Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Na Yeun Ha"
download as .bib file
@article{DBLP:journals/cm/KyungKLPPK24,
author = {Yeunwoong Kyung and
Haneul Ko and
Jaewook Lee and
Sangheon Pack and
Noik Park and
Namseok Ko},
title = {Location-Aware {B5G} LAN-Type Services: Architecture, Use Case, and
Challenges},
journal = {{IEEE} Commun. Mag.},
volume = {62},
number = {1},
pages = {88--94},
year = {2024},
url = {https://doi.org/10.1109/MCOM.005.2300207},
doi = {10.1109/MCOM.005.2300207},
timestamp = {Thu, 25 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cm/KyungKLPPK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/KoKLPK24,
author = {Haneul Ko and
Yeunwoong Kyung and
Jaewook Lee and
Sangheon Pack and
Namseok Ko},
title = {Mobility-aware personalized handover function provisioning system
in {B5G} networks},
journal = {Future Gener. Comput. Syst.},
volume = {157},
pages = {436--444},
year = {2024},
url = {https://doi.org/10.1016/j.future.2024.04.002},
doi = {10.1016/J.FUTURE.2024.04.002},
timestamp = {Fri, 31 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fgcs/KoKLPK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mia/YeungHAHXN24,
author = {Pak{-}Hei Yeung and
Linde S. Hesse and
Moska Aliasi and
Monique C. Haak and
Weidi Xie and
Ana I. L. Namburete},
title = {Sensorless volumetric reconstruction of fetal brain freehand ultrasound
scans with deep implicit representation},
journal = {Medical Image Anal.},
volume = {94},
pages = {103147},
year = {2024},
url = {https://doi.org/10.1016/j.media.2024.103147},
doi = {10.1016/J.MEDIA.2024.103147},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mia/YeungHAHXN24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/KieferZKPTWMYHJKMHSSHZCLXCLWZLRVNHPYFT24,
author = {Benjamin Kiefer and
Lojze Zust and
Matej Kristan and
Janez Pers and
Matija Tersek and
Arnold Wiliem and
Martin Messmer and
Cheng{-}Yen Yang and
Hsiang{-}Wei Huang and
Zhongyu Jiang and
Heng{-}Cheng Kuo and
Jie Mei and
Jenq{-}Neng Hwang and
Daniel Stadler and
Lars Sommer and
Kaer Huang and
Aiguo Zheng and
Weitu Chong and
Kanokphan Lertniphonphan and
Jun Xie and
Feng Chen and
Jian Li and
Zhepeng Wang and
Luca Zedda and
Andrea Loddo and
Cecilia Di Ruberto and
Tuan{-}Anh Vu and
Hai Nguyen{-}Truong and
Tan{-}Sang Ha and
Quan{-}Dung Pham and
Sai{-}Kit Yeung and
Yuan Feng and
Nguyen Thanh Thien and
Lixin Tian and
Sheng{-}Yao Kuan and
Yuan{-}Hao Ho and
{\'{A}}ngel Bueno Rodr{\'{\i}}guez and
Borja Carrillo{-}Perez and
Alexander Klein and
Antje Alex and
Yannik Steiniger and
Felix Sattler and
Edgardo Solano{-}Carrillo and
Matej Fabijanic and
Magdalena Sumunec and
Nadir Kapetanovic and
Andreas Michel and
Wolfgang Gross and
Martin Weinmann},
title = {2\({}^{\mbox{nd}}\) Workshop on Maritime Computer Vision (MaCVi) 2024:
Challenge Results},
booktitle = {{IEEE/CVF} Winter Conference on Applications of Computer Vision Workshops,
{WACVW} 2024 - Workshops, Waikoloa, HI, USA, January 1-6, 2024},
pages = {869--891},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/WACVW60836.2024.00099},
doi = {10.1109/WACVW60836.2024.00099},
timestamp = {Tue, 30 Apr 2024 09:16:29 +0200},
biburl = {https://dblp.org/rec/conf/wacv/KieferZKPTWMYHJKMHSSHZCLXCLWZLRVNHPYFT24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-08002,
author = {Juan Manuel Zambrano Chaves and
Shih{-}Cheng Huang and
Yanbo Xu and
Hanwen Xu and
Naoto Usuyama and
Sheng Zhang and
Fei Wang and
Yujia Xie and
Mahmoud Khademi and
Ziyi Yang and
Hany Hassan Awadalla and
Julia Gong and
Houdong Hu and
Jianwei Yang and
Chunyuan Li and
Jianfeng Gao and
Yu Gu and
Cliff Wong and
Mu Wei and
Tristan Naumann and
Muhao Chen and
Matthew P. Lungren and
Serena Yeung{-}Levy and
Curtis P. Langlotz and
Sheng Wang and
Hoifung Poon},
title = {Training Small Multimodal Models to Bridge Biomedical Competency Gap:
{A} Case Study in Radiology Imaging},
journal = {CoRR},
volume = {abs/2403.08002},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.08002},
doi = {10.48550/ARXIV.2403.08002},
eprinttype = {arXiv},
eprint = {2403.08002},
timestamp = {Fri, 02 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-08002.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccad/BarkamJYYZJSI23,
author = {Hamza Errahmouni Barkam and
SungHeon Eavn Jeon and
Sanggeon Yun and
Calvin Yeung and
Zhuowen Zou and
Xun Jiao and
Narayan Srinivasa and
Mohsen Imani},
title = {Invited Paper: Hyperdimensional Computing for Resilient Edge Learning},
booktitle = {{IEEE/ACM} International Conference on Computer Aided Design, {ICCAD}
2023, San Francisco, CA, USA, October 28 - Nov. 2, 2023},
pages = {1--8},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCAD57390.2023.10323671},
doi = {10.1109/ICCAD57390.2023.10323671},
timestamp = {Wed, 03 Jan 2024 08:34:26 +0100},
biburl = {https://dblp.org/rec/conf/iccad/BarkamJYYZJSI23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-14762,
author = {Benjamin Kiefer and
Lojze Zust and
Matej Kristan and
Janez Pers and
Matija Tersek and
Arnold Wiliem and
Martin Messmer and
Cheng{-}Yen Yang and
Hsiang{-}Wei Huang and
Zhongyu Jiang and
Heng{-}Cheng Kuo and
Jie Mei and
Jenq{-}Neng Hwang and
Daniel Stadler and
Lars Sommer and
Kaer Huang and
Aiguo Zheng and
Weitu Chong and
Kanokphan Lertniphonphan and
Jun Xie and
Feng Chen and
Jian Li and
Zhepeng Wang and
Luca Zedda and
Andrea Loddo and
Cecilia Di Ruberto and
Tuan{-}Anh Vu and
Hai Nguyen{-}Truong and
Tan{-}Sang Ha and
Quan{-}Dung Pham and
Sai{-}Kit Yeung and
Yuan Feng and
Nguyen Thanh Thien and
Lixin Tian and
Sheng{-}Yao Kuan and
Yuan{-}Hao Ho and
{\'{A}}ngel Bueno Rodr{\'{\i}}guez and
Borja Carrillo{-}Perez and
Alexander Klein and
Antje Alex and
Yannik Steiniger and
Felix Sattler and
Edgardo Solano{-}Carrillo and
Matej Fabijanic and
Magdalena Sumunec and
Nadir Kapetanovic and
Andreas Michel and
Wolfgang Gross and
Martin Weinmann},
title = {The 2nd Workshop on Maritime Computer Vision (MaCVi) 2024},
journal = {CoRR},
volume = {abs/2311.14762},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.14762},
doi = {10.48550/ARXIV.2311.14762},
eprinttype = {arXiv},
eprint = {2311.14762},
timestamp = {Thu, 29 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-14762.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/patterns/LissaSvLADGGKVA22,
author = {Caspar J. van Lissa and
Wolfgang Stroebe and
Michelle R. vanDellen and
N. Pontus Leander and
Maximilian Agostini and
Tim Draws and
Andrii Grygoryshyn and
Ben G{\"{u}}tzgow and
Jannis Kreienkamp and
Clara S. Vetter and
Georgios Abakoumkin and
Jamilah Hanum Abdul Khaiyom and
Vjolica Ahmedi and
Handan Akkas and
Carlos A. Almenara and
Mohsin Atta and
Sabahat Cigdem Bagci and
Sima Basel and
Edona Berisha Kida and
Allan B. I. Bernardo and
Nicholas R. Buttrick and
Phatthanakit Chobthamkit and
Hoon{-}Seok Choi and
Mioara Cristea and
S{\'{a}}ra Csaba and
Kaja Damnjanovic and
Ivan Danyliuk and
Arobindu Dash and
Daniela Di Santo and
Karen M. Douglas and
Violeta Enea and
Daiane Gracieli Faller and
Gavan J. Fitzsimons and
Alexandra Gheorghiu and
{\'{A}}ngel G{\'{o}}mez and
Ali Hamaidia and
Qing Han and
Mai Helmy and
Joevarian Hudiyana and
Bertus F. Jeronimus and
Ding{-}Yu Jiang and
Veljko Jovanovic and
Zeljka Kamenov and
Anna Kende and
Shian{-}Ling Keng and
Tra Thi Thanh Kieu and
Yasin Koc and
Kamila Kovyazina and
Inna Kozytska and
Joshua Krause and
Arie W. Kruglanksi and
Anton Kurapov and
Maja Kutlaca and
N{\'{o}}ra Anna Lantos and
Edward P. Lemay and
Cokorda Bagus Jaya Lesmana and
Winnifred R. Louis and
Adrian Lueders and
Najma Iqbal Malik and
Anton P. Martinez and
Kira O. McCabe and
Jasmina Mehulic and
Mirra Noor Milla and
Idris Mohammed and
Erica Molinario and
Manuel Moyano and
Hayat Muhammad and
Silvana Mula and
Hamdi Muluk and
Solomiia Myroniuk and
Reza Najafi and
Claudia F. Nisa and
Bogl{\'{a}}rka Ny{\'{u}}l and
Paul A. O'Keefe and
Jose Javier Olivas Osuna and
Evgeny N. Osin and
Joonha Park and
Gennaro Pica and
Antonio Pierro and
Jonas H. Rees and
Anne Margit Reitsema and
Elena Resta and
Marika Rullo and
Michelle K. Ryan and
Adil Samekin and
Pekka Santtila and
Edyta M. Sasin and
Birga M. Schumpe and
Heyla A. Selim and
Michael Vicente Stanton and
Samiah Sultana and
Robbie M. Sutton and
Eleftheria Tseliou and
Akira Utsugi and
Jolien Anne van Breen and
Kees van Veen and
Alexandra V{\'{a}}zquez and
Robin Wollast and
Victoria Wai{-}lan Yeung and
Somayeh Zand and
Iris Lav Zezelj and
Bang Zheng and
Andreas Zick and
Claudia Zuniga and
Jocelyn J. B{\'{e}}langer},
title = {Using machine learning to identify important predictors of {COVID-19}
infection prevention behaviors during the early phase of the pandemic},
journal = {Patterns},
volume = {3},
number = {4},
pages = {100482},
year = {2022},
url = {https://doi.org/10.1016/j.patter.2022.100482},
doi = {10.1016/J.PATTER.2022.100482},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/patterns/LissaSvLADGGKVA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/HanifIRKGAAHY22,
author = {Muhammad Hanif and
Nadeem Iqbal and
Fida Ur Rahman and
Muhammad Adnan Khan and
Taher M. Ghazal and
Sagheer Abbas and
Munir Ahmad and
Hussam M. N. Al Hamadi and
Chan Yeob Yeun},
title = {A Novel Grayscale Image Encryption Scheme Based on the Block-Level
Swapping of Pixels and the Chaotic System},
journal = {Sensors},
volume = {22},
number = {16},
pages = {6243},
year = {2022},
url = {https://doi.org/10.3390/s22166243},
doi = {10.3390/S22166243},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/HanifIRKGAAHY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/YeungAHXN22,
author = {Pak{-}Hei Yeung and
Moska Aliasi and
Monique C. Haak and
Weidi Xie and
Ana I. L. Namburete},
editor = {Linwei Wang and
Qi Dou and
P. Thomas Fletcher and
Stefanie Speidel and
Shuo Li},
title = {Adaptive 3D Localization of 2D Freehand Ultrasound Brain Images},
booktitle = {Medical Image Computing and Computer Assisted Intervention - {MICCAI}
2022 - 25th International Conference, Singapore, September 18-22,
2022, Proceedings, Part {IV}},
series = {Lecture Notes in Computer Science},
volume = {13434},
pages = {207--217},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-16440-8\_20},
doi = {10.1007/978-3-031-16440-8\_20},
timestamp = {Tue, 13 Dec 2022 14:39:06 +0100},
biburl = {https://dblp.org/rec/conf/miccai/YeungAHXN22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2209-05477,
author = {Pak{-}Hei Yeung and
Moska Aliasi and
Monique C. Haak and
Weidi Xie and
Ana I. L. Namburete},
title = {Adaptive 3D Localization of 2D Freehand Ultrasound Brain Images},
journal = {CoRR},
volume = {abs/2209.05477},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2209.05477},
doi = {10.48550/ARXIV.2209.05477},
eprinttype = {arXiv},
eprint = {2209.05477},
timestamp = {Thu, 29 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2209-05477.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mia/YeungAPHXN21,
author = {Pak{-}Hei Yeung and
Moska Aliasi and
Aris T. Papageorghiou and
Monique C. Haak and
Weidi Xie and
Ana I. L. Namburete},
title = {Learning to map 2D ultrasound images into 3D space with minimal human
annotation},
journal = {Medical Image Anal.},
volume = {70},
pages = {101998},
year = {2021},
url = {https://doi.org/10.1016/j.media.2021.101998},
doi = {10.1016/J.MEDIA.2021.101998},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mia/YeungAPHXN21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HuiMZAABBBBBBBB21,
author = {Steve C. N. Hui and
Mark Mikkelsen and
Helge J. Z{\"{o}}llner and
Vishwadeep Ahluwalia and
Sarael Alcauter and
Laima Baltusis and
Deborah A. Barany and
Laura R. Barlow and
Robert Becker and
Jeffrey I. Berman and
Adam Berrington and
Pallab K. Bhattacharyya and
Jakob Udby Blicher and
Wolfgang Bogner and
Mark S. Brown and
Vince D. Calhoun and
Ryan Castillo and
Kim M. Cecil and
Richard A. E. Edden and
Yeo Bi Choi and
Winnie C. W. Chu and
William T. Clarke and
Alexander R. Craven and
Koen Cuypers and
Michael Dacko and
Camilo de la Fuente{-}Sandoval and
Patricia Desmond and
Aleksandra Domagalik and
Julien Dumont and
Niall W. Duncan and
Ulrike Dydak and
Katherine Dyke and
David A. Edmondson and
Gabriele Ende and
Lars Ersland and
C. John Evans and
Alan S. R. Fermin and
Antonio Ferretti and
Ariane Fillmer and
Tao Gong and
Ian Greenhouse and
James T. Grist and
Meng Gu and
Ashley D. Harris and
Katarzyna Hat and
Stefanie Heba and
Eva Heckova and
John P. Hegarty and
Kirstin{-}Friederike Heise and
Shiori Honda and
Aaron Jacobson and
Jacobus F. A. Jansen and
Christopher W. Jenkins and
Stephen J. Johnston and
Christoph Juchem and
Alayar Kangarlu and
Adam B. Kerr and
Karl Landheer and
Thomas Lange and
Phil Lee and
Swati Rane Levendovszky and
Catherine Limperopoulos and
Feng Liu and
William Lloyd and
David J. Lythgoe and
Maro G. Machizawa and
Erin L. MacMillan and
Richard J. Maddock and
Andrei V. Manzhurtsev and
Mar{\'{\i}}a L. Martinez{-}Gudino and
Jack J. Miller and
Heline Mirzakhanian and
Marta Moreno{-}Ortega and
Paul G. Mullins and
Shinichiro Nakajima and
Jamie Near and
Ralph Noeske and
Wibeke Nordh{\o}y and
Georg Oeltzschner and
Raul Osorio{-}Duran and
Mar{\'{\i}}a Concepci{\'{o}}n Garc{\'{\i}}a Otaduy and
Erick H. Pasaye and
Ronald Peeters and
Scott J. Peltier and
Ulrich Pilatus and
Nenad Polomac and
Eric C. Porges and
Subechhya Pradhan and
James Joseph Prisciandaro and
Nicolaas A. Puts and
Caroline D. Rae and
Francisco Reyes{-}Madrigal and
Timothy P. L. Roberts and
Caroline E. Robertson and
Jens T. Rosenberg and
Diana{-}Georgiana Rotaru and
Ruth L. O'Gorman Tuura and
Muhammad G. Saleh and
Kristian Sandberg and
Ryan Sangill and
Keith Schembri and
Anouk Schrantee and
Natalia A. Semenova and
Debra Singel and
Rouslan Sitnikov and
Jolinda Smith and
Yulu Song and
Craig E. L. Stark and
Diederick Stoffers and
Stephan P. Swinnen and
Rongwen Tain and
Costin Tanase and
Sofie Tapper and
Martin Tegenthoff and
Thomas Thiel and
Marc Thioux and
Peter Truong and
Pim van Dijk and
Nolan Vella and
Rishma Vidyasagar and
Andrej Vovk and
Guangbin Wang and
Lars T. Westlye and
Timothy K. Wilbur and
William R. Willoughby and
Martin Wilson and
Hans{-}J{\"{o}}rg Wittsack and
Adam J. Woods and
Yen{-}Chien Wu and
Junqian Xu and
Maria Yanez Lopez and
David Ka Wai Yeung and
Qun Zhao and
Xiaopeng Zhou and
Gasper Zupan},
title = {Frequency drift in {MR} spectroscopy at 3T},
journal = {NeuroImage},
volume = {241},
pages = {118430},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2021.118430},
doi = {10.1016/J.NEUROIMAGE.2021.118430},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/HuiMZAABBBBBBBB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/KimLKYFSPCKH21,
author = {Jihun Kim and
Hah Min Lew and
Jung{-}Hee Kim and
Sangyeon Youn and
Hasan Al Faruque and
An Na Seo and
Soo Yeun Park and
Jin Ho Chang and
Eunjoo Kim and
Jae Youn Hwang},
title = {Forward-Looking Multimodal Endoscopic System Based on Optical Multispectral
and High-Frequency Ultrasound Imaging Techniques for Tumor Detection},
journal = {{IEEE} Trans. Medical Imaging},
volume = {40},
number = {2},
pages = {594--606},
year = {2021},
url = {https://doi.org/10.1109/TMI.2020.3032275},
doi = {10.1109/TMI.2020.3032275},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmi/KimLKYFSPCKH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tog/NaderQCWY21,
author = {Georges Nader and
Yu Han Quek and
Pei Zhi Chia and
Oliver Weeger and
Sai{-}Kit Yeung},
title = {KnitKit: a flexible system for machine knitting of customizable textiles},
journal = {{ACM} Trans. Graph.},
volume = {40},
number = {4},
pages = {64:1--64:16},
year = {2021},
url = {https://doi.org/10.1145/3450626.3459790},
doi = {10.1145/3450626.3459790},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tog/NaderQCWY21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/HamadiNYD21,
author = {Hussam M. N. Al Hamadi and
Nida Nasir and
Chan Yeob Yeun and
Ernesto Damiani},
title = {A Verified Protocol for Secure Autonomous and Cooperative Public Transportation
in Smart Cities},
booktitle = {{IEEE} International Conference on Communications Workshops, {ICC}
Workshops 2021, Montreal, QC, Canada, June 14-23, 2021},
pages = {1--6},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICCWorkshops50388.2021.9473591},
doi = {10.1109/ICCWORKSHOPS50388.2021.9473591},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icc/HamadiNYD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-12108,
author = {Pak{-}Hei Yeung and
Linde S. Hesse and
Moska Aliasi and
Monique C. Haak and
Weidi Xie and
Ana I. L. Namburete},
title = {ImplicitVol: Sensorless 3D Ultrasound Reconstruction with Deep Implicit
Representation},
journal = {CoRR},
volume = {abs/2109.12108},
year = {2021},
url = {https://arxiv.org/abs/2109.12108},
eprinttype = {arXiv},
eprint = {2109.12108},
timestamp = {Mon, 04 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-12108.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scirobotics/YuLWHCSLCYTCE20,
author = {Wenzhuo Yu and
Haisong Lin and
Yilian Wang and
Xu He and
Nathan Chen and
Kevin Sun and
Darren Lo and
Brian Cheng and
Christopher Yeung and
Jiawei Tan and
Dino Di Carlo and
Sam Emaminejad},
title = {A ferrobotic system for automated microfluidic logistics},
journal = {Sci. Robotics},
volume = {5},
number = {39},
year = {2020},
url = {https://doi.org/10.1126/scirobotics.aba4411},
doi = {10.1126/SCIROBOTICS.ABA4411},
timestamp = {Tue, 07 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/scirobotics/YuLWHCSLCYTCE20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/KumarVAZOTCHLHW20,
author = {Neeraj Kumar and
Ruchika Verma and
Deepak Anand and
Yanning Zhou and
Omer Fahri Onder and
Efstratios Tsougenis and
Hao Chen and
Pheng{-}Ann Heng and
Jiahui Li and
Zhiqiang Hu and
Yunzhi Wang and
Navid Alemi Koohbanani and
Mostafa Jahanifar and
Neda Zamani Tajeddin and
Ali Gooya and
Nasir M. Rajpoot and
Xuhua Ren and
Sihang Zhou and
Qian Wang and
Dinggang Shen and
Cheng{-}Kun Yang and
Chi{-}Hung Weng and
Wei{-}Hsiang Yu and
Chao{-}Yuan Yeh and
Shuang Yang and
Shuoyu Xu and
Pak{-}Hei Yeung and
Peng Sun and
Amirreza Mahbod and
Gerald Schaefer and
Isabella Ellinger and
Rupert Ecker and
{\"{O}}rjan Smedby and
Chunliang Wang and
Benjamin Chidester and
That{-}Vinh Ton and
Minh{-}Triet Tran and
Jian Ma and
Minh N. Do and
Simon Graham and
Quoc Dang Vu and
Jin Tae Kwak and
Akshaykumar Gunda and
Raviteja Chunduri and
Corey Hu and
Xiaoyang Zhou and
Dariush Lotfi and
Reza Safdari and
Antanas Kascenas and
Alison O'Neil and
Dennis Eschweiler and
Johannes Stegmaier and
Yanping Cui and
Baocai Yin and
Kailin Chen and
Xinmei Tian and
Philipp Gr{\"{u}}ning and
Erhardt Barth and
Elad Arbel and
Itay Remer and
Amir Ben{-}Dor and
Ekaterina Sirazitdinova and
Matthias Kohl and
Stefan Braunewell and
Yuexiang Li and
Xinpeng Xie and
Linlin Shen and
Jun Ma and
Krishanu Das Baksi and
Mohammad Azam Khan and
Jaegul Choo and
Adri{\'{a}}n Colomer and
Valery Naranjo and
Linmin Pei and
Khan M. Iftekharuddin and
Kaushiki Roy and
Debotosh Bhattacharjee and
An{\'{\i}}bal Pedraza and
Maria Gloria Bueno and
Sabarinathan Devanathan and
Saravanan Radhakrishnan and
Praveen Koduganty and
Zihan Wu and
Guanyu Cai and
Xiaojie Liu and
Yuqin Wang and
Amit Sethi},
title = {A Multi-Organ Nucleus Segmentation Challenge},
journal = {{IEEE} Trans. Medical Imaging},
volume = {39},
number = {5},
pages = {1380--1391},
year = {2020},
url = {https://doi.org/10.1109/TMI.2019.2947628},
doi = {10.1109/TMI.2019.2947628},
timestamp = {Fri, 16 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tmi/KumarVAZOTCHLHW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/YeungWLE19,
author = {Andy Wai Kan Yeung and
Natalie Sui Miu Wong and
Hakwan C. Lau and
Simon B. Eickhoff},
title = {Human brain responses to gustatory and food stimuli: {A} meta-evaluation
of neuroimaging meta-analyses},
journal = {NeuroImage},
volume = {202},
year = {2019},
url = {https://doi.org/10.1016/j.neuroimage.2019.116111},
doi = {10.1016/J.NEUROIMAGE.2019.116111},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/YeungWLE19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibe/AslanHOHKLMNYJO19,
author = {Seda Aslan and
Henry R. Halperin and
Laura Olivieri and
Narutoshi Hibino and
Axel Krieger and
Yue{-}Hin Loke and
Paige Mass and
Kevin Nelson and
Enoch Yeung and
Jed Johnson and
Justin D. Opfermann and
Hiroshi Matsushita and
Takahiro Inoue},
title = {Design and Simulation of Patient-Specific Tissue-Engineered Bifurcated
Right Ventricle-Pulmonary Artery Grafts using Computational Fluid
Dynamics},
booktitle = {19th {IEEE} International Conference on Bioinformatics and Bioengineering,
{BIBE} 2019, Athens, Greece, October 28-30, 2019},
pages = {1012--1018},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/BIBE.2019.00188},
doi = {10.1109/BIBE.2019.00188},
timestamp = {Fri, 29 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bibe/AslanHOHKLMNYJO19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biocas/HasnainBSMGVYSD19,
author = {Aqib Hasnain and
Diveena Becker and
Atsede Siba and
Narendra Maheshri and
Ben Gordon and
Chris Voigt and
Enoch Yeung and
Subhrajit Sinha and
Yuval Dorfan and
Amin Espah Borujeni and
Yongjin Park and
Paul Maschhoff and
Uma Saxena and
Joshua Urrutia and
Niall Gaffney},
title = {A data-driven method for quantifying the impact of a genetic circuit
on its host},
booktitle = {2019 {IEEE} Biomedical Circuits and Systems Conference, BioCAS 2019,
Nara, Japan, October 17-19, 2019},
pages = {1--4},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/BIOCAS.2019.8919140},
doi = {10.1109/BIOCAS.2019.8919140},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/biocas/HasnainBSMGVYSD19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/BoddupalliHNY19,
author = {Nibodh Boddupalli and
Aqib Hasnain and
Sai Pushpak Nandanoori and
Enoch Yeung},
title = {Koopman Operators for Generalized Persistence of Excitation Conditions
for Nonlinear Systems},
booktitle = {58th {IEEE} Conference on Decision and Control, {CDC} 2019, Nice,
France, December 11-13, 2019},
pages = {8106--8111},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CDC40024.2019.9029365},
doi = {10.1109/CDC40024.2019.9029365},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cdc/BoddupalliHNY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/KristanLMFPCVHL16,
author = {Matej Kristan and
Ales Leonardis and
Jiri Matas and
Michael Felsberg and
Roman P. Pflugfelder and
Luka Cehovin and
Tom{\'{a}}s Voj{\'{\i}}r and
Gustav H{\"{a}}ger and
Alan Lukezic and
Gustavo Fern{\'{a}}ndez and
Abhinav Gupta and
Alfredo Petrosino and
Alireza Memarmoghadam and
{\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and
Andr{\'{e}}s Sol{\'{\i}}s Montero and
Andrea Vedaldi and
Andreas Robinson and
Andy Jinhua Ma and
Anton Varfolomieiev and
A. Aydin Alatan and
Aykut Erdem and
Bernard Ghanem and
Bin Liu and
Bohyung Han and
Brais Mart{\'{\i}}nez and
Chang{-}Ming Chang and
Changsheng Xu and
Chong Sun and
Daijin Kim and
Dapeng Chen and
Dawei Du and
Deepak Mishra and
Dit{-}Yan Yeung and
Erhan Gundogdu and
Erkut Erdem and
Fahad Shahbaz Khan and
Fatih Porikli and
Fei Zhao and
Filiz Bunyak and
Francesco Battistone and
Gao Zhu and
Giorgio Roffo and
Gorthi R. K. Sai Subrahmanyam and
Guilherme Sousa Bastos and
Guna Seetharaman and
Henry Medeiros and
Hongdong Li and
Honggang Qi and
Horst Bischof and
Horst Possegger and
Huchuan Lu and
Hyemin Lee and
Hyeonseob Nam and
Hyung Jin Chang and
Isabela Drummond and
Jack Valmadre and
Jae{-}chan Jeong and
Jaeil Cho and
Jae{-}Yeong Lee and
Jianke Zhu and
Jiayi Feng and
Jin Gao and
Jin Young Choi and
Jingjing Xiao and
Ji{-}Wan Kim and
Jiyeoup Jeong and
Jo{\~{a}}o F. Henriques and
Jochen Lang and
Jongwon Choi and
Jos{\'{e}} M. Mart{\'{\i}}nez and
Junliang Xing and
Junyu Gao and
Kannappan Palaniappan and
Karel Lebeda and
Ke Gao and
Krystian Mikolajczyk and
Lei Qin and
Lijun Wang and
Longyin Wen and
Luca Bertinetto and
Madan Kumar Rapuru and
Mahdieh Poostchi and
Mario Edoardo Maresca and
Martin Danelljan and
Matthias Mueller and
Mengdan Zhang and
Michael Arens and
Michel F. Valstar and
Ming Tang and
Mooyeol Baek and
Muhammad Haris Khan and
Naiyan Wang and
Nana Fan and
Noor Al{-}Shakarji and
Ondrej Miksik and
Osman Akin and
Payman Moallem and
Pedro Senna and
Philip H. S. Torr and
Pong C. Yuen and
Qingming Huang and
Rafael Martin Nieto and
Rengarajan Pelapur and
Richard Bowden and
Robert Lagani{\`{e}}re and
Rustam Stolkin and
Ryan Walsh and
Sebastian Bernd Krah and
Shengkun Li and
Shengping Zhang and
Shizeng Yao and
Simon Hadfield and
Simone Melzi and
Siwei Lyu and
Siyi Li and
Stefan Becker and
Stuart Golodetz and
Sumithra Kakanuru and
Sunglok Choi and
Tao Hu and
Thomas Mauthner and
Tianzhu Zhang and
Tony P. Pridmore and
Vincenzo Santopietro and
Weiming Hu and
Wenbo Li and
Wolfgang H{\"{u}}bner and
Xiangyuan Lan and
Xiaomeng Wang and
Xin Li and
Yang Li and
Yiannis Demiris and
Yifan Wang and
Yuankai Qi and
Zejian Yuan and
Zexiong Cai and
Zhan Xu and
Zhenyu He and
Zhizhen Chi},
editor = {Gang Hua and
Herv{\'{e}} J{\'{e}}gou},
title = {The Visual Object Tracking {VOT2016} Challenge Results},
booktitle = {Computer Vision - {ECCV} 2016 Workshops - Amsterdam, The Netherlands,
October 8-10 and 15-16, 2016, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {9914},
pages = {777--823},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-48881-3\_54},
doi = {10.1007/978-3-319-48881-3\_54},
timestamp = {Thu, 18 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eccv/KristanLMFPCVHL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aei/PatrauceanANYBH15,
author = {Viorica Patraucean and
Iro Armeni and
Mohammad Nahangi and
Jamie Yeung and
Ioannis K. Brilakis and
Carl T. Haas},
title = {State of research in automatic as-built modelling},
journal = {Adv. Eng. Informatics},
volume = {29},
number = {2},
pages = {162--171},
year = {2015},
url = {https://doi.org/10.1016/j.aei.2015.01.001},
doi = {10.1016/J.AEI.2015.01.001},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aei/PatrauceanANYBH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/GanWYYH15,
author = {Chuang Gan and
Naiyan Wang and
Yi Yang and
Dit{-}Yan Yeung and
Alexander G. Hauptmann},
title = {DevNet: {A} Deep Event Network for multimedia event detection and
evidence recounting},
booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
2015, Boston, MA, USA, June 7-12, 2015},
pages = {2568--2577},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/CVPR.2015.7298872},
doi = {10.1109/CVPR.2015.7298872},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/GanWYYH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/YeungGTMBMV15,
author = {Arnold Yeung and
Harinath Garudadri and
Carolyn Van Toen and
Patrick P. Mercier and
Ozgur Balkan and
Scott Makeig and
Naznin Virji{-}Babul},
title = {Comparison of foam-based and spring-loaded dry {EEG} electrodes with
wet electrodes in resting and moving conditions},
booktitle = {37th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2015, Milan, Italy, August 25-29,
2015},
pages = {7131--7134},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/EMBC.2015.7320036},
doi = {10.1109/EMBC.2015.7320036},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/embc/YeungGTMBMV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kdd/WangWY15,
author = {Hao Wang and
Naiyan Wang and
Dit{-}Yan Yeung},
editor = {Longbing Cao and
Chengqi Zhang and
Thorsten Joachims and
Geoffrey I. Webb and
Dragos D. Margineantu and
Graham Williams},
title = {Collaborative Deep Learning for Recommender Systems},
booktitle = {Proceedings of the 21th {ACM} {SIGKDD} International Conference on
Knowledge Discovery and Data Mining, Sydney, NSW, Australia, August
10-13, 2015},
pages = {1235--1244},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2783258.2783273},
doi = {10.1145/2783258.2783273},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/kdd/WangWY15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/WangWY14,
author = {Hao Wang and
Naiyan Wang and
Dit{-}Yan Yeung},
title = {Collaborative Deep Learning for Recommender Systems},
journal = {CoRR},
volume = {abs/1409.2944},
year = {2014},
url = {http://arxiv.org/abs/1409.2944},
eprinttype = {arXiv},
eprint = {1409.2944},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/WangWY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12,
author = {Socrates D. Vamvakos and
Bendik Kleveland and
Dipak K. Sikdar and
B. K. Ahuja and
Haidang Lin and
Jayaprakash Balachandran and
Wignes Balakrishnan and
Aldo Bottelli and
Jawji Chen and
Xiaole Chen and
Jae Choi and
Jeong Choi and
Rajesh Chopra and
Sanjay Dabral and
Kalyan Dasari and
Ronald B. David and
Shaishav Desai and
Claude R. Gauthier and
Mahmudul Hassan and
Kuo{-}Chiang Hsieh and
Ramosan Canagasaby and
Jeff Kumala and
E. P. Kwon and
Ben Lee and
Ming Liu and
Gurupada Mandal and
Sundari Mitra and
Byeong Cheol Na and
Siddharth Panwar and
Jay Patel and
Chethan Rao and
Vithal Rao and
Richard Rouse and
Ritesh Saraf and
Subramanian Seshadri and
Jae{-}K. Sim and
Clement Szeto and
Alvin Wang and
Jason Yeung},
title = {A 576 Mb {DRAM} with 16-channel 10.3125Gbps serial {I/O} and 14.5
ns latency},
booktitle = {Proceedings of the 38th European Solid-State Circuit conference, {ESSCIRC}
2012, Bordeaux, France, September 17-21, 2012},
pages = {458--461},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ESSCIRC.2012.6341354},
doi = {10.1109/ESSCIRC.2012.6341354},
timestamp = {Thu, 26 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/LiuYSWZTS11,
author = {Tie Liu and
Zejian Yuan and
Jian Sun and
Jingdong Wang and
Nanning Zheng and
Xiaoou Tang and
Heung{-}Yeung Shum},
title = {Learning to Detect a Salient Object},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {33},
number = {2},
pages = {353--367},
year = {2011},
url = {https://doi.org/10.1109/TPAMI.2010.70},
doi = {10.1109/TPAMI.2010.70},
timestamp = {Thu, 25 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pami/LiuYSWZTS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pacis/KimRH10,
author = {Kyung Kyu Kim and
Sung Yul Ryoo and
Na Yeun Ha},
title = {Inter-Organizational Information Systems Visibility in Buyer-Supplier
Relationships: Buyer and Supplier Perspectives},
booktitle = {Pacific Asia Conference on Information Systems, {PACIS} 2010, Taipei,
Taiwan, 9-12 July 2010},
pages = {80},
publisher = {AISeL},
year = {2010},
url = {http://aisel.aisnet.org/pacis2010/80},
timestamp = {Tue, 28 Feb 2012 16:59:14 +0100},
biburl = {https://dblp.org/rec/conf/pacis/KimRH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/LiuWSZTS09,
author = {Tie Liu and
Jingdong Wang and
Jian Sun and
Nanning Zheng and
Xiaoou Tang and
Heung{-}Yeung Shum},
title = {Picture Collage},
journal = {{IEEE} Trans. Multim.},
volume = {11},
number = {7},
pages = {1225--1239},
year = {2009},
url = {https://doi.org/10.1109/TMM.2009.2030741},
doi = {10.1109/TMM.2009.2030741},
timestamp = {Thu, 25 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tmm/LiuWSZTS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/LiuSZTS07,
author = {Tie Liu and
Jian Sun and
Nanning Zheng and
Xiaoou Tang and
Heung{-}Yeung Shum},
title = {Learning to Detect {A} Salient Object},
booktitle = {2007 {IEEE} Computer Society Conference on Computer Vision and Pattern
Recognition {(CVPR} 2007), 18-23 June 2007, Minneapolis, Minnesota,
{USA}},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/CVPR.2007.383047},
doi = {10.1109/CVPR.2007.383047},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/LiuSZTS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/KangBYNSH06,
author = {Jinwoo Kang and
Amol Borkar and
Angelique Yeung and
Nancy Nong and
Marc Smith and
Monson Hayes},
title = {Short Wavelength Infrared Face Recognition for Personalization},
booktitle = {Proceedings of the International Conference on Image Processing, {ICIP}
2006, October 8-11, Atlanta, Georgia, {USA}},
pages = {2757--2760},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/ICIP.2006.313118},
doi = {10.1109/ICIP.2006.313118},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icip/KangBYNSH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/accv/2006-1,
editor = {P. J. Narayanan and
Shree K. Nayar and
Heung{-}Yeung Shum},
title = {Computer Vision - {ACCV} 2006, 7th Asian Conference on Computer Vision,
Hyderabad, India, January 13-16, 2006, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {3851},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11612032},
doi = {10.1007/11612032},
isbn = {3-540-31219-6},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/accv/2006-1.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/accv/2006-2,
editor = {P. J. Narayanan and
Shree K. Nayar and
Heung{-}Yeung Shum},
title = {Computer Vision - {ACCV} 2006, 7th Asian Conference on Computer Vision,
Hyderabad, India, January 13-16, 2006, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {3852},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11612704},
doi = {10.1007/11612704},
isbn = {3-540-31244-7},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/accv/2006-2.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cvgip/WangZLXS03,
author = {Tianshu Wang and
Nanning Zheng and
Yan Li and
Ying{-}Qing Xu and
Heung{-}Yeung Shum},
title = {Learning kernel-based HMMs for dynamic sequence synthesis},
journal = {Graph. Model.},
volume = {65},
number = {4},
pages = {206--221},
year = {2003},
url = {https://doi.org/10.1016/S1524-0703(03)00040-7},
doi = {10.1016/S1524-0703(03)00040-7},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cvgip/WangZLXS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/SunZS03,
author = {Jian Sun and
Nanning Zheng and
Heung{-}Yeung Shum},
title = {Stereo Matching Using Belief Propagation},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {25},
number = {7},
pages = {787--800},
year = {2003},
url = {https://doi.org/10.1109/TPAMI.2003.1206509},
doi = {10.1109/TPAMI.2003.1206509},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pami/SunZS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/SunZTS03,
author = {Jian Sun and
Nanning Zheng and
Hai Tao and
Heung{-}Yeung Shum},
title = {Image Hallucination with Primal Sketch Priors},
booktitle = {2003 {IEEE} Computer Society Conference on Computer Vision and Pattern
Recognition {(CVPR} 2003), 16-22 June 2003, Madison, WI, {USA}},
pages = {729--736},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/CVPR.2003.1211539},
doi = {10.1109/CVPR.2003.1211539},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cvpr/SunZTS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/SunSZ02,
author = {Jian Sun and
Heung{-}Yeung Shum and
Nanning Zheng},
editor = {Anders Heyden and
Gunnar Sparr and
Mads Nielsen and
Peter Johansen},
title = {Stereo Matching Using Belief Propagation},
booktitle = {Computer Vision - {ECCV} 2002, 7th European Conference on Computer
Vision, Copenhagen, Denmark, May 28-31, 2002, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {2351},
pages = {510--524},
publisher = {Springer},
year = {2002},
url = {https://doi.org/10.1007/3-540-47967-8\_34},
doi = {10.1007/3-540-47967-8\_34},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eccv/SunSZ02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/ChenZLLXS02,
author = {Hong Chen and
Nanning Zheng and
Lin Liang and
Yan Li and
Ying{-}Qing Xu and
Heung{-}Yeung Shum},
editor = {Lawrence A. Rowe and
Bernard M{\'{e}}rialdo and
Max M{\"{u}}hlh{\"{a}}user and
Keith W. Ross and
Nevenka Dimitrova},
title = {PicToon: a personalized image-based cartoon system},
booktitle = {Proceedings of the 10th {ACM} International Conference on Multimedia
2002, Juan les Pins, France, December 1-6, 2002},
pages = {171--178},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/641007.641040},
doi = {10.1145/641007.641040},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mm/ChenZLLXS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pg/WangZLXS02,
author = {Tianshu Wang and
Nanning Zheng and
Yan Li and
Ying{-}Qing Xu and
Heung{-}Yeung Shum},
title = {Learning Kernel-Based HMMs for Dynamic Sequence Synthesi},
booktitle = {10th Pacific Conference on Computer Graphics and Applications, {PG}
2002, Beijing, China, October 9-11, 2002},
pages = {87--95},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/PCCGA.2002.1167842},
doi = {10.1109/PCCGA.2002.1167842},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pg/WangZLXS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/ChenXSZZ01,
author = {Hong Chen and
Ying{-}Qing Xu and
Heung{-}Yeung Shum and
Song Chun Zhu and
Nanning Zheng},
title = {Example-Based Facial Sketch Generation with Non-parametric Sampling},
booktitle = {Proceedings of the Eighth International Conference On Computer Vision
(ICCV-01), Vancouver, British Columbia, Canada, July 7-14, 2001 -
Volume 2},
pages = {433--438},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/ICCV.2001.937657},
doi = {10.1109/ICCV.2001.937657},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccv/ChenXSZZ01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pcm/WangSXZ01,
author = {Tianshu Wang and
Heung{-}Yeung Shum and
Ying{-}Qing Xu and
Nanning Zheng},
editor = {Heung{-}Yeung Shum and
Mark Liao and
Shih{-}Fu Chang},
title = {Unsupervised Analysis of Human Gestures},
booktitle = {Advances in Multimedia Information Processing - {PCM} 2001, Second
{IEEE} Pacific Rim Conference on Multimedia, Bejing, China, October
24-26, 2001, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2195},
pages = {174--181},
publisher = {Springer},
year = {2001},
url = {https://doi.org/10.1007/3-540-45453-5\_23},
doi = {10.1007/3-540-45453-5\_23},
timestamp = {Fri, 24 Mar 2023 08:33:27 +0100},
biburl = {https://dblp.org/rec/conf/pcm/WangSXZ01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-08-04 05:25 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
