default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Patrícia D. Costa"
download as .bib file
@article{DBLP:journals/data/SilvaNetoMBCBRBRELMS24,
author = {Alexandre Vilhena Silva{-}Neto and
Gabriel Santos Mouta and
Ant{\^{o}}nio Alcirley Silva Balieiro and
Jady Shayenne Mota Cordeiro and
Patricia Carvalho Silva Balieiro and
Tatyana Costa Amorin Ramos and
Djane Clarys Baia{-}da{-}Silva and
{\'{E}}lisson Silva Rocha and
Patricia Takako Endo and
Theo Lynn and
Wuelton Marcelo Monteiro and
Vanderson de Souza Sampaio},
title = {Data Descriptor of Snakebites in Brazil from 2007 to 2020},
journal = {Data},
volume = {9},
number = {8},
pages = {91},
year = {2024},
url = {https://doi.org/10.3390/data9080091},
doi = {10.3390/DATA9080091},
timestamp = {Fri, 20 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/data/SilvaNetoMBCBRBRELMS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jirs/SalesMSS24,
author = {Raoni Sales and
Ana Patr{\'{\i}}cia Fontes Magalh{\~{a}}es Mascarenhas and
Marco A. C. Sim{\~{o}}es and
Josemar Rodrigues de Souza},
title = {Towards Automatic Code Generation for Robotic Soccer Behavior Simulation},
journal = {J. Intell. Robotic Syst.},
volume = {110},
number = {1},
pages = {18},
year = {2024},
url = {https://doi.org/10.1007/s10846-023-02036-5},
doi = {10.1007/S10846-023-02036-5},
timestamp = {Thu, 29 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jirs/SalesMSS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/MolterCTSBBFB24,
author = {Alan Renier Jamal Occhioni Molter and
Naise Oliveira da Rocha Carvalho and
Paloma Ribeiro Torres and
Marlete Pereira da Silva and
Patr{\'{\i}}cia Dias de Brito and
Pedro Emmanuel Alvarenga Americano do Brasil and
Claudio Fico Fonseca and
Adriana Costa Bacelo},
title = {Development of a mobile application to represent food intake in inpatients:
dietary data systematization},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {24},
number = {1},
pages = {28},
year = {2024},
url = {https://doi.org/10.1186/s12911-023-02406-x},
doi = {10.1186/S12911-023-02406-X},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/MolterCTSBBFB24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/PizzinoCMV24,
author = {Carlos Alexandre Pontes Pizzino and
Ramon Romankevicius Costa and
Daniel Mitchell and
Patr{\'{\i}}cia Am{\^{a}}ncio Vargas},
title = {NeoSLAM: Long-Term {SLAM} Using Computational Models of the Brain},
journal = {Sensors},
volume = {24},
number = {4},
pages = {1143},
year = {2024},
url = {https://doi.org/10.3390/s24041143},
doi = {10.3390/S24041143},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/PizzinoCMV24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcasI/RosaCCSB24,
author = {Morgana Macedo Azevedo da Rosa and
Patr{\'{\i}}cia {\"{U}}cker Leleu da Costa and
Eduardo Antonio Cesar da Costa and
Rafael Iankowski Soares and
Sergio Bampi},
title = {{VLSI} Architectures of Approximate Arithmetic Units Applied to Parallel
Sensors Calibration},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {71},
number = {3},
pages = {1000--1013},
year = {2024},
url = {https://doi.org/10.1109/TCSI.2023.3331675},
doi = {10.1109/TCSI.2023.3331675},
timestamp = {Fri, 22 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcasI/RosaCCSB24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcasII/RibeiroCPCAB24,
author = {L{\'{e}}o Ribeiro and
Patr{\'{\i}}cia U. L. da Costa and
Guilherme Paim and
Eduardo A. C. da Costa and
S{\'{e}}rgio Jose Melo de Almeida and
Sergio Bampi},
title = {{VLSI} Architecture for Energy-Efficient and Accurate Pre-Processing
Pan-Tompkins Design},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {71},
number = {11},
pages = {4768--4772},
year = {2024},
url = {https://doi.org/10.1109/TCSII.2023.3241124},
doi = {10.1109/TCSII.2023.3241124},
timestamp = {Thu, 14 Nov 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcasII/RibeiroCPCAB24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aied/RochaCT24,
author = {Hemilis Joyse Barbosa Rocha and
Evandro de Barros Costa and
Patr{\'{\i}}cia Cabral de Azevedo Restelli Tedesco},
editor = {Andrew M. Olney and
Irene{-}Angelica Chounta and
Zitao Liu and
Olga C. Santos and
Ig Ibert Bittencourt},
title = {Automated Detection and Analysis of Gaming the System in Novice Programmers},
booktitle = {Artificial Intelligence in Education. Posters and Late Breaking Results,
Workshops and Tutorials, Industry and Innovation Tracks, Practitioners,
Doctoral Consortium and Blue Sky - 25th International Conference,
{AIED} 2024, Recife, Brazil, July 8-12, 2024, Proceedings, Part {I}},
series = {Communications in Computer and Information Science},
volume = {2150},
pages = {338--346},
publisher = {Springer},
year = {2024},
url = {https://doi.org/10.1007/978-3-031-64315-6\_30},
doi = {10.1007/978-3-031-64315-6\_30},
timestamp = {Fri, 19 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aied/RochaCT24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/europar/CarastanSantosCPST24,
author = {Danilo Carastan{-}Santos and
Georges Da Costa and
Millian Poquet and
Patricia Stolf and
Denis Trystram},
editor = {Jes{\'{u}}s Carretero and
Sameer Shende and
Javier Garc{\'{\i}}a{-}Blas and
Ivona Brandic and
Katzalin Olcoz and
Martin Schreiber},
title = {Light-Weight Prediction for Improving Energy Consumption in {HPC}
Platforms},
booktitle = {Euro-Par 2024: Parallel Processing - 30th European Conference on Parallel
and Distributed Processing, Madrid, Spain, August 26-30, 2024, Proceedings,
Part {I}},
series = {Lecture Notes in Computer Science},
volume = {14801},
pages = {152--165},
publisher = {Springer},
year = {2024},
url = {https://doi.org/10.1007/978-3-031-69577-3\_11},
doi = {10.1007/978-3-031-69577-3\_11},
timestamp = {Sun, 08 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/europar/CarastanSantosCPST24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/CostaOZP24,
author = {Sofia da Costa and
Ana Patricia Oliveira and
Nelson Zagalo and
Elisabete Pinto},
editor = {June Wei and
George Margetis},
title = {Promoting Nutrition Literacy and Food Neophilia of Middle School Children
Through a Serious Hybrid Game},
booktitle = {Human-Centered Design, Operation and Evaluation of Mobile Communications
- 5th International Conference, {MOBILE} 2024, Held as Part of the
26th {HCI} International Conference, {HCII} 2024, Washington, DC,
USA, June 29 - July 4, 2024, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {14737},
pages = {3--13},
publisher = {Springer},
year = {2024},
url = {https://doi.org/10.1007/978-3-031-60458-4\_1},
doi = {10.1007/978-3-031-60458-4\_1},
timestamp = {Thu, 04 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hci/CostaOZP24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/propor/PaisFSAO24,
author = {Francisco Pais and
Patr{\'{\i}}cia Ferreira and
Catarina Silva and
Ana Alves and
Hugo Gon{\c{c}}alo Oliveira},
editor = {Pablo Gamallo and
Daniela Claro and
Ant{\'{o}}nio J. S. Teixeira and
Livy Real and
Marcos Garc{\'{\i}}a and
Hugo Gon{\c{c}}alo Oliveira and
Raquel Amaro},
title = {Question Answering for Dialogue State Tracking in Portuguese},
booktitle = {Proceedings of the 16th International Conference on Computational
Processing of Portuguese, {PROPOR} 2024, Santiago de Compostela, Galicia/Spain,
12-15 March, 2024},
pages = {461--471},
publisher = {Association for Computational Lingustics},
year = {2024},
url = {https://aclanthology.org/2024.propor-1.47},
timestamp = {Thu, 04 Apr 2024 08:26:29 +0200},
biburl = {https://dblp.org/rec/conf/propor/PaisFSAO24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigdial/FerreiraCASO24,
author = {Patr{\'{\i}}cia Sofia Pereira Ferreira and
Isabel Carvalho and
Ana Alves and
Catarina Silva and
Hugo Gon{\c{c}}alo Oliveira},
editor = {Tatsuya Kawahara and
Vera Demberg and
Stefan Ultes and
Koji Inoue and
Shikib Mehri and
David M. Howcroft and
Kazunori Komatani},
title = {Sentiment-Aware Dialogue Flow Discovery for Interpreting Communication
Trends},
booktitle = {Proceedings of the 25th Annual Meeting of the Special Interest Group
on Discourse and Dialogue, {SIGDIAL} 2024, Kyoto, Japan, September
18 - 20, 2024},
pages = {274--288},
publisher = {Association for Computational Linguistics},
year = {2024},
url = {https://aclanthology.org/2024.sigdial-1.24},
timestamp = {Fri, 04 Oct 2024 16:06:14 +0200},
biburl = {https://dblp.org/rec/conf/sigdial/FerreiraCASO24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/slate/MouraFCGAMB24,
author = {Alysson C. E. de Moura and
Geraldo P. Rocha Filho and
Marcos F. Caetano and
Jo{\~{a}}o J. C. Gondim and
Aleteia Araujo and
Marcelo Antonio Marotta and
Lucas Bondan},
editor = {M{\'{a}}rio Rodrigues and
Jos{\'{e}} Paulo Leal and
Filipe Portela},
title = {Anomaly Detection in Logs: {A} Comparative Analysis of Unsupervised
Algorithms},
booktitle = {13th Symposium on Languages, Applications and Technologies, {SLATE}
2024, July 4-5, 2024, {\'{A}}gueda, Portugal},
series = {OASIcs},
volume = {120},
pages = {12:1--12:14},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2024},
url = {https://doi.org/10.4230/OASIcs.SLATE.2024.12},
doi = {10.4230/OASICS.SLATE.2024.12},
timestamp = {Thu, 14 Nov 2024 17:20:55 +0100},
biburl = {https://dblp.org/rec/conf/slate/MouraFCGAMB24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-01403,
author = {Patr{\'{\i}}cia Ferreira and
Daniel Martins and
Ana Alves and
Catarina Silva and
Hugo Gon{\c{c}}alo Oliveira},
title = {Unsupervised Flow Discovery from Task-oriented Dialogues},
journal = {CoRR},
volume = {abs/2405.01403},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2405.01403},
doi = {10.48550/ARXIV.2405.01403},
eprinttype = {arXiv},
eprint = {2405.01403},
timestamp = {Sun, 09 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2405-01403.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2407-00035,
author = {Breno G. S. Costa and
Abhik Banerjee and
Prem Prakash Jayaraman and
Leonardo R. Carvalho and
Jo{\~{a}}o Bachiega Jr. and
Aleteia Araujo},
title = {Achieving Observability on Fog Computing with the use of open-source
tools},
journal = {CoRR},
volume = {abs/2407.00035},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2407.00035},
doi = {10.48550/ARXIV.2407.00035},
eprinttype = {arXiv},
eprint = {2407.00035},
timestamp = {Tue, 13 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2407-00035.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csur/BachiegaCCRA23,
author = {Jo{\~{a}}o Bachiega Jr. and
Breno G. S. Costa and
Leonardo Rebou{\c{c}}as de Carvalho and
Michel J. F. Rosa and
Alet{\'{e}}ia P. F. Ara{\'{u}}jo},
title = {Computational Resource Allocation in Fog Computing: {A} Comprehensive
Survey},
journal = {{ACM} Comput. Surv.},
volume = {55},
number = {14s},
pages = {336:1--336:31},
year = {2023},
url = {https://doi.org/10.1145/3586181},
doi = {10.1145/3586181},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/csur/BachiegaCCRA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csur/CostaBCA23,
author = {Breno G. S. Costa and
Jo{\~{a}}o Bachiega Jr. and
Leonardo Rebou{\c{c}}as de Carvalho and
Alet{\'{e}}ia P. F. Ara{\'{u}}jo},
title = {Orchestration in Fog Computing: {A} Comprehensive Survey},
journal = {{ACM} Comput. Surv.},
volume = {55},
number = {2},
pages = {29:1--29:34},
year = {2023},
url = {https://doi.org/10.1145/3486221},
doi = {10.1145/3486221},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/csur/CostaBCA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jss/MedeirosICV23,
author = {Nadia Patricia Da Silva Medeiros and
Naghmeh Ivaki and
Pedro Costa and
Marco Vieira},
title = {Trustworthiness models to categorize and prioritize code for security
improvement},
journal = {J. Syst. Softw.},
volume = {198},
pages = {111621},
year = {2023},
url = {https://doi.org/10.1016/j.jss.2023.111621},
doi = {10.1016/J.JSS.2023.111621},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jss/MedeirosICV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/Crivelari-Costa23,
author = {Patr{\'{\i}}cia Monique Crivelari{-}Costa and
Mendelson Lima and
Newton La Scala Jr. and
Fernando Saragosa Rossi and
Jo{\~{a}}o Lucas Della{-}Silva and
Ricardo Dalagnol and
Paulo Eduardo Teodoro and
Larissa Pereira Ribeiro Teodoro and
Gabriel de Oliveira and
Jos{\'{e}} Francisco de Oliveira{-}J{\'{u}}nior and
Carlos Antonio da Silva Junior},
title = {Changes in Carbon Dioxide Balance Associated with Land Use and Land
Cover in Brazilian Legal Amazon Based on Remotely Sensed Imagery},
journal = {Remote. Sens.},
volume = {15},
number = {11},
pages = {2780},
year = {2023},
url = {https://doi.org/10.3390/rs15112780},
doi = {10.3390/RS15112780},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/Crivelari-Costa23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/RosaPCCSB23,
author = {Morgana Macedo Azevedo da Rosa and
Guilherme Paim and
Patr{\'{\i}}cia {\"{U}}cker Leleu da Costa and
Eduardo Antonio Cesar da Costa and
Rafael Iankowski Soares and
Sergio Bampi},
title = {AxPPA: Approximate Parallel Prefix Adders},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {31},
number = {1},
pages = {17--28},
year = {2023},
url = {https://doi.org/10.1109/TVLSI.2022.3218021},
doi = {10.1109/TVLSI.2022.3218021},
timestamp = {Tue, 31 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvlsi/RosaPCCSB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/urban/DelgadoEnalesSM23,
author = {I{\~{n}}igo Delgado{-}Enales and
Javier Del Ser and
Patricia Molina{-}Costa},
title = {A framework to improve urban accessibility and environmental conditions
in age-friendly cities using graph modeling and multi-objective optimization},
journal = {Comput. Environ. Urban Syst.},
volume = {102},
pages = {101966},
year = {2023},
url = {https://doi.org/10.1016/j.compenvurbsys.2023.101966},
doi = {10.1016/J.COMPENVURBSYS.2023.101966},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/urban/DelgadoEnalesSM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csedu/RochaCT23,
author = {Hemilis Joyse Barbosa Rocha and
Evandro de Barros Costa and
Patr{\'{\i}}cia Cabral de Azevedo Restelli Tedesco},
editor = {Jelena Jovanovic and
Irene{-}Angelica Chounta and
James Uhomoibhi and
Bruce M. McLaren},
title = {A Taxonomy with Elements for Providing Adaptive Feedback},
booktitle = {Proceedings of the 15th International Conference on Computer Supported
Education, {CSEDU} 2023, Prague, Czech Republic, April 21-23, 2023,
Volume 1},
pages = {351--358},
publisher = {{SCITEPRESS}},
year = {2023},
timestamp = {Wed, 29 May 2024 11:49:17 +0200},
biburl = {https://dblp.org/rec/conf/csedu/RochaCT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/RochaCT23,
author = {Hemilis Joyse Barbosa Rocha and
Evandro de Barros Costa and
Patr{\'{\i}}cia Cabral de Azevedo Restelli Tedesco},
title = {A Taxonomy to Assist TAs in Providing Adaptive Feedback to Novice
Programmers},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2023, College Station,
TX, USA, October 18-21, 2023},
pages = {1--9},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/FIE58773.2023.10343309},
doi = {10.1109/FIE58773.2023.10343309},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fie/RochaCT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/RochaTC23,
author = {Hemilis Joyse Barbosa Rocha and
Patr{\'{\i}}cia Cabral de Azevedo Restelli Tedesco and
Evandro de Barros Costa},
title = {Analyzing Aspects of Gamification in the Manifestation of Gaming the
System Behavior},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2023, College Station,
TX, USA, October 18-21, 2023},
pages = {1--8},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/FIE58773.2023.10342997},
doi = {10.1109/FIE58773.2023.10342997},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fie/RochaTC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icecsys/CostaRSCB23,
author = {Patr{\'{\i}}cia U. L. da Costa and
Morgana M. A. da Rosa and
Rafael Soares and
Eduardo A. C. da Costa and
Sergio Bampi},
title = {An Optimized {VLSI} Exponential Unit Design Exploring Efficient Arithmetic
Operation Strategies},
booktitle = {30th {IEEE} International Conference on Electronics, Circuits and
Systems, {ICECS} 2023, Istanbul, Turkey, December 4-7, 2023},
pages = {1--4},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICECS58634.2023.10382829},
doi = {10.1109/ICECS58634.2023.10382829},
timestamp = {Thu, 18 Jan 2024 08:27:11 +0100},
biburl = {https://dblp.org/rec/conf/icecsys/CostaRSCB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/its/RochaTCR23,
author = {Hemilis Joyse Barbosa Rocha and
Patr{\'{\i}}cia Cabral de Azevedo Restelli Tedesco and
Evandro de Barros Costa and
Julios Suruagi Rocha},
editor = {Claude Frasson and
Phivos Mylonas and
Christos Troussas},
title = {An Approach for Detecting Gaming the System Behavior in Programming
Problem-Solving},
booktitle = {Augmented Intelligence and Intelligent Tutoring Systems - 19th International
Conference, {ITS} 2023, Corfu, Greece, June 2-5, 2023, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13891},
pages = {75--87},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-32883-1\_7},
doi = {10.1007/978-3-031-32883-1\_7},
timestamp = {Fri, 02 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/its/RochaTCR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itsc/Delgado-EnalesM23,
author = {I{\~{n}}igo Delgado{-}Enales and
Patricia Molina{-}Costa and
Javier Del Ser},
title = {Spatial Estimation of Ground-Level Temperature for Climate-Sensitive
Urban Mobility using Image-to-Image Deep Neural Networks},
booktitle = {25th {IEEE} International Conference on Intelligent Transportation
Systems, {ITSC} 2022, Macau, China, October 8-12, 2022},
pages = {6206--6212},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ITSC57777.2023.10422134},
doi = {10.1109/ITSC57777.2023.10422134},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/itsc/Delgado-EnalesM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/RosaCPCSB23,
author = {Morgana M. A. da Rosa and
Patr{\'{\i}}cia U. L. da Costa and
Guilherme Paim and
Eduardo A. C. da Costa and
Rafael Soares and
Sergio Bampi},
title = {An Energy-Efficient StEFCal {VLSI} Design with Approximate Squarer
and Divider Units},
booktitle = {14th {IEEE} Latin America Symposium on Circuits and System, {LASCAS}
2023, Quito, Ecuador, February 28 - March 3, 2023},
pages = {1--4},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/LASCAS56464.2023.10108306},
doi = {10.1109/LASCAS56464.2023.10108306},
timestamp = {Fri, 02 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lascas/RosaCPCSB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mis4tel/MarossiMABCCMMS23,
author = {Camilla Marossi and
Valentina Mariani and
Alicia Arenas and
Margherita Brondino and
Carlos Vaz de Carvalho and
Patr{\'{\i}}cia Costa and
Donatella Di Marco and
Elisa Menardo and
S{\'{\i}}lvia da Silva and
Margherita Pasini},
editor = {Marcelo Milrad and
Nuno Otero and
Mar{\'{\i}}a Cruz S{\'{a}}nchez G{\'{o}}mez and
Juan Jos{\'{e}} Mena Marcos and
Dalila Dur{\~{a}}es and
Filippo Sciarrone and
Claudio Alvarez{-}G{\'{o}}mez and
Manuel Rodrigues and
Pierpaolo Vittorini and
Rosella Gennari and
Tania Di Mascio and
Marco Temperini and
Fernando de la Prieta},
title = {Mindfulness Lessons in a Virtual Natural Environment to Cope with
Work-Related Stress},
booktitle = {Methodologies and Intelligent Systems for Technology Enhanced Learning,
13th International Conference, {MIS4TEL} 2023, Guimaraes, Portugal,
12-14 July 2023},
series = {Lecture Notes in Networks and Systems},
volume = {764},
pages = {227--238},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-41226-4\_24},
doi = {10.1007/978-3-031-41226-4\_24},
timestamp = {Tue, 07 May 2024 20:12:34 +0200},
biburl = {https://dblp.org/rec/conf/mis4tel/MarossiMABCCMMS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/webist/CoelhoBVSS0NMOA23,
author = {Jaqueline Gutierri Coelho and
Guilherme Dantas Bispo and
Guilherme Fay Vergara and
Gabriela Mayumi Saiki and
Andr{\'{e}} Luiz Marques Serrano and
Li Weigang and
Clovis Neumann and
Patricia Helena Martins and
Welber Santos de Oliveira and
Angela Brigida Albarello and
Ricardo Accorsi Casonatto and
Patr{\'{\i}}cia Missel and
Roberto de Medeiros Junior and
Jefferson de Oliveira Gomes and
Carlos Rosano{-}Pe{\~{n}}a and
Caroline Cabral F. da Costa},
editor = {Francisco J. Garc{\'{\i}}a{-}Pe{\~{n}}alvo and
Massimo Marchiori},
title = {Enhancing Industrial Productivity Through AI-Driven Systematic Literature
Reviews},
booktitle = {Proceedings of the 19th International Conference on Web Information
Systems and Technologies, {WEBIST} 2023, Rome, Italy, November 15-17,
2023},
pages = {472--479},
publisher = {{SCITEPRESS}},
year = {2023},
url = {https://doi.org/10.5220/0012235000003584},
doi = {10.5220/0012235000003584},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/webist/CoelhoBVSS0NMOA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-07787,
author = {M{\'{o}}nica Aguilar{-}Igartua and
Florina Almen{\'{a}}res and
Rebeca P. D{\'{\i}}az Redondo and
Manuela I. Mart{\'{\i}}n{-}Vicente and
Jordi Forn{\'{e}} and
Celeste Campo and
Ana Fern{\'{a}}ndez Vilas and
Luis J. de la Cruz Llopis and
Carlos Garc{\'{\i}}a{-}Rubio and
Andr{\'{e}}s Mar{\'{\i}}n and
Ahmad Mohamad Mezher and
Daniel D{\'{\i}}az S{\'{a}}nchez and
H{\'{e}}ctor Cerezo{-}Costas and
David Rebollo{-}Monedero and
Patricia Arias and
Francisco Rico{-}Novella},
title = {{INRISCO:} INcident monitoRing In Smart COmmunities},
journal = {CoRR},
volume = {abs/2312.07787},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.07787},
doi = {10.48550/ARXIV.2312.07787},
eprinttype = {arXiv},
eprint = {2312.07787},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-07787.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/GrangeSCR22,
author = {L{\'{e}}o Grange and
Patricia Stolf and
Georges Da Costa and
Paul Renaud{-}Goud},
title = {Multi-Objective and Cooperative Power Planning for Datacenter With
On-Site Renewable Energy Sources},
journal = {{IEEE} Access},
volume = {10},
pages = {104067--104092},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3210523},
doi = {10.1109/ACCESS.2022.3210523},
timestamp = {Tue, 18 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/GrangeSCR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/CostaBCRA22,
author = {Breno G. S. Costa and
Jo{\~{a}}o Bachiega Jr. and
Leonardo Rebou{\c{c}}as de Carvalho and
Michel J. F. Rosa and
Alet{\'{e}}ia P. F. Ara{\'{u}}jo},
title = {Monitoring fog computing: {A} review, taxonomy and open challenges},
journal = {Comput. Networks},
volume = {215},
pages = {109189},
year = {2022},
url = {https://doi.org/10.1016/j.comnet.2022.109189},
doi = {10.1016/J.COMNET.2022.109189},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cn/CostaBCRA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computers/InfanteJARNQSSN22,
author = {Paulo Infante and
Gon{\c{c}}alo Jacinto and
Anabela Afonso and
Leonor Rego and
V{\'{\i}}tor Nogueira and
Paulo Quaresma and
Jos{\'{e}} Saias and
Daniel Santos and
Pedro Nogueira and
Marcelo Silva and
Rosalina Pisco Costa and
Patr{\'{\i}}cia Gois and
Paulo Rebelo Manuel},
title = {Comparison of Statistical and Machine-Learning Models on Road Traffic
Accident Severity Classification},
journal = {Comput.},
volume = {11},
number = {5},
pages = {80},
year = {2022},
url = {https://doi.org/10.3390/computers11050080},
doi = {10.3390/COMPUTERS11050080},
timestamp = {Tue, 28 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/computers/InfanteJARNQSSN22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijet/OliveiraRBBA22,
author = {Simone De Oliveira and
Eliseo Reategui and
Patricia da Silva Campelo Costa Barcellos and
Marcio Bigolin and
Michel Carniato do Amaral},
title = {Improving Academic Writing with a Method for Text Revision Supported
by Text Mining},
journal = {Int. J. Emerg. Technol. Learn.},
volume = {17},
number = {21},
pages = {150--163},
year = {2022},
url = {https://doi.org/10.3991/ijet.v17i21.31249},
doi = {10.3991/IJET.V17I21.31249},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijet/OliveiraRBBA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/OzelimBCADGCSDJ22,
author = {Luan Carlos de Sena Monteiro Ozelim and
Lucas Parreira de Faria Borges and
Andr{\'{e}} Lu{\'{\i}}s Brasil Cavalcante and
Enzo Aldo Cunha Albuquerque and
Mariana dos Santos Diniz and
Manuelle Santos G{\'{o}}is and
Katherin Rocio Cano Bezerra da Costa and
Patr{\'{\i}}cia Figuereido de Sousa and
Ana Paola do Nascimento Dantas and
Rafael Mendes Jorge and
Gabriela Rodrigues Moreira and
Matheus Lima de Barros and
Fernando Rodrigo de Aquino},
title = {Structural Health Monitoring of Dams Based on Acoustic Monitoring,
Deep Neural Networks, Fuzzy Logic and a {CUSUM} Control Algorithm},
journal = {Sensors},
volume = {22},
number = {7},
pages = {2482},
year = {2022},
url = {https://doi.org/10.3390/s22072482},
doi = {10.3390/S22072482},
timestamp = {Thu, 02 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/OzelimBCADGCSDJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcasI/PereiraCFAPCB22,
author = {Pedro Tau{\~{a}} Lopes Pereira and
Patr{\'{\i}}cia {\"{U}}cker Leleu da Costa and
Guilherme da Costa Ferreira and
Brunno Alves de Abreu and
Guilherme Paim and
Eduardo Ant{\^{o}}nio C{\'{e}}sar da Costa and
Sergio Bampi},
title = {Energy-Quality Scalable Design Space Exploration of Approximate {FFT}
Hardware Architectures},
journal = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
volume = {69},
number = {11},
pages = {4524--4534},
year = {2022},
url = {https://doi.org/10.1109/TCSI.2022.3191180},
doi = {10.1109/TCSI.2022.3191180},
timestamp = {Tue, 06 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcasI/PereiraCFAPCB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aied/RochaTC22,
author = {Hemilis Joyse Barbosa Rocha and
Patr{\'{\i}}cia Cabral de Azevedo Restelli Tedesco and
Evandro de Barros Costa},
editor = {Maria Mercedes T. Rodrigo and
Noboru Matsuda and
Alexandra I. Cristea and
Vania Dimitrova},
title = {A Context-Aware Approach to Personalized Feedback for Novice Programmers},
booktitle = {Artificial Intelligence in Education. Posters and Late Breaking Results,
Workshops and Tutorials, Industry and Innovation Tracks, Practitioners'
and Doctoral Consortium - 23rd International Conference, {AIED} 2022,
Durham, UK, July 27-31, 2022, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {13356},
pages = {59--64},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-11647-6\_10},
doi = {10.1007/978-3-031-11647-6\_10},
timestamp = {Fri, 16 Feb 2024 09:02:05 +0100},
biburl = {https://dblp.org/rec/conf/aied/RochaTC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/Delgado-EnalesM22,
author = {I{\~{n}}igo Delgado{-}Enales and
Patricia Molina{-}Costa and
Eneko Osaba and
Silvia Urra{-}Uriarte and
Javier Del Ser},
title = {Improving the Urban Accessibility of Older Pedestrians using Multi-objective
Optimization},
booktitle = {{IEEE} Congress on Evolutionary Computation, {CEC} 2022, Padua, Italy,
July 18-23, 2022},
pages = {1--8},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/CEC55065.2022.9870432},
doi = {10.1109/CEC55065.2022.9870432},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cec/Delgado-EnalesM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/closer/BachiegaCCOSCA22,
author = {Jo{\~{a}}o Bachiega Jr. and
Breno G. S. Costa and
Leonardo Rebou{\c{c}}as de Carvalho and
Victor H. C. Oliveira and
William X. Santos and
Maria Clicia Stelling de Castro and
Alet{\'{e}}ia P. F. Ara{\'{u}}jo},
editor = {Maarten van Steen and
Donald Ferguson and
Claus Pahl},
title = {From the Sky to the Ground: Comparing Fog Computing with Related Distributed
Paradigms},
booktitle = {Proceedings of the 12th International Conference on Cloud Computing
and Services Science, {CLOSER} 2022,, Online Streaming, April 27-29,
2022},
pages = {158--169},
publisher = {{SCITEPRESS}},
year = {2022},
url = {https://doi.org/10.5220/0011033300003200},
doi = {10.5220/0011033300003200},
timestamp = {Tue, 06 Jun 2023 14:58:00 +0200},
biburl = {https://dblp.org/rec/conf/closer/BachiegaCCOSCA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icecsys/CostaRPCSB22,
author = {Patr{\'{\i}}cia U. L. da Costa and
Morgana M. A. da Rosa and
Guilherme Paim and
Eduardo Antonio Cesar da Costa and
Rafael Soares and
Sergio Bampi},
title = {An Efficient Exponential Unit Designed in {VLSI} {CMOS} with Custom
Operators},
booktitle = {29th {IEEE} International Conference on Electronics, Circuits and
Systems, {ICECS} 2022, Glasgow, United Kingdom, October 24-26, 2022},
pages = {1--4},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICECS202256217.2022.9970960},
doi = {10.1109/ICECS202256217.2022.9970960},
timestamp = {Fri, 23 Dec 2022 17:47:32 +0100},
biburl = {https://dblp.org/rec/conf/icecsys/CostaRPCSB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itqm/FaveroBSSCJ22,
author = {Luiz Paulo Lopes F{\'{a}}vero and
Patr{\'{\i}}cia Prado Belfiore and
Helder Prado Santos and
Marcos dos Santos and
Igor Pinheiro de Ara{\'{u}}jo Costa and
Wilson Tarantin Junior},
editor = {Yong Shi and
Jianping Li and
Gang Kou and
Daniel Berg and
James M. Tien},
title = {Classification Performance Evaluation from Multilevel Logistic and
Support Vector Machine Algorithms through Simulated Data in Python},
booktitle = {Proceedings of the 9th International Conference on Information Technology
and Quantitative Management, {ITQM} 2022, Global Green Digital Economy:
Challenges and Development, December 9-11, 2022, Beijing, China},
series = {Procedia Computer Science},
volume = {214},
pages = {511--519},
publisher = {Elsevier},
year = {2022},
url = {https://doi.org/10.1016/j.procs.2022.11.206},
doi = {10.1016/J.PROCS.2022.11.206},
timestamp = {Sat, 21 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/itqm/FaveroBSSCJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/CostaPAPCB22,
author = {Patr{\'{\i}}cia U. L. da Costa and
Pedro Tau{\~{a}} Lopes Pereira and
Brunno A. Abreu and
Guilherme Paim and
Eduardo A. C. da Costa and
Sergio Bampi},
title = {Improved Approximate Multipliers for Single-Precision Floating-Point
Hardware Design},
booktitle = {13th {IEEE} Latin America Symposium on Circuits and System, {LASCAS}
2022, Puerto Varas, Chile, March 1-4, 2022},
pages = {1--4},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/LASCAS53948.2022.9789077},
doi = {10.1109/LASCAS53948.2022.9789077},
timestamp = {Mon, 13 Jun 2022 16:53:37 +0200},
biburl = {https://dblp.org/rec/conf/lascas/CostaPAPCB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/OliveiraFM0022,
author = {Hugo Gon{\c{c}}alo Oliveira and
Patr{\'{\i}}cia Ferreira and
Daniel Martins and
Catarina Silva and
Ana Alves},
editor = {Nicoletta Calzolari and
Fr{\'{e}}d{\'{e}}ric B{\'{e}}chet and
Philippe Blache and
Khalid Choukri and
Christopher Cieri and
Thierry Declerck and
Sara Goggi and
Hitoshi Isahara and
Bente Maegaard and
Joseph Mariani and
H{\'{e}}l{\`{e}}ne Mazo and
Jan Odijk and
Stelios Piperidis},
title = {A Brief Survey of Textual Dialogue Corpora},
booktitle = {Proceedings of the Thirteenth Language Resources and Evaluation Conference,
{LREC} 2022, Marseille, France, 20-25 June 2022},
pages = {1264--1274},
publisher = {European Language Resources Association},
year = {2022},
url = {https://aclanthology.org/2022.lrec-1.135},
timestamp = {Mon, 10 Oct 2022 16:57:52 +0200},
biburl = {https://dblp.org/rec/conf/lrec/OliveiraFM0022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbsi/SilvaSVS22,
author = {Patricia Costa Silva and
Vanessa Cristina Oliveira de Souza and
Margarete Marin Lordelo Volpato and
Vania Aparecida Silva},
editor = {Rita Cristina Galarraga Berardi and
Alexandre Reis Graeml and
Valdemar Vicente Graciano Neto and
Awdren de Lima Font{\~{a}}o and
Williamson Silva},
title = {Regador : {APP} for coffee water potential estimation},
booktitle = {{SBSI:} {XVIII} Brazilian Symposium on Information Systems, Curitiba,
Brazil, May 16 - 19, 2022},
pages = {34:1--34:9},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3535511.3535545},
doi = {10.1145/3535511.3535545},
timestamp = {Fri, 05 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sbsi/SilvaSVS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-07425,
author = {Jo{\~{a}}o Bachiega Jr. and
Breno G. S. Costa and
Alet{\'{e}}ia P. F. Ara{\'{u}}jo},
title = {Computational Perspective of the Fog Node},
journal = {CoRR},
volume = {abs/2203.07425},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2203.07425},
doi = {10.48550/ARXIV.2203.07425},
eprinttype = {arXiv},
eprint = {2203.07425},
timestamp = {Tue, 17 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2203-07425.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-07091,
author = {Breno G. S. Costa and
Jo{\~{a}}o Bachiega Jr. and
Leonardo Rebou{\c{c}}as de Carvalho and
Michel J. F. Rosa and
Alet{\'{e}}ia P. F. Ara{\'{u}}jo},
title = {Monitoring Fog Computing: a Review, Taxonomy and Open Challenges},
journal = {CoRR},
volume = {abs/2206.07091},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.07091},
doi = {10.48550/ARXIV.2206.07091},
eprinttype = {arXiv},
eprint = {2206.07091},
timestamp = {Mon, 14 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-07091.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cssp/RosaPUPCBA21,
author = {Andrei La Rosa and
Pedro Tau{\~{a}} Lopes Pereira and
Patr{\'{\i}}cia {\"{U}}cker and
Guilherme Paim and
Eduardo A. C. da Costa and
Sergio Bampi and
S{\'{e}}rgio Almeida},
title = {Exploring NLMS-Based Adaptive Filter Hardware Architectures for Eliminating
Power Line Interference in {EEG} Signals},
journal = {Circuits Syst. Signal Process.},
volume = {40},
number = {7},
pages = {3305--3337},
year = {2021},
url = {https://doi.org/10.1007/s00034-020-01620-6},
doi = {10.1007/S00034-020-01620-6},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cssp/RosaPUPCBA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rbie/OliariUMSGPGCG21,
author = {Marco A. M. Oliari and
Jos{\'{e}} J. M. Uliana and
Beatriz M. S. Maia and
Mirelly M. da Silva and
Sophie D. Gama and
Thiago T. Paiva and
Roberta L. Gomes and
Patr{\'{\i}}cia D. Costa and
Rodrigo L. Guimar{\~{a}}es},
title = {Colet{\^{a}}nea de uma D{\'{e}}cada de Ensino de Programa{\c{c}}{\~{a}}o
para Estudantes da Rede P{\'{u}}blica no Projeto Introcomp},
journal = {Revista Brasileira de Inform{\'{a}}tica na Educ.},
volume = {29},
pages = {1202--1231},
year = {2021},
url = {https://doi.org/10.5753/rbie.2021.2125},
doi = {10.5753/RBIE.2021.2125},
timestamp = {Thu, 15 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/rbie/OliariUMSGPGCG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/suscom/HaddadCNPPRSV21,
author = {Marwa Haddad and
Georges Da Costa and
Jean{-}Marc Nicod and
Marie{-}C{\'{e}}cile P{\'{e}}ra and
Jean{-}Marc Pierson and
Veronika Rehn{-}Sonigo and
Patricia Stolf and
Christophe Varnier},
title = {Combined {IT} and power supply infrastructure sizing for standalone
green data centers},
journal = {Sustain. Comput. Informatics Syst.},
volume = {30},
pages = {100505},
year = {2021},
url = {https://doi.org/10.1016/j.suscom.2020.100505},
doi = {10.1016/J.SUSCOM.2020.100505},
timestamp = {Tue, 15 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/suscom/HaddadCNPPRSV21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/CostaPRCAB21,
author = {Patr{\'{\i}}cia {\"{U}}cker Leleu da Costa and
Guilherme Paim and
Leandro Mateus Giacomini Rocha and
Eduardo Ant{\^{o}}nio C{\'{e}}sar da Costa and
S{\'{e}}rgio Jose Melo de Almeida and
Sergio Bampi},
title = {Fixed-Point {NLMS} and {IPNLMS} {VLSI} Architectures for Accurate
{FECG} and {FHR} Processing},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {15},
number = {5},
pages = {898--911},
year = {2021},
url = {https://doi.org/10.1109/TBCAS.2021.3120237},
doi = {10.1109/TBCAS.2021.3120237},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbcas/CostaPRCAB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/PereiraPCCAB21,
author = {Pedro Tau{\~{a}} Lopes Pereira and
Guilherme Paim and
Patr{\'{\i}}cia {\"{U}}cker Leleu da Costa and
Eduardo Ant{\^{o}}nio C{\'{e}}sar da Costa and
S{\'{e}}rgio Jose Melo de Almeida and
Sergio Bampi},
title = {Architectural Exploration for Energy-Efficient Fixed-Point Kalman
Filter {VLSI} Design},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {29},
number = {7},
pages = {1402--1415},
year = {2021},
url = {https://doi.org/10.1109/TVLSI.2021.3075379},
doi = {10.1109/TVLSI.2021.3075379},
timestamp = {Wed, 03 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvlsi/PereiraPCCAB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edcc/MedeirosICV21,
author = {Nadia Patricia Da Silva Medeiros and
Naghmeh Ramezani Ivaki and
Pedro Costa and
Marco Vieira},
title = {An Empirical Study On Software Metrics and Machine Learning to Identify
Untrustworthy Code},
booktitle = {17th European Dependable Computing Conference, {EDCC} 2021, Munich,
Germany, September 13-16, 2021},
pages = {87--94},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/EDCC53658.2021.00020},
doi = {10.1109/EDCC53658.2021.00020},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/edcc/MedeirosICV21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icecsys/CostaPPCB21,
author = {Patr{\'{\i}}cia U. L. da Costa and
Pedro Tau{\~{a}} Lopes Pereira and
Guilherme Paim and
Eduardo A. C. da Costa and
Sergio Bampi},
title = {Boosting the Efficiency of the Harmonics Elimination {VLSI} Architecture
by Arithmetic Approximations},
booktitle = {28th {IEEE} International Conference on Electronics, Circuits, and
Systems, {ICECS} 2021, Dubai, United Arab Emirates, November 28 -
Dec. 1, 2021},
pages = {1--4},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICECS53924.2021.9665538},
doi = {10.1109/ICECS53924.2021.9665538},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icecsys/CostaPPCB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceis/SalvadoriMD21,
author = {Bianca G. Salvadori and
Patricia F. Magnago and
Alessandra C. S. Dutra},
editor = {Joaquim Filipe and
Michal Smialek and
Alexander Brodsky and
Slimane Hammoudi},
title = {Project based on Agile Methodologies by {DMAIC}},
booktitle = {Proceedings of the 23rd International Conference on Enterprise Information
Systems, {ICEIS} 2021, Online Streaming, April 26-28, 2021, Volume
2},
pages = {337--344},
publisher = {{SCITEPRESS}},
year = {2021},
url = {https://doi.org/10.5220/0010453103370344},
doi = {10.5220/0010453103370344},
timestamp = {Tue, 06 Jun 2023 14:58:01 +0200},
biburl = {https://dblp.org/rec/conf/iceis/SalvadoriMD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Aguilar-Igartua20,
author = {M{\'{o}}nica Aguilar{-}Igartua and
Florina Almen{\'{a}}rez Mendoza and
Rebeca P. D{\'{\i}}az Redondo and
Manuela I. Mart{\'{\i}}n{-}Vicente and
Jordi Forn{\'{e}} and
Celeste Campo and
Ana Fern{\'{a}}ndez Vilas and
Luis J. de la Cruz Llopis and
Carlos Garc{\'{\i}}a{-}Rubio and
Andr{\'{e}}s Mar{\'{\i}}n L{\'{o}}pez and
Ahmad Mohamad Mezher and
Daniel D{\'{\i}}az S{\'{a}}nchez and
H{\'{e}}ctor Cerezo{-}Costas and
David Rebollo{-}Monedero and
Patricia Arias Cabarcos and
Francisco Rico{-}Novella},
title = {{INRISCO:} INcident monitoRing in Smart COmmunities},
journal = {{IEEE} Access},
volume = {8},
pages = {72435--72460},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.2987483},
doi = {10.1109/ACCESS.2020.2987483},
timestamp = {Tue, 16 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/Aguilar-Igartua20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/MedeirosICV20,
author = {Nadia Patricia Da Silva Medeiros and
Naghmeh Ramezani Ivaki and
Pedro Costa and
Marco Vieira},
title = {Vulnerable Code Detection Using Software Metrics and Machine Learning},
journal = {{IEEE} Access},
volume = {8},
pages = {219174--219198},
year = {2020},
url = {https://doi.org/10.1109/ACCESS.2020.3041181},
doi = {10.1109/ACCESS.2020.3041181},
timestamp = {Sat, 21 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/MedeirosICV20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dint/SalesHVCSSP20,
author = {Luana Sales and
Patr{\'{\i}}cia Henning and
Viviane Veiga and
Maira Murrieta Costa and
Lu{\'{\i}}s Fernando Say{\~{a}}o and
Luiz Olavo Bonino da Silva Santos and
Lu{\'{\i}}s Ferreira Pires},
title = {{GO} {FAIR} Brazil: {A} Challenge for Brazilian Data Science},
journal = {Data Intell.},
volume = {2},
number = {1-2},
pages = {238--245},
year = {2020},
url = {https://doi.org/10.1162/dint\_a\_00046},
doi = {10.1162/DINT\_A\_00046},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dint/SalesHVCSSP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/ThiPCSNRH20,
author = {Minh{-}Thuyen Thi and
Jean{-}Marc Pierson and
Georges Da Costa and
Patricia Stolf and
Jean{-}Marc Nicod and
Gustavo Rostirolla and
Marwa Haddad},
title = {Negotiation game for joint {IT} and energy management in green datacenters},
journal = {Future Gener. Comput. Syst.},
volume = {110},
pages = {1116--1138},
year = {2020},
url = {https://doi.org/10.1016/j.future.2019.11.018},
doi = {10.1016/J.FUTURE.2019.11.018},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/fgcs/ThiPCSNRH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijgi/BritoKKPWCF20,
author = {Patricia Lustosa Brito and
Monika Kuffer and
Mila Koeva and
Julio Cesar Pedrassoli and
Jiong Wang and
Federico Costa and
Anderson Dias de Freitas},
title = {The Spatial Dimension of {COVID-19:} The Potential of Earth Observation
Data in Support of Slum Communities with Evidence from Brazil},
journal = {{ISPRS} Int. J. Geo Inf.},
volume = {9},
number = {9},
pages = {557},
year = {2020},
url = {https://doi.org/10.3390/ijgi9090557},
doi = {10.3390/IJGI9090557},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijgi/BritoKKPWCF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijtm/IkenamiLCSMLD20,
author = {Rodrigo Kazuo Ikenami and
Viktoriya Lipovaya and
Patr{\'{\i}}cia Gomes Ferreira Da Costa and
{\'{E}}dison Renato Silva and
Paula Salom{\~{a}}o Martins and
Luiza Da Silveira Lobo and
Francisco Jos{\'{e}} Duarte},
title = {A method proposal to support decision-making in unstable ecosystems:
application in the Brazilian eSports ecosystem case},
journal = {Int. J. Technol. Manag.},
volume = {82},
number = {2},
pages = {172--195},
year = {2020},
url = {https://doi.org/10.1504/IJTM.2020.107857},
doi = {10.1504/IJTM.2020.107857},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijtm/IkenamiLCSMLD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jss/TeixeiraAFRPCBM20,
author = {Sergio Teixeira and
Bruno Alves Agrizzi and
Jos{\'{e}} Gon{\c{c}}alves Pereira Filho and
Silvana Rossetto and
Isaac Sim{\~{o}}es Ara{\'{u}}jo Pereira and
Patricia Dockhorn Costa and
Adriano Francisco Branco and
Ruan Rocha Martinelli},
title = {{LAURA} architecture: Towards a simpler way of building situation-aware
and business-aware IoT applications},
journal = {J. Syst. Softw.},
volume = {161},
year = {2020},
url = {https://doi.org/10.1016/j.jss.2019.110494},
doi = {10.1016/J.JSS.2019.110494},
timestamp = {Tue, 16 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jss/TeixeiraAFRPCBM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icecsys/CostaPRCAB20,
author = {Patr{\'{\i}}cia U. L. da Costa and
Guilherme Paim and
Leandro M. G. Rocha and
Eduardo A. C. da Costa and
S{\'{e}}rgio Almeida and
Sergio Bampi},
title = {An Efficient NLMS-based {VLSI} Architecture for Robust {FECG} Extraction
and {FHR} Processing},
booktitle = {27th {IEEE} International Conference on Electronics, Circuits and
Systems, {ICECS} 2020, Glasgow, Scotland, UK, November 23-25, 2020},
pages = {1--4},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICECS49266.2020.9294943},
doi = {10.1109/ICECS49266.2020.9294943},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icecsys/CostaPRCAB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icecsys/RosaUPCAB20,
author = {Andrei La Rosa and
Patr{\'{\i}}cia {\"{U}}cker and
Guilherme Paim and
Eduardo A. C. da Costa and
S{\'{e}}rgio J. M. de Almeida and
Sergio Bampi},
title = {Exploring {NLMS} and {IPNLMS} Adaptive Filtering {VLSI} Hardware Architectures
for Robust {EEG} Signal Artifacts Elimination},
booktitle = {27th {IEEE} International Conference on Electronics, Circuits and
Systems, {ICECS} 2020, Glasgow, Scotland, UK, November 23-25, 2020},
pages = {1--4},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICECS49266.2020.9294785},
doi = {10.1109/ICECS49266.2020.9294785},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icecsys/RosaUPCAB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ideal/CarneiroVVPC20,
author = {Davide Carneiro and
Patr{\'{\i}}cia Veloso and
Andr{\'{e}} Ventura and
Guilherme Palumbo and
Jo{\~{a}}o Costa},
editor = {Cesar Analide and
Paulo Novais and
David Camacho and
Hujun Yin},
title = {Network Analysis for Fraud Detection in Portuguese Public Procurement},
booktitle = {Intelligent Data Engineering and Automated Learning - {IDEAL} 2020
- 21st International Conference, Guimaraes, Portugal, November 4-6,
2020, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {12490},
pages = {390--401},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-62365-4\_37},
doi = {10.1007/978-3-030-62365-4\_37},
timestamp = {Wed, 26 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ideal/CarneiroVVPC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip5-5/FerreiraSDACVCQ20,
author = {Ana Ferreira and
Patr{\'{\i}}cia Santos and
Pedro Dias and
Am{\'{e}}lia Alves and
Beatriz Carmo and
Filipe Vilhena and
Sofia Costa and
Cl{\'{a}}udia Quaresma and
Carla Quint{\~{a}}o},
editor = {Luis M. Camarinha{-}Matos and
Nastaran Farhadi and
F{\'{a}}bio Lopes and
Helena Pereira},
title = {RehabVisual: Application on Subjects with Stroke},
booktitle = {Technological Innovation for Life Improvement - 11th {IFIP} {WG} 5.5/SOCOLNET
Advanced Doctoral Conference on Computing, Electrical and Industrial
Systems, DoCEIS 2020, Costa de Caparica, Portugal, July 1-3, 2020,
Proceedings},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {577},
pages = {355--365},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-45124-0\_34},
doi = {10.1007/978-3-030-45124-0\_34},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ifip5-5/FerreiraSDACVCQ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/FontanariPRUCB20,
author = {Thomas V. Fontanari and
Guilherme Paim and
Leandro M. G. Rocha and
Patr{\'{\i}}cia {\"{U}}cker and
Eduardo A. C. da Costa and
Sergio Bampi},
title = {An Efficient N-bit 8-2 Adder Compressor with a Constant Internal Carry
Propagation Delay},
booktitle = {11th {IEEE} Latin American Symposium on Circuits {\&} Systems,
{LASCAS} 2020, San Jose, Costa Rica, February 25-28, 2020},
pages = {1--4},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/LASCAS45839.2020.9069009},
doi = {10.1109/LASCAS45839.2020.9069009},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lascas/FontanariPRUCB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/UckerWPCB20,
author = {Patr{\'{\i}}cia {\"{U}}cker and
Miguel R. Weirich and
Guilherme Paim and
Eduardo A. C. da Costa and
Sergio Bampi},
title = {Optimizing Iterative-based Dividers for an Efficient Natural Logarithm
Operator Design},
booktitle = {11th {IEEE} Latin American Symposium on Circuits {\&} Systems,
{LASCAS} 2020, San Jose, Costa Rica, February 25-28, 2020},
pages = {1--4},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/LASCAS45839.2020.9068958},
doi = {10.1109/LASCAS45839.2020.9068958},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lascas/UckerWPCB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mwscas/LemePRULSCB20,
author = {Mateus Terribele Leme and
Guilherme Paim and
Leandro M. G. Rocha and
Patr{\'{\i}}cia {\"{U}}cker and
Vitor G. Lima and
Rafael Soares and
Eduardo A. C. da Costa and
Sergio Bampi},
title = {Optimizing the Montgomery Modular Multiplier for a Power- and Area-Efficient
Hardware Architecture},
booktitle = {63rd {IEEE} International Midwest Symposium on Circuits and Systems,
{MWSCAS} 2020, Springfield, MA, USA, August 9-12, 2020},
pages = {1084--1087},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/MWSCAS48704.2020.9184487},
doi = {10.1109/MWSCAS48704.2020.9184487},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mwscas/LemePRULSCB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/PiersonBCCCGHLN19,
author = {Jean{-}Marc Pierson and
Gwilherm Baudic and
St{\'{e}}phane Caux and
Berk Celik and
Georges Da Costa and
L{\'{e}}o Grange and
Marwa Haddad and
J{\'{e}}r{\^{o}}me Lecuivre and
Jean{-}Marc Nicod and
Laurent Philippe and
Veronika Rehn{-}Sonigo and
Robin Roche and
Gustavo Rostirolla and
Amal Sayah and
Patricia Stolf and
Minh{-}Thuyen Thi and
Christophe Varnier},
title = {{DATAZERO:} Datacenter With Zero Emission and Robust Management Using
Renewable Energy},
journal = {{IEEE} Access},
volume = {7},
pages = {103209--103230},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2019.2930368},
doi = {10.1109/ACCESS.2019.2930368},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/PiersonBCCCGHLN19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ahfe/MackayFSMBVFCSS19,
author = {Ana Mackay and
In{\^{e}}s Fortes and
Catarina Santos and
D{\'{a}}rio Machado and
Patr{\'{\i}}cia Barbosa and
Vera Vilas{-}Boas and
Jo{\~{a}}o Pedro Ferreira and
N{\'{e}}lson Costa and
Carlos Silva and
Emanuel Sousa},
editor = {Pedro M. Arezes},
title = {The Impact of Autonomous Vehicles' Active Feedback on Trust},
booktitle = {Advances in Safety Management and Human Factors - Proceedings of the
{AHFE} 2019 International Conference on Safety Management and Human
Factors, Washington, DC, USA, July 24-28, 2019},
series = {Advances in Intelligent Systems and Computing},
volume = {969},
pages = {342--352},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-20497-6\_32},
doi = {10.1007/978-3-030-20497-6\_32},
timestamp = {Fri, 29 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ahfe/MackayFSMBVFCSS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clei/OliveiraVJC19,
author = {Patr{\'{\i}}cia Oliveira and
Gustavo Vale and
Paulo Afonso J{\'{u}}nior and
Heitor A. X. Costa},
title = {Extraction of a Software Product Line Using Conditional Compilation
- An Exploratory Study},
booktitle = {{XLV} Latin American Computing Conference, {CLEI} 2019, Panama, September
30 - October 4, 2019},
pages = {1--10},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CLEI47609.2019.9089045},
doi = {10.1109/CLEI47609.2019.9089045},
timestamp = {Tue, 15 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/clei/OliveiraVJC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/StolfPSCR19,
author = {Patricia Stolf and
Jean{-}Marc Pierson and
Amal Sayah and
Georges Da Costa and
Paul Renaud{-}Goud},
editor = {Tung Bui},
title = {e-Flooding: Crisis Management through Two Temporal Loops},
booktitle = {52nd Hawaii International Conference on System Sciences, {HICSS} 2019,
Grand Wailea, Maui, Hawaii, USA, January 8-11, 2019},
pages = {1--10},
publisher = {ScholarSpace},
year = {2019},
url = {https://hdl.handle.net/10125/59735},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hicss/StolfPSCR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icecsys/PereiraPUCAB19,
author = {Pedro Tau{\~{a}} Lopes Pereira and
Guilherme Paim and
Patr{\'{\i}}cia {\"{U}}cker and
Eduardo A. C. da Costa and
S{\'{e}}rgio J. M. de Almeida and
Sergio Bampi},
title = {Exploring Architectural Solutions for an Energy-Efficient Kalman Filter
Gain Realization},
booktitle = {26th {IEEE} International Conference on Electronics, Circuits and
Systems, {ICECS} 2019, Genoa, Italy, November 27-29, 2019},
pages = {650--653},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICECS46596.2019.8964734},
doi = {10.1109/ICECS46596.2019.8964734},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icecsys/PereiraPUCAB19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/iet/19/OleksiakL0CMFGGLLMMOPPPSSV19,
author = {Ariel Oleksiak and
Laurent Lef{\`{e}}vre and
Pedro Alonso and
Georges Da Costa and
Vincenzo De Maio and
Neki Frasheri and
V{\'{\i}}ctor M. Garc{\'{\i}}a and
Joel E. Guerrero and
S{\'{e}}bastien Lafond and
Alexey L. Lastovetsky and
Ravi Reddy Manumachu and
Benson Muite and
Anne{-}C{\'{e}}cile Orgerie and
Wojciech Piatek and
Jean{-}Marc Pierson and
Radu Prodan and
Patricia Stolf and
Enida Sheme and
S{\'{e}}bastien Varrette},
editor = {Jes{\'{u}}s Carretero and
Emmanuel Jeannot and
Albert Y. Zomaya},
title = {Energy aware ultrascale systems},
booktitle = {Ultrascale Computing Systems},
pages = {127--188},
publisher = {{IET}},
year = {2019},
url = {https://doi.org/10.1049/pbpc024e\_ch5},
doi = {10.1049/PBPC024E\_CH5},
timestamp = {Wed, 07 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/iet/19/OleksiakL0CMFGGLLMMOPPPSSV19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19,
author = {Ziawasch Abedjan and
Nozha Boujemaa and
Stuart Campbell and
Patricia Casla and
Supriyo Chatterjea and
Sergio Consoli and
Crist{\'{o}}bal Costa Soria and
Paul Czech and
Marija Despenic and
Chiara Garattini and
Dirk Hamelinck and
Adrienne Heinrich and
Wessel Kraaij and
Jacek Kustra and
Aizea Lojo and
Marga Martin Sanchez and
Miguel Angel Mayer and
Matteo Melideo and
Ernestina Menasalvas and
Frank M{\o}ller Aarestrup and
Elvira Narro Artigot and
Milan Petkovic and
Diego Reforgiato Recupero and
Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
Gisele Roesems Kerremans and
Roland Roller and
M{\'{a}}rio Rom{\~{a}}o and
Stefan R{\"{u}}ping and
Felix Sasaki and
Wouter Spek and
Nenad Stojanovic and
Jack Thoms and
Andrejs Vasiljevs and
Wilfried Verachtert and
Roel Wuyts},
editor = {Sergio Consoli and
Diego Reforgiato Recupero and
Milan Petkovic},
title = {Data Science in Healthcare: Benefits, Challenges and Opportunities},
booktitle = {Data Science for Healthcare - Methodologies and Applications},
pages = {3--38},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-05249-2\_1},
doi = {10.1007/978-3-030-05249-2\_1},
timestamp = {Fri, 22 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cea/SouzaQSDLLC18,
author = {Jo{\~{a}}o Batista Freire de Souza and
Jo{\~{a}}o Paulo Ara{\'{u}}jo Fernandes de Queiroz and
Victoria Julia Silva dos Santos and
Maiko Roberto Tavares Dantas and
Renata Nayhara de Lima and
Patr{\'{\i}}cia de Oliveira Lima and
Leonardo Lelis de Macedo Costa},
title = {Cutaneous evaporative thermolysis and hair coat surface temperature
of calves evaluated with the aid of a gas analyzer and infrared thermography},
journal = {Comput. Electron. Agric.},
volume = {154},
pages = {222--226},
year = {2018},
url = {https://doi.org/10.1016/j.compag.2018.09.004},
doi = {10.1016/J.COMPAG.2018.09.004},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cea/SouzaQSDLLC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/GrangeCS18,
author = {L{\'{e}}o Grange and
Georges Da Costa and
Patricia Stolf},
title = {Green {IT} scheduling for data center powered with renewable energy},
journal = {Future Gener. Comput. Syst.},
volume = {86},
pages = {99--120},
year = {2018},
url = {https://doi.org/10.1016/j.future.2018.03.049},
doi = {10.1016/J.FUTURE.2018.03.049},
timestamp = {Fri, 24 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fgcs/GrangeCS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/VisoBMGPAZBGC18,
author = {Juan Francisco Viso and
Patricia Belelli and
Mat{\'{\i}}as R. Machado and
Humberto Gonz{\'{a}}lez and
Sergio Pantano and
Mar{\'{\i}}a Julia Amundarain and
Fernando Zamarre{\~{n}}o and
Maria Marta Branda and
Diego M. A. Gu{\'{e}}rin and
Marcelo D. Costabel},
title = {Multiscale modelization in a small virus: Mechanism of proton channeling
and its role in triggering capsid disassembly},
journal = {PLoS Comput. Biol.},
volume = {14},
number = {4},
year = {2018},
url = {https://doi.org/10.1371/journal.pcbi.1006082},
doi = {10.1371/JOURNAL.PCBI.1006082},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/VisoBMGPAZBGC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/closer/CostaRAS18,
author = {Breno G. S. Costa and
Marco Antonio Sousa Reis and
Alet{\'{e}}ia P. F. Ara{\'{u}}jo and
Priscila Sol{\'{\i}}s},
editor = {V{\'{\i}}ctor M{\'{e}}ndez Mu{\~{n}}oz and
Donald Ferguson and
Markus Helfert and
Claus Pahl},
title = {Performance and Cost Analysis Between On-Demand and Preemptive Virtual
Machines},
booktitle = {Proceedings of the 8th International Conference on Cloud Computing
and Services Science, {CLOSER} 2018, Funchal, Madeira, Portugal, March
19-21, 2018},
pages = {169--178},
publisher = {SciTePress},
year = {2018},
url = {https://doi.org/10.5220/0006709001690178},
doi = {10.5220/0006709001690178},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/closer/CostaRAS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/closer/FariaHRCRHBA18,
author = {Heitor Faria and
Rodrigo Hagstrom and
Marco Antonio Sousa Reis and
Breno G. S. Costa and
Edward de Oliveira Ribeiro and
Maristela Holanda and
Priscila Sol{\'{\i}}s Barreto and
Alet{\'{e}}ia P. F. Ara{\'{u}}jo},
editor = {V{\'{\i}}ctor M{\'{e}}ndez Mu{\~{n}}oz and
Donald Ferguson and
Markus Helfert and
Claus Pahl},
title = {A Hadoop Open Source Backup Solution},
booktitle = {Proceedings of the 8th International Conference on Cloud Computing
and Services Science, {CLOSER} 2018, Funchal, Madeira, Portugal, March
19-21, 2018},
pages = {651--657},
publisher = {SciTePress},
year = {2018},
url = {https://doi.org/10.5220/0006809206510657},
doi = {10.5220/0006809206510657},
timestamp = {Tue, 17 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/closer/FariaHRCRHBA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsima/AlmeidaCG18,
author = {Jo{\~{a}}o Paulo A. Almeida and
Patricia Dockhorn Costa and
Giancarlo Guizzardi},
editor = {Galina L. Rogova and
Christian Lebiere and
Odd Erik Gundersen and
Andrea Salfinger and
Ken Baclawski},
title = {Towards an Ontology of Scenes and Situations},
booktitle = {{IEEE} Conference on Cognitive and Computational Aspects of Situation
Management, CogSIMA 2018, Boston, MA, USA, June 11-14, 2018},
pages = {29--35},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/COGSIMA.2018.8423994},
doi = {10.1109/COGSIMA.2018.8423994},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cogsima/AlmeidaCG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsima/BaldiCZA18,
author = {Alessandro M. Baldi and
Patricia Dockhorn Costa and
Eduardo Zambon and
Jo{\~{a}}o Paulo A. Almeida},
editor = {Galina L. Rogova and
Christian Lebiere and
Odd Erik Gundersen and
Andrea Salfinger and
Ken Baclawski},
title = {Situations in Simulations: An Initial Appraisal},
booktitle = {{IEEE} Conference on Cognitive and Computational Aspects of Situation
Management, CogSIMA 2018, Boston, MA, USA, June 11-14, 2018},
pages = {90--96},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/COGSIMA.2018.8423971},
doi = {10.1109/COGSIMA.2018.8423971},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cogsima/BaldiCZA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iesa/MoreiraPSWSCL18,
author = {Jo{\~{a}}o L. R. Moreira and
Lu{\'{\i}}s Ferreira Pires and
Marten van Sinderen and
Roel J. Wieringa and
Prince M. Singh and
Patricia Dockhorn Costa and
Miguel Llop},
editor = {Keith Popplewell and
Klaus{-}Dieter Thoben and
Thomas Knothe and
Raul Poler},
title = {Improving the Semantic Interoperability of IoT Early Warning Systems:
The Port of Valencia Use Case},
booktitle = {Enterprise Interoperability {VIII:} Smart Services and Business Impact
of Enterprise Interoperability, Proceedings of {I-ESA} 2018, Berlin,
Germany, 2018},
series = {Proceedings of the {I-ESA} Conferences},
volume = {9},
pages = {17--29},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-13693-2\_2},
doi = {10.1007/978-3-030-13693-2\_2},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iesa/MoreiraPSWSCL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iri/MorenoSSBCC18,
author = {M{\'{a}}rcio Ferreira Moreno and
Rodrigo C. M. Santos and
Wallas H. S. dos Santos and
Rafael Brand{\~{a}}o and
Patricia Carrion and
Renato Cerqueira},
title = {Handling Hyperknowledge Representations through an Interactive Visual
Approach},
booktitle = {2018 {IEEE} International Conference on Information Reuse and Integration,
{IRI} 2018, Salt Lake City, UT, USA, July 6-9, 2018},
pages = {139--146},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IRI.2018.00029},
doi = {10.1109/IRI.2018.00029},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iri/MorenoSSBCC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ism/MorenoSSCC18,
author = {M{\'{a}}rcio Ferreira Moreno and
Wallas Henrique Sousa dos Santos and
Rodrigo Costa Mesquita Santos and
Patricia Torres Pereira Carrion and
Renato Fontoura de Gusm{\~{a}}o Cerqueira},
title = {Supporting Multimedia Retrieval in Annotated Content using Hyperknowledge},
booktitle = {2018 {IEEE} International Symposium on Multimedia, {ISM} 2018, Taichung,
Taiwan, December 10-12, 2018},
pages = {231--238},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/ISM.2018.000-1},
doi = {10.1109/ISM.2018.000-1},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ism/MorenoSSCC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mike/0001DMFLAAMFRAF18,
author = {Jos{\'{e}} Neves and
Almeida Dias and
Ana Morais and
Francisca Fonseca and
Patr{\'{\i}}cia Loreto and
Victor Alves and
Isabel Ara{\'{u}}jo and
Joana Machado and
Bruno Fernandes and
Jorge Ribeiro and
Cesar Analide and
Filipa Ferraz and
Jo{\~{a}}o Neves and
Henrique Vicente},
editor = {Adrian Groza and
Rajendra Prasath},
title = {Predicative Vagueness in Lung Metastases in Soft Tissue Sarcoma Screening},
booktitle = {Mining Intelligence and Knowledge Exploration - 6th International
Conference, {MIKE} 2018, Cluj-Napoca, Romania, December 20-22, 2018,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {11308},
pages = {80--89},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-05918-7\_8},
doi = {10.1007/978-3-030-05918-7\_8},
timestamp = {Thu, 01 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mike/0001DMFLAAMFRAF18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/prdc/MedeirosI0V18,
author = {Nadia Patricia Da Silva Medeiros and
Naghmeh Ramezani Ivaki and
Pedro Costa and
Marco Vieira},
title = {An Approach for Trustworthiness Benchmarking Using Software Metrics},
booktitle = {23rd {IEEE} Pacific Rim International Symposium on Dependable Computing,
{PRDC} 2018, Taipei, Taiwan, December 4-7, 2018},
pages = {84--93},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/PRDC.2018.00019},
doi = {10.1109/PRDC.2018.00019},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/prdc/MedeirosI0V18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/GenovezEFBF17,
author = {Patricia Genovez and
Nelson F. F. Ebecken and
Corina da Costa Freitas and
Cristina Maria Bentz and
Ramon Freitas},
title = {Intelligent hybrid system for dark spot detection using {SAR} data},
journal = {Expert Syst. Appl.},
volume = {81},
pages = {384--397},
year = {2017},
url = {https://doi.org/10.1016/j.eswa.2017.03.037},
doi = {10.1016/J.ESWA.2017.03.037},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eswa/GenovezEFBF17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/GenovezFSBL17,
author = {Patricia Genovez and
Corina C. Freitas and
Sidnei J. S. Sant'Anna and
Cristina Maria Bentz and
Jo{\~{a}}o Ant{\^{o}}nio Lorenzzetti},
title = {Oil Slicks Detection From Polarimetric Data Using Stochastic Distances
Between Complex Wishart Distributions},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {10},
number = {2},
pages = {463--477},
year = {2017},
url = {https://doi.org/10.1109/JSTARS.2016.2628325},
doi = {10.1109/JSTARS.2016.2628325},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/GenovezFSBL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acsw/CostantinSW17,
author = {Daniel Costantin and
Krishnun Sansurooah and
Patricia A. H. Williams},
title = {Vulnerabilities associated with wi-fi protected setup in a medical
environment},
booktitle = {Proceedings of the Australasian Computer Science Week Multiconference,
{ACSW} 2017, Geelong, Australia, January 31 - February 3, 2017},
pages = {58:1--58:12},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3014812.3014872},
doi = {10.1145/3014812.3014872},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acsw/CostantinSW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eScience/MarianoSMT17,
author = {Greice Cristina Mariano and
Natalia Costa Soares and
Leonor Patricia Cerdeira Morellato and
Ricardo da Silva Torres},
title = {Change Frequency Heatmaps for Temporal Multivariate Phenological Data
Analysis},
booktitle = {13th {IEEE} International Conference on e-Science, e-Science 2017,
Auckland, New Zealand, October 24-27, 2017},
pages = {305--314},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/eScience.2017.44},
doi = {10.1109/ESCIENCE.2017.44},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eScience/MarianoSMT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edge/MedeirosICV17,
author = {Nadia Patricia Da Silva Medeiros and
Naghmeh Ramezani Ivaki and
Pedro Nunes Da Costa and
Marco Paulo Amorim Vieira},
title = {Towards an Approach for Trustworthiness Assessment of Software as
a Service},
booktitle = {{IEEE} International Conference on Edge Computing, {EDGE} 2017, Honolulu,
HI, USA, June 25-30, 2017},
pages = {220--223},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/IEEE.EDGE.2017.39},
doi = {10.1109/IEEE.EDGE.2017.39},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/edge/MedeirosICV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/FernandesSGSCCA17,
author = {Daniel Louzada Fernandes and
Rodrigo Siqueira{-}Batista and
Andreia Patricia Gomes and
Camila R. Souza and
Israel T. da Costa and
Felippe da S. L. Cardoso and
Jo{\~{a}}o V. de Assis and
Gustavo H. L. Caetano and
Fabio Ribeiro Cerqueira},
editor = {Petros Koumoutsakos and
Michael Lees and
Valeria V. Krzhizhanovskaya and
Jack J. Dongarra and
Peter M. A. Sloot},
title = {Investigation of the visual attention role in clinical bioethics decision-making
using machine learning algorithms},
booktitle = {International Conference on Computational Science, {ICCS} 2017, 12-14
June 2017, Zurich, Switzerland},
series = {Procedia Computer Science},
volume = {108},
pages = {1165--1174},
publisher = {Elsevier},
year = {2017},
url = {https://doi.org/10.1016/j.procs.2017.05.032},
doi = {10.1016/J.PROCS.2017.05.032},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccS/FernandesSGSCCA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interaccion/CostagutaLMMM17,
author = {Rosanna Costaguta and
Germ{\'{a}}n Lescano and
Pablo Santana Mansilla and
Daniela Missio and
Patricia Miro},
editor = {Juan Manuel Gonz{\'{a}}lez{-}Calleros},
title = {Using data mining for discovering relationships between collaboration
skills and group roles},
booktitle = {Proceedings of the {XVIII} International Conference on Human Computer
Interaction, Interacci{\'{o}}n 2017, Cancun, Mexico, September
25-27, 2017},
pages = {24:1--24:2},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3123818.3123848},
doi = {10.1145/3123818.3123848},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interaccion/CostagutaLMMM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/issre/MedeirosI0V17,
author = {Nadia Patricia Da Silva Medeiros and
Naghmeh Ramezani Ivaki and
Pedro Costa and
Marco Vieira},
title = {Software Metrics as Indicators of Security Vulnerabilities},
booktitle = {28th {IEEE} International Symposium on Software Reliability Engineering,
{ISSRE} 2017, Toulouse, France, October 23-26, 2017},
pages = {216--227},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/ISSRE.2017.11},
doi = {10.1109/ISSRE.2017.11},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/issre/MedeirosI0V17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jurse/BechtelCTVCTDSL17,
author = {Benjamin Bechtel and
Olaf Conrad and
Matthias Tamminga and
Marie{-}Leen Verdonck and
Frieke Van Coillie and
Devis Tuia and
Matthias Demuzere and
Linda See and
Patricia Lopes and
Cid{\'{a}}lia Costa Fonte and
Yong Xu and
Chao Ren and
Gerald Mills and
N. Kaloustian and
Arthur Cassone},
title = {Beyond the urban mask},
booktitle = {Joint Urban Remote Sensing Event, {JURSE} 2017, Dubai, United Arab
Emirates, March 6-8, 2017},
pages = {1--4},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/JURSE.2017.7924557},
doi = {10.1109/JURSE.2017.7924557},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/jurse/BechtelCTVCTDSL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/modelsward/MoreiraPSC17,
author = {Jo{\~{a}}o L. R. Moreira and
Lu{\'{\i}}s Ferreira Pires and
Marten van Sinderen and
Patricia Dockhorn Costa},
editor = {Lu{\'{\i}}s Ferreira Pires and
Slimane Hammoudi and
Bran Selic},
title = {Ontology-Driven Conceptual Modeling for Early Warning Systems: Redesigning
the Situation Modeling Language},
booktitle = {Proceedings of the 5th International Conference on Model-Driven Engineering
and Software Development, {MODELSWARD} 2017, Porto, Portugal, February
19-21, 2017},
pages = {467--477},
publisher = {SciTePress},
year = {2017},
url = {https://doi.org/10.5220/0006208904670477},
doi = {10.5220/0006208904670477},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/modelsward/MoreiraPSC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semco/PuttiniTCARCIAO17,
author = {Ricardo Staciarini Puttini and
Andre Amaro Toffanello and
Ricardo Matos Chaim and
Gabriela Alves and
Jussara M. P. R{\"{o}}tzsch and
Erica Oliveira Carvalho and
Edison Ishikawa and
Alet{\'{e}}ia Patr{\'{\i}}cia Favacho de Ara{\'{u}}jo and
Edgard Costa Oliveira},
title = {Semantic Framework for Electronic Health Records},
booktitle = {11th {IEEE} International Conference on Semantic Computing, {ICSC}
2017, San Diego, CA, USA, January 30 - February 1, 2017},
pages = {334--337},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/ICSC.2017.98},
doi = {10.1109/ICSC.2017.98},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/semco/PuttiniTCARCIAO17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gis/VilasGVPMRDHPGP16,
author = {Luis Gonz{\'{a}}lez Vilas and
C{\'{a}}stor Guisande and
Richard P. Vari and
Patricia Pelayo{-}Villamil and
Ana Manjarr{\'{e}}s{-}Hern{\'{a}}ndez and
Emilio Garc{\'{\i}}a Rosell{\'{o}} and
Jacinto Gonz{\'{a}}lez Dacosta and
J{\"{u}}rgen Heine and
Elisa P{\'{e}}rez{-}Costas and
Carlos Granado{-}Lorencio and
Antoni Palau{-}Ibars and
Jorge M. Lobo},
title = {Geospatial data of freshwater habitats for macroecological studies:
an example with freshwater fishes},
journal = {Int. J. Geogr. Inf. Sci.},
volume = {30},
number = {1},
pages = {126--141},
year = {2016},
url = {https://doi.org/10.1080/13658816.2015.1072629},
doi = {10.1080/13658816.2015.1072629},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/gis/VilasGVPMRDHPGP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cluster/VillebonnetCLPS16,
author = {Violaine Villebonnet and
Georges Da Costa and
Laurent Lef{\`{e}}vre and
Jean{-}Marc Pierson and
Patricia Stolf},
title = {Dynamically Building Energy Proportional Data Centers with Heterogeneous
Computing Resources},
booktitle = {2016 {IEEE} International Conference on Cluster Computing, {CLUSTER}
2016, Taipei, Taiwan, September 12-16, 2016},
pages = {217--220},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/CLUSTER.2016.34},
doi = {10.1109/CLUSTER.2016.34},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cluster/VillebonnetCLPS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpads/VillebonnetCLPS16,
author = {Violaine Villebonnet and
Georges Da Costa and
Laurent Lef{\`{e}}vre and
Jean{-}Marc Pierson and
Patricia Stolf},
title = {Energy Proportionality in Heterogeneous Data Center Supporting Applications
with Variable Load},
booktitle = {22nd {IEEE} International Conference on Parallel and Distributed Systems,
{ICPADS} 2016, Wuhan, China, December 13-16, 2016},
pages = {1023--1030},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/ICPADS.2016.0136},
doi = {10.1109/ICPADS.2016.0136},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpads/VillebonnetCLPS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispe/QuingerskiCSF16,
author = {Leandro Quingerski and
Scheila Nair da Costa and
Cristiano Schwening and
Patr{\'{\i}}cia de S{\'{a}} Freire},
editor = {Milton Borsato and
Nel Wognum and
Margherita Peruzzini and
Josip Stjepandic and
Wim J. C. Verhagen},
title = {{BND:} {A} Proposal of a Business Needs Documentation for Software
Solutions to Business Analysts},
booktitle = {Transdisciplinary Engineering: Crossing Boundaries - Proceedings of
the 23rd {ISPE} Inc. International Conference on Transdisciplinary
Engineering, Curitiba, Parana, Brazil, October 3-7, 2016},
series = {Advances in Transdisciplinary Engineering},
volume = {4},
pages = {259--266},
publisher = {{IOS} Press},
year = {2016},
url = {https://doi.org/10.3233/978-1-61499-703-0-259},
doi = {10.3233/978-1-61499-703-0-259},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ispe/QuingerskiCSF16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbac-pad/VillebonnetCLPS16,
author = {Violaine Villebonnet and
Georges Da Costa and
Laurent Lef{\`{e}}vre and
Jean{-}Marc Pierson and
Patricia Stolf},
title = {Energy Aware Dynamic Provisioning for Heterogeneous Data Centers},
booktitle = {28th International Symposium on Computer Architecture and High Performance
Computing, {SBAC-PAD} 2016, Los Angeles, CA, USA, October 26-28, 2016},
pages = {206--213},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/SBAC-PAD.2016.34},
doi = {10.1109/SBAC-PAD.2016.34},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sbac-pad/VillebonnetCLPS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbsi/CostaVM16,
author = {Augusto Verzbickas Costa and
Patricia Vilain and
Ronaldo dos Santos Mello},
editor = {Frank Siqueira and
Patricia Vilain and
Claudia Cappelli and
Raul Sidnei Wazlawick},
title = {Uma Camada para o Mapeamento de Instru{\c{c}}{\~{o}}es {SQL} {DML}
para o Banco de Dados NoSQL Chave-Valor Voldemort {[A} Layer for the
Mapping Management of {SQL} {DML} Instructions to the Key-Value NoSQL
Database Voldemort]},
booktitle = {Proceedings of the {XII} Brazilian Symposium on Information Systems
on Brazilian Symposium on Information Systems: Information Systems
in the Cloud Computing Era, {SBSI} 2016, Florian{\'{o}}polis,
Brazil, May 17-20, 2016},
pages = {224--231},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.5753/sbsi.2016.5966},
doi = {10.5753/SBSI.2016.5966},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sbsi/CostaVM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/adhoc/CupertinoCOPPSS15,
author = {Leandro F. Cupertino and
Georges Da Costa and
Ariel Oleksiak and
Wojciech Piatek and
Jean{-}Marc Pierson and
Jaume Salom and
Laura Sis{\'{o}} and
Patricia Stolf and
Hongyang Sun and
Thomas Zilio},
title = {Energy-efficient, thermal-aware modeling and simulation of data centers:
The CoolEmAll approach and evaluation results},
journal = {Ad Hoc Networks},
volume = {25},
pages = {535--553},
year = {2015},
url = {https://doi.org/10.1016/j.adhoc.2014.11.002},
doi = {10.1016/J.ADHOC.2014.11.002},
timestamp = {Thu, 27 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/adhoc/CupertinoCOPPSS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ao/MoreiraPSC15,
author = {Jo{\~{a}}o L. R. Moreira and
Lu{\'{\i}}s Ferreira Pires and
Marten van Sinderen and
Patricia Dockhorn Costa},
title = {Towards ontology-driven situation-aware disaster management},
journal = {Appl. Ontology},
volume = {10},
number = {3-4},
pages = {339--353},
year = {2015},
url = {https://doi.org/10.3233/AO-150155},
doi = {10.3233/AO-150155},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ao/MoreiraPSC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ppl/VillebonnetCLPS15,
author = {Violaine Villebonnet and
Georges Da Costa and
Laurent Lef{\`{e}}vre and
Jean{-}Marc Pierson and
Patricia Stolf},
title = {"Big, Medium, Little": Reaching Energy Proportionality with Heterogeneous
Computing Scheduler},
journal = {Parallel Process. Lett.},
volume = {25},
number = {3},
pages = {1541006:1--1541006:30},
year = {2015},
url = {https://doi.org/10.1142/S0129626415410066},
doi = {10.1142/S0129626415410066},
timestamp = {Tue, 24 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ppl/VillebonnetCLPS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/RibeiroJSCPR15,
author = {Patricia B. Ribeiro and
Leandro A. Passos Junior and
Luis Alexandre da Silva and
Kelton A. P. da Costa and
Jo{\~{a}}o P. Papa and
Roseli A. F. Romero},
editor = {Caetano Traina Jr. and
Pedro Pereira Rodrigues and
Bridget Kane and
Paulo Mazzoncini de Azevedo Marques and
Agma Juci Machado Traina},
title = {Unsupervised Breast Masses Classification through Optimum-Path Forest},
booktitle = {28th {IEEE} International Symposium on Computer-Based Medical Systems,
{CBMS} 2015, Sao Carlos, Brazil, June 22-25, 2015},
pages = {238--243},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/CBMS.2015.53},
doi = {10.1109/CBMS.2015.53},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cbms/RibeiroJSCPR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsima/SobralAC15,
author = {Vinicius M. Sobral and
Jo{\~{a}}o Paulo A. Almeida and
Patricia Dockhorn Costa},
title = {Assessing situation models with a lightweight formal method},
booktitle = {{IEEE} International Inter-Disciplinary Conference on Cognitive Methods
in Situation Awareness and Decision Support, CogSIMA 2015, Orlando,
FL, USA, March 9-12, 2015},
pages = {42--48},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/COGSIMA.2015.7108173},
doi = {10.1109/COGSIMA.2015.7108173},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cogsima/SobralAC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/GenovezFS15,
author = {Patricia Genovez and
Corina da Costa Freitas and
Sidnei J. S. Sant'Anna and
Cristina Maria Bentz and
Jo{\~{a}}o Ant{\^{o}}nio Lorenzzetti},
title = {Oil slicks detection using a polarimetric region classifier},
booktitle = {2015 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2015, Milan, Italy, July 26-31, 2015},
pages = {3239--3242},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/IGARSS.2015.7326508},
doi = {10.1109/IGARSS.2015.7326508},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/GenovezFS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/im/RibeiroSC15,
author = {Patricia Bellin Ribeiro and
Luis Alexandre da Silva and
Kelton Augusto Pontara da Costa},
editor = {Remi Badonnel and
Jin Xiao and
Shingo Ata and
Filip De Turck and
Voicu Groza and
Carlos Raniery Paula dos Santos},
title = {Spam intrusion detection in computer networks using intelligent techniques},
booktitle = {{IFIP/IEEE} International Symposium on Integrated Network Management,
{IM} 2015, Ottawa, ON, Canada, 11-15 May, 2015},
pages = {1357--1360},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/INM.2015.7140495},
doi = {10.1109/INM.2015.7140495},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/im/RibeiroSC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pdp/ChetsaLPSC15,
author = {Ghislain Landry Tsafack Chetsa and
Laurent Lef{\`{e}}vre and
Jean{-}Marc Pierson and
Patricia Stolf and
Georges Da Costa},
editor = {Masoud Daneshtalab and
Marco Aldinucci and
Ville Lepp{\"{a}}nen and
Johan Lilius and
Mats Brorsson},
title = {Application-Agnostic Framework for Improving the Energy Efficiency
of Multiple {HPC} Subsystems},
booktitle = {23rd Euromicro International Conference on Parallel, Distributed,
and Network-Based Processing, {PDP} 2015, Turku, Finland, March 4-6,
2015},
pages = {62--69},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/PDP.2015.18},
doi = {10.1109/PDP.2015.18},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pdp/ChetsaLPSC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ruleml/MoreiraPSC15,
author = {Jo{\~{a}}o L. R. Moreira and
Lu{\'{\i}}s Ferreira Pires and
Marten van Sinderen and
Patricia Dockhorn Costa},
editor = {Nick Bassiliades and
Paul Fodor and
Adrian Giurca and
Georg Gottlob and
Tom{\'{a}}s Kliegr and
Grzegorz J. Nalepa and
Monica Palmirani and
Adrian Paschke and
Mark Proctor and
Dumitru Roman and
Fariba Sadri and
Nenad Stojanovic},
title = {Developing Situation-Aware Applications for Disaster Management with
a Distributed Rule-Based platform},
booktitle = {Proceedings of the RuleML 2015 Challenge, the Special Track on Rule-based
Recommender Systems for the Web of Data, the Special Industry Track
and the RuleML 2015 Doctoral Consortium hosted by the 9th International
Web Rule Symposium (RuleML 2015), Berlin, Germany, August 2-5, 2015},
series = {{CEUR} Workshop Proceedings},
volume = {1417},
publisher = {CEUR-WS.org},
year = {2015},
url = {https://ceur-ws.org/Vol-1417/paper15.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:58 +0100},
biburl = {https://dblp.org/rec/conf/ruleml/MoreiraPSC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbgames/OliveiraLCTCL15,
author = {Patricia A. de Oliveira and
Erich P. Lotto and
Ana Grasielle Dion{\'{\i}}sio Corr{\^{e}}a and
Luis G. G. Taboada and
Laisa C. P. Costa and
Roseli D. Lopes},
editor = {Maria Andr{\'{e}}ia Formico Rodrigues and
Fl{\'{a}}via Garcia de Carvalho and
Marcelo Sim{\~{a}}o de Vasconcellos},
title = {Virtual Stage: An Immersive Musical Game for People with Visual Impairment},
booktitle = {14th Brazilian Symposium on Computer Games and Digital Entertainment,
SBGames 2015, Piau{\'{\i}}, Brazil, November 11-13, 2015},
pages = {135--141},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/SBGames.2015.26},
doi = {10.1109/SBGAMES.2015.26},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sbgames/OliveiraLCTCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/ChetsaLPSC14,
author = {Ghislain Landry Tsafack Chetsa and
Laurent Lef{\`{e}}vre and
Jean{-}Marc Pierson and
Patricia Stolf and
Georges Da Costa},
title = {Exploiting performance counters to predict and improve energy performance
of {HPC} systems},
journal = {Future Gener. Comput. Syst.},
volume = {36},
pages = {287--298},
year = {2014},
url = {https://doi.org/10.1016/j.future.2013.07.010},
doi = {10.1016/J.FUTURE.2013.07.010},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/fgcs/ChetsaLPSC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fini/MotaTCVBCLPRFPAT14,
author = {Benoit Da Mota and
Radu Tudoran and
Alexandru Costan and
Ga{\"{e}}l Varoquaux and
Goetz Brasche and
Patricia J. Conrod and
Herv{\'{e}} Lema{\^{\i}}tre and
Tom{\'{a}}s Paus and
Marcella Rietschel and
Vincent Frouin and
Jean{-}Baptiste Poline and
Gabriel Antoniu and
Bertrand Thirion},
title = {Generic Machine Learning Pattern for Neuroimaging-Genetic Studies
in the Cloud},
journal = {Frontiers Neuroinformatics},
volume = {8},
pages = {31},
year = {2014},
url = {https://doi.org/10.3389/fninf.2014.00031},
doi = {10.3389/FNINF.2014.00031},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fini/MotaTCVBCLPRFPAT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsa/FaicalCPUFCFVOVB14,
author = {Bruno S. Fai{\c{c}}al and
Fausto G. Costa and
Gustavo Pessin and
J{\'{o}} Ueyama and
Heitor Freitas and
Alexandre Colombo and
Pedro H. Fini and
Leandro A. Villas and
Fernando Santos Os{\'{o}}rio and
Patr{\'{\i}}cia A. Vargas and
Torsten Braun},
title = {The use of unmanned aerial vehicles and wireless sensor networks for
spraying pesticides},
journal = {J. Syst. Archit.},
volume = {60},
number = {4},
pages = {393--404},
year = {2014},
url = {https://doi.org/10.1016/j.sysarc.2014.01.004},
doi = {10.1016/J.SYSARC.2014.01.004},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jsa/FaicalCPUFCFVOVB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/suscom/SunSPC14,
author = {Hongyang Sun and
Patricia Stolf and
Jean{-}Marc Pierson and
Georges Da Costa},
title = {Energy-efficient and thermal-aware resource management for heterogeneous
datacenters},
journal = {Sustain. Comput. Informatics Syst.},
volume = {4},
number = {4},
pages = {292--306},
year = {2014},
url = {https://doi.org/10.1016/j.suscom.2014.08.005},
doi = {10.1016/J.SUSCOM.2014.08.005},
timestamp = {Thu, 27 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/suscom/SunSPC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bdcloud/VillebonnetCLPS14,
author = {Violaine Villebonnet and
Georges Da Costa and
Laurent Lef{\`{e}}vre and
Jean{-}Marc Pierson and
Patricia Stolf},
title = {Towards Generalizing "Big Little" for Energy Proportional {HPC} and
Cloud Infrastructures},
booktitle = {2014 {IEEE} Fourth International Conference on Big Data and Cloud
Computing, BDCloud 2014, Sydney, Australia, December 3-5, 2014},
pages = {703--710},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/BDCloud.2014.99},
doi = {10.1109/BDCLOUD.2014.99},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bdcloud/VillebonnetCLPS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/RibeiroCPR14,
author = {Patricia B. Ribeiro and
Kelton A. P. da Costa and
Jo{\~{a}}o Paulo Papa and
Roseli A. Francelin Romero},
title = {Optimum-Path Forest Applied for Breast Masses Classification},
booktitle = {2014 {IEEE} 27th International Symposium on Computer-Based Medical
Systems, New York, NY, USA, May 27-29, 2014},
pages = {52--55},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/CBMS.2014.27},
doi = {10.1109/CBMS.2014.27},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cbms/RibeiroCPR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/SunSPC14,
author = {Hongyang Sun and
Patricia Stolf and
Jean{-}Marc Pierson and
Georges Da Costa},
title = {Multi-objective Scheduling for Heterogeneous Server Systems with Machine
Placement},
booktitle = {14th {IEEE/ACM} International Symposium on Cluster, Cloud and Grid
Computing, CCGrid 2014, Chicago, IL, USA, May 26-29, 2014},
pages = {334--343},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/CCGrid.2014.53},
doi = {10.1109/CCGRID.2014.53},
timestamp = {Thu, 27 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ccgrid/SunSPC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsima/RaymundoCAP14,
author = {Caroline Rizzi Raymundo and
Patricia Dockhorn Costa and
Jo{\~{a}}o Paulo A. Almeida and
Isaac Pereira},
editor = {Gabriel Jakobson and
Kristin E. Schaefer and
Mitch Kokar and
Ann M. Bisantz and
Tom Ziemke},
title = {An infrastructure for distributed rule-based situation management},
booktitle = {{IEEE} International Inter-Disciplinary Conference on Cognitive Methods
in Situation Awareness and Decision Support, CogSIMA 2014, San Antonio,
TX, USA, March 3-6, 2014},
pages = {202--208},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/CogSIMA.2014.6816563},
doi = {10.1109/COGSIMA.2014.6816563},
timestamp = {Sun, 08 Aug 2021 01:40:51 +0200},
biburl = {https://dblp.org/rec/conf/cogsima/RaymundoCAP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/CostaK14,
author = {Patricia Dockhorn Costa and
Jens Kolb},
editor = {Georg Grossmann and
Sylvain Hall{\'{e}} and
Dimka Karastoyanova and
Manfred Reichert and
Stefanie Rinderle{-}Ma},
title = {Message from the Demonstration Track 2014 Chairs},
booktitle = {18th {IEEE} International Enterprise Distributed Object Computing
Conference Workshops and Demonstrations, {EDOC} Workshops 2014, Ulm,
Germany, September 1-2, 2014},
pages = {397},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/EDOCW.2014.65},
doi = {10.1109/EDOCW.2014.65},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/edoc/CostaK14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/KellerTCCTLPLJ14,
author = {Dami{\'{a}}n Keller and
Joseph Timoney and
Leandro Lesqueves Costalonga and
Ariadna Capasso and
Patricia Tinajero and
Victor Lazzarini and
Marcelo Soares Pimenta and
Maria Helena de Lima and
Marcelo O. Johann},
title = {Ecologically grounded multimodal design: The Palafito 1.0 study},
booktitle = {Music Technology meets Philosophy - From Digital Echos to Virtual
Ethos: Joint Proceedings of the 40th International Computer Music
Conference, {ICMC} 2014, and the 11th Sound and Music Computing Conference,
{SMC} 2014, Athens, Greece, September 14-20, 2014},
publisher = {Michigan Publishing},
year = {2014},
url = {https://hdl.handle.net/2027/spo.bbp2372.2014.255},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/KellerTCCTLPLJ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ihtc/RodriguesRVM14,
author = {Thelma Virg{\'{\i}}nia Rodrigues and
Elcie Helena Costa Rodrigues and
Silvana Patricia de Vasconcelos and
Plinio Soares Paolinelli Maciel},
title = {Maria Teixeira School},
booktitle = {2014 {IEEE} Canada International Humanitarian Technology Conference,
{IHTC} 2014, Montreal, QC, Canada, June 1-4, 2014},
pages = {1--6},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/IHTC.2014.7147539},
doi = {10.1109/IHTC.2014.7147539},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ihtc/RodriguesRVM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/SunSPC14,
author = {Hongyang Sun and
Patricia Stolf and
Jean{-}Marc Pierson and
Georges Da Costa},
title = {Energy-Efficient and Thermal-Aware Resource Management for Heterogeneous
Datacenters},
journal = {CoRR},
volume = {abs/1410.3104},
year = {2014},
url = {http://arxiv.org/abs/1410.3104},
eprinttype = {arXiv},
eprint = {1410.3104},
timestamp = {Thu, 27 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/SunSPC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aai/PessinOSUCWDBV13,
author = {Gustavo Pessin and
Fernando Santos Os{\'{o}}rio and
Jefferson R. Souza and
J{\'{o}} Ueyama and
Fausto G. Costa and
Denis F. Wolf and
Desislava C. Dimitrova and
Torsten Braun and
Patr{\'{\i}}cia Am{\^{a}}ncio Vargas},
title = {Investigation on the Evolution of an Indoor robotic Localization System
Based on Wireless Networks},
journal = {Appl. Artif. Intell.},
volume = {27},
number = {8},
pages = {743--758},
year = {2013},
url = {https://doi.org/10.1080/08839514.2013.823328},
doi = {10.1080/08839514.2013.823328},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aai/PessinOSUCWDBV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpca/DiouriCGLPSC13,
author = {Mohammed el Mehdi Diouri and
Ghislain Landry Tsafack Chetsa and
Olivier Gl{\"{u}}ck and
Laurent Lef{\`{e}}vre and
Jean{-}Marc Pierson and
Patricia Stolf and
Georges Da Costa},
title = {Energy efficiency in high-performance computing with and without knowledge
of applications and services},
journal = {Int. J. High Perform. Comput. Appl.},
volume = {27},
number = {3},
pages = {232--243},
year = {2013},
url = {https://doi.org/10.1177/1094342013495304},
doi = {10.1177/1094342013495304},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijhpca/DiouriCGLPSC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsima/PereiraCA13,
author = {Isaac Sim{\~{o}}es Ara{\'{u}}jo Pereira and
Patricia Dockhorn Costa and
Jo{\~{a}}o Paulo A. Almeida},
editor = {Gabriel Jakobson and
Adam Stotz and
Mitch Kokar and
Tom Ziemke},
title = {A rule-based platform for situation management},
booktitle = {{IEEE} International Multi-Disciplinary Conference on Cognitive Methods
in Situation Awareness and Decision Support, CogSIMA 2013, San Diego,
CA, USA, February 25-28, 2013},
pages = {83--90},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/CogSIMA.2013.6523827},
doi = {10.1109/COGSIMA.2013.6523827},
timestamp = {Sun, 08 Aug 2021 01:40:51 +0200},
biburl = {https://dblp.org/rec/conf/cogsima/PereiraCA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/greencom/ChetsaLPSC13,
author = {Ghislain Landry Tsafack Chetsa and
Laurent Lef{\`{e}}vre and
Jean{-}Marc Pierson and
Patricia Stolf and
Georges Da Costa},
title = {A User Friendly Phase Detection Methodology for {HPC} Systems' Analysis},
booktitle = {2013 {IEEE} International Conference on Green Computing and Communications
(GreenCom) and {IEEE} Internet of Things (iThings) and {IEEE} Cyber,
Physical and Social Computing (CPSCom), Beijing, China, August 20-23,
2013},
pages = {118--125},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/GreenCom-iThings-CPSCom.2013.43},
doi = {10.1109/GREENCOM-ITHINGS-CPSCOM.2013.43},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/greencom/ChetsaLPSC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ivs/AlvesGROO13,
author = {Patr{\'{\i}}cia Alves and
Joel Gon{\c{c}}alves and
Rosaldo J. F. Rossetti and
Eug{\'{e}}nio C. Oliveira and
Cristina Olaverri{-}Monreal},
title = {Forward collision warning systems using heads-up displays: Testing
usability of two new metaphors},
booktitle = {2013 {IEEE} Intelligent Vehicles Symposium (IV), Gold Coast City,
Australia, June 23-26, 2013},
pages = {1--6},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/IVS.2013.6629438},
doi = {10.1109/IVS.2013.6629438},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ivs/AlvesGROO13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/webmedia/LopesGSDSCBPYG13,
author = {Jo{\~{a}}o Ladislau Lopes and
M{\'{a}}rcia Zechlinski Gusm{\~{a}}o and
Rodrigo Santos de Souza and
Patricia Davet and
Alexandre Souza and
Cristiano Andr{\'{e}} da Costa and
Jorge L. V. Barbosa and
Ana Marilza Pernas and
Adenauer C. Yamin and
Cl{\'{a}}udio Fernando Resin Geyer},
editor = {C{\'{a}}ssio V. S. Prazeres and
Paulo Nazareno Maia Sampaio and
Andr{\'{e}} Santanch{\`{e}} and
Celso A. S. Santos and
Rudinei Goularte},
title = {Towards a distributed architecture for context-aware mobile applications
in UbiComp},
booktitle = {19th Brazilian Symposium on Multimedia and the Web, WebMedia '13,
Salvador, Brazil, November 5-8, 2013},
pages = {43--50},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2526188.2526209},
doi = {10.1145/2526188.2526209},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/webmedia/LopesGSDSCBPYG13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wise/AbreuCSMOLW13,
author = {Carolina G. Abreu and
Fl{\'{a}}vio Costa and
La{\'{e}}cio L. Santos and
Lucas Borges Monteiro and
Luiz Fernando Peres de Oliveira and
Patr{\'{\i}}cia Lustosa and
Li Weigang},
editor = {Xuemin Lin and
Yannis Manolopoulos and
Divesh Srivastava and
Guangyan Huang},
title = {Entity Extraction within Plain-Text Collections {WISE} 2013 Challenge
- {T1:} Entity Linking Track},
booktitle = {Web Information Systems Engineering - {WISE} 2013 - 14th International
Conference, Nanjing, China, October 13-15, 2013, Proceedings, Part
{I}},
series = {Lecture Notes in Computer Science},
volume = {8180},
pages = {491--496},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-41230-1\_42},
doi = {10.1007/978-3-642-41230-1\_42},
timestamp = {Mon, 15 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wise/AbreuCSMOLW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/shti/RoyCJLTNR13,
author = {Michael J. Roy and
Michelle E. Costanzo and
Tanja Jovanovic and
Suzanne Leaman and
Patricia L. Taylor and
Seth D. Norrholm and
Albert A. Rizzo},
editor = {Brenda K. Wiederhold and
Giuseppe Riva},
title = {Heart Rate Response to Fear Conditioning and Virtual Reality in Subthreshold
{PTSD}},
booktitle = {Annual Review of Cybertherapy and Telemedicine 2013 - Positive Technology
and Health Engagement for Healthy Living and Active Ageing},
series = {Studies in Health Technology and Informatics},
volume = {191},
pages = {115--119},
publisher = {{IOS} Press},
year = {2013},
url = {https://doi.org/10.3233/978-1-61499-282-0-115},
doi = {10.3233/978-1-61499-282-0-115},
timestamp = {Mon, 08 Aug 2022 21:35:40 +0200},
biburl = {https://dblp.org/rec/series/shti/RoyCJLTNR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/CorreiaAPLVCFA12,
author = {Sandra F. H. Correia and
Paulo Fernando da Costa Antunes and
Edison Pecoraro and
Patr{\'{\i}}cia P. Lima and
Humberto Varum and
Luis D. Carlos and
Rute A. S. Ferreira and
Paulo S. Andr{\'{e}}},
title = {Optical Fiber Relative Humidity Sensor Based on a {FBG} with a Di-Ureasil
Coating},
journal = {Sensors},
volume = {12},
number = {7},
pages = {8847--8860},
year = {2012},
url = {https://doi.org/10.3390/s120708847},
doi = {10.3390/S120708847},
timestamp = {Tue, 06 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/CorreiaAPLVCFA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/e2dc/ChetsaLPSC12,
author = {Ghislain Landry Tsafack Chetsa and
Laurent Lef{\`{e}}vre and
Jean{-}Marc Pierson and
Patricia Stolf and
Georges Da Costa},
editor = {Jyrki Huusko and
Hermann de Meer and
Sonja Klingert and
Andrey Somov},
title = {DNA-Inspired Scheme for Building the Energy Profile of {HPC} Systems},
booktitle = {Energy Efficient Data Centers - First International Workshop, {E2DC}
2012, Madrid, Spain, Mai 8, 2012, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {7396},
pages = {141--152},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-33645-4\_13},
doi = {10.1007/978-3-642-33645-4\_13},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/e2dc/ChetsaLPSC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eann/PessinOSCUWBV12,
author = {Gustavo Pessin and
Fernando Santos Os{\'{o}}rio and
Jefferson R. Souza and
Fausto G. Costa and
J{\'{o}} Ueyama and
Denis F. Wolf and
Torsten Braun and
Patr{\'{\i}}cia A. Vargas},
editor = {Chrisina Jayne and
Shigang Yue and
Lazaros S. Iliadis},
title = {Evolving an Indoor Robotic Localization System Based on Wireless Networks},
booktitle = {Engineering Applications of Neural Networks, 13th International Conference,
{EANN} 2012, London, UK, September 20-23, 2012. Proceedings},
series = {Communications in Computer and Information Science},
volume = {311},
pages = {61--70},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-32909-8\_7},
doi = {10.1007/978-3-642-32909-8\_7},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eann/PessinOSCUWBV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eatis/CostaNMDSJLJ12,
author = {Wanderson Costa and
Jos{\'{e}} Rafael Nascimento and
Elisa Menendez and
Marcos D{\'{o}}sea and
Leila Silva and
Monique Jabbur and
Ana Patr{\'{\i}}cia Lima and
Divaldo Lyra Junior},
editor = {Jos{\'{e}} Javier Samper Zapater and
Juan Jos{\'{e}} Mart{\'{\i}}nez{-}Dur{\'{a}} and
Vicente R. Tom{\'{a}}s L{\'{o}}pez},
title = {A system to help the teaching of pharmaceutical care},
booktitle = {Euro-American Conference on Telematics and Information Systems, {EATIS}
'12, Valencia, Spain, May 23-25, 2012},
pages = {97--104},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2261605.2261620},
doi = {10.1145/2261605.2261620},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eatis/CostaNMDSJLJ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/CostaMPA12,
author = {Patricia Dockhorn Costa and
Izon Thomaz Mielke and
Isaac Pereira and
Jo{\~{a}}o Paulo A. Almeida},
editor = {Chi{-}Hung Chi and
Dragan Gasevic and
Willem{-}Jan van den Heuvel},
title = {A Model-Driven Approach to Situations: Situation Modeling and Rule-Based
Situation Detection},
booktitle = {16th {IEEE} International Enterprise Distributed Object Computing
Conference, {EDOC} 2012, Beijing, China, September 10-14, 2012},
pages = {154--163},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/EDOC.2012.26},
doi = {10.1109/EDOC.2012.26},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/edoc/CostaMPA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpads/ChetsaLPSC12,
author = {Ghislain Landry Tsafack Chetsa and
Laurent Lef{\`{e}}vre and
Jean{-}Marc Pierson and
Patricia Stolf and
Georges Da Costa},
title = {A Runtime Framework for Energy Efficient {HPC} Systems without a Priori
Knowledge of Applications},
booktitle = {18th {IEEE} International Conference on Parallel and Distributed Systems,
{ICPADS} 2012, Singapore, December 17-19, 2012},
pages = {660--667},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/ICPADS.2012.94},
doi = {10.1109/ICPADS.2012.94},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icpads/ChetsaLPSC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip5-5/AlvesCO12,
author = {Patr{\'{\i}}cia Alves and
Pedro Campos and
Eug{\'{e}}nio C. Oliveira},
editor = {Luis M. Camarinha{-}Matos and
Lai Xu and
Hamideh Afsarmanesh},
title = {Modeling the Trustworthiness of a Supplier Agent in a {B2B} Relationship},
booktitle = {Collaborative Networks in the Internet of Services - 13th {IFIP} {WG}
5.5 Working Conference on Virtual Enterprises, {PRO-VE} 2012, Bournemouth,
UK, October 1-3, 2012. Proceedings},
series = {{IFIP} Advances in Information and Communication Technology},
volume = {380},
pages = {675--686},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-32775-9\_67},
doi = {10.1007/978-3-642-32775-9\_67},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip5-5/AlvesCO12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbac-pad/ChetsaLPSC12,
author = {Ghislain Landry Tsafack Chetsa and
Laurent Lef{\`{e}}vre and
Jean{-}Marc Pierson and
Patricia Stolf and
Georges Da Costa},
editor = {Jairo Panetta and
Jos{\'{e}} E. Moreira and
David A. Padua and
Philippe O. A. Navaux},
title = {Beyond {CPU} Frequency Scaling for a Fine-grained Energy Control of
{HPC} Systems},
booktitle = {{IEEE} 24th International Symposium on Computer Architecture and High
Performance Computing, {SBAC-PAD} 2012, New York, NY, USA, October
24-26, 2012},
pages = {132--138},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/SBAC-PAD.2012.32},
doi = {10.1109/SBAC-PAD.2012.32},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sbac-pad/ChetsaLPSC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/policy/CostaAVM11,
author = {Patricia Dockhorn Costa and
Jo{\~{a}}o Paulo A. Almeida and
Igor Magri Vale and
Izon Thomaz Mielke},
title = {A Model-Driven Approach for Incorporating Reactive Rules in Declarative
Interactive {TV} Applications},
booktitle = {{POLICY} 2011, {IEEE} International Symposium on Policies for Distributed
Systems and Networks, Pisa, Italy, 6-8 June 2011},
pages = {165--168},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/POLICY.2011.42},
doi = {10.1109/POLICY.2011.42},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/policy/CostaAVM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rita/BarbosaCTM10,
author = {Raquel de Miranda Barbosa and
Ant{\^{o}}nio Carlos da Rocha Costa and
Patr{\'{\i}}cia Cabral de Azevedo Restelli Tedesco and
Alexandre Cabral Mota},
title = {Usando CSP, {RSL} e o Modelo PopOrg na Especifica{\c{c}}{\~{a}}o Formal
de Organiza{\c{c}}{\~{o}}es de SMAs},
journal = {{RITA}},
volume = {17},
number = {3},
pages = {389--411},
year = {2010},
url = {https://doi.org/10.22456/2175-2745.16413},
doi = {10.22456/2175-2745.16413},
timestamp = {Mon, 03 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/rita/BarbosaCTM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ogrs/MotaBRFSABCR09,
author = {Guilherme L{\'{u}}cio Abelha Mota and
Jorge Lu{\'{\i}}s Nunes e Silva Brito and
Jo{\~{a}}o Ara{\'{u}}jo Ribeiro and
Orlando Bernardo Filho and
Marcelo Teixeira Silveira and
Rafael Alves de Aguiar and
Irving da Silva Badolato and
Sarina Lustosa da Costa and
Patr{\'{\i}}cia Farias Reolon},
editor = {Erwan Bocher and
Markus Neteler},
title = {The E-Foto Project and the Research to Implement a {GNU/GPL} Open
source Educational Digital Photogrammetric Workstation},
booktitle = {Geospatial Free and Open Source Software in the 21st Century - Proceedings
of the first Open Source Geospatial Research Symposium, {OGRS} 2009,
Nantes, France, 8-10 July, 2009},
series = {Lecture Notes in Geoinformation and Cartography},
pages = {89--106},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-10595-1\_6},
doi = {10.1007/978-3-642-10595-1\_6},
timestamp = {Wed, 14 Nov 2018 10:55:34 +0100},
biburl = {https://dblp.org/rec/conf/ogrs/MotaBRFSABCR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/CostaAPS08,
author = {Patricia Dockhorn Costa and
Jo{\~{a}}o Paulo A. Almeida and
Lu{\'{\i}}s Ferreira Pires and
Marten van Sinderen},
title = {Evaluation of a Rule-Based Approach for Context-Aware Services},
booktitle = {Proceedings of the Global Communications Conference, 2008. {GLOBECOM}
2008, New Orleans, LA, USA, 30 November - 4 December 2008},
pages = {1657--1661},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/GLOCOM.2008.ECP.322},
doi = {10.1109/GLOCOM.2008.ECP.322},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/globecom/CostaAPS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/LuzDG08,
author = {Filipe Costa Luz and
Manuel Jos{\'{e}} Dam{\'{a}}sio and
Patr{\'{\i}}cia Gouveia},
editor = {Kevin M. Brooks and
Aisling Kelliher and
Frank Nack},
title = {Realism in gameplay: digital fiction and embodiment},
booktitle = {Proceedings of the 2nd {ACM} Workshop on Story Representation, Mechanism
and Context, {SRMC} 2008, Vancouver, British Columbia, Canada, October
31, 2008},
pages = {1--8},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1462014.1462016},
doi = {10.1145/1462014.1462016},
timestamp = {Wed, 04 May 2022 13:02:13 +0200},
biburl = {https://dblp.org/rec/conf/mm/LuzDG08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/policy/NeisseCWS08,
author = {Ricardo Neisse and
Patricia Dockhorn Costa and
Maarten Wegdam and
Marten van Sinderen},
title = {An Information Model and Architecture for Context-Aware Management
Domains},
booktitle = {9th {IEEE} International Workshop on Policies for Distributed Systems
and Networks {(POLICY} 2008), 2-4 June 2008, Palisades, New York,
{USA}},
pages = {162--169},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/POLICY.2008.31},
doi = {10.1109/POLICY.2008.31},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/policy/NeisseCWS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/basesearch/DockhornCosta07,
author = {Patricia Dockhorn Costa},
title = {Architectural support for context-aware applications: from context
models to services platforms},
school = {University of Twente, Enschede, Netherlands},
year = {2007},
url = {http://purl.utwente.nl/publications/58357},
timestamp = {Thu, 23 Mar 2017 00:00:00 +0100},
biburl = {https://dblp.org/rec/phd/basesearch/DockhornCosta07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEscc/SantosRCVEB07,
author = {Luiz Olavo Bonino da Silva Santos and
Fano Ramparany and
Patricia Dockhorn Costa and
Peter Vink and
Richard Etter and
Tom H. F. Broens},
title = {A Service Architecture for Context Awareness and Reaction Provisioning},
booktitle = {2007 {IEEE} International Conference on Services Computing - Workshops
{(SCW} 2007), 9-13 July 2007, Salt Lake City, Utah, {USA}},
pages = {25--32},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/SERVICES.2007.10},
doi = {10.1109/SERVICES.2007.10},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/IEEEscc/SantosRCVEB07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ami/PiresMSC07,
author = {Lu{\'{\i}}s Ferreira Pires and
Nieko Maatjes and
Marten van Sinderen and
Patricia Dockhorn Costa},
editor = {Alois Ferscha and
Erwin Aitenbichler},
title = {Model-Driven Approach to the Implementation of Context-Aware Applications
Using Rule Engines},
booktitle = {Constructing Ambient Intelligence - AmI 2007 Workshops Darmstadt,
Germany, November 7-10, 2007 Revised Papers},
series = {Communications in Computer and Information Science},
volume = {11},
pages = {104--112},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-85379-4\_13},
doi = {10.1007/978-3-540-85379-4\_13},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ami/PiresMSC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dais/CostaAPS07,
author = {Patricia Dockhorn Costa and
Jo{\~{a}}o Paulo A. Almeida and
Lu{\'{\i}}s Ferreira Pires and
Marten van Sinderen},
editor = {Jadwiga Indulska and
Kerry Raymond},
title = {Situation Specification and Realization in Rule-Based Context-Aware
Applications},
booktitle = {Distributed Applications and Interoperable Systems, 7th {IFIP} {WG}
6.1 International Conference, {DAIS} 2007, Paphos, Cyprus, June 6-8,
2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4531},
pages = {32--47},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-72883-2\_3},
doi = {10.1007/978-3-540-72883-2\_3},
timestamp = {Thu, 14 Oct 2021 09:51:55 +0200},
biburl = {https://dblp.org/rec/conf/dais/CostaAPS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip6-6/DanieleCP07,
author = {Laura Daniele and
Patricia Dockhorn Costa and
Lu{\'{\i}}s Ferreira Pires},
editor = {Aiko Pras and
Marten van Sinderen},
title = {Towards a Rule-Based Approach for Context-Aware Applications},
booktitle = {Dependable and Adaptable Networks and Services, 13th Open European
Summer School and {IFIP} {TC6.6} Workshop, {EUNICE} 2007, Enschede,
The Netherlands, July 18-20, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4606},
pages = {33--43},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-73530-4\_5},
doi = {10.1007/978-3-540-73530-4\_5},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip6-6/DanieleCP07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifiptm/NeisseWCS07,
author = {Ricardo Neisse and
Maarten Wegdam and
Patricia Dockhorn Costa and
Marten van Sinderen},
editor = {Bob Hulsebosch and
Gabriele Lenzini and
Santtu Toivonen and
Maarten Wegdam},
title = {Context-Aware Management Domains},
booktitle = {First International Workshop on Combining Context with Trust, Security
and Privacy In conjunction with IFIPTM, CAT@IFIPTM 2007, Moncton,
New Brunswick, Canada, July 30, 2007},
series = {{CEUR} Workshop Proceedings},
volume = {269},
publisher = {CEUR-WS.org},
year = {2007},
url = {https://ceur-ws.org/Vol-269/paper5.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:18 +0100},
biburl = {https://dblp.org/rec/conf/ifiptm/NeisseWCS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sew/StrattonSLC07,
author = {William C. Stratton and
Deane E. Sibol and
Mikael Lindvall and
Patricia Costa},
title = {The {SAVE} Tool and Process Applied to Ground Software Development
at {JHU/APL:} An Experience Report on Technology Infusion},
booktitle = {31st Annual {IEEE} / {NASA} Software Engineering Workshop {(SEW-31}
2007), 6-8 March 2007, Loyola College, Columbia, MD, {USA}},
pages = {187--193},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.ieeecomputersociety.org/10.1109/SEW.2007.110},
doi = {10.1109/SEW.2007.110},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sew/StrattonSLC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/CostaGAPS06,
author = {Patricia Dockhorn Costa and
Giancarlo Guizzardi and
Jo{\~{a}}o Paulo A. Almeida and
Lu{\'{\i}}s Ferreira Pires and
Marten van Sinderen},
title = {Situations in Conceptual Modeling of Context},
booktitle = {Tenth {IEEE} International Enterprise Distributed Object Computing
Conference {(EDOC} 2006), 16-20 October 2006, Hong Kong, China, Workshops},
pages = {6},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/EDOCW.2006.62},
doi = {10.1109/EDOCW.2006.62},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/edoc/CostaGAPS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iconip/BotelhoSS06,
author = {Silvia Silva da Costa Botelho and
Gisele M. Simas and
Patricia Silveira},
editor = {Irwin King and
Jun Wang and
Laiwan Chan and
DeLiang L. Wang},
title = {Prediction of Protein Secondary Structure Using Nonlinear Method},
booktitle = {Neural Information Processing, 13th International Conference, {ICONIP}
2006, Hong Kong, China, October 3-6, 2006, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {4234},
pages = {40--47},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11893295\_5},
doi = {10.1007/11893295\_5},
timestamp = {Fri, 16 Aug 2024 07:48:40 +0200},
biburl = {https://dblp.org/rec/conf/iconip/BotelhoSS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icps/EtterCB06,
author = {Richard Etter and
Patricia Dockhorn Costa and
Tom H. F. Broens},
title = {A Rule-Based Approach Towards Context-Aware User Notification Services},
booktitle = {Proceedings of the {ACS/IEEE} International Conference on Pervasive
Services 2006, {ICPS} '06, 26-29 June 2006, Lyon, France},
pages = {281--284},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/PERSER.2006.1652242},
doi = {10.1109/PERSER.2006.1652242},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icps/EtterCB06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/DuarteCBM06,
author = {Alexandre Duarte and
Walfredo Cirne and
Francisco Vilar Brasileiro and
Patr{\'{\i}}cia D. L. Machado},
editor = {Leon J. Osterweil and
H. Dieter Rombach and
Mary Lou Soffa},
title = {GridUnit: software testing on the grid},
booktitle = {28th International Conference on Software Engineering {(ICSE} 2006),
Shanghai, China, May 20-28, 2006},
pages = {779--782},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1134285.1134410},
doi = {10.1145/1134285.1134410},
timestamp = {Tue, 16 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icse/DuarteCBM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijpcc/CostaPS05,
author = {Patricia Dockhorn Costa and
Lu{\'{\i}}s Ferreira Pires and
Marten van Sinderen},
title = {Designing a configurable services platform for mobile context-aware
applications},
journal = {Int. J. Pervasive Comput. Commun.},
volume = {1},
number = {1},
pages = {13--24},
year = {2005},
url = {https://doi.org/10.1108/17427370580000109},
doi = {10.1108/17427370580000109},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijpcc/CostaPS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isse/LindvallRSZDMBCTHAAP05,
author = {Mikael Lindvall and
Ioana Rus and
Forrest Shull and
Marvin V. Zelkowitz and
Paolo Donzelli and
Atif M. Memon and
Victor R. Basili and
Patricia Costa and
Roseanne Tesoriero Tvedt and
Lorin Hochstein and
Sima Asgari and
Christopher Ackermann and
Daniel Pech},
title = {An evolutionary testbed for software technology evaluation},
journal = {Innov. Syst. Softw. Eng.},
volume = {1},
number = {1},
pages = {3--11},
year = {2005},
url = {https://doi.org/10.1007/s11334-005-0007-z},
doi = {10.1007/S11334-005-0007-Z},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/isse/LindvallRSZDMBCTHAAP05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/SanchesVDCG05,
author = {J. A. L. Sanches and
Patr{\'{\i}}cia Kayser Vargas and
In{\^{e}}s de Castro Dutra and
V{\'{\i}}tor Santos Costa and
Cl{\'{a}}udio F. R. Geyer},
title = {ReGS: user-level reliability in a grid environment},
booktitle = {5th International Symposium on Cluster Computing and the Grid (CCGrid
2005), 9-12 May, 2005, Cardiff, {UK}},
pages = {718--725},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/CCGRID.2005.1558634},
doi = {10.1109/CCGRID.2005.1558634},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ccgrid/SanchesVDCG05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icws/PokraevKSBCWES05,
author = {Stanislav Pokraev and
Johan Koolwaaij and
Mark van Setten and
Tom H. F. Broens and
Patricia Dockhorn Costa and
Martin Wibbels and
Peter Ebben and
Patrick Strating},
title = {Service Platform for Rapid Development and Deployment of Context-Aware,
Mobile Applications},
booktitle = {2005 {IEEE} International Conference on Web Services {(ICWS} 2005),
11-15 July 2005, Orlando, FL, {USA}},
pages = {639--646},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ICWS.2005.106},
doi = {10.1109/ICWS.2005.106},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icws/PokraevKSBCWES05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwuc/CostaPS05,
author = {Patricia Dockhorn Costa and
Lu{\'{\i}}s Ferreira Pires and
Marten van Sinderen},
editor = {Soraya Kouadri Most{\'{e}}faoui and
Zakaria Maamar},
title = {Architectural Patterns for Context-Aware Services Platforms},
booktitle = {Ubiquitous Computing, Proceedings of the 2nd International Workshop
on Ubiquitous Computing, {IWUC} 2005, In conjunction with {ICEIS}
2005, Miami, USA, May 2005},
pages = {3--18},
publisher = {{INSTICC} Press},
year = {2005},
timestamp = {Tue, 05 Jul 2005 15:02:30 +0200},
biburl = {https://dblp.org/rec/conf/iwuc/CostaPS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mse/LimaAALSB05,
author = {Mar{\'{\i}}lia Lima and
Andre Aziz and
Diogo Jos{\'{e}} Costa Alves and
Patricia Lira and
V{\'{\i}}tor Schwambach and
Edna Barros},
title = {ipPROCESS: Using a Process to Teach IP-Core Development},
booktitle = {2005 International Conference on Microelectronics Systems Education,
{MSE} 2005, Anaheim, CA, USA, June 12-13, 2005},
pages = {27--28},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/MSE.2005.38},
doi = {10.1109/MSE.2005.38},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mse/LimaAALSB05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbbd/CarvalhoBMSP05,
author = {Andr{\'{e}} Luiz da Costa Carvalho and
Allan Jos{\'{e}} de Souza Bezerra and
Edleno Silva de Moura and
Altigran Soares da Silva and
Patr{\'{\i}}cia Silva Peres},
editor = {Carlos A. Heuser},
title = {Detec{\c{c}}{\~{a}}o de R{\'{e}}plicas Utilizando Conte{\'{u}}do
e Estrutura},
booktitle = {20{\textdegree} Simp{\'{o}}sio Brasileiro de Bancos de Dados,
3-7 de Outubro, 2005, Uberl{\^{a}}ndia, MG, Brazil, Anais/Proceedings},
pages = {25--39},
publisher = {{UFU}},
year = {2005},
url = {http://www.sbbd-sbes2005.ufu.br/arquivos/artigo-02-novo\_Carvalho.pdf},
timestamp = {Tue, 17 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sbbd/CarvalhoBMSP05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ac/CohenLC04,
author = {David Cohen and
Mikael Lindvall and
Patricia Costa},
title = {An introduction to agile methods},
journal = {Adv. Comput.},
volume = {62},
pages = {1--66},
year = {2004},
url = {https://doi.org/10.1016/S0065-2458(03)62001-2},
doi = {10.1016/S0065-2458(03)62001-2},
timestamp = {Wed, 20 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ac/CohenLC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dexa/CarneiroPBCTS04,
author = {Adriana Carneiro and
R{\^{o}}mulo Passos and
Rosalie Belian and
Thiago Costa and
Patr{\'{\i}}cia Azevedo Tedesco and
Ana Carolina Salgado},
editor = {Fernando Galindo and
Makoto Takizawa and
Roland Traunm{\"{u}}ller},
title = {DBSitter: An Intelligent Tool for Database Administration},
booktitle = {Database and Expert Systems Applications, 15th International Conference,
{DEXA} 2004 Zaragoza, Spain, August 30-September 3, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3180},
pages = {171--180},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30075-5\_17},
doi = {10.1007/978-3-540-30075-5\_17},
timestamp = {Sat, 30 Sep 2023 09:38:52 +0200},
biburl = {https://dblp.org/rec/conf/dexa/CarneiroPBCTS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusai/BroensPSKC04,
author = {Tom H. F. Broens and
Stanislav Pokraev and
Marten van Sinderen and
Johan Koolwaaij and
Patricia Dockhorn Costa},
editor = {Panos Markopoulos and
Berry Eggen and
Emile H. L. Aarts and
James L. Crowley},
title = {Context-Aware, Ontology-Based Service Discovery},
booktitle = {Ambient Intelligence: Second European Symposium, {EUSAI} 2004, Eindhoven,
The Netherlands, November 8-11, 2004. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3295},
pages = {72--83},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30473-9\_7},
doi = {10.1007/978-3-540-30473-9\_7},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eusai/BroensPSKC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusai/CostaPSR04,
author = {Patricia Dockhorn Costa and
Lu{\'{\i}}s Ferreira Pires and
Marten van Sinderen and
D. Rios},
editor = {Panos Markopoulos and
Berry Eggen and
Emile H. L. Aarts and
James L. Crowley},
title = {Services Platforms for Context-Aware Applications},
booktitle = {Ambient Intelligence: Second European Symposium, {EUSAI} 2004, Eindhoven,
The Netherlands, November 8-11, 2004. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3295},
pages = {363--366},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30473-9\_34},
doi = {10.1007/978-3-540-30473-9\_34},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eusai/CostaPSR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwuc/CostaPSF04,
author = {Patricia Dockhorn Costa and
Lu{\'{\i}}s Ferreira Pires and
Marten van Sinderen and
Jos{\'{e}} Gon{\c{c}}alves Pereira Filho},
editor = {Soraya Kouadri Most{\'{e}}faoui and
Zakaria Maamar and
Omer F. Rana},
title = {Towards a Service Platform for Mobile Context-Aware Applications},
booktitle = {Ubiquitous Computing - Proceedings of the 1st International Workshop
on Ubiquitous Computing, {IWUC} 2004, In conjunction with {ICEIS}
2004, Porto, Portugal, April 2004},
pages = {48--61},
publisher = {{INSTICC} Press},
year = {2004},
timestamp = {Tue, 07 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iwuc/CostaPSF04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/irtaw/MaiaMBCHRP03,
author = {Ricardo Maia and
Fl{\'{a}}vio Moreira and
R. Barbosa and
Diamantino Costa and
Kjeld Hjortaes and
Patricia Rodr{\'{\i}}guez and
Lu{\'{\i}}s Miguel Pinho},
editor = {Tullio Vardanega},
title = {Verifying, validating and monitoring the open Ravenscar real time
kernel},
booktitle = {Proceedings of the 12th International Workshop on Real-Time Ada, {IRTAW}
2003, Viana do Castelo, Portugal, September 15-19, 2003},
pages = {74--81},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/959222.959236},
doi = {10.1145/959222.959236},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/irtaw/MaiaMBCHRP03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/metrics/ShullBBBCLPRTZ02,
author = {Forrest Shull and
Victor R. Basili and
Barry W. Boehm and
A. Winsor Brown and
Patricia Costa and
Mikael Lindvall and
Daniel Port and
Ioana Rus and
Roseanne Tesoriero and
Marvin V. Zelkowitz},
title = {What We Have Learned About Fighting Defects},
booktitle = {8th {IEEE} International Software Metrics Symposium {(METRICS} 2002),
4-7 June 2002, Ottawa, Canada},
pages = {249},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/METRIC.2002.1011343},
doi = {10.1109/METRIC.2002.1011343},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/metrics/ShullBBBCLPRTZ02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/xpu/LindvallBBCDSTWZ02,
author = {Mikael Lindvall and
Victor R. Basili and
Barry W. Boehm and
Patricia Costa and
Kathleen Coleman Dangle and
Forrest Shull and
Roseanne Tesoriero Tvedt and
Laurie A. Williams and
Marvin V. Zelkowitz},
editor = {Don Wells and
Laurie A. Williams},
title = {Empirical Findings in Agile Methods},
booktitle = {Extreme Programming and Agile Methods - XP/Agile Universe 2002, Second
{XP} Universe and First Agile Universe Conference Chicago, IL, USA,
August 4-7, 2002, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2418},
pages = {197--207},
publisher = {Springer},
year = {2002},
url = {https://doi.org/10.1007/3-540-45672-4\_19},
doi = {10.1007/3-540-45672-4\_19},
timestamp = {Tue, 14 May 2019 10:00:54 +0200},
biburl = {https://dblp.org/rec/conf/xpu/LindvallBBCDSTWZ02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/europar/CastroCGSVC99,
author = {Lu{\'{\i}}s Fernando Castro and
V{\'{\i}}tor Santos Costa and
Cl{\'{a}}udio F. R. Geyer and
Fernando M. A. Silva and
Patr{\'{\i}}cia Kayser Vargas and
Manuel Eduardo Correia},
editor = {Patrick Amestoy and
Philippe Berger and
Michel J. Dayd{\'{e}} and
Iain S. Duff and
Val{\'{e}}rie Frayss{\'{e}} and
Luc Giraud and
Daniel Ruiz},
title = {{DAOS} - Scalable And-Or Parallelism},
booktitle = {Euro-Par '99 Parallel Processing, 5th International Euro-Par Conference,
Toulouse, France, August 31 - September 3, 1999, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1685},
pages = {899--908},
publisher = {Springer},
year = {1999},
url = {https://doi.org/10.1007/3-540-48311-X\_125},
doi = {10.1007/3-540-48311-X\_125},
timestamp = {Tue, 04 Jun 2019 14:36:07 +0200},
biburl = {https://dblp.org/rec/conf/europar/CastroCGSVC99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbes/MachadoMFG94,
author = {Patr{\'{\i}}cia Duarte de Lima Machado and
Silvio Romero de Lemos Meira and
Edson Costa de Barros Carvalho Filho and
Herman Martins Gomes},
editor = {Roberto Antonio Rodrigues de Almeida and
Roberto Tom Price},
title = {Uma Especifica{\c{c}}{\~{a}}o Formal Orientada a Objetos de Redes
Neurais Artificiais},
booktitle = {Proceedings of the 8th Brazilian Symposium on Software Engineering,
{SBES} 1994, Curitiba, PR, Brazil, October 26-27, 1994},
pages = {159--173},
publisher = {{SBC}},
year = {1994},
url = {https://doi.org/10.5753/sbes.1994.24466},
doi = {10.5753/SBES.1994.24466},
timestamp = {Tue, 16 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sbes/MachadoMFG94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-11-18 02:21 CET from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
