mike Cain and
Mimee Xu and
Mirac Suzgun and
Mitch Walker and
Mo Tiwari and
Mohit Bansal and
Moin Aminnaseri and
Mor Geva and
Mozhdeh Gheini and
Mukund Varma T. and
Nanyun Peng and
Nathan A. Chi and
Nayeon Lee and
Neta Gur{-}Ari Krakover and
Nicholas Cameron and
Nicholas Roberts and
Nick Doiron and
Nicole Martinez and
Nikita Nangia and
Niklas Deckers and
Niklas Muennighoff and
Nitish Shirish Keskar and
Niveditha Iyer and
Noah Constant and
Noah Fiedel and
Nuan Wen and
Oliver Zhang and
Omar Agha and
Omar Elbaghdadi and
Omer Levy and
Owain Evans and
Pablo Antonio Moreno Casares and
Parth Doshi and
Pascale Fung and
Paul Pu Liang and
Paul Vicol and
Pegah Alipoormolabashi and
Peiyuan Liao and
Percy Liang and
Peter Chang and
Peter Eckersley and
Phu Mon Htut and
Pinyu Hwang and
Piotr Milkowski and
Piyush Patil and
Pouya Pezeshkpour and
Priti Oli and
Qiaozhu Mei and
Qing Lyu and
Qinlang Chen and
Rabin Banjade and
Rachel Etta Rudolph and
Raefer Gabriel and
Rahel Habacker and
Ramon Risco and
Rapha{\"{e}}l Milli{\`{e}}re and
Rhythm Garg and
Richard Barnes and
Rif A. Saurous and
Riku Arakawa and
Robbe Raymaekers and
Robert Frank and
Rohan Sikand and
Roman Novak and
Roman Sitelew and
Ronan LeBras and
Rosanne Liu and
Rowan Jacobs and
Rui Zhang and
Ruslan Salakhutdinov and
Ryan Chi and
Ryan Lee and
Ryan Stovall and
Ryan Teehan and
Rylan Yang and
Sahib Singh and
Saif M. Mohammad and
Sajant Anand and
Sam Dillavou and
Sam Shleifer and
Sam Wiseman and
Samuel Gruetter and
Samuel R. Bowman and
Samuel S. Schoenholz and
Sanghyun Han and
Sanjeev Kwatra and
Sarah A. Rous and
Sarik Ghazarian and
Sayan Ghosh and
Sean Casey and
Sebastian Bischoff and
Sebastian Gehrmann and
Sebastian Schuster and
Sepideh Sadeghi and
Shadi Hamdan and
Sharon Zhou and
Shashank Srivastava and
Sherry Shi and
Shikhar Singh and
Shima Asaadi and
Shixiang Shane Gu and
Shubh Pachchigar and
Shubham Toshniwal and
Shyam Upadhyay and
Shyamolima (Shammie) Debnath and
Siamak Shakeri and
Simon Thormeyer and
Simone Melzi and
Siva Reddy and
Sneha Priscilla Makini and
Soo{-}Hwan Lee and
Spencer Torene and
Sriharsha Hatwar and
Stanislas Dehaene and
Stefan Divic and
Stefano Ermon and
Stella Biderman and
Stephanie Lin and
Stephen Prasad and
Steven T. Piantadosi and
Stuart M. Shieber and
Summer Misherghi and
Svetlana Kiritchenko and
Swaroop Mishra and
Tal Linzen and
Tal Schuster and
Tao Li and
Tao Yu and
Tariq Ali and
Tatsu Hashimoto and
Te{-}Lin Wu and
Th{\'{e}}o Desbordes and
Theodore Rothschild and
Thomas Phan and
Tianle Wang and
Tiberius Nkinyili and
Timo Schick and
Timofei Kornev and
Titus Tunduny and
Tobias Gerstenberg and
Trenton Chang and
Trishala Neeraj and
Tushar Khot and
Tyler Shultz and
Uri Shaham and
Vedant Misra and
Vera Demberg and
Victoria Nyamai and
Vikas Raunak and
Vinay V. Ramasesh and
Vinay Uday Prabhu and
Vishakh Padmakumar and
Vivek Srikumar and
William Fedus and
William Saunders and
William Zhang and
Wout Vossen and
Xiang Ren and
Xiaoyu Tong and
Xinran Zhao and
Xinyi Wu and
Xudong Shen and
Yadollah Yaghoobzadeh and
Yair Lakretz and
Yangqiu Song and
Yasaman Bahri and
Yejin Choi and
Yichi Yang and
Yiding Hao and
Yifu Chen and
Yonatan Belinkov and
Yu Hou and
Yufang Hou and
Yuntao Bai and
Zachary Seid and
Zhuoye Zhao and
Zijian Wang and
Zijie J. Wang and
Zirui Wang and
Ziyi Wu},
title = {Beyond the Imitation Game: Quantifying and extrapolating the capabilities
of language models},
journal = {CoRR},
volume = {abs/2206.04615},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.04615},
doi = {10.48550/ARXIV.2206.04615},
eprinttype = {arXiv},
eprint = {2206.04615},
timestamp = {Mon, 05 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-04615.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2207-08002,
author = {David Bethge and
Philipp Hallgarten and
Tobias Grosse{-}Puppendahl and
Mohamed Kari and
Lewis L. Chuang and
Ozan {\"{O}}zdenizci and
Albrecht Schmidt},
title = {EEG2Vec: Learning Affective {EEG} Representations via Variational
Autoencoders},
journal = {CoRR},
volume = {abs/2207.08002},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2207.08002},
doi = {10.48550/ARXIV.2207.08002},
eprinttype = {arXiv},
eprint = {2207.08002},
timestamp = {Tue, 19 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2207-08002.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-13138,
author = {Karan Singhal and
Shekoofeh Azizi and
Tao Tu and
S. Sara Mahdavi and
Jason Wei and
Hyung Won Chung and
Nathan Scales and
Ajay Kumar Tanwani and
Heather Cole{-}Lewis and
Stephen Pfohl and
Perry Payne and
Martin Seneviratne and
Paul Gamble and
Chris Kelly and
Nathaneal Sch{\"{a}}rli and
Aakanksha Chowdhery and
Philip Andrew Mansfield and
Blaise Ag{\"{u}}era y Arcas and
Dale R. Webster and
Gregory S. Corrado and
Yossi Matias and
Katherine Chou and
Juraj Gottweis and
Nenad Tomasev and
Yun Liu and
Alvin Rajkomar and
Joelle K. Barral and
Christopher Semturs and
Alan Karthikesalingam and
Vivek Natarajan},
title = {Large Language Models Encode Clinical Knowledge},
journal = {CoRR},
volume = {abs/2212.13138},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.13138},
doi = {10.48550/ARXIV.2212.13138},
eprinttype = {arXiv},
eprint = {2212.13138},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-13138.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LhoestMJTPPCDPT21,
author = {Quentin Lhoest and
Albert Villanova del Moral and
Yacine Jernite and
Abhishek Thakur and
Patrick von Platen and
Suraj Patil and
Julien Chaumond and
Mariama Drame and
Julien Plu and
Lewis Tunstall and
Joe Davison and
Mario Sasko and
Gunjan Chhablani and
Bhavitvya Malik and
Simon Brandeis and
Teven Le Scao and
Victor Sanh and
Canwen Xu and
Nicolas Patry and
Angelina McMillan{-}Major and
Philipp Schmid and
Sylvain Gugger and
Cl{\'{e}}ment Delangue and
Th{\'{e}}o Matussi{\`{e}}re and
Lysandre Debut and
Stas Bekman and
Pierric Cistac and
Thibault Goehringer and
Victor Mustar and
Fran{\c{c}}ois Lagunas and
Alexander M. Rush and
Thomas Wolf},
editor = {Heike Adel and
Shuming Shi},
title = {Datasets: {A} Community Library for Natural Language Processing},
booktitle = {Proceedings of the 2021 Conference on Empirical Methods in Natural
Language Processing: System Demonstrations, {EMNLP} 2021, Online and
Punta Cana, Dominican Republic, 7-11 November, 2021},
pages = {175--184},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.emnlp-demo.21},
doi = {10.18653/V1/2021.EMNLP-DEMO.21},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/LhoestMJTPPCDPT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsa/0001CCFJKKKLLST21,
author = {Steffen Becker and
Javier C{\'{a}}mara and
St{\'{e}}phanie Challita and
Christoph Fehling and
Anton Jansen and
Oliver Kopp and
Heiko Koziolek and
Philippe Kruchten and
Grace A. Lewis and
Carola Lilienthal and
Romina Spalazzese and
Catia Trubiani},
title = {Message from the SAIP, NEMI, ECRF, Journal First, and Workshops Track
Chairs},
booktitle = {18th {IEEE} International Conference on Software Architecture Companion,
{ICSA} Companion 2021, Stuttgart, Germany, March 22-26, 2021},
pages = {10--11},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICSA-C52384.2021.00006},
doi = {10.1109/ICSA-C52384.2021.00006},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icsa/0001CCFJKKKLLST21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-02846,
author = {Quentin Lhoest and
Albert Villanova del Moral and
Yacine Jernite and
Abhishek Thakur and
Patrick von Platen and
Suraj Patil and
Julien Chaumond and
Mariama Drame and
Julien Plu and
Lewis Tunstall and
Joe Davison and
Mario Sasko and
Gunjan Chhablani and
Bhavitvya Malik and
Simon Brandeis and
Teven Le Scao and
Victor Sanh and
Canwen Xu and
Nicolas Patry and
Angelina McMillan{-}Major and
Philipp Schmid and
Sylvain Gugger and
Clement Delangue and
Th{\'{e}}o Matussi{\`{e}}re and
Lysandre Debut and
Stas Bekman and
Pierric Cistac and
Thibault Goehringer and
Victor Mustar and
Fran{\c{c}}ois Lagunas and
Alexander M. Rush and
Thomas Wolf},
title = {Datasets: {A} Community Library for Natural Language Processing},
journal = {CoRR},
volume = {abs/2109.02846},
year = {2021},
url = {https://arxiv.org/abs/2109.02846},
eprinttype = {arXiv},
eprint = {2109.02846},
timestamp = {Mon, 20 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-02846.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/WangYZLGMPWLMWB20,
author = {Jiyao Wang and
Philippe Youkharibache and
Dachuan Zhang and
Christopher J. Lanczycki and
Renata C. Geer and
Thomas Madej and
Lon Phan and
Minghong Ward and
Shennan Lu and
Gabriele H. Marchler and
Yanli Wang and
Stephen H. Bryant and
Lewis Y. Geer and
Aron Marchler{-}Bauer},
title = {iCn3D, a web-based 3D viewer for sharing 1D/2D/3D representations
of biomolecular structures},
journal = {Bioinform.},
volume = {36},
number = {1},
pages = {131--135},
year = {2020},
url = {https://doi.org/10.1093/bioinformatics/btz502},
doi = {10.1093/BIOINFORMATICS/BTZ502},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/WangYZLGMPWLMWB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/ShefchekHGMUBKC20,
author = {Kent A. Shefchek and
Nomi L. Harris and
Michael A. Gargano and
Nicolas Matentzoglu and
Deepak R. Unni and
Matthew H. Brush and
Dan Keith and
Tom Conlin and
Nicole A. Vasilevsky and
Xingmin Aaron Zhang and
James P. Balhoff and
Larry Babb and
Susan M. Bello and
Hannah Blau and
Yvonne M. Bradford and
Seth Carbon and
Leigh Carmody and
Lauren E. Chan and
Valentina Cipriani and
Alayne Cuzick and
Maria G. Della Rocca and
Nathan A. Dunn and
Shahim Essaid and
Petra Fey and
Christian A. Grove and
Jean{-}Philippe F. Gourdine and
Ada Hamosh and
Midori A. Harris and
Ingo Helbig and
Maureen E. Hoatlin and
Marcin P. Joachimiak and
Simon Jupp and
Kenneth B. Lett and
Suzanna E. Lewis and
Craig McNamara and
Zo{\"{e}} May Pendlington and
Clare Pilgrim and
Tim E. Putman and
Vida Ravanmehr and
Justin T. Reese and
Erin Rooney Riggs and
Sofia M. C. Robb and
Paola Roncaglia and
James Seager and
Erik Segerdell and
Morgan Similuk and
Andrea L. Storm and
Courtney Thaxon and
Anne E. Thessen and
Julius O. B. Jacobsen and
Julie A. McMurry and
Tudor Groza and
Sebastian K{\"{o}}hler and
Damian Smedley and
Peter N. Robinson and
Christopher J. Mungall and
Melissa A. Haendel and
Monica C. Munoz{-}Torres and
David Osumi{-}Sutherland},
title = {The Monarch Initiative in 2019: an integrative data and analytic platform
connecting phenotypes to genotypes across species},
journal = {Nucleic Acids Res.},
volume = {48},
number = {Database-Issue},
pages = {D704--D715},
year = {2020},
url = {https://doi.org/10.1093/nar/gkz997},
doi = {10.1093/NAR/GKZ997},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/ShefchekHGMUBKC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/LemanWRLMWMLALK20,
author = {Julia Koehler Leman and
Brian D. Weitzner and
P. Douglas Renfrew and
Steven M. Lewis and
Rocco Moretti and
Andrew M. Watkins and
Vikram Khipple Mulligan and
Sergey Lyskov and
Jared Adolf{-}Bryfogle and
Jason W. Labonte and
Justyna Krys and
RosettaCommons Consortium and
Christopher Bystroff and
William R. Schief and
Dominik Gront and
Ora Schueler{-}Furman and
David Baker and
Philip Bradley and
Roland L. Dunbrack Jr. and
Tanja Kortemme and
Andrew Leaver{-}Fay and
Charlie E. M. Strauss and
Jens Meiler and
Brian Kuhlman and
Jeffrey J. Gray and
Richard Bonneau},
title = {Better together: Elements of successful scientific software development
in a distributed collaborative community},
journal = {PLoS Comput. Biol.},
volume = {16},
number = {5},
year = {2020},
url = {https://doi.org/10.1371/journal.pcbi.1007507},
doi = {10.1371/JOURNAL.PCBI.1007507},
timestamp = {Sat, 25 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ploscb/LemanWRLMWMLALK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/CockburnLQG20,
author = {Andy Cockburn and
Blaine Lewis and
Philip Quinn and
Carl Gutwin},
editor = {Regina Bernhaupt and
Florian 'Floyd' Mueller and
David Verweij and
Josh Andres and
Joanna McGrenere and
Andy Cockburn and
Ignacio Avellino and
Alix Goguey and
Pernille Bj{\o}n and
Shengdong Zhao and
Briane Paul Samson and
Rafal Kocielnik},
title = {Framing Effects Influence Interface Feature Decisions},
booktitle = {{CHI} '20: {CHI} Conference on Human Factors in Computing Systems,
Honolulu, HI, USA, April 25-30, 2020},
pages = {1--11},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3313831.3376496},
doi = {10.1145/3313831.3376496},
timestamp = {Wed, 12 Jun 2024 07:39:18 +0200},
biburl = {https://dblp.org/rec/conf/chi/CockburnLQG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/AnastasopoulosC20,
author = {Antonios Anastasopoulos and
Alessandro Cattelan and
Zi{-}Yi Dou and
Marcello Federico and
Christian Federmann and
Dmitriy Genzel and
Francisco Guzm{\'{a}}n and
Junjie Hu and
Macduff Hughes and
Philipp Koehn and
Rosie Lazar and
William Lewis and
Graham Neubig and
Mengmeng Niu and
Alp {\"{O}}ktem and
Eric Paquin and
Grace Tang and
Sylwia Tur},
editor = {Karin Verspoor and
Kevin Bretonnel Cohen and
Michael Conway and
Berry de Bruijn and
Mark Dredze and
Rada Mihalcea and
Byron C. Wallace},
title = {{TICO-19:} the Translation Initiative for COvid-19},
booktitle = {Proceedings of the 1st Workshop on {NLP} for COVID-19@ {EMNLP} 2020,
Online, December 2020},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.nlpcovid19-2.5},
doi = {10.18653/V1/2020.NLPCOVID19-2.5},
timestamp = {Thu, 17 Feb 2022 16:43:16 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/AnastasopoulosC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/SiqueiraLTSKGLR20,
author = {Andreia Siqueira and
Adam Lewis and
Medhavy Thankappan and
Zoltan Szantoi and
Brian Killough and
Philippe Goryl and
Steven Labahn and
Jonathon Ross and
Takeo Tadono and
Ake Rosenqvist and
Jennifer Lacey and
Matthew Steventon},
title = {{CEOS} Analysis Ready Data for Land: Implementation Phase and Next
Steps},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2020, Waikoloa, HI, USA, September 26 - October 2, 2020},
pages = {3376--3378},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IGARSS39084.2020.9324703},
doi = {10.1109/IGARSS39084.2020.9324703},
timestamp = {Tue, 31 Oct 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/SiqueiraLTSKGLR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2007-01788,
author = {Antonios Anastasopoulos and
Alessandro Cattelan and
Zi{-}Yi Dou and
Marcello Federico and
Christian Federmann and
Dmitriy Genzel and
Francisco Guzm{\'{a}}n and
Junjie Hu and
Macduff Hughes and
Philipp Koehn and
Rosie Lazar and
William Lewis and
Graham Neubig and
Mengmeng Niu and
Alp {\"{O}}ktem and
Eric Paquin and
Grace Tang and
Sylwia Tur},
title = {{TICO-19:} the Translation Initiative for Covid-19},
journal = {CoRR},
volume = {abs/2007.01788},
year = {2020},
url = {https://arxiv.org/abs/2007.01788},
eprinttype = {arXiv},
eprint = {2007.01788},
timestamp = {Thu, 08 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2007-01788.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scirobotics/JustusHLWIMLT19,
author = {Kyle B. Justus and
Tess Lee Hellebrekers and
Daniel D. Lewis and
Adam Wood and
Christian Ingham and
Carmel Majidi and
Philip R. Leduc and
Cheemeng Tan},
title = {A biosensing soft robot: Autonomous parsing of chemical signals through
integrated organic and inorganic interfaces},
journal = {Sci. Robotics},
volume = {4},
number = {31},
year = {2019},
url = {https://doi.org/10.1126/scirobotics.aax0765},
doi = {10.1126/SCIROBOTICS.AAX0765},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/scirobotics/JustusHLWIMLT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tamm/PeeplesACHLN19,
author = {Joanne Peeples and
James {\'{A}}lvarez and
Ruth Charney and
John Harris and
Jim Lewis and
Nancy Ann Neudauer},
title = {Yueh-Gin Gung and Dr. Charles Y. Hu Award for 2019 to Philip Uri Treisman
for Distinguished Service to Mathematics},
journal = {Am. Math. Mon.},
volume = {126},
number = {3},
pages = {195--198},
year = {2019},
url = {https://doi.org/10.1080/00029890.2019.1551605},
doi = {10.1080/00029890.2019.1551605},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tamm/PeeplesACHLN19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/SiqueiraTRLLTSG19,
author = {Andreia Siqueira and
Takeo Tadono and
Ake Rosenqvist and
Jennifer Lacey and
Adam Lewis and
Medhavy Thankappan and
Zoltan Szantoi and
Philippe Goryl and
Steven Labahn and
Jonathon Ross and
Steven Hosford and
Susanne Mecklenburg},
title = {{CEOS} Analysis Ready Data For Land - An Overview on the Current and
Future Work},
booktitle = {2019 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2019, Yokohama, Japan, July 28 - August 2, 2019},
pages = {5536--5537},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/IGARSS.2019.8899846},
doi = {10.1109/IGARSS.2019.8899846},
timestamp = {Thu, 21 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/SiqueiraTRLLTSG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/WeberLDMQMOWKME18,
author = {Nick Weber and
David Liou and
Jennifer Dommer and
Philip MacMenamin and
Mariam Qui{\~{n}}ones and
Ian Misner and
Andrew J. Oler and
Joe Wan and
Lewis Kim and
Meghan Coakley McCarthy and
Samuel Ezeji and
Karlynn Noble and
Darrell E. Hurt},
title = {Nephele: a cloud platform for simplified, standardized and reproducible
microbiome data analysis},
journal = {Bioinform.},
volume = {34},
number = {8},
pages = {1411--1413},
year = {2018},
url = {https://doi.org/10.1093/bioinformatics/btx617},
doi = {10.1093/BIOINFORMATICS/BTX617},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/WeberLDMQMOWKME18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/FrasslHDEHKSLWO18,
author = {Marieke A. Frassl and
David P. Hamilton and
Blaize A. Denfeld and
Elvira de Eyto and
Stephanie E. Hampton and
Philipp S. Keller and
Sapna Sharma and
Abigail S. L. Lewis and
Gesa A. Weyhenmeyer and
Catherine M. O'Reilly and
Mary E. Lofton and
N{\'{u}}ria Catal{\'{a}}n},
title = {Ten simple rules for collaboratively writing a multi-authored paper},
journal = {PLoS Comput. Biol.},
volume = {14},
number = {11},
year = {2018},
url = {https://doi.org/10.1371/journal.pcbi.1006508},
doi = {10.1371/JOURNAL.PCBI.1006508},
timestamp = {Sat, 25 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ploscb/FrasslHDEHKSLWO18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/AdamsLD18,
author = {Jennifer Adams and
Philip Lewis and
Mathias Disney},
title = {Decoupling Canopy Structure and Leaf Biochemistry: Testing the Utility
of Directional Area Scattering Factor {(DASF)}},
journal = {Remote. Sens.},
volume = {10},
number = {12},
pages = {1911},
year = {2018},
url = {https://doi.org/10.3390/rs10121911},
doi = {10.3390/RS10121911},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/AdamsLD18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/CaldersOBDNRAML18,
author = {Kim Calders and
Niall Origo and
Andrew Burt and
Mathias Disney and
Joanne M. Nightingale and
Pasi Raumonen and
Markku {\AA}kerblom and
Yadvinder Malhi and
Philip Lewis},
title = {Realistic Forest Stand Reconstruction from Terrestrial LiDAR for Radiative
Transfer Modelling},
journal = {Remote. Sens.},
volume = {10},
number = {6},
pages = {933},
year = {2018},
url = {https://doi.org/10.3390/rs10060933},
doi = {10.3390/RS10060933},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/CaldersOBDNRAML18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asist/RolanEBLGWMMR18,
author = {Gregory Rolan and
Joanne Evans and
Jane Bone and
Antonina Lewis and
Frank Golding and
Jacqueline Wilson and
Sue McKemmish and
Philip Mendes and
Keir Reeves},
title = {Weapons of affect: The imperative for transdisciplinary information
systems design},
booktitle = {Building {\&} Sustaining an Ethical Future with Emerging Technology
- Proceedings of the 81st ASIS{\&}T Annual Meeting, {ASIST} 2018,
Vancouver, BC, Canada, November 10-14, 2018},
series = {Proc. Assoc. Inf. Sci. Technol.},
volume = {55},
number = {1},
pages = {420--429},
publisher = {Wiley},
year = {2018},
url = {https://doi.org/10.1002/pra2.2018.14505501046},
doi = {10.1002/PRA2.2018.14505501046},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asist/RolanEBLGWMMR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cc/GinsbachCO18,
author = {Philip Ginsbach and
Lewis Crawford and
Michael F. P. O'Boyle},
editor = {Christophe Dubach and
Jingling Xue},
title = {CAnDL: a domain specific language for compiler analysis},
booktitle = {Proceedings of the 27th International Conference on Compiler Construction,
{CC} 2018, February 24-25, 2018, Vienna, Austria},
pages = {151--162},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3178372.3179515},
doi = {10.1145/3178372.3179515},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cc/GinsbachCO18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/BrennanGLCH18,
author = {James Brennan and
Jos{\'{e}} G{\'{o}}mez{-}Dans and
Philip Lewis and
Maxim Chernetskiy and
Angelika Heil},
title = {Uncertainty for Burnt Area Products},
booktitle = {2018 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2018, Valencia, Spain, July 22-27, 2018},
pages = {1808--1811},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IGARSS.2018.8518257},
doi = {10.1109/IGARSS.2018.8518257},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/BrennanGLCH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/LewisLMRSKSTRGM18,
author = {Adam Lewis and
Jennifer Lacey and
Susanne Mecklenburg and
Jonathon Ross and
Andreia Siqueira and
Brian Killough and
Zoltan Szantoi and
Takeo Tadono and
Ake Rosenqvist and
Philippe Goryl and
Nuno Miranda and
Steven Hosford},
title = {{CEOS} Analysis Ready Data for Land {(CARD4L)} Overview},
booktitle = {2018 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2018, Valencia, Spain, July 22-27, 2018},
pages = {7407--7410},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IGARSS.2018.8519255},
doi = {10.1109/IGARSS.2018.8519255},
timestamp = {Tue, 31 Oct 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/LewisLMRSKSTRGM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/YinGL18,
author = {Feng Yin and
Jos{\'{e}} G{\'{o}}mez{-}Dans and
Philip Lewis},
title = {A Sensor Invariant Atmospheric Correction Method for Satellite Images},
booktitle = {2018 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2018, Valencia, Spain, July 22-27, 2018},
pages = {1804--1807},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IGARSS.2018.8517466},
doi = {10.1109/IGARSS.2018.8517466},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/YinGL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/MungallM0BBBCCD17,
author = {Christopher J. Mungall and
Julie A. McMurry and
Sebastian K{\"{o}}hler and
James P. Balhoff and
Charles D. Borromeo and
Matthew H. Brush and
Seth Carbon and
Tom Conlin and
Nathan A. Dunn and
Mark Engelstad and
Erin Foster and
Jean{-}Philippe F. Gourdine and
Julius O. B. Jacobsen and
Dan Keith and
Bryan Laraway and
Suzanna E. Lewis and
Jeremy NguyenXuan and
Kent A. Shefchek and
Nicole A. Vasilevsky and
Zhou Yuan and
Nicole L. Washington and
Harry Hochheiser and
Tudor Groza and
Damian Smedley and
Peter N. Robinson and
Melissa A. Haendel},
title = {The Monarch Initiative: an integrative data and analytic platform
connecting phenotypes to genotypes across species},
journal = {Nucleic Acids Res.},
volume = {45},
number = {Database-Issue},
pages = {D712--D722},
year = {2017},
url = {https://doi.org/10.1093/nar/gkw1128},
doi = {10.1093/NAR/GKW1128},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/MungallM0BBBCCD17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/PhamMLNDFML17,
author = {Thuy T. Pham and
Steven T. Moore and
Simon J. G. Lewis and
Diep N. Nguyen and
Eryk Dutkiewicz and
Andrew J. Fuglevand and
Alistair Lee McEwan and
Philip Heng Wai Leong},
title = {Freezing of Gait Detection in Parkinson's Disease: {A} Subject-Independent
Detector Using Anomaly Scores},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {64},
number = {11},
pages = {2719--2728},
year = {2017},
url = {https://doi.org/10.1109/TBME.2017.2665438},
doi = {10.1109/TBME.2017.2665438},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbe/PhamMLNDFML17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/f1000research/GriffinKLLOPPRR17,
author = {Philippa C. Griffin and
Jyoti Khadake and
Kate S. LeMay and
Suzanna E. Lewis and
Sandra E. Orchard and
Andrew Pask and
Bernard J. Pope and
Ute Roessner and
Keith Russell and
Torsten Seemann and
Andrew E. Treloar and
Sonika Tyagi and
Jeffrey H. Christiansen and
Saravanan Dayalan and
Simon Gladman and
Sandra B. Hangartner and
Helen L. Hayden and
William W. H. Ho and
Gabriel Keeble{-}Gagn{\`{e}}re and
Pasi K. Korhonen and
Peter Neish and
Priscilla R. Prestes and
Mark F. Richardson and
Nathan S. Watson{-}Haigh and
Kelly L. Wyres and
Neil D. Young and
Maria Victoria Schneider},
title = {Best practice data life cycle approaches for the life sciences},
journal = {F1000Research},
volume = {6},
pages = {1618},
year = {2017},
url = {https://doi.org/10.12688/f1000research.12344.1},
doi = {10.12688/F1000RESEARCH.12344.1},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/f1000research/GriffinKLLOPPRR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/KingLDMFLEPL16,
author = {Zachary A. King and
Justin Lu and
Andreas Dr{\"{a}}ger and
Philip Miller and
Stephen Federowicz and
Joshua A. Lerman and
Ali Ebrahim and
Bernhard O. Palsson and
Nathan E. Lewis},
title = {BiGG Models: {A} platform for integrating, standardizing and sharing
genome-scale models},
journal = {Nucleic Acids Res.},
volume = {44},
number = {Database-Issue},
pages = {515--522},
year = {2016},
url = {https://doi.org/10.1093/nar/gkv1049},
doi = {10.1093/NAR/GKV1049},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/KingLDMFLEPL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/DisneyMKKVLP16,
author = {Mathias Disney and
Jan{-}Peter Muller and
Sa{\"{\i}}d Kharbouche and
Thomas Kaminski and
Michael Vo{\ss}beck and
Philip Lewis and
Bernard Pinty},
title = {A New Global fAPAR and {LAI} Dataset Derived from Optimal Albedo Estimates:
Comparison with {MODIS} Products},
journal = {Remote. Sens.},
volume = {8},
number = {4},
pages = {275},
year = {2016},
url = {https://doi.org/10.3390/rs8040275},
doi = {10.3390/RS8040275},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/DisneyMKKVLP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/CaldersBODNRL16,
author = {Kim Calders and
Andrew Burt and
Niall Origo and
Mathias Disney and
Joanne M. Nightingale and
Pasi Raumonen and
Philip Lewis},
title = {Large-area virtual forests from terrestrial laser scanning data},
booktitle = {2016 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2016, Beijing, China, July 10-15, 2016},
pages = {1765--1767},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/IGARSS.2016.7729452},
doi = {10.1109/IGARSS.2016.7729452},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/CaldersBODNRL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/MelendezDSPL15,
author = {Kevin Melendez and
A. Desmoulin and
Kevin Sanchez and
Philippe Perdu and
Dean Lewis},
title = {A way to implement the electro-optical technique to inertial {MEMS}},
journal = {Microelectron. Reliab.},
volume = {55},
number = {9-10},
pages = {1916--1919},
year = {2015},
url = {https://doi.org/10.1016/j.microrel.2015.07.041},
doi = {10.1016/J.MICROREL.2015.07.041},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/MelendezDSPL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/BedfordRBBCCDGH15,
author = {Trevor Bedford and
Steven Riley and
Ian G. Barr and
Shobha Broor and
Mandeep Chadha and
Nancy J. Cox and
Rodney S. Daniels and
C. Palani Gunasekaran and
Aeron C. Hurt and
Anne Kelso and
Alexander Klimov and
Nicola S. Lewis and
Xiyan Li and
John W. McCauley and
Takato Odagiri and
Varsha Potdar and
Andrew Rambaut and
Yuelong Shu and
Eugene Skepner and
Derek J. Smith and
Marc A. Suchard and
Masato Tashiro and
Dayan Wang and
Xiyan Xu and
Philippe Lemey and
Colin A. Russell},
title = {Global circulation patterns of seasonal influenza viruses vary with
antigenic drift},
journal = {Nat.},
volume = {523},
number = {7559},
pages = {217--220},
year = {2015},
url = {https://doi.org/10.1038/nature14460},
doi = {10.1038/NATURE14460},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nature/BedfordRBBCCDGH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acmidc/OrrFPVL15,
author = {Jillian Orr and
Louise P. Flannery and
Ashley Lewis Presser and
Philip Vahey and
Sonja Latimore},
editor = {Marina Umaschi Bers and
Glenda Revelle},
title = {Early math with \emph{Gracie {\&} Friends}{\texttrademark} demo:
app-infused curriculum and teacher support for preschool},
booktitle = {Proceedings of the 14th International Conference on Interaction Design
and Children, {IDC} '15, Medford, MA, USA, June 21-25, 2015},
pages = {458--461},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2771839.2771885},
doi = {10.1145/2771839.2771885},
timestamp = {Thu, 11 Mar 2021 17:04:51 +0100},
biburl = {https://dblp.org/rec/conf/acmidc/OrrFPVL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/LoweryRLBMBYMMR15,
author = {Arthur James Lowery and
Jeffrey V. Rosenfeld and
Philip M. Lewis and
Damien Browne and
Anand Mohan and
Emma Brunton and
Edwin Yan and
Jerome J. Maller and
Collette Mann and
Ramesh Rajan and
Marcello Rosa and
Jeanette Pritchard},
title = {Restoration of vision using wireless cortical implants: The Monash
Vision Group project},
booktitle = {37th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2015, Milan, Italy, August 25-29,
2015},
pages = {1041--1044},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/EMBC.2015.7318543},
doi = {10.1109/EMBC.2015.7318543},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/LoweryRLBMBYMMR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/RebaiDGBSPL14,
author = {Mohamed Mehdi Reba{\"{\i}} and
Fr{\'{e}}d{\'{e}}ric Darracq and
Jean{-}Paul Guillet and
Elise Bernou and
Kevin Sanchez and
Philippe Perdu and
Dean Lewis},
title = {A comprehensive study of the application of the {EOP} techniques on
bipolar devices},
journal = {Microelectron. Reliab.},
volume = {54},
number = {9-10},
pages = {2088--2092},
year = {2014},
url = {https://doi.org/10.1016/j.microrel.2014.07.116},
doi = {10.1016/J.MICROREL.2014.07.116},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/RebaiDGBSPL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/MoukhtariPLDLP13,
author = {I. El Moukhtari and
Vincent Pouget and
C. Larue and
Fr{\'{e}}d{\'{e}}ric Darracq and
Dean Lewis and
Philippe Perdu},
title = {Impact of negative bias temperature instability on the single-event
upset threshold of a 65 nm {SRAM} cell},
journal = {Microelectron. Reliab.},
volume = {53},
number = {9-11},
pages = {1325--1328},
year = {2013},
url = {https://doi.org/10.1016/j.microrel.2013.07.129},
doi = {10.1016/J.MICROREL.2013.07.129},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/MoukhtariPLDLP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/RaumonenKAKKVHD13,
author = {Pasi Raumonen and
Mikko Kaasalainen and
Markku {\AA}kerblom and
Sanna Kaasalainen and
Harri Kaartinen and
Mikko Vastaranta and
Markus Holopainen and
Mathias Disney and
Philip Lewis},
title = {Fast Automatic Precision Tree Models from Terrestrial Laser Scanner
Data},
journal = {Remote. Sens.},
volume = {5},
number = {2},
pages = {491--520},
year = {2013},
url = {https://doi.org/10.3390/rs5020491},
doi = {10.3390/RS5020491},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/RaumonenKAKKVHD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acmidc/PresserVZ13,
author = {Ashley Lewis Presser and
Philip Vahey and
Christine Zanchi},
editor = {Nitin "Nick" Sawhney and
Emily Reardon and
Juan Pablo Hourcade},
title = {Designing early childhood math games: a research-driven approach},
booktitle = {Interaction Design and Children 2013, {IDC} '13, New York, NY, {USA}
- June 24 - 27, 2013},
pages = {376--379},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2485760.2485802},
doi = {10.1145/2485760.2485802},
timestamp = {Thu, 11 Mar 2021 17:04:51 +0100},
biburl = {https://dblp.org/rec/conf/acmidc/PresserVZ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acmidc/ZanchiPV13,
author = {Christine Zanchi and
Ashley Lewis Presser and
Philip Vahey},
editor = {Nitin "Nick" Sawhney and
Emily Reardon and
Juan Pablo Hourcade},
title = {Next generation preschool math demo: tablet games for preschool classrooms},
booktitle = {Interaction Design and Children 2013, {IDC} '13, New York, NY, {USA}
- June 24 - 27, 2013},
pages = {527--530},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2485760.2485857},
doi = {10.1145/2485760.2485857},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acmidc/ZanchiPV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ercimdl/BlowerABCKLLMNOP13,
author = {Jon D. Blower and
Raquel Alegre and
Victoria L. Bennett and
Debbie J. Clifford and
Philip J. Kershaw and
Bryan N. Lawrence and
Jane P. Lewis and
Kevin Marsh and
Maurizio Nagni and
Alan O'Neill and
Rhona A. Phipps},
editor = {Lukasz Bolikowski and
Vittore Casarosa and
Paula Goodale and
Nikos Houssos and
Paolo Manghi and
Jochen Schirrwagen},
title = {Understanding Climate Data Through Commentary Metadata: The CHARMe
Project},
booktitle = {Theory and Practice of Digital Libraries - {TPDL} 2013 Selected Workshops
- {LCPD} 2013, {SUEDL} 2013, DataCur 2013, Held in Valletta, Malta,
September 22-26, 2013. Revised Selected Papers},
series = {Communications in Computer and Information Science},
volume = {416},
pages = {28--39},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-319-08425-1\_4},
doi = {10.1007/978-3-319-08425-1\_4},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ercimdl/BlowerABCKLLMNOP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/BurtDRACL13,
author = {Andrew Burt and
Mathias Disney and
Pasi Raumonen and
John Armston and
Kim Calders and
Philip Lewis},
title = {Rapid characterisation of forest structure from {TLS} and 3D modelling},
booktitle = {2013 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2013, Melbourne, Australia, July 21-26, 2013},
pages = {3387--3390},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/IGARSS.2013.6723555},
doi = {10.1109/IGARSS.2013.6723555},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/BurtDRACL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jisys/HuertaSLY12,
author = {Esperanza Huerta and
Stephen B. Salter and
Philip A. Lewis and
Pamela Yeow},
title = {Motivating Employees to Share Their Failures in Knowledge Management
Systems: Anonymity and Culture},
journal = {J. Inf. Syst.},
volume = {26},
number = {2},
pages = {93--117},
year = {2012},
url = {https://doi.org/10.2308/isys-50214},
doi = {10.2308/ISYS-50214},
timestamp = {Sun, 21 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jisys/HuertaSLY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/CaldersLDVAH12,
author = {Kim Calders and
Philip Lewis and
Mathias Disney and
Jan Verbesselt and
John Armston and
Martin Herold},
title = {Effects of clumping on modelling LiDAR waveforms in forest canopies},
booktitle = {2012 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2012, Munich, Germany, July 22-27, 2012},
pages = {3391--3394},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/IGARSS.2012.6350693},
doi = {10.1109/IGARSS.2012.6350693},
timestamp = {Mon, 16 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/CaldersLDVAH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/LewisGSMWSKFDPNHDKZFBS12,
author = {Philip Lewis and
Luis Guanter and
Gerardo L{\'{o}}pez Salda{\~{n}}a and
Jan{-}Peter Muller and
Gill Watson and
Neville Shane and
Tom Kennedy and
J{\"{u}}rgen Fischer and
Carlos Domenech and
Rene Preusker and
Peter R. J. North and
Andreas Heckel and
Olaf Danne and
Uwe Kr{\"{a}}mer and
Marco Z{\"{u}}hlke and
Norman Fomferra and
Carsten Brockmann and
Crystal Schaaf},
title = {The {ESA} globAlbedo project: Algorithm},
booktitle = {2012 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2012, Munich, Germany, July 22-27, 2012},
pages = {5745--5748},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/IGARSS.2012.6352306},
doi = {10.1109/IGARSS.2012.6352306},
timestamp = {Wed, 25 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/LewisGSMWSKFDPNHDKZFBS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biodb/GaudetBFSTABBBCCCCEGGGGHHIKLLKOORRRSSSTTWWY11,
author = {Pascale Gaudet and
Amos Bairoch and
Dawn Field and
Susanna{-}Assunta Sansone and
Chris F. Taylor and
Teresa K. Attwood and
Alex Bateman and
Judith A. Blake and
Carol J. Bult and
J. Michael Cherry and
Rex L. Chisholm and
Guy Cochrane and
Charles E. Cook and
Janan T. Eppig and
Michael Y. Galperin and
Robert Gentleman and
Carole A. Goble and
Takashi Gojobori and
John M. Hancock and
Douglas G. Howe and
Tadashi Imanishi and
Janet Kelso and
David Landsman and
Suzanna E. Lewis and
Ilene Karsch{-}Mizrachi and
Sandra E. Orchard and
B. F. Francis Ouellette and
Shoba Ranganathan and
Lorna J. Richardson and
Philippe Rocca{-}Serra and
Paul N. Schofield and
Damian Smedley and
Christopher Southan and
Tin Wee Tan and
Tatiana A. Tatusova and
Patricia L. Whetzel and
Owen White and
Chisato Yamasaki},
title = {Towards BioDBcore: a community-defined information specification for
biological databases},
journal = {Database J. Biol. Databases Curation},
volume = {2011},
year = {2011},
url = {https://doi.org/10.1093/database/baq027},
doi = {10.1093/DATABASE/BAQ027},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/biodb/GaudetBFSTABBBCCCCEGGGGHHIKLLKOORRRSSSTTWWY11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/BascoulPBDCL11,
author = {Guillaume Bascoul and
Philippe Perdu and
A. Benigni and
Sylvain Dudit and
Guillaume Celi and
Dean Lewis},
title = {Time Resolved Imaging: From logical states to events, a new and efficient
pattern matching method for {VLSI} analysis},
journal = {Microelectron. Reliab.},
volume = {51},
number = {9-11},
pages = {1640--1645},
year = {2011},
url = {https://doi.org/10.1016/j.microrel.2011.06.043},
doi = {10.1016/J.MICROREL.2011.06.043},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/BascoulPBDCL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/CeliDPPRLV11,
author = {Guillaume Celi and
Sylvain Dudit and
Thierry Parrassin and
Philippe Perdu and
Antoine Reverdy and
Dean Lewis and
Michel Vallet},
title = {{LVI} detection on passive structure in advance {CMOS} technology:
New opportunities for device analysis},
journal = {Microelectron. Reliab.},
volume = {51},
number = {9-11},
pages = {1662--1667},
year = {2011},
url = {https://doi.org/10.1016/j.microrel.2011.07.030},
doi = {10.1016/J.MICROREL.2011.07.030},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/CeliDPPRLV11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/InfantePKGL11,
author = {Fulvio Infante and
Philippe Perdu and
H. B. Kor and
Chee Lip Gan and
Dean Lewis},
title = {Magnetic field spatial Fourier analysis: {A} new opportunity for high
resolution current localization},
journal = {Microelectron. Reliab.},
volume = {51},
number = {9-11},
pages = {1684--1688},
year = {2011},
url = {https://doi.org/10.1016/j.microrel.2011.07.076},
doi = {10.1016/J.MICROREL.2011.07.076},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/InfantePKGL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/GaudetBFSTABBBCCCCEGGGGHHIKLLKOORRRSSSTTWWY11,
author = {Pascale Gaudet and
Amos Bairoch and
Dawn Field and
Susanna{-}Assunta Sansone and
Chris F. Taylor and
Teresa K. Attwood and
Alex Bateman and
Judith A. Blake and
Carol J. Bult and
J. Michael Cherry and
Rex L. Chisholm and
Guy Cochrane and
Charles E. Cook and
Janan T. Eppig and
Michael Y. Galperin and
Robert Gentleman and
Carole A. Goble and
Takashi Gojobori and
John M. Hancock and
Douglas G. Howe and
Tadashi Imanishi and
Janet Kelso and
David Landsman and
Suzanna E. Lewis and
Ilene Karsch{-}Mizrachi and
Sandra E. Orchard and
B. F. Francis Ouellette and
Shoba Ranganathan and
Lorna J. Richardson and
Philippe Rocca{-}Serra and
Paul N. Schofield and
Damian Smedley and
Christopher Southan and
Tin Wee Tan and
Tatiana A. Tatusova and
Patricia L. Whetzel and
Owen White and
Chisato Yamasaki},
title = {Towards BioDBcore: a community-defined information specification for
biological databases},
journal = {Nucleic Acids Res.},
volume = {39},
number = {Database-Issue},
pages = {7--10},
year = {2011},
url = {https://doi.org/10.1093/nar/gkq1173},
doi = {10.1093/NAR/GKQ1173},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/GaudetBFSTABBBCCCCEGGGGHHIKLLKOORRRSSSTTWWY11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/CeliDPRPBLV10,
author = {Guillaume Celi and
Sylvain Dudit and
Philippe Perdu and
Antoine Reverdy and
Thierry Parrassin and
Emmanuel Bechet and
Dean Lewis and
Michel Vallet},
title = {Facing the defect characterization and localization challenges of
bridge defects on a submicronic technology {(45} nm and below)},
journal = {Microelectron. Reliab.},
volume = {50},
number = {9-11},
pages = {1499--1505},
year = {2010},
url = {https://doi.org/10.1016/j.microrel.2010.07.115},
doi = {10.1016/J.MICROREL.2010.07.115},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/CeliDPRPBLV10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/DeyineSPBL10,
author = {A. Deyine and
Kevin Sanchez and
Philippe Perdu and
F. Battistella and
Dean Lewis},
title = {CADless laser assisted methodologies for failure analysis and device
reliability},
journal = {Microelectron. Reliab.},
volume = {50},
number = {9-11},
pages = {1236--1240},
year = {2010},
url = {https://doi.org/10.1016/j.microrel.2010.07.131},
doi = {10.1016/J.MICROREL.2010.07.131},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/DeyineSPBL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/InfantePL10,
author = {Fulvio Infante and
Philippe Perdu and
Dean Lewis},
title = {Magnetic microscopy for ground plane current detection: a fast and
reliable technique for current leakage localization by means of magnetic
simulations},
journal = {Microelectron. Reliab.},
volume = {50},
number = {9-11},
pages = {1700--1705},
year = {2010},
url = {https://doi.org/10.1016/j.microrel.2010.07.109},
doi = {10.1016/J.MICROREL.2010.07.109},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/InfantePL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fpga/ChenPPCAPLWHWM10,
author = {Chen Chen and
Roozbeh Parsa and
Nishant Patil and
Soogine Chong and
Kerem Akarvardar and
J. Provine and
David Lewis and
Jeff Watt and
Roger T. Howe and
H.{-}S. Philip Wong and
Subhasish Mitra},
editor = {Peter Y. K. Cheung and
John Wawrzynek},
title = {Efficient FPGAs using nanoelectromechanical relays},
booktitle = {Proceedings of the {ACM/SIGDA} 18th International Symposium on Field
Programmable Gate Arrays, {FPGA} 2010, Monterey, California, USA,
February 21-23, 2010},
pages = {273--282},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1723112.1723158},
doi = {10.1145/1723112.1723158},
timestamp = {Tue, 06 Nov 2018 16:58:23 +0100},
biburl = {https://dblp.org/rec/conf/fpga/ChenPPCAPLWHWM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pdpta/WelchLLJL10,
author = {Aaron Welch and
Alejandro Lopez{-}Lago and
Mark Lewis and
Philip Jensen and
Ye Liu},
editor = {Hamid R. Arabnia and
Steve C. Chiu and
George A. Gravvanis and
Minoru Ito and
Kazuki Joe and
Hiroaki Nishikawa and
Ashu M. G. Solo},
title = {A Comparison of Load Balancing Algorithms for Spatially Oriented Multi-Agent
Simulation Frameworks},
booktitle = {Proceedings of the International Conference on Parallel and Distributed
Processing Techniques and Applications, {PDPTA} 2010, Las Vegas, Nevada,
USA, July 12-15, 2010, 2 Volumes},
pages = {123--129},
publisher = {{CSREA} Press},
year = {2010},
timestamp = {Tue, 07 Dec 2010 09:22:06 +0100},
biburl = {https://dblp.org/rec/conf/pdpta/WelchLLJL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/whispers/WangSLKSSMC10,
author = {Zhuosen Wang and
Crystal Barker Schaaf and
Philip Lewis and
Yuri Knyazikhin and
Mitchell A. Schull and
Alan H. Strahler and
Ranga B. Myneni and
Mark J. Chopping},
editor = {J{\'{o}}n Atli Benediktsson and
Jocelyn Chanussot and
Bj{\"{o}}rn Waske},
title = {Canopy vertical structure using {MODIS} Bidirectional Reflectance
data},
booktitle = {2nd Workshop on Hyperspectral Image and Signal Processing: Evolution
in Remote Sensing, {WHISPERS} 2010, Reykjavik, Iceland, 14-16, June,
2010},
pages = {1--4},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/WHISPERS.2010.5594952},
doi = {10.1109/WHISPERS.2010.5594952},
timestamp = {Mon, 28 Jun 2021 15:15:01 +0200},
biburl = {https://dblp.org/rec/conf/whispers/WangSLKSSMC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/WishartKGEYGHPDBMSXJCLSSHLFPFCTCLSZDXCGNSLVF09,
author = {David S. Wishart and
Craig Knox and
Anchi Guo and
Roman Eisner and
Nelson Young and
Bijaya Gautam and
David D. Hau and
Nick Psychogios and
Edison Dong and
Souhaila Bouatra and
Rupasri Mandal and
Igor Sinelnikov and
Jianguo Xia and
Leslie Jia and
Joseph A. Cruz and
Emilia Lim and
Constance A. Sobsey and
Savita Shrivastava and
Paul Huang and
Philip Liu and
Lydia Fang and
Jun Peng and
Ryan Fradette and
Dean Cheng and
Dan Tzur and
Melisa Clements and
Avalyn Lewis and
Andrea De Souza and
Azaret Zuniga and
Margot Dawe and
Yeping Xiong and
Derrick Clive and
Russell Greiner and
Alsu Nazyrova and
Rustem Shaykhutdinov and
Liang Li and
Hans J. Vogel and
Ian J. Forsythe},
title = {{HMDB:} a knowledgebase for the human metabolome},
journal = {Nucleic Acids Res.},
volume = {37},
number = {Database-Issue},
pages = {603--610},
year = {2009},
url = {https://doi.org/10.1093/nar/gkn810},
doi = {10.1093/NAR/GKN810},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/WishartKGEYGHPDBMSXJCLSSHLFPFCTCLSZDXCGNSLVF09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/DisneyLBPH09,
author = {Mathias Disney and
Philip Lewis and
Marc Bouvet and
Ana Prieto{-}Blanco and
Steven Hancock},
title = {Quantifying Surface Reflectivity for Spaceborne Lidar via Two Independent
Methods},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {47},
number = {9},
pages = {3262--3271},
year = {2009},
url = {https://doi.org/10.1109/TGRS.2009.2019268},
doi = {10.1109/TGRS.2009.2019268},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/DisneyLBPH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tlt/LewisBGCZ09,
author = {No{\"{e}}lle Lewis and
Michel Billaud and
Didier Geoffroy and
Philippe Cazenave and
Thomas Zimmer},
title = {A Distance Measurement Platform Dedicated to Electrical Engineering},
journal = {{IEEE} Trans. Learn. Technol.},
volume = {2},
number = {4},
pages = {312--319},
year = {2009},
url = {https://doi.org/10.1109/TLT.2009.45},
doi = {10.1109/TLT.2009.45},
timestamp = {Fri, 03 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tlt/LewisBGCZ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fpga/LewisACVLLP09,
author = {David M. Lewis and
Elias Ahmed and
David Cashman and
Tim Vanderhoek and
Christopher Lane and
Andy Lee and
Philip Pan},
editor = {Paul Chow and
Peter Y. K. Cheung},
title = {Architectural enhancements in Stratix-III\({}^{\mbox{TM}}\) and Stratix-IV\({}^{\mbox{TM}}\)},
booktitle = {Proceedings of the {ACM/SIGDA} 17th International Symposium on Field
Programmable Gate Arrays, {FPGA} 2009, Monterey, California, USA,
February 22-24, 2009},
pages = {33--42},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1508128.1508135},
doi = {10.1145/1508128.1508135},
timestamp = {Tue, 06 Nov 2018 16:58:23 +0100},
biburl = {https://dblp.org/rec/conf/fpga/LewisACVLLP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdsc/AppiahHOAL09,
author = {Kofi Appiah and
Andrew Hunter and
Jonathan D. Owens and
Philip Aiken and
Katrina Lewis},
title = {Autonomous real-time surveillance system with distributed {IP} cameras},
booktitle = {Third {ACM/IEEE} International Conference on Distributed Smart Cameras,
{ICDSC} 2009, Como, Italy, August 30 - September 2, 2009},
pages = {1--8},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/ICDSC.2009.5289387},
doi = {10.1109/ICDSC.2009.5289387},
timestamp = {Fri, 22 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdsc/AppiahHOAL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/Gomez-DansWLS09,
author = {Jos{\'{e}} G{\'{o}}mez{-}Dans and
Martin Wooster and
Philip Lewis and
Allan Spessa},
title = {Probabilistic Calibration of a Coupled Ecosystem and Fire Model using
Satellite Data},
booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
{IGARSS} 2009, July 12-17, 2009, University of Cape Town, Cape Town,
South Africa, Proceedings},
pages = {81--84},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/IGARSS.2009.5417367},
doi = {10.1109/IGARSS.2009.5417367},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/Gomez-DansWLS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/Prieto-BlancoDLGG09,
author = {Ana Prieto{-}Blanco and
Mathias Disney and
Philip Lewis and
Jos{\'{e}} G{\'{o}}mez{-}Dans and
Sangram Ganguly},
title = {Satellite Monitoring of Disturbances in Arctic Ecosystems},
booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
{IGARSS} 2009, July 12-17, 2009, University of Cape Town, Cape Town,
South Africa, Proceedings},
pages = {585--588},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/IGARSS.2009.5417825},
doi = {10.1109/IGARSS.2009.5417825},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/Prieto-BlancoDLGG09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/FerrignoMPLHG08,
author = {Julie Ferrigno and
Aziz Machouat and
Philippe Perdu and
Dean Lewis and
G{\'{e}}rald Haller and
Vincent Goubier},
title = {Generic simulator for faulty {IC}},
journal = {Microelectron. Reliab.},
volume = {48},
number = {8-9},
pages = {1592--1596},
year = {2008},
url = {https://doi.org/10.1016/j.microrel.2008.07.013},
doi = {10.1016/J.MICROREL.2008.07.013},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/FerrignoMPLHG08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/MachouatHGLPPFE08,
author = {Aziz Machouat and
G{\'{e}}rald Haller and
Vincent Goubier and
Dean Lewis and
Philippe Perdu and
Vincent Pouget and
Pascal Fouillat and
Fabien Essely},
title = {Effect of physical defect on shmoos in {CMOS} {DSM} technologies},
journal = {Microelectron. Reliab.},
volume = {48},
number = {8-9},
pages = {1333--1338},
year = {2008},
url = {https://doi.org/10.1016/j.microrel.2008.07.043},
doi = {10.1016/J.MICROREL.2008.07.043},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/MachouatHGLPPFE08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/SienkiewiczPFSCL08,
author = {Magdalena Sienkiewicz and
Philippe Perdu and
Abdellatif Firiti and
Kevin Sanchez and
Olivier Cr{\'{e}}pel and
Dean Lewis},
title = {Failure Analysis enhancement by evaluating the Photoelectric Laser
Stimulation impact on mixed-mode ICs},
journal = {Microelectron. Reliab.},
volume = {48},
number = {8-9},
pages = {1529--1532},
year = {2008},
url = {https://doi.org/10.1016/j.microrel.2008.07.060},
doi = {10.1016/J.MICROREL.2008.07.060},
timestamp = {Tue, 11 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mr/SienkiewiczPFSCL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/AyoubLBLAA08,
author = {Fran{\c{c}}ois Ayoub and
S{\'{e}}bastien Leprince and
Renaud Binet and
Kevin W. Lewis and
Oded Aharonson and
Jean{-}Philippe Avouac},
title = {Influence of camera distortions on satellite image registration and
change detection applications},
booktitle = {{IEEE} International Geoscience {\&} Remote Sensing Symposium,
{IGARSS} 2008, July 8-11, 2008, Boston, Massachusetts, USA, Proceedings},
pages = {1072--1075},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/IGARSS.2008.4779184},
doi = {10.1109/IGARSS.2008.4779184},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/AyoubLBLAA08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggrapha/TanLAW08,
author = {Kevin T. W. Tan and
Emma M. Lewis and
Nick J. Avis and
Philip J. Withers},
title = {Using augmented reality to promote an understanding of materials science
to school children},
booktitle = {International Conference on Computer Graphics and Interactive Techniques,
{SIGGRAPH} {ASIA} 2008, Singapore, December 10-13, 2008, Educators
Programme},
pages = {2:1--2:8},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1507713.1507716},
doi = {10.1145/1507713.1507716},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/siggrapha/TanLAW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/BerridgeABBCDDKLMRSSSTRRRW07,
author = {Rex Berridge and
Robert M. Averill III and
Arnold E. Barish and
Michael A. Bowen and
Peter J. Camporese and
Jack DiLullo and
Peter E. Dudley and
Joachim Keinert and
David W. Lewis and
Robert D. Morel and
Thomas E. Rosser and
Nicole S. Schwartz and
Philip Shephard and
Howard H. Smith and
Dave Thomas and
Phillip J. Restle and
John R. Ripley and
Stephen L. Runyon and
Patrick M. Williams},
title = {{IBM} {POWER6} microprocessor physical design and design methodology},
journal = {{IBM} J. Res. Dev.},
volume = {51},
number = {6},
pages = {685--714},
year = {2007},
url = {https://doi.org/10.1147/rd.516.0685},
doi = {10.1147/RD.516.0685},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/BerridgeABBCDDKLMRSSSTRRRW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/PolBSFLBSSFB07,
author = {L. A. van de Pol and
Josephine Barnes and
Rachael I. Scahill and
Chris Frost and
Emma B. Lewis and
Richard G. Boyes and
Ronald A. van Schijndel and
Philip Scheltens and
Nick C. Fox and
Frederik Barkhof},
title = {Improved reliability of hippocampal atrophy rate measurement in mild
cognitive impairment using fluid registration},
journal = {NeuroImage},
volume = {34},
number = {3},
pages = {1036--1041},
year = {2007},
url = {https://doi.org/10.1016/j.neuroimage.2006.10.033},
doi = {10.1016/J.NEUROIMAGE.2006.10.033},
timestamp = {Mon, 25 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/PolBSFLBSSFB07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/uais/KeatesABCGGHHKLLPRRSSSTV07,
author = {Simeon Keates and
Ray Adams and
Cathy Bodine and
Sara J. Czaja and
Wayne Gordon and
Peter Gregor and
Emily Hacker and
Vicki L. Hanson and
John Kemp and
Mark Laff and
Clayton Lewis and
Michael Pieper and
John T. Richards and
David Rose and
Anthony Savidis and
Greg Schultz and
Paul Snayd and
Shari Trewin and
Philip Varker},
title = {Cognitive and learning difficulties and how they affect access to
{IT} systems},
journal = {Univers. Access Inf. Soc.},
volume = {5},
number = {4},
pages = {329--339},
year = {2007},
url = {https://doi.org/10.1007/s10209-006-0058-4},
doi = {10.1007/S10209-006-0058-4},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/uais/KeatesABCGGHHKLLPRRSSSTV07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijfcs/LuBL06,
author = {Shiyong Lu and
Arthur J. Bernstein and
Philip M. Lewis},
title = {Completeness and realizability: conditions for automatic generation
of workflows},
journal = {Int. J. Found. Comput. Sci.},
volume = {17},
number = {1},
pages = {223--245},
year = {2006},
url = {https://doi.org/10.1142/S0129054106003784},
doi = {10.1142/S0129054106003784},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijfcs/LuBL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/DouinPMLPF06,
author = {Alexandre Douin and
Vincent Pouget and
M. De Matos and
Dean Lewis and
Philippe Perdu and
Pascal Fouillat},
title = {Time resolved imaging using synchronous picosecond Photoelectric Laser
Stimulation},
journal = {Microelectron. Reliab.},
volume = {46},
number = {9-11},
pages = {1514--1519},
year = {2006},
url = {https://doi.org/10.1016/j.microrel.2006.07.028},
doi = {10.1016/J.MICROREL.2006.07.028},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/DouinPMLPF06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/EsselyDPRBGBPTL06,
author = {Fabien Essely and
Fr{\'{e}}d{\'{e}}ric Darracq and
Vincent Pouget and
Mustapha Remmach and
Felix Beaudoin and
Nicolas Guitard and
Marise Bafleur and
Philippe Perdu and
Andr{\'{e}} Touboul and
Dean Lewis},
title = {Application of various optical techniques for {ESD} defect localization},
journal = {Microelectron. Reliab.},
volume = {46},
number = {9-11},
pages = {1563--1568},
year = {2006},
url = {https://doi.org/10.1016/j.microrel.2006.07.021},
doi = {10.1016/J.MICROREL.2006.07.021},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/EsselyDPRBGBPTL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcs/LuBL06,
author = {Shiyong Lu and
Arthur J. Bernstein and
Philip M. Lewis},
title = {Automatic workflow verification and generation},
journal = {Theor. Comput. Sci.},
volume = {353},
number = {1-3},
pages = {71--92},
year = {2006},
url = {https://doi.org/10.1016/j.tcs.2005.10.035},
doi = {10.1016/J.TCS.2005.10.035},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcs/LuBL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eScience/DoveWWBAASCTTCDATCEMPBCDLLAABM06,
author = {Martin T. Dove and
Toby O. H. White and
Andrew M. Walker and
Richard Paul Bruin and
Kat F. Austen and
Emilio Artacho and
L. A. Sullivan and
Mark Calleja and
Matthew G. Tucker and
Rik P. Tyer and
Philip A. Couch and
Kerstin Kleese van Dam and
R. J. Allan and
Ilian T. Todorov and
Clovis Chapman and
Wolfgang Emmerich and
Arnaud Marmier and
Steve C. Parker and
M. O. Blanchard and
C. Richard A. Catlow and
Z. Du and
N. de Leeuw and
Gareth J. Lewis and
Vassil Alexandrov and
M. Alfredsson and
J. P. Brodholt and
Peter Murray{-}Rust},
title = {Computational Grids for Mid-Sized Collaborative Projects: The eMinerals
Experience},
booktitle = {Second International Conference on e-Science and Grid Technologies
(e-Science 2006), 4-6 December 2006, Amsterdam, The Netherlands},
pages = {95},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/E-SCIENCE.2006.261179},
doi = {10.1109/E-SCIENCE.2006.261179},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eScience/DoveWWBAASCTTCDATCEMPBCDLLAABM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/flairs/McCarthyLDM06,
author = {Philip M. McCarthy and
Gwyneth A. Lewis and
David F. Dufty and
Danielle S. McNamara},
editor = {Geoff Sutcliffe and
Randy Goebel},
title = {Analyzing Writing Styles with Coh-Metrix},
booktitle = {Proceedings of the Nineteenth International Florida Artificial Intelligence
Research Society Conference, Melbourne Beach, Florida, USA, May 11-13,
2006},
pages = {764--769},
publisher = {{AAAI} Press},
year = {2006},
url = {http://www.aaai.org/Library/FLAIRS/2006/flairs06-151.php},
timestamp = {Wed, 26 Oct 2022 08:35:26 +0200},
biburl = {https://dblp.org/rec/conf/flairs/McCarthyLDM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/FiritiBHPLF05,
author = {Abdellatif Firiti and
Felix Beaudoin and
G{\'{e}}rald Haller and
Philippe Perdu and
Dean Lewis and
Pascal Fouillat},
title = {Impact of semiconductors material on {IR} Laser Stimulation signal},
journal = {Microelectron. Reliab.},
volume = {45},
number = {9-11},
pages = {1465--1470},
year = {2005},
url = {https://doi.org/10.1016/j.microrel.2005.07.029},
doi = {10.1016/J.MICROREL.2005.07.029},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/FiritiBHPLF05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/GuitardETBNPTPL05,
author = {Nicolas Guitard and
Fabien Essely and
David Tr{\'{e}}mouilles and
Marise Bafleur and
Nicolas Nolhier and
Philippe Perdu and
Andr{\'{e}} Touboul and
Vincent Pouget and
Dean Lewis},
title = {Different Failure signatures of multiple {TLP} and {HBM} Stresses
in an {ESD} robust protection structure},
journal = {Microelectron. Reliab.},
volume = {45},
number = {9-11},
pages = {1415--1420},
year = {2005},
url = {https://doi.org/10.1016/j.microrel.2005.07.030},
doi = {10.1016/J.MICROREL.2005.07.030},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/GuitardETBNPTPL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/RemmachPDPLND05,
author = {Mustapha Remmach and
A. Pigozzi and
Romain Desplats and
Philippe Perdu and
Dean Lewis and
J. Noel and
Sylvain Dudit},
title = {Light Emission to Time Resolved Emission For {IC} Debug and Failure
Analysis},
journal = {Microelectron. Reliab.},
volume = {45},
number = {9-11},
pages = {1476--1481},
year = {2005},
url = {https://doi.org/10.1016/j.microrel.2005.07.034},
doi = {10.1016/J.MICROREL.2005.07.034},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/RemmachPDPLND05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iolts/DouinPLFP05,
author = {Alexandre Douin and
Vincent Pouget and
Dean Lewis and
Pascal Fouillat and
Philippe Perdu},
title = {Electrical Modeling for Laser Testing with Different Pulse Durations},
booktitle = {11th {IEEE} International On-Line Testing Symposium {(IOLTS} 2005),
6-8 July 2005, Saint Raphael, France},
pages = {9--13},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/IOLTS.2005.27},
doi = {10.1109/IOLTS.2005.27},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iolts/DouinPLFP05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/EsselyBGBWDPTL04,
author = {Fabien Essely and
Corinne Bestory and
Nicolas Guitard and
Marise Bafleur and
A. Wislez and
E. Doche and
Philippe Perdu and
Andr{\'{e}} Touboul and
Dean Lewis},
title = {Study of the {ESD} defects impact on ICs reliability},
journal = {Microelectron. Reliab.},
volume = {44},
number = {9-11},
pages = {1811--1815},
year = {2004},
url = {https://doi.org/10.1016/j.microrel.2004.07.090},
doi = {10.1016/J.MICROREL.2004.07.090},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/EsselyBGBWDPTL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/FiritiBHPLF04,
author = {Abdellatif Firiti and
Felix Beaudoin and
G{\'{e}}rald Haller and
Philippe Perdu and
Dean Lewis and
Pascal Fouillat},
title = {Understanding the effects of {NIR} laser stimulation on {NMOS} transistor},
journal = {Microelectron. Reliab.},
volume = {44},
number = {9-11},
pages = {1675--1680},
year = {2004},
url = {https://doi.org/10.1016/j.microrel.2004.07.052},
doi = {10.1016/J.MICROREL.2004.07.052},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/FiritiBHPLF04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkde/LuBL04,
author = {Shiyong Lu and
Arthur J. Bernstein and
Philip M. Lewis},
title = {Correct Execution of Transactions at Different Isolation Levels},
journal = {{IEEE} Trans. Knowl. Data Eng.},
volume = {16},
number = {9},
pages = {1070--1081},
year = {2004},
url = {https://doi.org/10.1109/TKDE.2004.34},
doi = {10.1109/TKDE.2004.34},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tkde/LuBL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsoc/DuanBLL04,
author = {Ziyang Duan and
Arthur J. Bernstein and
Philip M. Lewis and
Shiyong Lu},
editor = {Marco Aiello and
Mikio Aoyama and
Francisco Curbera and
Mike P. Papazoglou},
title = {A model for abstract process specification, verification and composition},
booktitle = {Service-Oriented Computing - {ICSOC} 2004, Second International Conference,
New York, NY, USA, November 15-19, 2004, Proceedings},
pages = {232--241},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/1035167.1035201},
doi = {10.1145/1035167.1035201},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icsoc/DuanBLL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icws/DuanBLL04,
author = {Ziyang Duan and
Arthur J. Bernstein and
Philip M. Lewis and
Shiyong Lu},
title = {Semantics Based Verification and Synthesis of {BPEL4WS} Abstract Processes},
booktitle = {Proceedings of the {IEEE} International Conference on Web Services
(ICWS'04), June 6-9, 2004, San Diego, California, {USA}},
pages = {734--737},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/ICWS.2004.1314805},
doi = {10.1109/ICWS.2004.1314805},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icws/DuanBLL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/QuaifeLDLWP04,
author = {Tristan Quaife and
Philip Lewis and
Mathias Disney and
Mark Lomas and
Ian Woodward and
Ghislain Picard},
title = {Coupling a Canopy Reflectance Model with a Global Vegetation Model},
booktitle = {2004 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2004, Anchorage, Alaska, USA, 20-24 September 2004},
pages = {11},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/IGARSS.2004.1368931},
doi = {10.1109/IGARSS.2004.1368931},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/QuaifeLDLWP04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/RebeloLR04,
author = {Lisa Rebelo and
Philip Lewis and
David P. Roy},
title = {A temporal-BRDF model-based approach to change detection},
booktitle = {2004 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2004, Anchorage, Alaska, USA, 20-24 September 2004},
pages = {2103--2106},
publisher = {{IEEE}},
year = {2004},
url = {https://doi.org/10.1109/IGARSS.2004.1370772},
doi = {10.1109/IGARSS.2004.1370772},
timestamp = {Thu, 25 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/RebeloLR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejasp/Etienne-CummingsPL03,
author = {Ralph Etienne{-}Cummings and
Philippe O. Pouliquen and
M. Anthony Lewis},
title = {A Vision Chip for Color Segmentation and Pattern Matching},
journal = {{EURASIP} J. Adv. Signal Process.},
volume = {2003},
number = {7},
pages = {703--712},
year = {2003},
url = {https://doi.org/10.1155/S1110865703302021},
doi = {10.1155/S1110865703302021},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ejasp/Etienne-CummingsPL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/BeaucheneLBPPFD03,
author = {Thomas Beauch{\^{e}}ne and
Dean Lewis and
Felix Beaudoin and
Vincent Pouget and
Philippe Perdu and
Pascal Fouillat and
Yves Danto},
title = {A physical approach on {SCOBIC} investigation in {VLSI}},
journal = {Microelectron. Reliab.},
volume = {43},
number = {1},
pages = {173--177},
year = {2003},
url = {https://doi.org/10.1016/S0026-2714(02)00282-2},
doi = {10.1016/S0026-2714(02)00282-2},
timestamp = {Wed, 20 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/BeaucheneLBPPFD03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/BeaudoinDPFHPL03,
author = {Felix Beaudoin and
Romain Desplats and
Philippe Perdu and
Abdellatif Firiti and
G{\'{e}}rald Haller and
Vincent Pouget and
Dean Lewis},
title = {From Static Thermal and Photoelectric Laser Stimulation {(TLS/PLS)}
to Dynamic Laser Testing},
journal = {Microelectron. Reliab.},
volume = {43},
number = {9-11},
pages = {1681--1686},
year = {2003},
url = {https://doi.org/10.1016/S0026-2714(03)00305-6},
doi = {10.1016/S0026-2714(03)00305-6},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/BeaudoinDPFHPL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/FiritiFHMGPBL03,
author = {Abdellatif Firiti and
D. Faujour and
G{\'{e}}rald Haller and
J. M. Moragues and
Vincent Goubier and
Philippe Perdu and
Felix Beaudoin and
Dean Lewis},
title = {Short defect characterization based on {TCR} parameter extraction},
journal = {Microelectron. Reliab.},
volume = {43},
number = {9-11},
pages = {1563--1568},
year = {2003},
url = {https://doi.org/10.1016/S0026-2714(03)00275-0},
doi = {10.1016/S0026-2714(03)00275-0},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/FiritiFHMGPBL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003},
url = {https://doi.org/10.1145/945546.945549},
doi = {10.1145/945546.945549},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/DisneySL03,
author = {Mathias I. Disney and
Paul Saich and
Philip Lewis},
title = {Modelling the radiometric response of a dynamic, 3D structural model
of Scots pine in the optical and microwave domains},
booktitle = {2003 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2003, Toulouse, France, July 21-15, 2003},
pages = {3537--3539},
publisher = {{IEEE}},
year = {2003},
url = {https://doi.org/10.1109/IGARSS.2003.1294846},
doi = {10.1109/IGARSS.2003.1294846},
timestamp = {Wed, 19 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/DisneySL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/LewisSDAFL03,
author = {Philip Lewis and
Paul Saich and
Mathias Disney and
Bruno Andrieu and
Christian Fournier and
S. Ljutovac},
title = {Modelling the radiometric response of a dynamic, 3D structural model
of wheat in the optical and microwave domains},
booktitle = {2003 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2003, Toulouse, France, July 21-15, 2003},
pages = {3543--3545},
publisher = {{IEEE}},
year = {2003},
url = {https://doi.org/10.1109/IGARSS.2003.1294848},
doi = {10.1109/IGARSS.2003.1294848},
timestamp = {Fri, 07 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/LewisSDAFL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/RebeloLR03,
author = {Lisa Rebelo and
Philip Lewis and
David P. Roy},
title = {Burn scar detection in southern Africa using a bi-directional reflectance
model based approach},
booktitle = {2003 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2003, Toulouse, France, July 21-15, 2003},
pages = {997--999},
publisher = {{IEEE}},
year = {2003},
url = {https://doi.org/10.1109/IGARSS.2003.1293990},
doi = {10.1109/IGARSS.2003.1293990},
timestamp = {Fri, 07 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/RebeloLR03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/ThackrahL03,
author = {Graham Thackrah and
Philip Lewis},
title = {An initial analysis of CHRIS-on-board-PROBA data for the purposes
of biophysical parameter mapping over a variety of land cover types},
booktitle = {2003 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2003, Toulouse, France, July 21-15, 2003},
pages = {2017--2019},
publisher = {{IEEE}},
year = {2003},
url = {https://doi.org/10.1109/IGARSS.2003.1294325},
doi = {10.1109/IGARSS.2003.1294325},
timestamp = {Fri, 07 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/ThackrahL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ibmrd/LuddenRHRJCBBPABKKLLMMNPPRSTVW02,
author = {John M. Ludden and
Wolfgang Roesner and
Gerry M. Heiling and
John R. Reysa and
Jonathan R. Jackson and
Bing{-}Lun Chu and
Michael L. Behm and
Jason Baumgartner and
Richard D. Peterson and
Jamee Abdulhafiz and
William E. Bucy and
John H. Klaus and
Danny J. Klema and
Tien N. Le and
F. Danette Lewis and
Philip E. Milling and
Lawrence A. McConville and
Bradley S. Nelson and
Viresh Paruthi and
Travis W. Pouarz and
Audre D. Romonosky and
Jeff Stuecheli and
Kent D. Thompson and
Dave W. Victor and
Bruce Wile},
title = {Functional verification of the {POWER4} microprocessor and {POWER4}
multiprocessor system},
journal = {{IBM} J. Res. Dev.},
volume = {46},
number = {1},
pages = {53--76},
year = {2002},
url = {https://doi.org/10.1147/rd.461.0053},
doi = {10.1147/RD.461.0053},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ibmrd/LuddenRHRJCBBPABKKLLMMNPPRSTVW02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/technometrics/PrescottDDL02,
author = {Philip Prescott and
Angela M. Dean and
Norman R. Draper and
Susan M. Lewis},
title = {Mixture Experiments: ILL-Conditioning and Quadratic Model Specification},
journal = {Technometrics},
volume = {44},
number = {3},
pages = {260--268},
year = {2002},
url = {https://doi.org/10.1198/004017002188618446},
doi = {10.1198/004017002188618446},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/technometrics/PrescottDDL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/SchaafS0LJLZTML02,
author = {Crystal Barker Schaaf and
Alan H. Strahler and
Feng Gao and
Wolfgang Lucht and
Yufang Jin and
Xiaowen Li and
Xiaoyang Zhang and
Elena Tsvetsinskaya and
Jan{-}Peter Muller and
Philip Lewis and
Michael J. Barnsley and
Gareth Roberts and
Christopher Doll and
Shunlin Liang and
David P. Roy and
Jeffrey L. Privette},
title = {Global albedo, {BRDF} and nadir BRDF-adjusted reflectance products
from {MODIS}},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2002, Toronto, Ontario, Canada, 24-28 June 2002},
pages = {1188--1190},
publisher = {{IEEE}},
year = {2002},
url = {https://doi.org/10.1109/IGARSS.2002.1025877},
doi = {10.1109/IGARSS.2002.1025877},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/SchaafS0LJLZTML02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/aw/LewisBK01,
author = {Philip M. Lewis and
Arthur J. Bernstein and
Michael Kifer},
title = {Databases and Transaction Processing: An Application-Oriented Approach},
publisher = {Addison-Wesley},
year = {2001},
isbn = {0-201-70872-8},
timestamp = {Thu, 03 Jan 2002 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/aw/LewisBK01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/LewisPBLFTBP01,
author = {Dean Lewis and
Vincent Pouget and
Thomas Beauch{\^{e}}ne and
Herv{\'{e}} Lapuyade and
Pascal Fouillat and
Andr{\'{e}} Touboul and
Felix Beaudoin and
Philippe Perdu},
title = {Front Side and Backside {OBIT} Mappings applied to Single Event Transient
Testing},
journal = {Microelectron. Reliab.},
volume = {41},
number = {9-10},
pages = {1471--1476},
year = {2001},
url = {https://doi.org/10.1016/S0026-2714(01)00198-6},
doi = {10.1016/S0026-2714(01)00198-6},
timestamp = {Wed, 20 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/LewisPBLFTBP01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/AttwoodCFLMSSW00,
author = {Terri K. Attwood and
Michael D. R. Croning and
Darren R. Flower and
A. P. Lewis and
J. E. Mabey and
Philip Scordis and
J. N. Selley and
W. Wright},
title = {{PRINTS-S:} the database formerly known as {PRINTS}},
journal = {Nucleic Acids Res.},
volume = {28},
number = {1},
pages = {225--227},
year = {2000},
url = {https://doi.org/10.1093/nar/28.1.225},
doi = {10.1093/NAR/28.1.225},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/AttwoodCFLMSSW00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigsoft/CleavelandLS00,
author = {Rance Cleaveland and
Philip M. Lewis and
Scott A. Smolka},
title = {Practical techniques for the design, specification, verification,
and implementation of concurrent systems},
journal = {{ACM} {SIGSOFT} Softw. Eng. Notes},
volume = {25},
number = {1},
pages = {43--44},
year = {2000},
url = {https://doi.org/10.1145/340855.340878},
doi = {10.1145/340855.340878},
timestamp = {Thu, 17 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigsoft/CleavelandLS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkl/FeurzeigKLS00,
author = {Wallace Feurzeig and
Gabriel Katz and
Philip Lewis and
Victor Steinbok},
title = {Two-Parameter Universes: Part 1 Consider a Rectangular Point..},
journal = {Int. J. Comput. Math. Learn.},
volume = {5},
number = {2},
pages = {169--178},
year = {2000},
url = {https://doi.org/10.1023/A\%3A1009854121483},
doi = {10.1023/A\%3A1009854121483},
timestamp = {Tue, 19 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tkl/FeurzeigKLS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkl/FeurzeigKLS00a,
author = {Wallace Feurzeig and
Gabriel Katz and
Philip Lewis and
Victor Steinbok},
title = {Two-Parameter Universes. Part 2. Picture a Quadratic Polynomial..},
journal = {Int. J. Comput. Math. Learn.},
volume = {5},
number = {3},
pages = {263--274},
year = {2000},
url = {https://doi.org/10.1023/A\%3A1009809630326},
doi = {10.1023/A\%3A1009809630326},
timestamp = {Tue, 19 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tkl/FeurzeigKLS00a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icde/BernsteinLL00,
author = {Arthur J. Bernstein and
Philip M. Lewis and
Shiyong Lu},
editor = {David B. Lomet and
Gerhard Weikum},
title = {Semantic Conditions for Correctness at Different Isolation Levels},
booktitle = {Proceedings of the 16th International Conference on Data Engineering,
San Diego, California, USA, February 28 - March 3, 2000},
pages = {57--66},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/ICDE.2000.839387},
doi = {10.1109/ICDE.2000.839387},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icde/BernsteinLL00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/is/BernsteinGL99,
author = {Arthur J. Bernstein and
David Scott Gerstl and
Philip M. Lewis},
title = {Concurrency control for step-decomposed transactions},
journal = {Inf. Syst.},
volume = {24},
number = {8},
pages = {673--698},
year = {1999},
url = {https://doi.org/10.1016/S0306-4379(00)00004-1},
doi = {10.1016/S0306-4379(00)00004-1},
timestamp = {Wed, 14 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/is/BernsteinGL99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/AttwoodFLMMSSW99,
author = {Terri K. Attwood and
Darren R. Flower and
A. P. Lewis and
J. E. Mabey and
S. R. Morgan and
Philip Scordis and
J. N. Selley and
W. Wright},
title = {{PRINTS} prepares for the new millennium},
journal = {Nucleic Acids Res.},
volume = {27},
number = {1},
pages = {220--225},
year = {1999},
url = {https://doi.org/10.1093/nar/27.1.220},
doi = {10.1093/NAR/27.1.220},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/AttwoodFLMMSSW99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/CudahyWCMP99,
author = {Thomas Cudahy and
Lewis B. Whitbourn and
Philip M. Connor and
Peter Mason and
Richard N. Phillips},
title = {Mapping surface mineralogy and scattering behavior using backscattered
reflectance from a hyperspectral midinfrared airborne {CO} \({}_{\mbox{2}}\)
laser system (MIRACO\({}_{\mbox{2}}\)LAS)},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {37},
number = {4},
pages = {2019--2034},
year = {1999},
url = {https://doi.org/10.1109/36.774713},
doi = {10.1109/36.774713},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/CudahyWCMP99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/JusticeVTDRHSPRSLMKRNWHLWGMLB98,
author = {Christopher Justice and
Eric F. Vermote and
John R. Townshend and
Ruth S. DeFries and
David P. Roy and
Dorothy K. Hall and
Vincent V. Salomonson and
Jeffrey L. Privette and
George A. Riggs and
Alan H. Strahler and
Wolfgang Lucht and
Ranga B. Myneni and
Yuri Knyazikhin and
Steven W. Running and
Ramakrishna R. Nemani and
Zhengming Wan and
Alfredo R. Huete and
Wim van Leeuwen and
Robert E. Wolfe and
Louis Giglio and
Jan{-}Peter Muller and
Philip Lewis and
Michael J. Barnsley},
title = {The Moderate Resolution Imaging Spectroradiometer {(MODIS):} land
remote sensing for global change research},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {36},
number = {4},
pages = {1228--1249},
year = {1998},
url = {https://doi.org/10.1109/36.701075},
doi = {10.1109/36.701075},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/JusticeVTDRHSPRSLMKRNWHLWGMLB98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icde/BernsteinGLL98,
author = {Arthur J. Bernstein and
David Scott Gerstl and
Wai{-}Hong Leung and
Philip M. Lewis},
editor = {Susan Darling Urban and
Elisa Bertino},
title = {Design and Performance of an Assertional Concurrency Control System},
booktitle = {Proceedings of the Fourteenth International Conference on Data Engineering,
Orlando, Florida, USA, February 23-27, 1998},
pages = {436--445},
publisher = {{IEEE} Computer Society},
year = {1998},
url = {https://doi.org/10.1109/ICDE.1998.655806},
doi = {10.1109/ICDE.1998.655806},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icde/BernsteinGLL98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dpd/BernsteinL96,
author = {Arthur J. Bernstein and
Philip M. Lewis},
title = {Transaction Decomposition Using Transaction Semantics},
journal = {Distributed Parallel Databases},
volume = {4},
number = {1},
pages = {25--47},
year = {1996},
url = {https://doi.org/10.1007/BF00122147},
doi = {10.1007/BF00122147},
timestamp = {Mon, 18 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dpd/BernsteinL96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cav/CleavelandLSS96,
author = {Rance Cleaveland and
Philip M. Lewis and
Scott A. Smolka and
Oleg Sokolsky},
editor = {Rajeev Alur and
Thomas A. Henzinger},
title = {The Concurrency Factory: {A} Development Environment for Concurrent
Systems},
booktitle = {Computer Aided Verification, 8th International Conference, {CAV} '96,
New Brunswick, NJ, USA, July 31 - August 3, 1996, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1102},
pages = {398--401},
publisher = {Springer},
year = {1996},
url = {https://doi.org/10.1007/3-540-61474-5\_88},
doi = {10.1007/3-540-61474-5\_88},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/cav/CleavelandLSS96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/seke/CleavelandLLS96,
author = {Rance Cleaveland and
Insup Lee and
Philip M. Lewis and
Scott A. Smolka},
title = {A Theory of Testing for Soft Real-Time Processes},
booktitle = {The 8th International Conference on Software Engineering and Knowledge
Engineering, {SEKE} '96, Lake Tahoe, Nevada, USA, June 10-12, 1996},
pages = {474--479},
publisher = {Knowledge Systems Institute},
year = {1996},
timestamp = {Thu, 26 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/seke/CleavelandLLS96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tacas/CleavelandLSS96,
author = {Rance Cleaveland and
Philip M. Lewis and
Scott A. Smolka and
Oleg Sokolsky},
editor = {Tiziana Margaria and
Bernhard Steffen},
title = {The Concurrency Factory Software Development Environment},
booktitle = {Tools and Algorithms for Construction and Analysis of Systems, Second
International Workshop, {TACAS} '96, Passau, Germany, March 27-29,
1996, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1055},
pages = {391--395},
publisher = {Springer},
year = {1996},
url = {https://doi.org/10.1007/3-540-61042-1\_56},
doi = {10.1007/3-540-61042-1\_56},
timestamp = {Sun, 02 Jun 2019 21:19:27 +0200},
biburl = {https://dblp.org/rec/conf/tacas/CleavelandLSS96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dimacs/CleavelandGLSSZ94,
author = {Rance Cleaveland and
Jayesh N. Gada and
Philip M. Lewis and
Scott A. Smolka and
Oleg Sokolsky and
Shipei Zhang},
editor = {Guy E. Blelloch and
K. Mani Chandy and
Suresh Jagannathan},
title = {The Concurrency Factory - Practical Tools for Specification, Stimulation,
Verification, and Implementation of Concurrent Systems},
booktitle = {Specification of Parallel Algorithms, Proceedings of a {DIMACS} Workshop,
Princeton, New Jersey, USA, May 9-11, 1994},
series = {{DIMACS} Series in Discrete Mathematics and Theoretical Computer Science},
volume = {18},
pages = {75--89},
publisher = {{DIMACS/AMS}},
year = {1994},
url = {https://doi.org/10.1090/dimacs/018/06},
doi = {10.1090/DIMACS/018/06},
timestamp = {Mon, 22 May 2023 16:07:35 +0200},
biburl = {https://dblp.org/rec/conf/dimacs/CleavelandGLSSZ94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/daglib/0081844,
author = {Arthur J. Bernstein and
Philip M. Lewis},
title = {Concurrency in programming and database systems},
publisher = {Jones and Bartlett Publishers},
year = {1993},
isbn = {978-0-86720-205-2},
timestamp = {Fri, 29 Apr 2011 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/daglib/0081844.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ndjfl/Gent92,
author = {Ian P. Gent},
title = {A Sequent- or Tableau-style System for Lewis's Counterfactual Logic
{VC}},
journal = {Notre Dame J. Formal Log.},
volume = {33},
number = {3},
pages = {369--382},
year = {1992},
url = {https://doi.org/10.1305/ndjfl/1093634402},
doi = {10.1305/NDJFL/1093634402},
timestamp = {Thu, 21 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ndjfl/Gent92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ior/HeidelbergerL84,
author = {Philip Heidelberger and
Peter A. W. Lewis},
title = {Quantile Estimation in Dependent Sequences},
journal = {Oper. Res.},
volume = {32},
number = {1},
pages = {185--209},
year = {1984},
url = {https://doi.org/10.1287/opre.32.1.185},
doi = {10.1287/OPRE.32.1.185},
timestamp = {Tue, 31 Mar 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ior/HeidelbergerL84.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/HeidelbergerL81,
author = {Philip Heidelberger and
Peter A. W. Lewis},
title = {Regression-Adjusted Estimates for Regenerative Simulations, with Graphics},
journal = {Commun. {ACM}},
volume = {24},
number = {4},
pages = {260--273},
year = {1981},
url = {https://doi.org/10.1145/358598.358641},
doi = {10.1145/358598.358641},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/HeidelbergerL81.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/berkeley/RosenkrantzSL77,
author = {Daniel J. Rosenkrantz and
Richard Edwin Stearns and
Philip M. Lewis II},
title = {A System Level Concurrency Control for Distributed Database Systems},
booktitle = {Proceedings of the Second Berkeley Workshop on Distributed Data Management
and Computer Networks, May 25-27, 1977},
pages = {132--145},
publisher = {Technical Information Department, Lawrence Berkeley Laboratory, University
of California, Berkeley {CA}},
year = {1977},
timestamp = {Sat, 03 Aug 2019 18:08:49 +0200},
biburl = {https://dblp.org/rec/conf/berkeley/RosenkrantzSL77.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/Lewis66,
author = {Philip M. Lewis II},
title = {A Lower Bound on the Number of Corrections Required for Convergence
of the Single Threshold Gate Adaptive Procedure},
journal = {{IEEE} Trans. Electron. Comput.},
volume = {15},
number = {6},
pages = {933--935},
year = {1966},
url = {https://doi.org/10.1109/PGEC.1966.264480},
doi = {10.1109/PGEC.1966.264480},
timestamp = {Wed, 20 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/Lewis66.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/CoatesL64,
author = {Clarence L. Coates and
Philip M. Lewis II},
title = {{DONUT:} {A} Threshold Gate Computer},
journal = {{IEEE} Trans. Electron. Comput.},
volume = {13},
number = {3},
pages = {240--247},
year = {1964},
url = {https://doi.org/10.1109/PGEC.1964.263910},
doi = {10.1109/PGEC.1964.263910},
timestamp = {Wed, 20 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/CoatesL64.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/afips/ColeDL64,
author = {M. Phyllis Cole and
Philip H. Dorn and
C. Richard Lewis},
title = {Operational software in a disk oriented system},
booktitle = {Proceedings of the 1964 fall joint computer conference, part I, {AFIPS}
1964 (Fall, part I), San Francisco, California, USA, October 27-29,
1964},
pages = {351--362},
publisher = {{ACM}},
year = {1964},
url = {https://doi.org/10.1145/1464052.1464083},
doi = {10.1145/1464052.1464083},
timestamp = {Mon, 19 Apr 2021 12:25:12 +0200},
biburl = {https://dblp.org/rec/conf/afips/ColeDL64.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/CoatesL63,
author = {Clarence L. Coates and
Philip M. Lewis II},
title = {A Realization Procedure for Threshold Gate Networks},
journal = {{IEEE} Trans. Electron. Comput.},
volume = {12},
number = {5},
pages = {454--461},
year = {1963},
url = {https://doi.org/10.1109/PGEC.1963.263625},
doi = {10.1109/PGEC.1963.263625},
timestamp = {Wed, 20 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/CoatesL63.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/LewisC63a,
author = {Philip M. Lewis II and
Clarence L. Coates},
title = {Realization of Logical Functions by a Network of Threshold Components
with Specified Sensitivity},
journal = {{IEEE} Trans. Electron. Comput.},
volume = {12},
number = {5},
pages = {443--454},
year = {1963},
url = {https://doi.org/10.1109/PGEC.1963.263624},
doi = {10.1109/PGEC.1963.263624},
timestamp = {Wed, 20 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/LewisC63a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/CoatesKL62,
author = {Clarence L. Coates and
Roger B. Kirchner and
Philip M. Lewis II},
title = {A Simplified Procedure for the Realization of Linearly-Separable Switching
Functions},
journal = {{IRE} Trans. Electron. Comput.},
volume = {11},
number = {4},
pages = {447--458},
year = {1962},
url = {https://doi.org/10.1109/TEC.1962.5219383},
doi = {10.1109/TEC.1962.5219383},
timestamp = {Mon, 25 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/CoatesKL62.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/focs/LewisC62,
author = {Philip M. Lewis II and
C. L. Coates},
title = {A realization procedure for threshold gate networks},
booktitle = {3rd Annual Symposium on Switching Circuit Theory and Logical Design,
Chicago, Illinois, USA, October 7-12, 1962},
pages = {159--168},
publisher = {{IEEE} Computer Society},
year = {1962},
url = {https://doi.org/10.1109/FOCS.1962.2},
doi = {10.1109/FOCS.1962.2},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/focs/LewisC62.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iandc/Lewis61,
author = {Philip M. Lewis II},
title = {A Note on Realization of Decision Networks Using Summation Elements},
journal = {Inf. Control.},
volume = {4},
number = {2-3},
pages = {282--290},
year = {1961},
url = {https://doi.org/10.1016/S0019-9958(61)80022-3},
doi = {10.1016/S0019-9958(61)80022-3},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iandc/Lewis61.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-10-05 07:37 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
