default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "M.-S. Hsieh"
more than 1000 matches, exporting first 1000 hits only!
download as .bib file
@article{DBLP:journals/behaviourIT/ChouHP24,
author = {Shih{-}Wei Chou and
Ming{-}Chia Hsieh and
Hui{-}Chun Pan},
title = {Understanding the impact of self-regulation on perceived learning
outcomes based on social cognitive theory},
journal = {Behav. Inf. Technol.},
volume = {43},
number = {6},
pages = {1129--1148},
year = {2024},
url = {https://doi.org/10.1080/0144929x.2023.2198048},
doi = {10.1080/0144929X.2023.2198048},
timestamp = {Fri, 31 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/behaviourIT/ChouHP24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csi/BeheraPHL24,
author = {Gopal Behera and
Sanjaya Kumar Panda and
Meng{-}Yen Hsieh and
Kuan{-}Ching Li},
title = {Hybrid collaborative filtering using matrix factorization and XGBoost
for movie recommendation},
journal = {Comput. Stand. Interfaces},
volume = {90},
pages = {103847},
year = {2024},
url = {https://doi.org/10.1016/j.csi.2024.103847},
doi = {10.1016/J.CSI.2024.103847},
timestamp = {Fri, 02 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csi/BeheraPHL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbi/ChenKLYTLHCWCWCLHLFCCL24,
author = {Wei{-}Wen Chen and
Ling Kuo and
Yi{-}Xun Lin and
Wen{-}Chung Yu and
Chien{-}Chao Tseng and
Yenn{-}Jiang Lin and
Ching{-}Chun Huang and
Shih{-}Lin Chang and
Jacky Chung{-}Hao Wu and
Chun{-}Ku Chen and
Ching{-}Yao Weng and
Siwa Chan and
Wei{-}Wen Lin and
Yu{-}Cheng Hsieh and
Ming{-}Chih Lin and
Yun{-}Ching Fu and
Tsung Chen and
Shih{-}Ann Chen and
Henry Horng{-}Shing Lu},
title = {A Deep Learning Approach to Classify Fabry Cardiomyopathy from Hypertrophic
Cardiomyopathy Using Cine Imaging on Cardiac Magnetic Resonance},
journal = {Int. J. Biomed. Imaging},
volume = {2024},
pages = {6114826:1--6114826:9},
year = {2024},
url = {https://doi.org/10.1155/2024/6114826},
doi = {10.1155/2024/6114826},
timestamp = {Wed, 08 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbi/ChenKLYTLHCWCWCLHLFCCL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/ShenSHCKYWWZZZCCCLZJCJW24,
author = {Chao Shen and
Jianfei Song and
Chang{-}Yu Hsieh and
Dong{-}Sheng Cao and
Yu Kang and
Wenling Ye and
Zhenxing Wu and
Jike Wang and
Odin Zhang and
Xujun Zhang and
Hao Zeng and
Heng Cai and
Yu Chen and
Linkang Chen and
Hao Luo and
Xinda Zhao and
Tianye Jian and
Tong Chen and
Dejun Jiang and
Mingyang Wang and
Qing Ye and
Jialu Wu and
Hongyan Du and
Hui Shi and
Yafeng Deng and
Tingjun Hou},
title = {DrugFlow: An AI-Driven One-Stop Platform for Innovative Drug Discovery},
journal = {J. Chem. Inf. Model.},
volume = {64},
number = {14},
pages = {5381--5391},
year = {2024},
url = {https://doi.org/10.1021/acs.jcim.4c00621},
doi = {10.1021/ACS.JCIM.4C00621},
timestamp = {Fri, 09 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/ShenSHCKYWWZZZCCCLZJCJW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcss/WangMHKX24,
author = {Zhao Wang and
Yaping Mao and
Sun{-}Yuan Hsieh and
Ralf Klasing and
Yuzhi Xiao},
title = {The g-extra connectivity of graph products},
journal = {J. Comput. Syst. Sci.},
volume = {145},
pages = {103552},
year = {2024},
url = {https://doi.org/10.1016/j.jcss.2024.103552},
doi = {10.1016/J.JCSS.2024.103552},
timestamp = {Fri, 09 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcss/WangMHKX24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcss/YangYHMK24,
author = {Chenxu Yang and
Gang Yang and
Sun{-}Yuan Hsieh and
Yaping Mao and
Ralf Klasing},
title = {Monitoring the edges of a graph using distances with given girth},
journal = {J. Comput. Syst. Sci.},
volume = {143},
pages = {103528},
year = {2024},
url = {https://doi.org/10.1016/j.jcss.2024.103528},
doi = {10.1016/J.JCSS.2024.103528},
timestamp = {Fri, 09 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcss/YangYHMK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WuSCHRCWCLHLSCLWLLHTC24,
author = {Ping{-}Chun Wu and
Jian{-}Wei Su and
Yen{-}Lin Chung and
Li{-}Yang Hong and
Jin{-}Sheng Ren and
Fu{-}Chun Chang and
Yuan Wu and
Ho{-}Yu Chen and
Chen{-}Hsun Lin and
Hsu{-}Ming Hsiao and
Sih{-}Han Li and
Shyh{-}Shyuan Sheu and
Shih{-}Chieh Chang and
Wei{-}Chung Lo and
Chih{-}I Wu and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Meng{-}Fan Chang},
title = {An 8b-Precision 6T {SRAM} Computing-in-Memory Macro Using Time-Domain
Incremental Accumulation for {AI} Edge Chips},
journal = {{IEEE} J. Solid State Circuits},
volume = {59},
number = {7},
pages = {2297--2309},
year = {2024},
url = {https://doi.org/10.1109/JSSC.2023.3343669},
doi = {10.1109/JSSC.2023.3343669},
timestamp = {Fri, 19 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WuSCHRCWCLHLSCLWLLHTC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WuSHRCCKHLSLCLLHTC24,
author = {Ping{-}Chun Wu and
Jian{-}Wei Su and
Li{-}Yang Hong and
Jin{-}Sheng Ren and
Chih{-}Han Chien and
Ho{-}Yu Chen and
Chao{-}En Ke and
Hsu{-}Ming Hsiao and
Sih{-}Han Li and
Shyh{-}Shyuan Sheu and
Wei{-}Chung Lo and
Shih{-}Chieh Chang and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Meng{-}Fan Chang},
title = {A Floating-Point 6T {SRAM} In-Memory-Compute Macro Using Hybrid-Domain
Structure for Advanced {AI} Edge Chips},
journal = {{IEEE} J. Solid State Circuits},
volume = {59},
number = {1},
pages = {196--207},
year = {2024},
url = {https://doi.org/10.1109/JSSC.2023.3309966},
doi = {10.1109/JSSC.2023.3309966},
timestamp = {Sat, 13 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/WuSHRCCKHLSLCLLHTC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/make/HsiehLNNSOJM24,
author = {Chihcheng Hsieh and
Andr{\'{e}} Lu{\'{\i}}s and
Jos{\'{e}} Neves and
Isabel Blanco Nobre and
Sandra Costa Sousa and
Chun Ouyang and
Joaquim Jorge and
Catarina Moreira},
title = {EyeXNet: Enhancing Abnormality Detection and Diagnosis via Eye-Tracking
and X-ray Fusion},
journal = {Mach. Learn. Knowl. Extr.},
volume = {6},
number = {2},
pages = {1055--1071},
year = {2024},
url = {https://doi.org/10.3390/make6020048},
doi = {10.3390/MAKE6020048},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/make/HsiehLNNSOJM24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/ChangYYGLH24,
author = {Yun{-}Hsuan Chang and
Meng{-}Heng Yang and
Cheng{-}Ta Yang and
Joshua Oon Soo Goh and
Sheng{-}Hsiang Lin and
Shulan Hsieh},
title = {Alternation of psychological resilience may moderate mentalization
toward mental health conditions from macro- and microstructure aspects},
journal = {NeuroImage},
volume = {299},
pages = {120810},
year = {2024},
url = {https://doi.org/10.1016/j.neuroimage.2024.120810},
doi = {10.1016/J.NEUROIMAGE.2024.120810},
timestamp = {Fri, 20 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/ChangYYGLH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/ChangYHN24,
author = {Jose Ramon Chang and
Zai{-}Fu Yao and
Shulan Hsieh and
Torbj{\"{o}}rn E. M. Nordling},
title = {Age Prediction Using Resting-State Functional {MRI}},
journal = {Neuroinformatics},
volume = {22},
number = {2},
pages = {119--134},
year = {2024},
url = {https://doi.org/10.1007/s12021-024-09653-x},
doi = {10.1007/S12021-024-09653-X},
timestamp = {Sat, 04 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ni/ChangYHN24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmhci/EvansRHZXASA24,
author = {Hayley I. Evans and
Myeonghan Ryu and
Theresa Hsieh and
Jiawei Zhou and
Kefan Xu and
Kenneth W. Akers and
Andrew M. Sherrill and
Rosa I. Arriaga},
title = {Using Sensor-Captured Patient-Generated Data to Support Clinical Decision-making
in {PTSD} Therapy},
journal = {Proc. {ACM} Hum. Comput. Interact.},
volume = {8},
number = {{CSCW1}},
pages = {1--28},
year = {2024},
url = {https://doi.org/10.1145/3637426},
doi = {10.1145/3637426},
timestamp = {Mon, 19 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pacmhci/EvansRHZXASA24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/systems/HsiehC24,
author = {Ming{-}Jin Hsieh and
Shiu{-}Kuan Chiu},
title = {Innovative Thinking in Volunteer Organizations: Addressing the Impact
of Psychological Ownership on Volunteer Organizational Commitment},
journal = {Syst.},
volume = {12},
number = {7},
pages = {228},
year = {2024},
url = {https://doi.org/10.3390/systems12070228},
doi = {10.3390/SYSTEMS12070228},
timestamp = {Fri, 19 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/systems/HsiehC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tai/HsiehCCCSH24,
author = {Jun{-}Wei Hsieh and
Cheng{-}Han Chou and
Ming{-}Ching Chang and
Ping{-}Yang Chen and
Santanu Santra and
Chih{-}Sheng Huang},
title = {Mean-Shift Based Differentiable Architecture Search},
journal = {{IEEE} Trans. Artif. Intell.},
volume = {5},
number = {3},
pages = {1235--1246},
year = {2024},
url = {https://doi.org/10.1109/TAI.2023.3329792},
doi = {10.1109/TAI.2023.3329792},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tai/HsiehCCCSH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcasII/SuLWCLCHRHCMLSLCHLLHTC24,
author = {Jian{-}Wei Su and
Pei{-}Jung Lu and
Ping{-}Chun Wu and
Yen{-}Chi Chou and
Ta{-}Wei Liu and
Yen{-}Lin Chung and
Li{-}Yang Hung and
Jin{-}Sheng Ren and
Wei{-}Hsing Huang and
Chih{-}Han Chien and
Peng{-}I Mei and
Sih{-}Han Li and
Shyh{-}Shyuan Sheu and
Wei{-}Chung Lo and
Shih{-}Chieh Chang and
Hao{-}Chiao Hong and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Meng{-}Fan Chang},
title = {8-Bit Precision 6T {SRAM} Compute-in-Memory Macro Using Global Bitline-Combining
Scheme for Edge {AI} Chips},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {71},
number = {4},
pages = {2304--2308},
year = {2024},
url = {https://doi.org/10.1109/TCSII.2023.3331375},
doi = {10.1109/TCSII.2023.3331375},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcasII/SuLWCLCHRHCMLSLCHLLHTC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tii/WangHLSWJJ24,
author = {Jen{-}Cheng Wang and
Chao{-}Liang Hsieh and
Mu{-}Hwa Lee and
Chih{-}Hong Sun and
Tzai{-}Hung Wen and
Jehn{-}Yih Juang and
Joe{-}Air Jiang},
title = {Research on Monitoring Road Surface Anomalies Using an IoT-Based Automatic
Detection System: Case Study in Taiwan},
journal = {{IEEE} Trans. Ind. Informatics},
volume = {20},
number = {9},
pages = {11404--11417},
year = {2024},
url = {https://doi.org/10.1109/TII.2024.3404052},
doi = {10.1109/TII.2024.3404052},
timestamp = {Tue, 24 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tii/WangHLSWJJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/LinHCL24,
author = {Ming{-}Yi Lin and
Sheng{-}Hsien Hsieh and
Ching{-}Han Chen and
Chun{-}Hung Lin},
title = {High-Performance Chip Design With Parallel Architecture for Magnetic
Field Imaging System},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {73},
pages = {1--13},
year = {2024},
url = {https://doi.org/10.1109/TIM.2023.3334351},
doi = {10.1109/TIM.2023.3334351},
timestamp = {Sat, 13 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tim/LinHCL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ton/WangXCTLLCHHXP24,
author = {Sihan Wang and
Tian Xie and
Min{-}Yue Chen and
Guan{-}Hua Tu and
Chi{-}Yu Li and
Xinyu Lei and
Po{-}Yi Chou and
Fu{-}Cheng Hsieh and
Yiwen Hu and
Li Xiao and
Chunyi Peng},
title = {Dissecting Operational Cellular IoT Service Security: Attacks and
Defenses},
journal = {{IEEE/ACM} Trans. Netw.},
volume = {32},
number = {2},
pages = {1229--1244},
year = {2024},
url = {https://doi.org/10.1109/TNET.2023.3313557},
doi = {10.1109/TNET.2023.3313557},
timestamp = {Sat, 04 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ton/WangXCTLLCHHXP24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/WangHCCSL24,
author = {Yu{-}Hsiang Wang and
Jun{-}Wei Hsieh and
Ping{-}Yang Chen and
Ming{-}Ching Chang and
Hung{-}Hin So and
Xin Li},
editor = {Michael J. Wooldridge and
Jennifer G. Dy and
Sriraam Natarajan},
title = {SMILEtrack: SiMIlarity LEarning for Occlusion-Aware Multiple Object
Tracking},
booktitle = {Thirty-Eighth {AAAI} Conference on Artificial Intelligence, {AAAI}
2024, Thirty-Sixth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2024, Fourteenth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2014, February 20-27, 2024, Vancouver,
Canada},
pages = {5740--5748},
publisher = {{AAAI} Press},
year = {2024},
url = {https://doi.org/10.1609/aaai.v38i6.28386},
doi = {10.1609/AAAI.V38I6.28386},
timestamp = {Tue, 02 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/WangHCCSL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/HsiehKLM24,
author = {Chiao Hsieh and
Yubin Koh and
Yangge Li and
Sayan Mitra},
title = {Assuring Safety of Vision-Based Swarm Formation Control},
booktitle = {American Control Conference, {ACC} 2024, Toronto, ON, Canada, July
10-12, 2024},
pages = {3215--3222},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.23919/ACC60939.2024.10644491},
doi = {10.23919/ACC60939.2024.10644491},
timestamp = {Sat, 21 Sep 2024 12:19:37 +0200},
biburl = {https://dblp.org/rec/conf/amcc/HsiehKLM24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/ZhongSMKCH24,
author = {Ruican Zhong and
Donghoon Shin and
Rosemary Meza and
Predrag Klasnja and
Lucas Colusso and
Gary Hsieh},
editor = {Florian 'Floyd' Mueller and
Penny Kyburz and
Julie R. Williamson and
Corina Sas and
Max L. Wilson and
Phoebe O. Toups Dugas and
Irina Shklovski},
title = {AI-Assisted Causal Pathway Diagram for Human-Centered Design},
booktitle = {Proceedings of the {CHI} Conference on Human Factors in Computing
Systems, {CHI} 2024, Honolulu, HI, USA, May 11-16, 2024},
pages = {2:1--2:19},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3613904.3642179},
doi = {10.1145/3613904.3642179},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/ZhongSMKCH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icc/MarasingheTHHMB24,
author = {Dileepa Marasinghe and
Muhammad Tayyab and
Sofonias Hailu and
Frank Hsieh and
Nitin Mangalvedhe and
M. Majid Butt and
Rapeepat Ratasuk and
Navin Hathiramani},
title = {Ambient IoT Devices in Future Cellular Networks: {A} System Level
Study},
booktitle = {{IEEE} International Conference on Communications Workshops, {ICC}
2024 Workshops, Denver, CO, USA, June 9-13, 2024},
pages = {129--134},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ICCWorkshops59551.2024.10615328},
doi = {10.1109/ICCWORKSHOPS59551.2024.10615328},
timestamp = {Wed, 21 Aug 2024 14:57:07 +0200},
biburl = {https://dblp.org/rec/conf/icc/MarasingheTHHMB24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/WangSLLYHDK24,
author = {Yihan Wang and
Si Si and
Daliang Li and
Michal Lukasik and
Felix Yu and
Cho{-}Jui Hsieh and
Inderjit S. Dhillon and
Sanjiv Kumar},
title = {Two-stage {LLM} Fine-tuning with Less Specialization and More Generalization},
booktitle = {The Twelfth International Conference on Learning Representations,
{ICLR} 2024, Vienna, Austria, May 7-11, 2024},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/forum?id=pCEgna6Qco},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/WangSLLYHDK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/Xiong0G0S0HY24,
author = {Yuanhao Xiong and
Long Zhao and
Boqing Gong and
Ming{-}Hsuan Yang and
Florian Schroff and
Ting Liu and
Cho{-}Jui Hsieh and
Liangzhe Yuan},
title = {Structured Video-Language Modeling with Temporal Grouping and Spatial
Grounding},
booktitle = {The Twelfth International Conference on Learning Representations,
{ICLR} 2024, Vienna, Austria, May 7-11, 2024},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/forum?id=5dlfiJIXoh},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/Xiong0G0S0HY24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/0006W0HWJLJPLBW24,
author = {Lu Yin and
You Wu and
Zhenyu Zhang and
Cheng{-}Yu Hsieh and
Yaqing Wang and
Yiling Jia and
Gen Li and
Ajay Kumar Jaiswal and
Mykola Pechenizkiy and
Yi Liang and
Michael Bendersky and
Zhangyang Wang and
Shiwei Liu},
title = {Outlier Weighed Layerwise Sparsity {(OWL):} {A} Missing Secret Sauce
for Pruning LLMs to High Sparsity},
booktitle = {Forty-first International Conference on Machine Learning, {ICML} 2024,
Vienna, Austria, July 21-27, 2024},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/forum?id=ahEm3l2P6w},
timestamp = {Mon, 02 Sep 2024 16:45:29 +0200},
biburl = {https://dblp.org/rec/conf/icml/0006W0HWJLJPLBW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/WangACZHH24,
author = {Ruochen Wang and
Sohyun An and
Minhao Cheng and
Tianyi Zhou and
Sung Ju Hwang and
Cho{-}Jui Hsieh},
title = {One Prompt is not Enough: Automated Construction of a Mixture-of-Expert
Prompts},
booktitle = {Forty-first International Conference on Machine Learning, {ICML} 2024,
Vienna, Austria, July 21-27, 2024},
publisher = {OpenReview.net},
year = {2024},
url = {https://openreview.net/forum?id=edHLN40DWu},
timestamp = {Mon, 02 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/WangACZHH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/imw2/TsengFLLLLLHWL24,
author = {Po{-}Hao Tseng and
Shao{-}Yu Fang and
Yu{-}Hsuan Lin and
Feng{-}Ming Lee and
Jhe{-}Yi Liao and
Yu{-}Yu Lin and
Ming{-}Hsiu Lee and
Kuang{-}Yeu Hsieh and
Keh{-}Chung Wang and
Chih{-}Yuan Lu},
title = {3D-NAND based Filtering Cube with High Resolution 2D Query and Tunable
Feature Length for Computational {SSD}},
booktitle = {{IEEE} International Memory Workshop, {IMW} 2024, Seoul, Republic
of Korea, May 12-15, 2024},
pages = {1--4},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/IMW59701.2024.10536967},
doi = {10.1109/IMW59701.2024.10536967},
timestamp = {Mon, 10 Jun 2024 16:21:17 +0200},
biburl = {https://dblp.org/rec/conf/imw2/TsengFLLLLLHWL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/irps/ChangLCCLLHYLHH24,
author = {H. C. Chang and
P. J. Liao and
S. H. Chen and
Y. K. Chang and
C. P. Li and
W. C. Liao and
M. H. Hsieh and
H. W. Yang and
J. H. Lee and
C. M. Huang and
Jun He},
title = {Enhancing {EM} Reliability and Lifetime Modeling: {A} Multi-Link Structure
Approach},
booktitle = {{IEEE} International Reliability Physics Symposium, {IRPS} 2024, Grapevine,
TX, USA, April 14-18, 2024},
pages = {1--4},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/IRPS48228.2024.10529443},
doi = {10.1109/IRPS48228.2024.10529443},
timestamp = {Wed, 29 May 2024 21:52:31 +0200},
biburl = {https://dblp.org/rec/conf/irps/ChangLCCLLHYLHH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/irps/YangTLCHHCLKTHHLLL24,
author = {Y. L. Yang and
P. C. Tsao and
C. W. Lin and
H. Q. Chen and
B. J. Huang and
Hank Hsieh and
Kerwin Chen and
Ross Lee and
Khim Koh and
Y. J. Ting and
B. C. Hsu and
Y. S. Huang and
Citi Lai and
M. Z. Lee and
T. H. Lee},
title = {Vmin Shift Prediction Using Machine Learning-Based Methodology for
Automotive Products},
booktitle = {{IEEE} International Reliability Physics Symposium, {IRPS} 2024, Grapevine,
TX, USA, April 14-18, 2024},
pages = {3},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/IRPS48228.2024.10529430},
doi = {10.1109/IRPS48228.2024.10529430},
timestamp = {Wed, 29 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/irps/YangTLCHHCLKTHHLLL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/KhwaWWSCKCHCCLLHTC24,
author = {Win{-}San Khwa and
Ping{-}Chun Wu and
Jui{-}Jen Wu and
Jian{-}Wei Su and
Ho{-}Yu Chen and
Zhao{-}En Ke and
Ting{-}Chien Chiu and
Jun{-}Ming Hsu and
Chiao{-}Yen Cheng and
Yu{-}Chen Chen and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Meng{-}Fan Chang},
title = {34.2 {A} 16nm 96Kb Integer/Floating-Point Dual-Mode-Gain-Cell-Computing-in-Memory
Macro Achieving 73.3-163.3TOPS/W and 33.2-91.2TFLOPS/W for AI-Edge
Devices},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2024,
San Francisco, CA, USA, February 18-22, 2024},
pages = {568--570},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISSCC49657.2024.10454447},
doi = {10.1109/ISSCC49657.2024.10454447},
timestamp = {Tue, 19 Mar 2024 09:04:31 +0100},
biburl = {https://dblp.org/rec/conf/isscc/KhwaWWSCKCHCCLLHTC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/LienLLLPH24,
author = {Bei{-}Shing Lien and
Szu Lin Liu and
Wei{-}Lin Lai and
Yi{-}Chen Lu and
Yung{-}Chow Peng and
Kenny Cheng{-}Hsiang Hsieh},
title = {3.8 {A} 0.65V 900{\(\mathrm{\mu}\)}m{\({^2}\)} BEoL RC-Based Temperature
Sensor with {\(\pm\)}1{\textdegree}C Inaccuracy from -25{\textdegree}C
to 125{\textdegree}C},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2024,
San Francisco, CA, USA, February 18-22, 2024},
pages = {68--70},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISSCC49657.2024.10454423},
doi = {10.1109/ISSCC49657.2024.10454423},
timestamp = {Tue, 19 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/LienLLLPH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ShihHTLTCLCHNWKXJFMCHJCLWCJ24,
author = {Ming{-}En Shih and
Shih{-}Wei Hsieh and
Ping{-}Yuan Tsai and
Ming{-}Hung Lin and
Pei{-}Kuei Tsung and
En{-}Jui Chang and
Jenwei Liang and
Shu{-}Hsin Chang and
Chung{-}Lun Huang and
You{-}Yu Nian and
Zhe Wan and
Sushil Kumar and
Cheng{-}Xin Xue and
Gajanan Jedhe and
Hidehiro Fujiwara and
Haruki Mori and
Chih{-}Wei Chen and
Po{-}Hua Huang and
Chih{-}Feng Juan and
Chung{-}Yi Chen and
Tsung{-}Yao Lin and
Ch Wang and
Chih{-}Cheng Chen and
Kevin Jou},
title = {20.1 {NVE:} {A} 3nm 23.2TOPS/W 12b-Digital-CIM-Based Neural Engine
for High-Resolution Visual-Quality Enhancement on Smart Devices},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2024,
San Francisco, CA, USA, February 18-22, 2024},
pages = {360--362},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISSCC49657.2024.10454482},
doi = {10.1109/ISSCC49657.2024.10454482},
timestamp = {Tue, 19 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/ShihHTLTCLCHNWKXJFMCHJCLWCJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/WenHKHKCWCHLLHTTCCCC24,
author = {Tai{-}Hao Wen and
Hung{-}Hsi Hsu and
Win{-}San Khwa and
Wei{-}Hsing Huang and
Zhao{-}En Ke and
Yu{-}Hsiang Chin and
Hua{-}Jin Wen and
Yu{-}Chen Chang and
Wei{-}Ting Hsu and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Shih{-}Hsih Teng and
Chung{-}Cheng Chou and
Yu{-}Der Chih and
Tsung{-}Yung Jonathan Chang and
Meng{-}Fan Chang},
title = {34.8 {A} 22nm 16Mb Floating-Point ReRAM Compute-in-Memory Macro with
31.2TFLOPS/W for {AI} Edge Devices},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2024,
San Francisco, CA, USA, February 18-22, 2024},
pages = {580--582},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ISSCC49657.2024.10454468},
doi = {10.1109/ISSCC49657.2024.10454468},
timestamp = {Tue, 19 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/WenHKHKCWCHLLHTTCCCC24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iui/DubielASMHW24,
author = {Mateusz Dubiel and
Matthew Peter Aylett and
Anuschka Schmitt and
Zilin Ma and
Gary Hsieh and
Thiemo Wambsganss},
title = {Speech as Interactive Design Material {(SIDM):} How to design and
evaluate task-tailored synthetic voices?},
booktitle = {Companion Proceedings of the 29th International Conference on Intelligent
User Interfaces, {IUI} 2024, Greenville, SC, USA, March 18-21, 2024},
pages = {131--133},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3640544.3645258},
doi = {10.1145/3640544.3645258},
timestamp = {Mon, 15 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iui/DubielASMHW24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/CheeSHP24,
author = {Kong Yao Chee and
Thales C. Silva and
M. Ani Hsieh and
George J. Pappas},
editor = {Alessandro Abate and
Mark Cannon and
Kostas Margellos and
Antonis Papachristodoulou},
title = {Uncertainty quantification and robustification of model-based controllers
using conformal prediction},
booktitle = {6th Annual Learning for Dynamics {\&} Control Conference, 15-17
July 2024, University of Oxford, Oxford, {UK}},
series = {Proceedings of Machine Learning Research},
volume = {242},
pages = {528--540},
publisher = {{PMLR}},
year = {2024},
url = {https://proceedings.mlr.press/v242/chee24a.html},
timestamp = {Fri, 05 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/l4dc/CheeSHP24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lak/HsiehY24,
author = {Yi{-}Chun Hsieh and
Albert C. M. Yang},
editor = {Martin Hlosta and
Ivan Moser and
Brendan Flanagan and
Gloria Milena Fern{\'{a}}ndez Nieto and
Lixiang Yan and
Angela Stewart and
Amir Winer and
Nitza Geri and
Umesh Ramnarain and
Christo van der Westhuizen and
Atsushi Shimada and
Fumiya Okubo and
Hsiao{-}Ting Tseng and
Albert C. M. Yang and
Owen H. T. Lu and
Hiroaki Ogata and
Vanessa Echeverr{\'{\i}}a and
Roberto Mart{\'{\i}}nez Maldonado and
Yi{-}Shan Tsai and
LuEttaMae Lawrence and
Shaveen Singh and
Stanislav Pozdniakov and
Lujie Karen Chen and
Jiaqi Gong and
Louise Yarnall and
Andy Nguyen and
Lele Sha and
Jionghao Lin and
Mutlu Cukurova and
Kshitij Sharma and
Linxuan Zhao and
Yuheng Li and
Yueqiao Jin and
Dragan Gasevic and
Caitlin Mills and
Stephen Hutt},
title = {Enhancing Personalized Learning with {MBTI} Forecasts and ChatGPT's
Tailored Study Advice},
booktitle = {Joint Proceedings of {LAK} 2024 Workshops co-located with 14th International
Conference on Learning Analytics and Knowledge {(LAK} 2024), Kyoto,
Japan, March 18-22, 2024},
series = {{CEUR} Workshop Proceedings},
volume = {3667},
pages = {42--46},
publisher = {CEUR-WS.org},
year = {2024},
url = {https://ceur-ws.org/Vol-3667/DC-LAK24-paper-5.pdf},
timestamp = {Mon, 23 Sep 2024 20:29:57 +0200},
biburl = {https://dblp.org/rec/conf/lak/HsiehY24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nsdi/Hsieh0SMEPNCK24,
author = {Kevin Hsieh and
Mike Wong and
Santiago Segarra and
Sathiya Kumaran Mani and
Trevor Eberl and
Anatoliy Panasyuk and
Ravi Netravali and
Ranveer Chandra and
Srikanth Kandula},
editor = {Laurent Vanbever and
Irene Zhang},
title = {NetVigil: Robust and Low-Cost Anomaly Detection for East-West Data
Center Security},
booktitle = {21st {USENIX} Symposium on Networked Systems Design and Implementation,
{NSDI} 2024, Santa Clara, CA, April 15-17, 2024},
publisher = {{USENIX} Association},
year = {2024},
url = {https://www.usenix.org/conference/nsdi24/presentation/hsieh},
timestamp = {Fri, 19 Apr 2024 11:29:16 +0200},
biburl = {https://dblp.org/rec/conf/nsdi/Hsieh0SMEPNCK24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmod/LambSHCKHS24,
author = {Andrew Lamb and
Yijie Shen and
Dani{\"{e}}l Heres and
Jayjeet Chakraborty and
Mehmet Ozan Kabak and
Liang{-}Chi Hsieh and
Chao Sun},
editor = {Pablo Barcel{\'{o}} and
Nayat S{\'{a}}nchez{-}Pi and
Alexandra Meliou and
S. Sudarshan},
title = {Apache Arrow DataFusion: {A} Fast, Embeddable, Modular Analytic Query
Engine},
booktitle = {Companion of the 2024 International Conference on Management of Data,
{SIGMOD/PODS} 2024, Santiago AA, Chile, June 9-15, 2024},
pages = {5--17},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3626246.3653368},
doi = {10.1145/3626246.3653368},
timestamp = {Wed, 24 Jul 2024 21:43:30 +0200},
biburl = {https://dblp.org/rec/conf/sigmod/LambSHCKHS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/stoc/HsiehMM024,
author = {Jun{-}Ting Hsieh and
Theo McKenzie and
Sidhanth Mohanty and
Pedro Paredes},
editor = {Bojan Mohar and
Igor Shinkar and
Ryan O'Donnell},
title = {Explicit Two-Sided Unique-Neighbor Expanders},
booktitle = {Proceedings of the 56th Annual {ACM} Symposium on Theory of Computing,
{STOC} 2024, Vancouver, BC, Canada, June 24-28, 2024},
pages = {788--799},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3618260.3649705},
doi = {10.1145/3618260.3649705},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/stoc/HsiehMM024.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tqc/ChenAH24,
author = {Kuo{-}Chin Chen and
Simon Apers and
Min{-}Hsiu Hsieh},
editor = {Fr{\'{e}}d{\'{e}}ric Magniez and
Alex Bredariol Grilo},
title = {(Quantum) Complexity of Testing Signed Graph Clusterability},
booktitle = {19th Conference on the Theory of Quantum Computation, Communication
and Cryptography, {TQC} 2024, September 9-13, 2024, Okinawa, Japan},
series = {LIPIcs},
volume = {310},
pages = {8:1--8:16},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2024},
url = {https://doi.org/10.4230/LIPIcs.TQC.2024.8},
doi = {10.4230/LIPICS.TQC.2024.8},
timestamp = {Mon, 26 Aug 2024 16:40:52 +0200},
biburl = {https://dblp.org/rec/conf/tqc/ChenAH24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsdm/ChangJZATHYV24,
author = {Wei{-}Cheng Chang and
Jyun{-}Yu Jiang and
Jiong Zhang and
Mutasem Al{-}Darabsah and
Choon Hui Teo and
Cho{-}Jui Hsieh and
Hsiang{-}Fu Yu and
S. V. N. Vishwanathan},
editor = {Luz Angelica Caudillo{-}Mata and
Silvio Lattanzi and
Andr{\'{e}}s Mu{\~{n}}oz Medina and
Leman Akoglu and
Aristides Gionis and
Sergei Vassilvitskii},
title = {{PEFA:} Parameter-Free Adapters for Large-scale Embedding-based Retrieval
Models},
booktitle = {Proceedings of the 17th {ACM} International Conference on Web Search
and Data Mining, {WSDM} 2024, Merida, Mexico, March 4-8, 2024},
pages = {77--86},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3616855.3635791},
doi = {10.1145/3616855.3635791},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsdm/ChangJZATHYV24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2401-11590,
author = {Jun{-}Ting Hsieh and
Pravesh K. Kothari and
Sidhanth Mohanty and
David Munh{\'{a}} Correia and
Benny Sudakov},
title = {Small Even Covers, Locally Decodable Codes and Restricted Subgraphs
of Edge-Colored Kikuchi Graphs},
journal = {CoRR},
volume = {abs/2401.11590},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2401.11590},
doi = {10.48550/ARXIV.2401.11590},
eprinttype = {arXiv},
eprint = {2401.11590},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2401-11590.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-12741,
author = {Sen Li and
Ruochen Wang and
Cho{-}Jui Hsieh and
Minhao Cheng and
Tianyi Zhou},
title = {MuLan: Multimodal-LLM Agent for Progressive Multi-Object Diffusion},
journal = {CoRR},
volume = {abs/2402.12741},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.12741},
doi = {10.48550/ARXIV.2402.12741},
eprinttype = {arXiv},
eprint = {2402.12741},
timestamp = {Thu, 21 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-12741.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-16592,
author = {Mateusz Dubiel and
Matthew P. Aylett and
Anuschka Schmitt and
Zilin Ma and
Gary Hsieh and
Thiemo Wambsganss},
title = {Speech as Interactive Design Material {(SIDM):} How to design and
evaluate task-tailored synthetic voices?},
journal = {CoRR},
volume = {abs/2402.16592},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.16592},
doi = {10.48550/ARXIV.2402.16592},
eprinttype = {arXiv},
eprint = {2402.16592},
timestamp = {Tue, 09 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-16592.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-02363,
author = {Ying{-}Hsuan Wu and
Jun{-}Wei Hsieh and
Li Xin and
Shin{-}You Teng and
Yi{-}Kuan Hsieh and
Ming{-}Ching Chang},
title = {Addressing Long-Tail Noisy Label Learning Problems: a Two-Stage Solution
with Label Refurbishment Considering Label Rarity},
journal = {CoRR},
volume = {abs/2403.02363},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.02363},
doi = {10.48550/ARXIV.2403.02363},
eprinttype = {arXiv},
eprint = {2403.02363},
timestamp = {Tue, 02 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-02363.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-08111,
author = {Ruican Zhong and
Donghoon Shin and
Rosemary Meza and
Predrag Klasnja and
Lucas Colusso and
Gary Hsieh},
title = {AI-Assisted Causal Pathway Diagram for Human-Centered Design},
journal = {CoRR},
volume = {abs/2403.08111},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.08111},
doi = {10.48550/ARXIV.2403.08111},
eprinttype = {arXiv},
eprint = {2403.08111},
timestamp = {Thu, 04 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-08111.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-00014,
author = {Odin Zhang and
Yufei Huang and
Shichen Cheng and
Mengyao Yu and
Xujun Zhang and
Haitao Lin and
Yundian Zeng and
Mingyang Wang and
Zhenxing Wu and
Huifeng Zhao and
Zaixi Zhang and
Chenqing Hua and
Yu Kang and
Sunliang Cui and
Peichen Pan and
Chang{-}Yu Hsieh and
Tingjun Hou},
title = {Deep Geometry Handling and Fragment-wise Molecular 3D Graph Generation},
journal = {CoRR},
volume = {abs/2404.00014},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2404.00014},
doi = {10.48550/ARXIV.2404.00014},
eprinttype = {arXiv},
eprint = {2404.00014},
timestamp = {Mon, 03 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2404-00014.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-09432,
author = {Shuo Wang and
David C. Anastasiu and
Zheng Tang and
Ming{-}Ching Chang and
Yue Yao and
Liang Zheng and
Mohammed Shaiqur Rahman and
Meenakshi S. Arya and
Anuj Sharma and
Pranamesh Chakraborty and
Sanjita Prajapati and
Quan Kong and
Norimasa Kobori and
Munkhjargal Gochoo and
Munkh{-}Erdene Otgonbold and
Fady Alnajjar and
Ganzorig Batnasan and
Ping{-}Yang Chen and
Jun{-}Wei Hsieh and
Xunlei Wu and
Sameer Satish Pusegaonkar and
Yizhou Wang and
Sujit Biswas and
Rama Chellappa},
title = {The 8th {AI} City Challenge},
journal = {CoRR},
volume = {abs/2404.09432},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2404.09432},
doi = {10.48550/ARXIV.2404.09432},
eprinttype = {arXiv},
eprint = {2404.09432},
timestamp = {Wed, 15 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2404-09432.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-03714,
author = {Siddhant Kharbanda and
Devaansh Gupta and
Gururaj K and
Pankaj Malhotra and
Cho{-}Jui Hsieh and
Rohit Babbar},
title = {UniDEC : Unified Dual Encoder and Classifier Training for Extreme
Multi-Label Classification},
journal = {CoRR},
volume = {abs/2405.03714},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2405.03714},
doi = {10.48550/ARXIV.2405.03714},
eprinttype = {arXiv},
eprint = {2405.03714},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2405-03714.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-07137,
author = {Nai{-}Hui Chia and
Min{-}Hsiu Hsieh and
Shih{-}Han Hung and
En{-}Jui Kuo},
title = {Oracle Separation between Noisy Quantum Polynomial Time and the Polynomial
Hierarchy},
journal = {CoRR},
volume = {abs/2405.07137},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2405.07137},
doi = {10.48550/ARXIV.2405.07137},
eprinttype = {arXiv},
eprint = {2405.07137},
timestamp = {Mon, 24 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2405-07137.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-16194,
author = {Chun{-}Mao Lai and
Hsiang{-}Chun Wang and
Ping{-}Chun Hsieh and
Yu{-}Chiang Frank Wang and
Min{-}Hung Chen and
Shao{-}Hua Sun},
title = {Diffusion-Reward Adversarial Imitation Learning},
journal = {CoRR},
volume = {abs/2405.16194},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2405.16194},
doi = {10.48550/ARXIV.2405.16194},
eprinttype = {arXiv},
eprint = {2405.16194},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2405-16194.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-18655,
author = {Ping{-}Han Hsieh and
Ru{-}Xiu Hsiao and
Katalin Ferenc and
Anthony Mathelier and
Rebekka Burkholz and
Chien{-}Yu Chen and
Geir Kjetil Sandve and
Tatiana Belova and
Marieke L. Kuijjer},
title = {{CAVACHON:} a hierarchical variational autoencoder to integrate multi-modal
single-cell data},
journal = {CoRR},
volume = {abs/2405.18655},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2405.18655},
doi = {10.48550/ARXIV.2405.18655},
eprinttype = {arXiv},
eprint = {2405.18655},
timestamp = {Tue, 25 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2405-18655.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2406-05184,
author = {Scott Geng and
Cheng{-}Yu Hsieh and
Vivek Ramanujan and
Matthew Wallingford and
Chun{-}Liang Li and
Pang Wei Koh and
Ranjay Krishna},
title = {The Unmet Promise of Synthetic Training Images: Using Retrieved Real
Images Performs Better},
journal = {CoRR},
volume = {abs/2406.05184},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2406.05184},
doi = {10.48550/ARXIV.2406.05184},
eprinttype = {arXiv},
eprint = {2406.05184},
timestamp = {Sat, 13 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2406-05184.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2406-11794,
author = {Jeffrey Li and
Alex Fang and
Georgios Smyrnis and
Maor Ivgi and
Matt Jordan and
Samir Yitzhak Gadre and
Hritik Bansal and
Etash Kumar Guha and
Sedrick Keh and
Kushal Arora and
Saurabh Garg and
Rui Xin and
Niklas Muennighoff and
Reinhard Heckel and
Jean Mercat and
Mayee Chen and
Suchin Gururangan and
Mitchell Wortsman and
Alon Albalak and
Yonatan Bitton and
Marianna Nezhurina and
Amro Abbas and
Cheng{-}Yu Hsieh and
Dhruba Ghosh and
Josh Gardner and
Maciej Kilian and
Hanlin Zhang and
Rulin Shao and
Sarah M. Pratt and
Sunny Sanyal and
Gabriel Ilharco and
Giannis Daras and
Kalyani Marathe and
Aaron Gokaslan and
Jieyu Zhang and
Khyathi Raghavi Chandu and
Thao Nguyen and
Igor Vasiljevic and
Sham M. Kakade and
Shuran Song and
Sujay Sanghavi and
Fartash Faghri and
Sewoong Oh and
Luke Zettlemoyer and
Kyle Lo and
Alaaeldin El{-}Nouby and
Hadi Pouransari and
Alexander Toshev and
Stephanie Wang and
Dirk Groeneveld and
Luca Soldaini and
Pang Wei Koh and
Jenia Jitsev and
Thomas Kollar and
Alexandros G. Dimakis and
Yair Carmon and
Achal Dave and
Ludwig Schmidt and
Vaishaal Shankar},
title = {DataComp-LM: In search of the next generation of training sets for
language models},
journal = {CoRR},
volume = {abs/2406.11794},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2406.11794},
doi = {10.48550/ARXIV.2406.11794},
eprinttype = {arXiv},
eprint = {2406.11794},
timestamp = {Mon, 02 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2406-11794.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2407-00256,
author = {Ruochen Wang and
Sohyun An and
Minhao Cheng and
Tianyi Zhou and
Sung Ju Hwang and
Cho{-}Jui Hsieh},
title = {One Prompt is not Enough: Automated Construction of a Mixture-of-Expert
Prompts},
journal = {CoRR},
volume = {abs/2407.00256},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2407.00256},
doi = {10.48550/ARXIV.2407.00256},
eprinttype = {arXiv},
eprint = {2407.00256},
timestamp = {Fri, 09 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2407-00256.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2407-06723,
author = {Yu{-}Guan Hsieh and
Cheng{-}Yu Hsieh and
Shih{-}Ying Yeh and
Louis B{\'{e}}thune and
Hadipour Ansari and
Pavan Kumar Anasosalu Vasu and
Chun{-}Liang Li and
Ranjay Krishna and
Oncel Tuzel and
Marco Cuturi},
title = {Graph-Based Captioning: Enhancing Visual Descriptions by Interconnecting
Region Captions},
journal = {CoRR},
volume = {abs/2407.06723},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2407.06723},
doi = {10.48550/ARXIV.2407.06723},
eprinttype = {arXiv},
eprint = {2407.06723},
timestamp = {Mon, 19 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2407-06723.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2407-07930,
author = {Jike Wang and
Rui Qin and
Mingyang Wang and
Meijing Fang and
Yangyang Zhang and
Yuchen Zhu and
Qun Su and
Qiaolin Gou and
Chao Shen and
Odin Zhang and
Zhenxing Wu and
Dejun Jiang and
Xujun Zhang and
Huifeng Zhao and
Xiaozhe Wan and
Zhourui Wu and
Liwei Liu and
Yu Kang and
Chang{-}Yu Hsieh and
Tingjun Hou},
title = {Token-Mol 1.0: Tokenized drug design with large language model},
journal = {CoRR},
volume = {abs/2407.07930},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2407.07930},
doi = {10.48550/ARXIV.2407.07930},
eprinttype = {arXiv},
eprint = {2407.07930},
timestamp = {Sat, 24 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2407-07930.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2407-08227,
author = {Chihcheng Hsieh and
Catarina Moreira and
Isabel Blanco Nobre and
Sandra Costa Sousa and
Chun Ouyang and
Margot Brereton and
Joaquim Jorge and
Jacinto C. Nascimento},
title = {{DALL-M:} Context-Aware Clinical Data Augmentation with LLMs},
journal = {CoRR},
volume = {abs/2407.08227},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2407.08227},
doi = {10.48550/ARXIV.2407.08227},
eprinttype = {arXiv},
eprint = {2407.08227},
timestamp = {Sun, 18 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2407-08227.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2408-07776,
author = {Tom Z. Jiahao and
Ryan Adolf and
Cynthia Sung and
M. Ani Hsieh},
title = {Knowledge-based Neural Ordinary Differential Equations for Cosserat
Rod-based Soft Robots},
journal = {CoRR},
volume = {abs/2408.07776},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2408.07776},
doi = {10.48550/ARXIV.2408.07776},
eprinttype = {arXiv},
eprint = {2408.07776},
timestamp = {Fri, 27 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2408-07776.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2408-14407,
author = {Benjamin D. Shaffer and
Jeremy R. Vorenberg and
M. Ani Hsieh},
title = {Spectrally Informed Learning of Fluid Flows},
journal = {CoRR},
volume = {abs/2408.14407},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2408.14407},
doi = {10.48550/ARXIV.2408.14407},
eprinttype = {arXiv},
eprint = {2408.14407},
timestamp = {Sat, 28 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2408-14407.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2408-16378,
author = {Min{-}Hsiu Hsieh and
Leandro Mendes and
Michael de Oliveira and
Sathyawageeswar Subramanian},
title = {Unconditionally separating noisy QNC\({}^{\mbox{0}}\) from bounded
polynomial threshold circuits of constant depth},
journal = {CoRR},
volume = {abs/2408.16378},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2408.16378},
doi = {10.48550/ARXIV.2408.16378},
eprinttype = {arXiv},
eprint = {2408.16378},
timestamp = {Sat, 28 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2408-16378.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/arobots/HsiehS23,
author = {M. Ani Hsieh and
Dylan A. Shell},
title = {Editorial},
journal = {Auton. Robots},
volume = {47},
number = {5},
pages = {503--504},
year = {2023},
url = {https://doi.org/10.1007/s10514-023-10119-3},
doi = {10.1007/S10514-023-10119-3},
timestamp = {Tue, 11 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/arobots/HsiehS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/arobots/SalamH23,
author = {Tahiya Salam and
M. Ani Hsieh},
title = {Heterogeneous robot teams for modeling and prediction of multiscale
environmental processes},
journal = {Auton. Robots},
volume = {47},
number = {4},
pages = {353--376},
year = {2023},
url = {https://doi.org/10.1007/s10514-023-10089-6},
doi = {10.1007/S10514-023-10089-6},
timestamp = {Fri, 02 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/arobots/SalamH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/HsiehLZSGK23,
author = {Ping{-}Han Hsieh and
Camila Miranda Lopes{-}Ramos and
Manuela Zucknick and
Geir Kjetil Sandve and
Kimberly Glass and
Marieke L. Kuijjer},
title = {Adjustment of spurious correlations in co-expression measurements
from RNA-Sequencing data},
journal = {Bioinform.},
volume = {39},
number = {10},
year = {2023},
url = {https://doi.org/10.1093/bioinformatics/btad610},
doi = {10.1093/BIOINFORMATICS/BTAD610},
timestamp = {Fri, 22 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/HsiehLZSGK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biosystems/LingCHS23,
author = {Ming{-}Yang Ling and
Lin{-}Jie Chiu and
Ching{-}Chu Hsieh and
Che{-}Chi Shu},
title = {Dimerization induces bimodality in protein number distributions},
journal = {Biosyst.},
volume = {223},
pages = {104812},
year = {2023},
url = {https://doi.org/10.1016/j.biosystems.2022.104812},
doi = {10.1016/J.BIOSYSTEMS.2022.104812},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/biosystems/LingCHS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcmi/ChangYCH23,
author = {Herng{-}Hua Chang and
Shin{-}Joe Yeh and
Ming{-}Chang Chiang and
Sung{-}Tsang Hsieh},
title = {RU-Net: skull stripping in rat brain {MR} images after ischemic stroke
with rat U-Net},
journal = {{BMC} Medical Imaging},
volume = {23},
number = {1},
pages = {44},
year = {2023},
url = {https://doi.org/10.1186/s12880-023-00994-8},
doi = {10.1186/S12880-023-00994-8},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcmi/ChangYCH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cea/ChouCZGHPTCWJ23,
author = {Cheng{-}Ying Chou and
Shan{-}Cheng Chang and
Zi{-}Ping Zhong and
Ming{-}Chi Guo and
Ming{-}Hsien Hsieh and
Jui{-}Chu Peng and
Ling{-}Chieh Tai and
Ping{-}Liang Chung and
Jen{-}Cheng Wang and
Joe{-}Air Jiang},
title = {Development of AIoT System for facility asparagus cultivation},
journal = {Comput. Electron. Agric.},
volume = {206},
pages = {107665},
year = {2023},
url = {https://doi.org/10.1016/j.compag.2023.107665},
doi = {10.1016/J.COMPAG.2023.107665},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cea/ChouCZGHPTCWJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chb/WuRTHHC23,
author = {Jen{-}Her Wu and
Simon Robinson and
Jing{-}Shiang Tsemg and
Yu{-}Ping Hsu and
Ming{-}Che Hsieh and
Yi{-}Cheng Chen},
title = {Digital and physical factors influencing an individual's preventive
behavior during the {COVID-19} pandemic in Taiwan: {A} perspective
based on the {S-O-R} model},
journal = {Comput. Hum. Behav.},
volume = {139},
pages = {107525},
year = {2023},
url = {https://doi.org/10.1016/j.chb.2022.107525},
doi = {10.1016/J.CHB.2022.107525},
timestamp = {Sun, 15 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/chb/WuRTHHC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/debu/RothCWY0HKHZL0023,
author = {Holger R. Roth and
Yan Cheng and
Yuhong Wen and
Isaac Yang and
Ziyue Xu and
Yuan{-}Ting Hsieh and
Kristopher Kersten and
Ahmed Harouni and
Can Zhao and
Kevin Lu and
Zhihong Zhang and
Wenqi Li and
Andriy Myronenko and
Dong Yang and
Sean Yang and
Nicola Rieke and
Abood Quraini and
Chester Chen and
Daguang Xu and
Nic Ma and
Prerna Dogra and
Mona Flores and
Andrew Feng},
title = {{NVIDIA} {FLARE:} Federated Learning from Simulation to Real-World},
journal = {{IEEE} Data Eng. Bull.},
volume = {46},
number = {1},
pages = {170--184},
year = {2023},
url = {http://sites.computer.org/debull/A23mar/p170.pdf},
timestamp = {Tue, 26 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/debu/RothCWY0HKHZL0023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieeemm/HsiehZSH23,
author = {Jui{-}Hung Hsieh and
Zhi{-}Yu Zhang and
Jing{-}Cheng Syu and
Mao{-}Cheng Hsieh},
title = {Bandwidth-Aware High-Efficiency Video Coding Design Scheme on a Multiprocessor
System on Chip},
journal = {{IEEE} Multim.},
volume = {30},
number = {3},
pages = {37--47},
year = {2023},
url = {https://doi.org/10.1109/MMUL.2023.3253521},
doi = {10.1109/MMUL.2023.3253521},
timestamp = {Sat, 14 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieeemm/HsiehZSH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijet/ShiehH23,
author = {Meng{-}Dar Shieh and
Hsin{-}Yin Hsieh},
title = {Using Technology Acceptance Model to Discuss Factors in Distance Learning
Behavior},
journal = {Int. J. Emerg. Technol. Learn.},
volume = {18},
number = {21},
pages = {161--170},
year = {2023},
url = {https://doi.org/10.3991/ijet.v18i21.43919},
doi = {10.3991/IJET.V18I21.43919},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijet/ShiehH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijfs/LiuHHLT23,
author = {Chui{-}Hua Liu and
Sun{-}Weng Huang and
Mei{-}Ting Hsieh and
Chiao{-}Bing Lin and
Gwo{-}Hshiung Tzeng},
title = {Improving the Poverty-Alleviating Effects of Bed and Breakfast Tourism
Using {Z-DEMATEL}},
journal = {Int. J. Fuzzy Syst.},
volume = {25},
number = {5},
pages = {1907--1921},
year = {2023},
url = {https://doi.org/10.1007/s40815-023-01481-6},
doi = {10.1007/S40815-023-01481-6},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijfs/LiuHHLT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijrr/HsiehS23,
author = {M. Ani Hsieh and
Dylan A. Shell},
title = {Selected papers from {RSS2021}},
journal = {Int. J. Robotics Res.},
volume = {42},
number = {10},
pages = {703--704},
year = {2023},
url = {https://doi.org/10.1177/02783649231199044},
doi = {10.1177/02783649231199044},
timestamp = {Fri, 03 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijrr/HsiehS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/intr/ChengMHCCWH23,
author = {Rocky Chung{-}Ngam Cheng and
Xiaohua Men and
J. J. Po{-}An Hsieh and
Zhuo June Cheng and
Xiaocong Cui and
Tiange Wang and
Sheng{-}Hsun Hsu},
title = {The effects of {IT} chargeback on strategic alignment and performance:
the contingent roles of business executives' {IT} competence and CIOs'
business competence},
journal = {Internet Res.},
volume = {33},
number = {1},
pages = {57--83},
year = {2023},
url = {https://doi.org/10.1108/INTR-11-2020-0630},
doi = {10.1108/INTR-11-2020-0630},
timestamp = {Sat, 29 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/intr/ChengMHCCWH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/HungWCXHLH23,
author = {Chih{-}Lung Hung and
Jen{-}Her Wu and
Pei{-}Yu Chen and
Xiaoyu Xu and
Wan{-}Ling Hsu and
Li{-}Min Lin and
Ming{-}Che Hsieh},
title = {Enhancing healthcare services and brand engagement through social
media marketing: Integration of Kotler's 5A framework with {IDEA}
process},
journal = {Inf. Process. Manag.},
volume = {60},
number = {4},
pages = {103379},
year = {2023},
url = {https://doi.org/10.1016/j.ipm.2023.103379},
doi = {10.1016/J.IPM.2023.103379},
timestamp = {Fri, 21 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ipm/HungWCXHLH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/WangZSWWJWZCCHH23,
author = {Jike Wang and
Yundian Zeng and
Huiyong Sun and
Junmei Wang and
Xiaorui Wang and
Ruofan Jin and
Mingyang Wang and
Xujun Zhang and
Dong{-}Sheng Cao and
Xi Chen and
Chang{-}Yu Hsieh and
Tingjun Hou},
title = {Molecular Generation with Reduced Labeling through Constraint Architecture},
journal = {J. Chem. Inf. Model.},
volume = {63},
number = {11},
pages = {3319--3327},
year = {2023},
url = {https://doi.org/10.1021/acs.jcim.3c00579},
doi = {10.1021/ACS.JCIM.3C00579},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/WangZSWWJWZCCHH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmis/PanMH023,
author = {Yang Pan and
Sunil Mithas and
JJ Po{-}An Hsieh and
Che{-}Wei Liu},
title = {Do Risk Preferences Shape the Effect of Online Trading on Trading
Frequency, Volume, and Portfolio Performance?},
journal = {J. Manag. Inf. Syst.},
volume = {40},
number = {2},
pages = {440--469},
year = {2023},
url = {http://www.jmis-web.org/articles/1618},
timestamp = {Wed, 05 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmis/PanMH023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChenHMH23,
author = {Chih{-}Cheng Chen and
Yu{-}Hsiang Huang and
John Carl Joel Salao Marquez and
Chih{-}Cheng Hsieh},
title = {A 12-ENOB Second-Order Noise-Shaping {SAR} {ADC} With PVT-Insensitive
Voltage- Time-Voltage Converter},
journal = {{IEEE} J. Solid State Circuits},
volume = {58},
number = {10},
pages = {2897--2906},
year = {2023},
url = {https://doi.org/10.1109/JSSC.2023.3273311},
doi = {10.1109/JSSC.2023.3273311},
timestamp = {Sun, 11 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChenHMH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HungWHHCSKLLHTC23,
author = {Je{-}Min Hung and
Tai{-}Hao Wen and
Yen{-}Hsiang Huang and
Sheng{-}Po Huang and
Fu{-}Chun Chang and
Chin{-}I Su and
Win{-}San Khwa and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Yu{-}Der Chih and
Tsung{-}Yung Jonathan Chang and
Meng{-}Fan Chang},
title = {8-b Precision 8-Mb ReRAM Compute-in-Memory Macro Using Direct-Current-Free
Time-Domain Readout Scheme for {AI} Edge Devices},
journal = {{IEEE} J. Solid State Circuits},
volume = {58},
number = {1},
pages = {303--315},
year = {2023},
url = {https://doi.org/10.1109/JSSC.2022.3200515},
doi = {10.1109/JSSC.2022.3200515},
timestamp = {Sun, 15 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/HungWHHCSKLLHTC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SuCLLLWCHRPJHCMLSCLWSLLHTC23,
author = {Jian{-}Wei Su and
Yen{-}Chi Chou and
Ruhui Liu and
Ta{-}Wei Liu and
Pei{-}Jung Lu and
Ping{-}Chun Wu and
Yen{-}Lin Chung and
Li{-}Yang Hong and
Jin{-}Sheng Ren and
Tianlong Pan and
Chuan{-}Jia Jhang and
Wei{-}Hsing Huang and
Chih{-}Han Chien and
Peng{-}I Mei and
Sih{-}Han Li and
Shyh{-}Shyuan Sheu and
Shih{-}Chieh Chang and
Wei{-}Chung Lo and
Chih{-}I Wu and
Xin Si and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Meng{-}Fan Chang},
title = {A 8-b-Precision 6T {SRAM} Computing-in-Memory Macro Using Segmented-Bitline
Charge-Sharing Scheme for {AI} Edge Chips},
journal = {{IEEE} J. Solid State Circuits},
volume = {58},
number = {3},
pages = {877--892},
year = {2023},
url = {https://doi.org/10.1109/JSSC.2022.3199077},
doi = {10.1109/JSSC.2022.3199077},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/SuCLLLWCHRPJHCMLSCLWSLLHTC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/natmi/KadambiMHSS23,
author = {Achuta Kadambi and
Celso de Melo and
Cho{-}Jui Hsieh and
Mani B. Srivastava and
Stefano Soatto},
title = {Incorporating physics into data-driven computer vision},
journal = {Nat. Mac. Intell.},
volume = {5},
number = {6},
pages = {572--580},
year = {2023},
url = {https://doi.org/10.1038/s42256-023-00662-0},
doi = {10.1038/S42256-023-00662-0},
timestamp = {Sat, 13 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/natmi/KadambiMHSS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/oir/ChouHP23,
author = {Shih{-}Wei Chou and
Ming{-}Chia Hsieh and
Hui{-}Chun Pan},
title = {Understanding viewers' information-sharing in live-streaming based
on a motivation perspective},
journal = {Online Inf. Rev.},
volume = {47},
number = {1},
pages = {177--196},
year = {2023},
url = {https://doi.org/10.1108/OIR-12-2020-0576},
doi = {10.1108/OIR-12-2020-0576},
timestamp = {Sat, 25 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/oir/ChouHP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmhci/ZadeWJSZHAHS23,
author = {Himanshu Zade and
Megan Woodruff and
Erika Johnson and
Mariah Stanley and
Zhennan Zhou and
Minh Tu Huynh and
Alissa Elizabeth Acheson and
Gary Hsieh and
Kate Starbird},
title = {Tweet Trajectory and AMPS-based Contextual Cues can Help Users Identify
Misinformation},
journal = {Proc. {ACM} Hum. Comput. Interact.},
volume = {7},
number = {{CSCW1}},
pages = {1--27},
year = {2023},
url = {https://doi.org/10.1145/3579536},
doi = {10.1145/3579536},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pacmhci/ZadeWJSZHAHS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmpl/AstorgaHMM23,
author = {Angello Astorga and
Chiao Hsieh and
P. Madhusudan and
Sayan Mitra},
title = {Perception Contracts for Safety of ML-Enabled Systems},
journal = {Proc. {ACM} Program. Lang.},
volume = {7},
number = {{OOPSLA2}},
pages = {2196--2223},
year = {2023},
url = {https://doi.org/10.1145/3622875},
doi = {10.1145/3622875},
timestamp = {Sun, 10 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pacmpl/AstorgaHMM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/TianSDZLZYHWWHLYT23,
author = {Jinkai Tian and
Xiaoyu Sun and
Yuxuan Du and
Shanshan Zhao and
Qing Liu and
Kaining Zhang and
Wei Yi and
Wanrong Huang and
Chaoyue Wang and
Xingyao Wu and
Min{-}Hsiu Hsieh and
Tongliang Liu and
Wenjing Yang and
Dacheng Tao},
title = {Recent Advances for Quantum Neural Networks in Generative Learning},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {45},
number = {10},
pages = {12321--12340},
year = {2023},
url = {https://doi.org/10.1109/TPAMI.2023.3272029},
doi = {10.1109/TPAMI.2023.3272029},
timestamp = {Tue, 21 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pami/TianSDZLZYHWWHLYT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/quantum/SingalCHKGH23,
author = {Tanmay Singal and
Che Chiang and
Eugene Hsu and
Eunsang Kim and
Hsi{-}Sheng Goan and
Min{-}Hsiu Hsieh},
title = {Counting stabiliser codes for arbitrary dimension},
journal = {Quantum},
volume = {7},
pages = {1048},
year = {2023},
url = {https://doi.org/10.22331/q-2023-07-06-1048},
doi = {10.22331/Q-2023-07-06-1048},
timestamp = {Sat, 13 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/quantum/SingalCHKGH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ral/HsiehLWVLLHC23,
author = {Yu{-}Ming Hsieh and
Chin{-}Yi Lin and
Jan Wilch and
Birgit Vogel{-}Heuser and
Yu{-}Chen Lin and
Yu{-}Chuan Lin and
Min{-}Hsiung Hung and
Fan{-}Tien Cheng},
title = {An Intelligent Factory Automation System With Multivariate Time Series
Algorithm for Chip Probing Process},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {8},
number = {9},
pages = {5464--5471},
year = {2023},
url = {https://doi.org/10.1109/LRA.2023.3295237},
doi = {10.1109/LRA.2023.3295237},
timestamp = {Fri, 18 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ral/HsiehLWVLLHC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ral/KamWOSHWKK23,
author = {Michael Kam and
Shuwen Wei and
Justin D. Opfermann and
Hamed Saeidi and
Michael H. Hsieh and
Karen C. Wang and
Jin U. Kang and
Axel Krieger},
title = {Autonomous System for Vaginal Cuff Closure via Model-Based Planning
and Markerless Tracking Techniques},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {8},
number = {7},
pages = {3915--3922},
year = {2023},
url = {https://doi.org/10.1109/LRA.2023.3273416},
doi = {10.1109/LRA.2023.3273416},
timestamp = {Fri, 07 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ral/KamWOSHWKK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ral/WilchVMCFHC23,
author = {Jan Wilch and
Birgit Vogel{-}Heuser and
Jens Mager and
Rostislav Cendel{\'{\i}}n and
Thomas Fett and
Yu{-}Ming Hsieh and
Fan{-}Tien Cheng},
title = {A Distributed Framework for Knowledge-Driven Root-Cause Analysis on
Evolving Alarm Data-An Industrial Case Study},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {8},
number = {6},
pages = {3732--3739},
year = {2023},
url = {https://doi.org/10.1109/LRA.2023.3270822},
doi = {10.1109/LRA.2023.3270822},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ral/WilchVMCFHC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/McCallumWFGHHLMMMPSSV23,
author = {Ian McCallum and
Jon Walker and
Steffen Fritz and
Markus Grau and
Cassie Hannan and
I{-}Sah Hsieh and
Deanna Lape and
Jen Mahone and
Caroline McLester and
Steve Mellgren and
Nolan Piland and
Linda See and
Gerhard Svolba and
Murray de Villiers},
title = {Crowd-Driven Deep Learning Tracks Amazon Deforestation},
journal = {Remote. Sens.},
volume = {15},
number = {21},
pages = {5204},
year = {2023},
url = {https://doi.org/10.3390/rs15215204},
doi = {10.3390/RS15215204},
timestamp = {Fri, 26 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/remotesensing/McCallumWFGHHLMMMPSSV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/SigalinggingPLHAF23,
author = {Xanno Kharis Sigalingging and
Setya Widyawan Prakosa and
Jenq{-}Shiou Leu and
He{-}Yen Hsieh and
Cries Avian and
Muhamad Faisal},
title = {SCANet: Implementation of Selective Context Adaptation Network in
Smart Farming Applications},
journal = {Sensors},
volume = {23},
number = {3},
pages = {1358},
year = {2023},
url = {https://doi.org/10.3390/s23031358},
doi = {10.3390/S23031358},
timestamp = {Sat, 11 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/SigalinggingPLHAF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taffco/PavanSLMSDCHP23,
author = {Matheus Camasmie Pavan and
Vitor Garcia dos Santos and
Alex Gwo Jen Lan and
Jo{\~{a}}o Trevisan Martins and
Wesley Ramos dos Santos and
Caio Deutsch and
Pablo Botton da Costa and
Fernando Chiu Hsieh and
Ivandr{\'{e}} Paraboni},
title = {Morality Classification in Natural Language Text},
journal = {{IEEE} Trans. Affect. Comput.},
volume = {14},
number = {1},
pages = {857--863},
year = {2023},
url = {https://doi.org/10.1109/TAFFC.2020.3034050},
doi = {10.1109/TAFFC.2020.3034050},
timestamp = {Tue, 28 Mar 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taffco/PavanSLMSDCHP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcbb/TuLCSH23,
author = {Deng{-}Yao Tu and
Peng{-}Chan Lin and
Hsin{-}Hung Chou and
Meng{-}Ru Shen and
Sun{-}Yuan Hsieh},
title = {Slice-Fusion: Reducing False Positives in Liver Tumor Detection for
Mask {R-CNN}},
journal = {{IEEE} {ACM} Trans. Comput. Biol. Bioinform.},
volume = {20},
number = {5},
pages = {3267--3277},
year = {2023},
url = {https://doi.org/10.1109/TCBB.2023.3265394},
doi = {10.1109/TCBB.2023.3265394},
timestamp = {Fri, 27 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcbb/TuLCSH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcbb/WuLCSH23,
author = {Tzu{-}Hsuan Wu and
Peng{-}Chan Lin and
Hsin{-}Hung Chou and
Meng{-}Ru Shen and
Sun{-}Yuan Hsieh},
title = {Pathogenicity Prediction of Single Amino Acid Variants With Machine
Learning Model Based on Protein Structural Energies},
journal = {{IEEE} {ACM} Trans. Comput. Biol. Bioinform.},
volume = {20},
number = {1},
pages = {606--615},
year = {2023},
url = {https://doi.org/10.1109/TCBB.2021.3139048},
doi = {10.1109/TCBB.2021.3139048},
timestamp = {Mon, 03 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcbb/WuLCSH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/RenHMWL23,
author = {Xiaojing Ren and
Chao{-}Mao Hsieh and
Mohammad O. A. Malik and
Joshua Su Weiming and
Quan Liu},
title = {A Radio Frequency Tagging Continuous-Wave Optical Spectrometer With
Megahertz Refreshing Rate},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {72},
pages = {1--8},
year = {2023},
url = {https://doi.org/10.1109/TIM.2022.3227992},
doi = {10.1109/TIM.2022.3227992},
timestamp = {Tue, 31 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tim/RenHMWL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aicas/KuZHLC23,
author = {Ming{-}Yueh Ku and
Tai{-}Siang Zhong and
Yi{-}Ting Hsieh and
Shuenn{-}Yuh Lee and
Ju{-}Yi Chen},
title = {A High Performance Accelerating {CNN} Inference on {FPGA} with Arrhythmia
Classification},
booktitle = {5th {IEEE} International Conference on Artificial Intelligence Circuits
and Systems, {AICAS} 2023, Hangzhou, China, June 11-13, 2023},
pages = {1--4},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/AICAS57966.2023.10168615},
doi = {10.1109/AICAS57966.2023.10168615},
timestamp = {Mon, 24 Jul 2023 15:56:17 +0200},
biburl = {https://dblp.org/rec/conf/aicas/KuZHLC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmvc/Hsieh0D023,
author = {Yu{-}Cheng Hsieh and
Cheng Sun and
Suraj Dengale and
Min Sun},
title = {PanoMixSwap - Panorama Mixing via Structural Swapping for Indoor Scene
Understanding},
booktitle = {34th British Machine Vision Conference 2023, {BMVC} 2023, Aberdeen,
UK, November 20-24, 2023},
pages = {226--228},
publisher = {{BMVA} Press},
year = {2023},
url = {http://proceedings.bmvc2023.org/226/},
timestamp = {Mon, 11 Mar 2024 15:42:29 +0100},
biburl = {https://dblp.org/rec/conf/bmvc/Hsieh0D023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmvc/LinHWW023,
author = {Ting{-}Ying Lin and
Lin{-}Yung Hsieh and
Fu{-}En Wang and
Wen{-}Shen Wuen and
Min Sun},
title = {Sparse and Privacy-enhanced Representation for Human Pose Estimation},
booktitle = {34th British Machine Vision Conference 2023, {BMVC} 2023, Aberdeen,
UK, November 20-24, 2023},
pages = {143},
publisher = {{BMVA} Press},
year = {2023},
url = {http://proceedings.bmvc2023.org/143/},
timestamp = {Tue, 16 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bmvc/LinHWW023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/ChenCMHP23,
author = {Shaoru Chen and
Kong Yao Chee and
Nikolai Matni and
M. Ani Hsieh and
George J. Pappas},
title = {Safety Filter Design for Neural Network Systems via Convex Optimization},
booktitle = {62nd {IEEE} Conference on Decision and Control, {CDC} 2023, Singapore,
December 13-15, 2023},
pages = {6356--6363},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CDC49753.2023.10383577},
doi = {10.1109/CDC49753.2023.10383577},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cdc/ChenCMHP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/SilvaH23,
author = {Thales C. Silva and
M. Ani Hsieh},
title = {Local Input-to-State Stability for Consensus in the Presence of Intermittent
Communication and Input Saturation},
booktitle = {62nd {IEEE} Conference on Decision and Control, {CDC} 2023, Singapore,
December 13-15, 2023},
pages = {7420--7426},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CDC49753.2023.10383364},
doi = {10.1109/CDC49753.2023.10383364},
timestamp = {Mon, 29 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cdc/SilvaH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cocoon/TsaiHH23,
author = {Meng{-}Shiou Tsai and
Sun{-}Yuan Hsieh and
Ling{-}Ju Hung},
editor = {Weili Wu and
Guangmo Tong},
title = {Hardness and Approximation for the Star {\(\beta\)}-Hub Routing Cost
Problem in {\textdollar}{\textbackslash}varDelta {\_}{\textbackslash}beta
{\textdollar}-Metric Graphs},
booktitle = {Computing and Combinatorics - 29th International Conference, {COCOON}
2023, Hawaii, HI, USA, December 15-17, 2023, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {14422},
pages = {97--111},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-49190-0\_7},
doi = {10.1007/978-3-031-49190-0\_7},
timestamp = {Thu, 04 Jan 2024 08:13:45 +0100},
biburl = {https://dblp.org/rec/conf/cocoon/TsaiHH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csee/ShauLHLM23,
author = {An{-}Chi Shau and
Yan{-}Cih Liang and
Wan{-}Jung Hsieh and
Xiang{-}Ling Lin and
Shang{-}Pin Ma},
title = {PSAbot: {A} Chatbot System for the Analysis of Posts on Stack Overflow},
booktitle = {35th International Conference on Software Engineering Education and
Training, CSEE{\&}T 2023, Tokyo, Japan, August 7-9, 2023},
pages = {137--141},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CSEET58097.2023.00029},
doi = {10.1109/CSEET58097.2023.00029},
timestamp = {Wed, 13 Sep 2023 08:43:31 +0200},
biburl = {https://dblp.org/rec/conf/csee/ShauLHLM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/AncutiAVTZDLCLLLWCDLQHLWJLYJBAKYCCHCHC23,
author = {Codruta O. Ancuti and
Cosmin Ancuti and
Florin{-}Alexandru Vasluianu and
Radu Timofte and
Han Zhou and
Wei Dong and
Yangyi Liu and
Jun Chen and
Huan Liu and
Liangyan Li and
Zijun Wu and
Yubo Dong and
Yuyan Li and
Tian Qiu and
Yu He and
Yonghong Lu and
Yinwei Wu and
Zhenxiang Jiang and
Songhua Liu and
Xingyi Yang and
Yongcheng Jing and
Bilel Benjdira and
Anas M. Ali and
Anis Koubaa and
Hao{-}Hsiang Yang and
I{-}Hsiang Chen and
Wei{-}Ting Chen and
Zhi{-}Kai Huang and
Yi{-}Chung Chen and
Chia{-}Hsuan Hsieh and
Hua{-}En Chang and
Yuan{-}Chun Chiang and
Sy{-}Yen Kuo and
Yu Guo and
Yuan Gao and
Ryan Wen Liu and
Yuxu Lu and
Jingxiang Qu and
Shengfeng He and
Wenqi Ren and
Trung Hoang and
Haichuan Zhang and
Amirsaeed Yazdani and
Vishal Monga and
Lehan Yang and
Alex Jiahao Wu and
Tiancheng Mai and
Xiaofeng Cong and
Xuemeng Yin and
Xuefei Yin and
Hazim Emad and
Ahmed Abdallah and
Yahya Yasser and
Dalia Elshahat and
Esraa Elbaz and
Zhan Li and
Wenqing Kuang and
Ziwei Luo and
Fredrik K. Gustafsson and
Zheng Zhao and
Jens Sj{\"{o}}lund and
Thomas B. Sch{\"{o}}n and
Zhao Zhang and
Yanyan Wei and
Junhu Wang and
Suiyi Zhao and
Huan Zheng and
Jin Guo and
Yangfan Sun and
Tianli Liu and
Dejun Hao and
Kui Jiang and
Anjali Sarvaiya and
Kalpesh Prajapati and
Ratnadeep Patra and
Pragnesh Barik and
Chaitanya Rathod and
Kishor P. Upla and
Kiran B. Raja and
Raghavendra Ramachandra and
Christoph Busch},
title = {{NTIRE} 2023 {HR} NonHomogeneous Dehazing Challenge Report},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023 - Workshops, Vancouver, BC, Canada, June 17-24, 2023},
pages = {1808--1825},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPRW59228.2023.00180},
doi = {10.1109/CVPRW59228.2023.00180},
timestamp = {Thu, 08 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/AncutiAVTZDLCLLLWCDLQHLWJLYJBAKYCCHCHC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/CaoMYWZZDLSTSLZSCMCZCXLBSHZAHWYZZLCRZW23,
author = {Mingdeng Cao and
Chong Mou and
Fanghua Yu and
Xintao Wang and
Yinqiang Zheng and
Jian Zhang and
Chao Dong and
Gen Li and
Ying Shan and
Radu Timofte and
Xiaopeng Sun and
Weiqi Li and
Zhenyu Zhang and
Xuhan Sheng and
Bin Chen and
Haoyu Ma and
Ming Cheng and
Shijie Zhao and
Wanwan Cui and
Tianyu Xu and
Chunyang Li and
Long Bao and
Heng Sun and
Huaibo Huang and
Xiaoqiang Zhou and
Yuang Ai and
Ran He and
Renlong Wu and
Yi Yang and
Zhilu Zhang and
Shuohao Zhang and
Junyi Li and
Yunjin Chen and
Dongwei Ren and
Wangmeng Zuo and
Qian Wang and
Hao{-}Hsiang Yang and
Yi{-}Chung Chen and
Zhi{-}Kai Huang and
Wei{-}Ting Chen and
Yuan{-}Chun Chiang and
Hua{-}En Chang and
I{-}Hsiang Chen and
Chia{-}Hsuan Hsieh and
Sy{-}Yen Kuo and
Zebin Zhang and
Jiaqi Zhang and
Yuhui Wang and
Shuhao Cui and
Junshi Huang and
Li Zhu and
Shuman Tian and
Wei Yu and
Bingchun Luo},
title = {{NTIRE} 2023 Challenge on 360{\textdegree} Omnidirectional Image and
Video Super-Resolution: Datasets, Methods and Results},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023 - Workshops, Vancouver, BC, Canada, June 17-24, 2023},
pages = {1731--1745},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPRW59228.2023.00174},
doi = {10.1109/CVPRW59228.2023.00174},
timestamp = {Wed, 18 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/CaoMYWZZDLSTSLZSCMCZCXLBSHZAHWYZZLCRZW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/CondeZTMLZPLGZCLHYZLSKBPDTABLZFSSLGLYX23,
author = {Marcos V. Conde and
Eduard Zamfir and
Radu Timofte and
Daniel Motilla and
Cen Liu and
Zexin Zhang and
Yunbo Peng and
Yue Lin and
Jiaming Guo and
Xueyi Zou and
Yuyi Chen and
Yi Liu and
Jia Hao and
Youliang Yan and
Yuanfan Zhang and
Gen Li and
Lei Sun and
Lingshun Kong and
Haoran Bai and
Jinshan Pan and
Jiangxin Dong and
Jinhui Tang and
Mustafa Ayazoglu and
Bahri Batuhan Bilecen and
Mingxi Li and
Yuhang Zhang and
Xianjun Fan and
Yankai Sheng and
Long Sun and
Zibin Liu and
Weiran Gou and
Shaoqing Li and
Ziyao Yi and
Yan Xiang and
Dehui Kong and
Ke Xu and
Ganzorig Gankhuyag and
Kihwan Yoon and
Jin Zhang and
Gaocheng Yu and
Feng Zhang and
Hongbin Wang and
Zhou Zhou and
Jiahao Chao and
Hongfan Gao and
Jiali Gong and
Zhengfeng Yang and
Zhenbing Zeng and
Chengpeng Chen and
Zichao Guo and
Anjin Park and
Yuqing Liu and
Qi Jia and
Hongyuan Yu and
Xuanwu Yin and
Dongyang Zhang and
Ting Fu and
Zhengxue Cheng and
Shiai Zhu and
Dajiang Zhou and
Weichen Yu and
Lin Ge and
Jiahua Dong and
Yajun Zou and
Zhuoyuan Wu and
Binnan Han and
Xiaolin Zhang and
Heng Zhang and
Ben Shao and
Shaolong Zheng and
Daheng Yin and
Baijun Chen and
Mengyang Liu and
Marian{-}Sergiu Nistor and
Yi{-}Chung Chen and
Zhi{-}Kai Huang and
Yuan{-}Chun Chiang and
Wei{-}Ting Chen and
Hao{-}Hsiang Yang and
Hua{-}En Chang and
I{-}Hsiang Chen and
Chia{-}Hsuan Hsieh and
Sy{-}Yen Kuo and
Tu Vo and
Qingsen Yan and
Yun Zhu and
Jinqiu Su and
Yanning Zhang and
Cheng Zhang and
Jiaying Luo and
Youngsun Cho and
Nakyung Lee and
Kunlong Zuo},
title = {Efficient Deep Models for Real-Time 4K Image Super-Resolution. {NTIRE}
2023 Benchmark and Report},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023 - Workshops, Vancouver, BC, Canada, June 17-24, 2023},
pages = {1495--1521},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPRW59228.2023.00154},
doi = {10.1109/CVPRW59228.2023.00154},
timestamp = {Wed, 14 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/CondeZTMLZPLGZCLHYZLSKBPDTABLZFSSLGLYX23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/GochooOGHCCDJBAAL23,
author = {Munkhjargal Gochoo and
Munkh{-}Erdene Otgonbold and
Erkhembayar Ganbold and
Jun{-}Wei Hsieh and
Ming{-}Ching Chang and
Ping{-}Yang Chen and
Byambaa Dorj and
Hamad Al Jassmi and
Ganzorig Batnasan and
Fady Alnajjar and
Mohammed Abduljabbar and
Fang{-}Pang Lin},
title = {FishEye8K: {A} Benchmark and Dataset for Fisheye Camera Object Detection},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023 - Workshops, Vancouver, BC, Canada, June 17-24, 2023},
pages = {5305--5313},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPRW59228.2023.00559},
doi = {10.1109/CVPRW59228.2023.00559},
timestamp = {Wed, 23 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/GochooOGHCCDJBAAL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/LiZTGYLLJWHLJLFLWCLZFSMZWZSPDTYWPCDZKV23,
author = {Yawei Li and
Yulun Zhang and
Radu Timofte and
Luc Van Gool and
Lei Yu and
Youwei Li and
Xinpeng Li and
Ting Jiang and
Qi Wu and
Mingyan Han and
Wenjie Lin and
Chengzhi Jiang and
Jinting Luo and
Haoqiang Fan and
Shuaicheng Liu and
Yucong Wang and
Minjie Cai and
Mingxi Li and
Yuhang Zhang and
Xianjun Fan and
Yankai Sheng and
Yanyu Mao and
Nihao Zhang and
Qian Wang and
Mingjun Zheng and
Long Sun and
Jinshan Pan and
Jiangxin Dong and
Jinhui Tang and
Zhongbao Yang and
Yan Wang and
Erlin Pan and
Qixuan Cai and
Xinan Dai and
Magauiya Zhussip and
Nikolay Kalyazin and
Dmitry Vyal and
Xueyi Zou and
Youliang Yan and
Heaseo Chung and
Jin Zhang and
Gaocheng Yu and
Feng Zhang and
Hongbin Wang and
Bohao Liao and
Zhibo Du and
Yu{-}Liang Wu and
Gege Shi and
Long Peng and
Yang Wang and
Yang Cao and
Zhengjun Zha and
Zhi{-}Kai Huang and
Yi{-}Chung Chen and
Yuan{-}Chun Chiang and
Hao{-}Hsiang Yang and
Wei{-}Ting Chen and
Hua{-}En Chang and
I{-}Hsiang Chen and
Chia{-}Hsuan Hsieh and
Sy{-}Yen Kuo and
Xin Liu and
Jiahao Pan and
Hongyuan Yu and
Weichen Yu and
Lin Ge and
Jiahua Dong and
Yajun Zou and
Zhuoyuan Wu and
Binnan Han and
Xiaolin Zhang and
Heng Zhang and
Xuanwu Yin and
Kunlong Zuo and
Weijian Deng and
Hongjie Yuan and
Zengtong Lu and
Mingyu Ouyang and
Wenzhuo Ma and
Nian Liu and
Hanyou Zheng and
Yuantong Zhang and
Junxi Zhang and
Zhenzhong Chen and
Garas Gendy and
Nabil Sabor and
Jingchao Hou and
Guanghui He and
Yurui Zhu and
Xi Wang and
Xueyang Fu and
Zheng{-}Jun Zha and
Daheng Yin and
Mengyang Liu and
Baijun Chen and
Ao Li and
Lei Luo and
Kangjun Jin and
Ce Zhu and
Xiaoming Zhang and
Chengxing Xie and
Linze Li and
Haiteng Meng and
Tianlin Zhang and
Tianrui Li and
Xiaole Zhao and
Zhao Zhang and
Baiang Li and
Huan Zheng and
Suiyi Zhao and
Yangcheng Gao and
Jiahuan Ren and
Kang Hu and
Jingpeng Shi and
Zhijian Wu and
Dingjiang Huang and
Jinchen Zhu and
Hui Li and
Qianru Xv and
Tianle Liu and
Gang Wu and
Junpeng Jiang and
Xianming Liu and
Junjun Jiang and
Mingjian Zhang and
Shizhuang Weng and
Jing Hu and
Chengxu Wu and
Qinrui Fan and
Chengming Feng and
Ziwei Luo and
Shu Hu and
Siwei Lyu and
Xi Wu and
Xin Wang},
title = {{NTIRE} 2023 Challenge on Efficient Super-Resolution: Methods and
Results},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023 - Workshops, Vancouver, BC, Canada, June 17-24, 2023},
pages = {1922--1960},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPRW59228.2023.00189},
doi = {10.1109/CVPRW59228.2023.00189},
timestamp = {Fri, 06 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/LiZTGYLLJWHLJLFLWCLZFSMZWZSPDTYWPCDZKV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ShutovaEPEBTCETZRBBSLWWLFSWWLXZWGSLDKO23,
author = {Alina Shutova and
Egor I. Ershov and
Georgy Perevozchikov and
Ivan Ermakov and
Nikola Banic and
Radu Timofte and
Richard Collins and
Maria Efimova and
Arseniy P. Terekhin and
Simone Zini and
Claudio Rota and
Marco Buzzelli and
Simone Bianco and
Raimondo Schettini and
Chunxia Lei and
Tingniao Wang and
Song Wang and
Shuai Liu and
Chaoyu Feng and
Guangqi Shao and
Hao Wang and
Xiaotao Wang and
Lei Lei and
Lu Xu and
Chao Zhang and
Yasi Wang and
Jin Guo and
Yangfan Sun and
Tianli Liu and
Hao Dejun and
Furkan Kinli and
Baris {\"{O}}zcan and
Furkan Kira{\c{c}} and
Hyerin Chung and
Nakyung Lee and
Sungkeun Kwak and
Marcos V. Conde and
Tim Seizinger and
Florin{-}Alexandru Vasluianu and
Omar Elezabi and
Chia{-}Hsuan Hsieh and
Wei{-}Ting Chen and
Hao{-}Hsiang Yang and
Zhi{-}Kai Huang and
Hua{-}En Chang and
I{-}Hsiang Chen and
Yi{-}Chung Chen and
Yuan{-}Chun Chiang},
title = {{NTIRE} 2023 Challenge on Night Photography Rendering},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023 - Workshops, Vancouver, BC, Canada, June 17-24, 2023},
pages = {1982--1993},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPRW59228.2023.00192},
doi = {10.1109/CVPRW59228.2023.00192},
timestamp = {Wed, 31 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/ShutovaEPEBTCETZRBBSLWWLFSWWLXZWGSLDKO23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/VasluianuSTCHTFZZWWLGZSSDZLLYOLRLJHWLY23,
author = {Florin{-}Alexandru Vasluianu and
Tim Seizinger and
Radu Timofte and
Shuhao Cui and
Junshi Huang and
Shuman Tian and
Mingyuan Fan and
Jiaqi Zhang and
Li Zhu and
Xiaoming Wei and
Xiaolin Wei and
Ziwei Luo and
Fredrik K. Gustafsson and
Zheng Zhao and
Jens Sj{\"{o}}lund and
Thomas B. Sch{\"{o}}n and
Xiaoyi Dong and
Xi Sheryl Zhang and
Chenghua Li and
Cong Leng and
Woon{-}Ha Yeo and
Wang{-}Taek Oh and
Yeoreum Lee and
Han{-}Cheol Ryu and
Jinting Luo and
Chengzhi Jiang and
Mingyan Han and
Qi Wu and
Wenjie Lin and
Lei Yu and
Xinpeng Li and
Ting Jiang and
Haoqiang Fan and
Shuaicheng Liu and
Shuning Xu and
Binbin Song and
Xiangyu Chen and
Shile Zhang and
Jiantao Zhou and
Zhao Zhang and
Suiyi Zhao and
Huan Zheng and
Yangcheng Gao and
Yanyan Wei and
Bo Wang and
Jiahuan Ren and
Yan Luo and
Yuki Kondo and
Riku Miyata and
Fuma Yasue and
Taito Naruki and
Norimichi Ukita and
Hua{-}En Chang and
Hao{-}Hsiang Yang and
Yi{-}Chung Chen and
Yuan{-}Chun Chiang and
Zhi{-}Kai Huang and
Wei{-}Ting Chen and
I{-}Hsiang Chen and
Chia{-}Hsuan Hsieh and
Sy{-}Yen Kuo and
Li Xianwei and
Huiyuan Fu and
Chunlin Liu and
Huadong Ma and
Binglan Fu and
Huiming He and
Mengjia Wang and
Wenxuan She and
Yu Liu and
Sabari Nathan and
Priya Kansal and
Zhongjian Zhang and
Huabin Yang and
Yan Wang and
Yanru Zhang and
Shruti S. Phutke and
Ashutosh Kulkarni and
Md Raqib Khan and
Subrahmanyam Murala and
Santosh Kumar Vipparthi and
Heng Ye and
Zixi Liu and
Xingyi Yang and
Songhua Liu and
Yinwei Wu and
Yongcheng Jing and
Qianhao Yu and
Naishan Zheng and
Jie Huang and
Yuhang Long and
Mingde Yao and
Feng Zhao and
Bowen Zhao and
Nan Ye and
Ning Shen and
Yanpeng Cao and
Tong Xiong and
Weiran Xia and
Dingwen Li and
Shuchen Xia},
title = {{NTIRE} 2023 Image Shadow Removal Challenge Report},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023 - Workshops, Vancouver, BC, Canada, June 17-24, 2023},
pages = {1788--1807},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPRW59228.2023.00179},
doi = {10.1109/CVPRW59228.2023.00179},
timestamp = {Mon, 26 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/VasluianuSTCHTFZZWWLGZSSDZLLYOLRLJHWLY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/WangCHHCHTYT23,
author = {Bor{-}Shiun Wang and
Ping{-}Yang Chen and
Yi{-}Kuan Hsieh and
Jun{-}Wei Hsieh and
Ming{-}Ching Chang and
JiaXin He and
Shin{-}You Teng and
HaoYuan Yue and
Yu{-}Chee Tseng},
title = {{PRB-FPN+:} Video Analytics for Enforcing Motorcycle Helmet Laws},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023 - Workshops, Vancouver, BC, Canada, June 17-24, 2023},
pages = {5477--5485},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPRW59228.2023.00579},
doi = {10.1109/CVPRW59228.2023.00579},
timestamp = {Wed, 23 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/WangCHHCHTYT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ZhangZCLTZZPMJHZAHQZLLZZLWLKKKYLLLCCHC23,
author = {Yulun Zhang and
Kai Zhang and
Zheng Chen and
Yawei Li and
Radu Timofte and
Junpei Zhang and
Kexin Zhang and
Rui Peng and
Yanbiao Ma and
Licheng Jia and
Huaibo Huang and
Xiaoqiang Zhou and
Yuang Ai and
Ran He and
Yajun Qiu and
Qiang Zhu and
Pengfei Li and
Qianhui Li and
Shuyuan Zhu and
Dafeng Zhang and
Jia Li and
Fan Wang and
Chunmiao Li and
TaeHyung Kim and
Jungkeong Kil and
Eon Kim and
Yeonseung Yu and
Beomyeol Lee and
Subin Lee and
Seokjae Lim and
Somi Chae and
Heungjun Choi and
Zhi{-}Kai Huang and
YiChung Chen and
Yuan{-}Chun Chiang and
Hao{-}Hsiang Yang and
Wei{-}Ting Chen and
Hua{-}En Chang and
I{-}Hsiang Chen and
Chia{-}Hsuan Hsieh and
Sy{-}Yen Kuo and
Ui{-}Jin Choi and
Marcos V. Conde and
Sunder Ali Khowaja and
Jiseok Yoon and
Ik Hyun Lee and
Garas Gendy and
Nabil Sabor and
Jingchao Hou and
Guanghui He and
Zhao Zhang and
Baiang Li and
Huan Zheng and
Suiyi Zhao and
Yangcheng Gao and
Yanyan Wei and
Jiahuan Ren and
Jiayu Wei and
Yanfeng Li and
Jia Sun and
Zhanyi Cheng and
Zhiyuan Li and
Xu Yao and
Xinyi Wang and
Danxu Li and
Xuan Cui and
Jun Cao and
Cheng Li and
Jianbin Zheng and
Anjali Sarvaiya and
Kalpesh Prajapati and
Ratnadeep Patra and
Pragnesh Barik and
Chaitanya Rathod and
Kishor P. Upla and
Kiran B. Raja and
Raghavendra Ramachandra and
Christoph Busch},
title = {{NTIRE} 2023 Challenge on Image Super-Resolution ({\texttimes}4):
Methods and Results},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2023 - Workshops, Vancouver, BC, Canada, June 17-24, 2023},
pages = {1865--1884},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CVPRW59228.2023.00185},
doi = {10.1109/CVPRW59228.2023.00185},
timestamp = {Fri, 06 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/ZhangZCLTZZPMJHZAHQZLLZZLWLKKKYLLLCCHC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cw/TanLLHSC23,
author = {Joanne Tan and
Wei Lun Lim and
Ruilin Li and
Meng{-}Hsueh Hsieh and
Olga Sourina and
Chun{-}Hsien Chen},
editor = {Najoua Essoukri Ben Amara and
Alexei Sourin and
Olga Sourina and
Christophe Rosenberger},
title = {Heart Rate Based Cross-subject Stress Recognition},
booktitle = {International Conference on Cyberworlds, {CW} 2023, Sousse, Tunisia,
October 3-5, 2023},
pages = {329--332},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/CW58918.2023.00057},
doi = {10.1109/CW58918.2023.00057},
timestamp = {Wed, 13 Dec 2023 14:38:50 +0100},
biburl = {https://dblp.org/rec/conf/cw/TanLLHSC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/ChangYCH23,
author = {Herng{-}Hua Chang and
Shin{-}Joe Yeh and
Ming{-}Chang Chiang and
Sung{-}Tsang Hsieh},
title = {Automated Stroke Lesion Segmentation in Rat Brain {MR} Images Using
an Encoder-Decoder Framework},
booktitle = {45th Annual International Conference of the {IEEE} Engineering in
Medicine {\&} Biology Society, {EMBC} 2023, Sydney, Australia,
July 24-27, 2023},
pages = {1--4},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/EMBC40787.2023.10340278},
doi = {10.1109/EMBC40787.2023.10340278},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/embc/ChangYCH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/ChuYHACT23,
author = {Slo{-}Li Chu and
Hideo Yokota and
Hao{-}Lun Hsieh and
Kuniya Abe and
Dooseon Cho and
Ming{-}Dar Tsai},
title = {Quantitative Analysis of Differentiation Activity for Mouse Embryonic
Stem Cells by Deep Learning for Cell Center Detection using Three-Dimensional
Confocal Fluorescence Microscopy Images},
booktitle = {45th Annual International Conference of the {IEEE} Engineering in
Medicine {\&} Biology Society, {EMBC} 2023, Sydney, Australia,
July 24-27, 2023},
pages = {1--4},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/EMBC40787.2023.10340148},
doi = {10.1109/EMBC40787.2023.10340148},
timestamp = {Thu, 11 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/embc/ChuYHACT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hotnets/ManiHSECAABK23,
author = {Sathiya Kumaran Mani and
Kevin Hsieh and
Santiago Segarra and
Trevor Eberl and
Ranveer Chandra and
Eliran Azulai and
Narayan Annamalai and
Deepak Bansal and
Srikanth Kandula},
title = {Securing Public Clouds using Dynamic Communication Graphs},
booktitle = {Proceedings of the 22nd {ACM} Workshop on Hot Topics in Networks,
HotNets 2023, Cambridge, MA, USA, November 28-29, 2023},
pages = {272--279},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3626111.3628198},
doi = {10.1145/3626111.3628198},
timestamp = {Tue, 28 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hotnets/ManiHSECAABK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hotnets/ManiZHSEAFCK23,
author = {Sathiya Kumaran Mani and
Yajie Zhou and
Kevin Hsieh and
Santiago Segarra and
Trevor Eberl and
Eliran Azulai and
Ido Frizler and
Ranveer Chandra and
Srikanth Kandula},
title = {Enhancing Network Management Using Code Generated by Large Language
Models},
booktitle = {Proceedings of the 22nd {ACM} Workshop on Hot Topics in Networks,
HotNets 2023, Cambridge, MA, USA, November 28-29, 2023},
pages = {196--204},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3626111.3628183},
doi = {10.1145/3626111.3628183},
timestamp = {Tue, 28 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hotnets/ManiZHSEAFCK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ialp/WattyKH23,
author = {Deborah Watty and
Micah Kitsunai and
Shu{-}Kai Hsieh},
editor = {Lei Wang and
Yanfeng Lu and
Minghui Dong},
title = {Prompt-Based Translation of Chinese into Taiwanese Mandarin Braille},
booktitle = {International Conference on Asian Language Processing, {IALP} 2023,
Singapore, November 18-20, 2023},
pages = {56--61},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/IALP61005.2023.10337277},
doi = {10.1109/IALP61005.2023.10337277},
timestamp = {Wed, 17 Jan 2024 17:11:26 +0100},
biburl = {https://dblp.org/rec/conf/ialp/WattyKH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icbsp/LiaoHCLT023,
author = {Hung{-}Ju Liao and
Ya{-}Chu Hsieh and
Shih{-}Wen Chiu and
Meng{-}Rui Lee and
Kea{-}Tiong Tang and
Min Sun},
title = {Shared Embedding of X-ray {\&} Enose Networks for Lung Cancer
Classification},
booktitle = {Proceedings of the 2023 8th International Conference on Biomedical
Imaging, Signal Processing, {ICBSP} 2023, Singapore, Singapore, October
20-22, 2023},
pages = {9--16},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3634875.3634877},
doi = {10.1145/3634875.3634877},
timestamp = {Sat, 10 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icbsp/LiaoHCLT023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/ChungCHLHHC23,
author = {Ming{-}An Chung and
Sung{-}Yun Chai and
Ming{-}Chun Hsieh and
Chia{-}Wei Lin and
Chia{-}Chun Hsu and
Shang{-}Jui Huang and
Kai{-}Xiang Chen},
title = {A Fusion Algorithm Using Camera and {FMCW} Radar for Emotion Recognition},
booktitle = {International Conference on Consumer Electronics - Taiwan, ICCE-Taiwan
2023, PingTung, Taiwan, July 17-19, 2023},
pages = {715--716},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCE-Taiwan58799.2023.10226903},
doi = {10.1109/ICCE-TAIWAN58799.2023.10226903},
timestamp = {Fri, 08 Sep 2023 15:28:17 +0200},
biburl = {https://dblp.org/rec/conf/icce-tw/ChungCHLHHC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/JuangWSSH23,
author = {Wen{-}Ho Juang and
Meng{-}Chang Wu and
Yung{-}Hoh Sheu and
Jen{-}Yu Shieh and
Tung{-}Hsien Hsieh},
title = {A Cost-efficient Hardware Accelerator Design for 2D Sliding Discrete
Fourier Transform},
booktitle = {International Conference on Consumer Electronics - Taiwan, ICCE-Taiwan
2023, PingTung, Taiwan, July 17-19, 2023},
pages = {595--596},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCE-Taiwan58799.2023.10227037},
doi = {10.1109/ICCE-TAIWAN58799.2023.10227037},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icce-tw/JuangWSSH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/LeeHT23,
author = {Hsiang{-}Wen Lee and
Shu{-}Lin Hsieh and
Ming{-}Fong Tsai},
title = {Action Recognition with Multiple People Using Long Short-term Memory},
booktitle = {International Conference on Consumer Electronics - Taiwan, ICCE-Taiwan
2023, PingTung, Taiwan, July 17-19, 2023},
pages = {127--128},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICCE-Taiwan58799.2023.10226656},
doi = {10.1109/ICCE-TAIWAN58799.2023.10226656},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icce-tw/LeeHT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icebe/TsaiMWZWKCHHHLS23,
author = {Kuen{-}Yu Tsai and
Guang{-}Yun Meng and
Tung{-}Ling Wu and
Ming{-}Hui Zheng and
Wei{-}Yao Wang and
Chih{-}Ming Kung and
Yen{-}Chuan Chen and
Chi{-}Fa Huang and
Tsang{-}Chieh Hsieh and
Hsin{-}Sheng Hsu and
Huei{-}Der Lin and
Jing{-}Xiang Shi},
title = {eVTOL, UAM, and {AAM:} Brief Development History and Implementation
Outlook of the United States},
booktitle = {{IEEE} International Conference on e-Business Engineering, {ICEBE}
2023, Sydney, Australia, November 4-6, 2023},
pages = {287--296},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ICEBE59045.2023.00053},
doi = {10.1109/ICEBE59045.2023.00053},
timestamp = {Mon, 22 Jan 2024 20:34:14 +0100},
biburl = {https://dblp.org/rec/conf/icebe/TsaiMWZWKCHHHLS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/ZengS0KLHJ23,
author = {Yi Zeng and
Zhouxing Shi and
Ming Jin and
Feiyang Kang and
Lingjuan Lyu and
Cho{-}Jui Hsieh and
Ruoxi Jia},
title = {Towards Robustness Certification Against Universal Perturbations},
booktitle = {The Eleventh International Conference on Learning Representations,
{ICLR} 2023, Kigali, Rwanda, May 1-5, 2023},
publisher = {OpenReview.net},
year = {2023},
url = {https://openreview.net/forum?id=7GEvPKxjtt},
timestamp = {Wed, 24 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/ZengS0KLHJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/CheeSHP23,
author = {Kong Yao Chee and
Thales C. Silva and
M. Ani Hsieh and
George J. Pappas},
title = {Enhancing Sample Efficiency and Uncertainty Compensation in Learning-Based
Model Predictive Control for Aerial Robots},
booktitle = {{IROS}},
pages = {9435--9441},
year = {2023},
url = {https://doi.org/10.1109/IROS55552.2023.10341774},
doi = {10.1109/IROS55552.2023.10341774},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iros/CheeSHP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/EdwardsSMDH23,
author = {Victoria M. Edwards and
Thales C. Silva and
Bharg Mehta and
Jasleen Dhanoa and
M. Ani Hsieh},
title = {On Collaborative Robot Teams for Environmental Monitoring: {A} Macroscopic
Ensemble Approach},
booktitle = {{IROS}},
pages = {11148--11153},
year = {2023},
url = {https://doi.org/10.1109/IROS55552.2023.10342495},
doi = {10.1109/IROS55552.2023.10342495},
timestamp = {Wed, 17 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iros/EdwardsSMDH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isaac/KuoCFHTK23,
author = {Ting{-}Yu Kuo and
Yu{-}Han Chen and
Andrea Frosini and
Sun{-}Yuan Hsieh and
Shi{-}Chun Tsai and
Mong{-}Jen Kao},
editor = {Satoru Iwata and
Naonori Kakimura},
title = {On Min-Max Graph Balancing with Strict Negative Correlation Constraints},
booktitle = {34th International Symposium on Algorithms and Computation, {ISAAC}
2023, December 3-6, 2023, Kyoto, Japan},
series = {LIPIcs},
volume = {283},
pages = {50:1--50:15},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2023},
url = {https://doi.org/10.4230/LIPIcs.ISAAC.2023.50},
doi = {10.4230/LIPICS.ISAAC.2023.50},
timestamp = {Wed, 21 Aug 2024 22:46:00 +0200},
biburl = {https://dblp.org/rec/conf/isaac/KuoCFHTK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/HuangTHCTCFHCCCKWCMH23,
author = {Bo{-}Jr Huang and
Alfred Tsai and
Lear Hsieh and
Kathleen Chang and
C.{-}J. Tsai and
Jia{-}Ming Chen and
Eric Jia{-}Wei Fang and
Sung S.{-}Y. Hsueh and
Jack Ciao and
Barry Chen and
Chuck Chang and
Ping Kao and
Ericbill Wang and
Harry H. Chen and
Hugh Mair and
Shih{-}Arn Hwang},
title = {A 5G Mobile Gaming-Centric SoC with High-Performance Thermal Management
in 4nm FinFET},
booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2023,
San Francisco, CA, USA, February 19-23, 2023},
pages = {40--41},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ISSCC42615.2023.10067271},
doi = {10.1109/ISSCC42615.2023.10067271},
timestamp = {Wed, 29 Mar 2023 15:53:39 +0200},
biburl = {https://dblp.org/rec/conf/isscc/HuangTHCTCFHCCCKWCMH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/WuSHRCCKHLSLCLLHTC23,
author = {Ping{-}Chun Wu and
Jian{-}Wei Su and
Li{-}Yang Hong and
Jin{-}Sheng Ren and
Chih{-}Han Chien and
Ho{-}Yu Chen and
Chao{-}En Ke and
Hsu{-}Ming Hsiao and
Sih{-}Han Li and
Shyh{-}Shyuan Sheu and
Wei{-}Chung Lo and
Shih{-}Chieh Chang and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Meng{-}Fan Chang},
title = {A 22nm 832Kb Hybrid-Domain Floating-Point {SRAM} In-Memory-Compute
Macro with 16.2-70.2TFLOPS/W for High-Accuracy AI-Edge Devices},
booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2023,
San Francisco, CA, USA, February 19-23, 2023},
pages = {126--127},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/ISSCC42615.2023.10067527},
doi = {10.1109/ISSCC42615.2023.10067527},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/WuSHRCCKHLSLCLLHTC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/l4dc/SalamLH23,
author = {Tahiya Salam and
Alice Kate Li and
M. Ani Hsieh},
editor = {Nikolai Matni and
Manfred Morari and
George J. Pappas},
title = {Online Estimation of the Koopman Operator Using Fourier Features},
booktitle = {Learning for Dynamics and Control Conference, {L4DC} 2023, 15-16 June
2023, Philadelphia, PA, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {211},
pages = {1271--1283},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v211/salam23a.html},
timestamp = {Fri, 16 Jun 2023 14:48:17 +0200},
biburl = {https://dblp.org/rec/conf/l4dc/SalamLH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mibam/ChangYLCH23,
author = {Herng{-}Hua Chang and
Shin{-}Joe Yeh and
Yi{-}Ru Lin and
Ming{-}Chang Chiang and
Sung{-}Tsang Hsieh},
editor = {Barjor S. Gimi and
Andrzej Kr{\'{o}}l},
title = {Automatic infarct segmentation in rat brain {MR} images after stroke
using an adaptive deformable model},
booktitle = {Medical Imaging 2023: Biomedical Applications in Molecular, Structural,
and Functional Imaging, San Diego, CA, USA, February 19-23, 2023},
series = {{SPIE} Proceedings},
volume = {12468},
publisher = {{SPIE}},
year = {2023},
url = {https://doi.org/10.1117/12.2654532},
doi = {10.1117/12.2654532},
timestamp = {Thu, 21 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mibam/ChangYLCH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micad/DunningRHEYWGFM23,
author = {Chelsea A. S. Dunning and
Prabhakar Shantha Rajiah and
Scott S. Hsieh and
Andrea Esquivel and
Mariana Yalon and
Nikkole M. Weber and
Hao Gong and
Joel G. Fletcher and
Cynthia H. McCollough and
Shuai Leng},
editor = {Khan M. Iftekharuddin and
Weijie Chen},
title = {Classification of high-risk coronary plaques using radiomic analysis
of multi-energy photon-counting-detector computed tomography {(PCD-CT)}
images},
booktitle = {Medical Imaging 2023: Computer-Aided Diagnosis, San Diego, CA, USA,
February 19-23, 2023},
series = {{SPIE} Proceedings},
volume = {12465},
publisher = {{SPIE}},
year = {2023},
url = {https://doi.org/10.1117/12.2654412},
doi = {10.1117/12.2654412},
timestamp = {Tue, 19 Mar 2024 12:50:04 +0100},
biburl = {https://dblp.org/rec/conf/micad/DunningRHEYWGFM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miipop/HsiehIYCFGPVJLY23,
author = {Scott S. Hsieh and
Akitoshi Inoue and
Mariana Yalon and
David A. Cook and
Jeff L. Fidler and
Hao Gong and
Parvathy Sudhir Pillai and
Andrew J. Vercnocke and
Matthew P. Johnson and
Shuai Leng and
Lifeng Yu and
David R. Holmes III and
Rickey E. Carter and
Cynthia H. McCollough and
Joel G. Fletcher},
editor = {Claudia R. Mello{-}Thoms and
Yan Chen},
title = {A training program to reduce reader search errors for liver metastasis
detection in {CT}},
booktitle = {Medical Imaging 2023: Image Perception, Observer Performance, and
Technology Assessment, San Diego, CA, USA, February 21-23, 2023},
series = {{SPIE} Proceedings},
volume = {12467},
publisher = {{SPIE}},
year = {2023},
url = {https://doi.org/10.1117/12.2654007},
doi = {10.1117/12.2654007},
timestamp = {Tue, 19 Mar 2024 12:48:44 +0100},
biburl = {https://dblp.org/rec/conf/miipop/HsiehIYCFGPVJLY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mlsp/HsiehYCST23,
author = {Tsun{-}An Hsieh and
Chao{-}Han Huck Yang and
Pin{-}Yu Chen and
Sabato Marco Siniscalchi and
Yu Tsao},
editor = {Danilo Comminiello and
Michele Scarpiniti},
title = {Inference and Denoise: Causal Inference-Based Neural Speech Enhancement},
booktitle = {33rd {IEEE} International Workshop on Machine Learning for Signal
Processing, {MLSP} 2023, Rome, Italy, September 17-20, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/MLSP55844.2023.10285967},
doi = {10.1109/MLSP55844.2023.10285967},
timestamp = {Mon, 06 Nov 2023 17:21:37 +0100},
biburl = {https://dblp.org/rec/conf/mlsp/HsiehYCST23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nsdi/KhaniAHJNSAB23,
author = {Mehrdad Khani Shirkoohi and
Ganesh Ananthanarayanan and
Kevin Hsieh and
Junchen Jiang and
Ravi Netravali and
Yuanchao Shu and
Mohammad Alizadeh and
Victor Bahl},
editor = {Mahesh Balakrishnan and
Manya Ghobadi},
title = {{RECL:} Responsive Resource-Efficient Continuous Learning for Video
Analytics},
booktitle = {20th {USENIX} Symposium on Networked Systems Design and Implementation,
{NSDI} 2023, Boston, MA, April 17-19, 2023},
pages = {917--932},
publisher = {{USENIX} Association},
year = {2023},
url = {https://www.usenix.org/conference/nsdi23/presentation/khani},
timestamp = {Fri, 19 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nsdi/KhaniAHJNSAB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/paclic/TsengKCCH23,
author = {Yu{-}Hsiang Tseng and
Mao{-}Chang Ku and
Wei{-}Ling Chen and
Yu{-}Lin Chang and
Shu{-}Kai Hsieh},
editor = {Chu{-}Ren Huang and
Yasunari Harada and
Jong{-}Bok Kim and
Si Chen and
Yu{-}Yin Hsu and
Emmanuele Chersoni and
Pranav A and
Winnie Huiheng Zeng and
Bo Peng and
Yuxi Li and
Junlin Li},
title = {Vec2Gloss: definition modeling leveraging contextualized vectors with
Wordnet gloss},
booktitle = {Proceedings of the 37th Pacific Asia Conference on Language, Information
and Computation, {PACLIC} 2023, The Hong Kong Polytechnic University,
Hong Kong, SAR, China, 2-4 December 2023},
pages = {679--690},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://aclanthology.org/2023.paclic-1.68},
timestamp = {Thu, 15 Feb 2024 16:12:31 +0100},
biburl = {https://dblp.org/rec/conf/paclic/TsengKCCH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/qce/HongHCFHLYY23,
author = {Xin Hong and
Wei{-}Jia Huang and
Wei{-}Chen Chien and
Yuan Feng and
Min{-}Hsiu Hsieh and
Sanjiang Li and
Chia{-}Shun Yeh and
Mingsheng Ying},
editor = {Brian La Cour and
Lia Yeh and
Marek Osinski},
title = {Decision Diagrams for Symbolic Verification of Quantum Circuits},
booktitle = {{IEEE} International Conference on Quantum Computing and Engineering,
{QCE} 2023, Bellevue, WA, USA, September 17-22, 2023},
pages = {970--977},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/QCE57702.2023.00111},
doi = {10.1109/QCE57702.2023.00111},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/qce/HongHCFHLYY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/soda/HsiehKM23,
author = {Jun{-}Ting Hsieh and
Pravesh K. Kothari and
Sidhanth Mohanty},
editor = {Nikhil Bansal and
Viswanath Nagarajan},
title = {A simple and sharper proof of the hypergraph Moore bound},
booktitle = {Proceedings of the 2023 {ACM-SIAM} Symposium on Discrete Algorithms,
{SODA} 2023, Florence, Italy, January 22-25, 2023},
pages = {2324--2344},
publisher = {{SIAM}},
year = {2023},
url = {https://doi.org/10.1137/1.9781611977554.ch89},
doi = {10.1137/1.9781611977554.CH89},
timestamp = {Fri, 17 Feb 2023 09:28:57 +0100},
biburl = {https://dblp.org/rec/conf/soda/HsiehKM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/taai/HsuTH23,
author = {Feng{-}Chiao Hsu and
Meng{-}Che Tsai and
Sun{-}Yuan Hsieh},
editor = {Chao{-}Yang Lee and
Chun{-}Li Lin and
Hsuan{-}Ting Chang},
title = {Automated Pediatric Bone Age Assessment Using Convolutional Neural
Networks},
booktitle = {Technologies and Applications of Artificial Intelligence - 28th International
Conference, {TAAI} 2023, Yunlin, Taiwan, December 1-2, 2023, Proceedings,
Part {II}},
series = {Communications in Computer and Information Science},
volume = {2075},
pages = {228--237},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-981-97-1714-9\_19},
doi = {10.1007/978-981-97-1714-9\_19},
timestamp = {Wed, 03 Apr 2024 16:03:15 +0200},
biburl = {https://dblp.org/rec/conf/taai/HsuTH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uai/SomnathPHM0B23,
author = {Vignesh Ram Somnath and
Matteo Pariset and
Ya{-}Ping Hsieh and
Mar{\'{\i}}a Rodr{\'{\i}}guez Mart{\'{\i}}nez and
Andreas Krause and
Charlotte Bunne},
editor = {Robin J. Evans and
Ilya Shpitser},
title = {Aligned Diffusion Schr{\"{o}}dinger Bridges},
booktitle = {Uncertainty in Artificial Intelligence, {UAI} 2023, July 31 - 4 August
2023, Pittsburgh, PA, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {216},
pages = {1985--1995},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v216/somnath23a.html},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/uai/SomnathPHM0B23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/ChangXDJLCLLKJG23,
author = {En{-}Jui Chang and
Cheng{-}Xin Xue and
Chetan Deshpande and
Gajanan Jedhe and
Jenwei Liang and
Chih{-}Chung Cheng and
Hung{-}Wei Lin and
Chia{-}Da Lee and
Sushil Kumar and
Kim Soon Jway and
Zijie Guo and
Ritesh Garg and
Allen{-}Cl Lu and
Chien{-}Hung Lin and
Meng{-}Han Hsieh and
Tsung{-}Yao Lin and
Chih{-}Cheng Chen},
title = {A 12-nm 0.62-1.61 mW Ultra-Low Power Digital CIM-based Deep-Learning
System for End-to-End Always-on Vision},
booktitle = {2023 {IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits), Kyoto, Japan, June 11-16, 2023},
pages = {1--2},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.23919/VLSITechnologyandCir57934.2023.10185296},
doi = {10.23919/VLSITECHNOLOGYANDCIR57934.2023.10185296},
timestamp = {Fri, 28 Jul 2023 10:40:41 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/ChangXDJLCLLKJG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/ChenLZHLTHWCXCC23,
author = {Yu{-}Rui Chen and
Yi{-}Chun Liu and
Zefu Zhao and
Wan{-}Hsuan Hsieh and
Jia{-}Yang Lee and
Chien{-}Te Tu and
Bo{-}Wei Huang and
Jer{-}Fu Wang and
Shee{-}Jier Chueh and
Yifan Xing and
Guan{-}Hua Chen and
Hung{-}Chun Chou and
Dong Soo Woo and
Min{-}Hung Lee and
Chee Wee Liu},
title = {First Stacked Nanosheet FeFET Featuring Memory Window of 1.8V at Record
Low Write Voltage of 2V and Endurance {\textgreater}1E11 Cycles},
booktitle = {2023 {IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits), Kyoto, Japan, June 11-16, 2023},
pages = {1--2},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.23919/VLSITechnologyandCir57934.2023.10185284},
doi = {10.23919/VLSITECHNOLOGYANDCIR57934.2023.10185284},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/ChenLZHLTHWCXCC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/ChiangHWHWHHCLC23,
author = {H.{-}L. Chiang and
Richard A. Hadi and
J.{-}F. Wang and
H.{-}C. Han and
J.{-}J. Wu and
H.{-}H. Hsieh and
J.{-}J. Horng and
W.{-}S. Chou and
B.{-}S. Lien and
C.{-}H. Chang and
Y.{-}C. Chen and
Yeong{-}Her Wang and
T.{-}C. Chen and
J.{-}C. Liu and
Y.{-}C. Liu and
Meng{-}Hsueh Chiang and
K.{-}H. Kao and
B. Pulicherla and
J. Cai and
C.{-}S. Chang and
K.{-}W. Su and
K.{-}L. Cheng and
T.{-}J. Yeh and
Y.{-}C. Peng and
C. Enz and
Mau{-}Chung Frank Chang and
M.{-}F. Chang and
H.{-}S. Philip Wong and
Iuliana P. Radu},
title = {How Fault-Tolerant Quantum Computing Benefits from Cryo-CMOS Technology},
booktitle = {2023 {IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits), Kyoto, Japan, June 11-16, 2023},
pages = {1--2},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.23919/VLSITechnologyandCir57934.2023.10185325},
doi = {10.23919/VLSITECHNOLOGYANDCIR57934.2023.10185325},
timestamp = {Mon, 29 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/ChiangHWHWHHCLC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/KomuraMOTISKKOY23,
author = {Yusuke Komura and
Shoki Miyata and
Yuki Okamoto and
Yuki Tamatsukuri and
Hiroki Inoue and
Toshihiko Saito and
Munehiro Kozuma and
Hidetomo Kobayashi and
Tatsuya Onuki and
Yuichi Yanagisawa and
Toshihiko Takeuchi and
Yutaka Okazaki and
Hitoshi Kunitake and
Daiki Nakamura and
Takaaki Nagata and
Yasumasa Yamane and
Makoto Ikeda and
Shih{-}Ci Yen and
Chuan{-}Hua Chang and
Wen{-}Hsiang Hsieh and
Hiroshi Yoshida and
Min{-}Cheng Chen and
Ming{-}Han Liao and
Shou{-}Zen Chang and
Shunpei Yamazaki},
title = {Two-Dimensionally Arranged Display Drivers Achieved by OS/Si Structure},
booktitle = {2023 {IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits), Kyoto, Japan, June 11-16, 2023},
pages = {1--2},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.23919/VLSITechnologyandCir57934.2023.10185358},
doi = {10.23919/VLSITECHNOLOGYANDCIR57934.2023.10185358},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/KomuraMOTISKKOY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/WenHHWCLCSKWLLH23,
author = {Tai{-}Hao Wen and
Je{-}Min Hung and
Hung{-}Hsi Hsu and
Yuan Wu and
Fu{-}Chun Chang and
Chung{-}Yuan Li and
Chih{-}Han Chien and
Chin{-}I Su and
Win{-}San Khwa and
Jui{-}Jen Wu and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Mon{-}Shu Ho and
Yu{-}Der Chih and
Tsung{-}Yung Jonathan Chang and
Meng{-}Fan Chang},
title = {A 28nm Nonvolatile {AI} Edge Processor using 4Mb Analog-Based Near-Memory-Compute
ReRAM with 27.2 {TOPS/W} for Tiny {AI} Edge Devices},
booktitle = {2023 {IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits), Kyoto, Japan, June 11-16, 2023},
pages = {1--2},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.23919/VLSITechnologyandCir57934.2023.10185326},
doi = {10.23919/VLSITECHNOLOGYANDCIR57934.2023.10185326},
timestamp = {Tue, 20 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsit/WenHHWCLCSKWLLH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/YuMH23,
author = {Hsin Yu and
John Carl Joel Salao Marquez and
Chih{-}Cheng Hsieh},
title = {A -20{\textdegree}C{\textasciitilde}+107{\textdegree}C 52mk-NETD Reference-cell-free
15-bits {ROIC} for 80{\texttimes}60 Micro-bolometer Thermal Imager},
booktitle = {2023 {IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits), Kyoto, Japan, June 11-16, 2023},
pages = {1--2},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.23919/VLSITechnologyandCir57934.2023.10185249},
doi = {10.23919/VLSITECHNOLOGYANDCIR57934.2023.10185249},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/YuMH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vnc/WangSHT23,
author = {Bo{-}Wen Wang and
Wen{-}Hsuan Shen and
Ming{-}Ju Hsieh and
Hsin{-}Mu Tsai},
editor = {Sinem Coleri and
Onur Altintas and
Frank Kargl and
Takamasa Higuchi and
Michele Segata and
Florian Klingler},
title = {{EMS-RTC:} LSTM-based Adaptive Video Streaming for Smart Ambulance},
booktitle = {{IEEE} Vehicular Networking Conference, {VNC} 2023, Istanbul, Turkey,
April 26-28, 2023},
pages = {9--16},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/VNC57357.2023.10136348},
doi = {10.1109/VNC57357.2023.10136348},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vnc/WangSHT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vr/LuisHNSMJM23,
author = {Andr{\'{e}} Lu{\'{\i}}s and
Chihcheng Hsieh and
Isabel Blanco Nobre and
Sandra Costa Sousa and
Anderson Maciel and
Joaquim Jorge and
Catarina Moreira},
title = {Integrating Eye-Gaze Data into {CXR} {DL} Approaches: {A} Preliminary
study},
booktitle = {{IEEE} Conference on Virtual Reality and 3D User Interfaces Abstracts
and Workshops, {VR} Workshops 2023, Shanghai, China, March 25-29,
2023},
pages = {196--199},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/VRW58643.2023.00048},
doi = {10.1109/VRW58643.2023.00048},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vr/LuisHNSMJM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/LiCLLH23,
author = {Hong{-}Wen Li and
You{-}Cheng Chen and
Alan Liu and
Shih{-}Cheng Lin and
Meng{-}Yuan Hsieh},
title = {A Generative Adversarial Network Approach to Reflectarray Pattern
Synthesis},
booktitle = {{IEEE} Wireless Communications and Networking Conference, {WCNC} 2023,
Glasgow, UK, March 26-29, 2023},
pages = {1--6},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/WCNC55385.2023.10119100},
doi = {10.1109/WCNC55385.2023.10119100},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wcnc/LiCLLH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/LeeWMWBHC23,
author = {Wonkyeong Lee and
Fabian Wagner and
Andreas Maier and
Adam S. Wang and
Jongduk Baek and
Scott S. Hsieh and
Jang{-}Hwan Choi},
title = {Low-dose Computed Tomography Perceptual Image Quality Assessment Grand
Challenge Dataset {(MICCAI} 2023) (Version 1)},
publisher = {Zenodo},
year = {2023},
month = apr,
howpublished = {\url{https://doi.org/10.5281/zenodo.7833096}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.7833096},
doi = {10.5281/ZENODO.7833096},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/LeeWMWBHC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2301-00984,
author = {Jonathan P. Mailoa and
Zhaofeng Ye and
Jiezhong Qiu and
Chang{-}Yu Hsieh and
Shengyu Zhang},
title = {Protein-Ligand Complex Generator {\&} Drug Screening via Tiered
Tensor Transform},
journal = {CoRR},
volume = {abs/2301.00984},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2301.00984},
doi = {10.48550/ARXIV.2301.00984},
eprinttype = {arXiv},
eprint = {2301.00984},
timestamp = {Tue, 10 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2301-00984.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-01212,
author = {Jun{-}Ting Hsieh and
Theo McKenzie and
Sidhanth Mohanty and
Pedro Paredes},
title = {Explicit two-sided unique-neighbor expanders},
journal = {CoRR},
volume = {abs/2302.01212},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.01212},
doi = {10.48550/ARXIV.2302.01212},
eprinttype = {arXiv},
eprint = {2302.01212},
timestamp = {Mon, 13 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-01212.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-02509,
author = {Yingkai Ouyang and
Kaumudibikash Goswami and
Jacquiline Romero and
Barry C. Sanders and
Min{-}Hsiu Hsieh and
Marco Tomamichel},
title = {Approximate reconstructability of quantum states and noisy quantum
secret sharing schemes},
journal = {CoRR},
volume = {abs/2302.02509},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.02509},
doi = {10.48550/ARXIV.2302.02509},
eprinttype = {arXiv},
eprint = {2302.02509},
timestamp = {Mon, 13 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-02509.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-02940,
author = {Andr{\'{e}} Lu{\'{\i}}s and
Chihcheng Hsieh and
Isabel Blanco Nobre and
Sandra Costa Sousa and
Anderson Maciel and
Catarina Moreira and
Joaquim Jorge},
title = {Integrating Eye-Gaze Data into {CXR} {DL} Approaches: {A} Preliminary
study},
journal = {CoRR},
volume = {abs/2302.02940},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.02940},
doi = {10.48550/ARXIV.2302.02940},
eprinttype = {arXiv},
eprint = {2302.02940},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-02940.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-11419,
author = {Vignesh Ram Somnath and
Matteo Pariset and
Ya{-}Ping Hsieh and
Mar{\'{\i}}a Rodr{\'{\i}}guez Mart{\'{\i}}nez and
Andreas Krause and
Charlotte Bunne},
title = {Aligned Diffusion Schr{\"{o}}dinger Bridges},
journal = {CoRR},
volume = {abs/2302.11419},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.11419},
doi = {10.48550/ARXIV.2302.11419},
eprinttype = {arXiv},
eprint = {2302.11419},
timestamp = {Fri, 24 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-11419.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-13390,
author = {Chihcheng Hsieh and
Isabel Blanco Nobre and
Sandra Costa Sousa and
Chun Ouyang and
Margot Brereton and
Jacinto C. Nascimento and
Joaquim Jorge and
Catarina Moreira},
title = {MDF-Net: Multimodal Dual-Fusion Network for Abnormality Detection
using {CXR} Images and Clinical Data},
journal = {CoRR},
volume = {abs/2302.13390},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.13390},
doi = {10.48550/ARXIV.2302.13390},
eprinttype = {arXiv},
eprint = {2302.13390},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-13390.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2303-16341,
author = {Yuanhao Xiong and
Long Zhao and
Boqing Gong and
Ming{-}Hsuan Yang and
Florian Schroff and
Ting Liu and
Cho{-}Jui Hsieh and
Liangzhe Yuan},
title = {Spatiotemporally Discriminative Video-Language Pre-Training with Text
Grounding},
journal = {CoRR},
volume = {abs/2303.16341},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2303.16341},
doi = {10.48550/ARXIV.2303.16341},
eprinttype = {arXiv},
eprint = {2303.16341},
timestamp = {Wed, 30 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2303-16341.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-00732,
author = {Sandeep Manjanna and
Tom Z. Jiahao and
M. Ani Hsieh},
title = {Leveraging Predictive Models for Adaptive Sampling of Spatiotemporal
Fluid Processes},
journal = {CoRR},
volume = {abs/2304.00732},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.00732},
doi = {10.48550/ARXIV.2304.00732},
eprinttype = {arXiv},
eprint = {2304.00732},
timestamp = {Mon, 17 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-00732.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-02143,
author = {Fabio Hellmann and
Silvan Mertes and
Mohamed Benouis and
Alexander Hustinx and
Tzung{-}Chien Hsieh and
Cristina Conati and
Peter Krawitz and
Elisabeth Andr{\'{e}}},
title = {GANonymization: {A} GAN-based Face Anonymization Framework for Preserving
Emotional Expressions},
journal = {CoRR},
volume = {abs/2305.02143},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.02143},
doi = {10.48550/ARXIV.2305.02143},
eprinttype = {arXiv},
eprint = {2305.02143},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-02143.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-17449,
author = {Munkhjargal Gochoo and
Munkh{-}Erdene Otgonbold and
Erkhembayar Ganbold and
Jun{-}Wei Hsieh and
Ming{-}Ching Chang and
Ping{-}Yang Chen and
Byambaa Dorj and
Hamad Al Jassmi and
Ganzorig Batnasan and
Fady Alnajjar and
Mohammed Abduljabbar and
Fang{-}Pang Lin},
title = {FishEye8K: {A} Benchmark and Dataset for Fisheye Camera Object Detection},
journal = {CoRR},
volume = {abs/2305.17449},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.17449},
doi = {10.48550/ARXIV.2305.17449},
eprinttype = {arXiv},
eprint = {2305.17449},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-17449.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-17855,
author = {Yu{-}Hsiang Tseng and
Mao{-}Chang Ku and
Wei{-}Ling Chen and
Yu{-}Lin Chang and
Shu{-}Kai Hsieh},
title = {Vec2Gloss: definition modeling leveraging contextualized vectors with
Wordnet gloss},
journal = {CoRR},
volume = {abs/2305.17855},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.17855},
doi = {10.48550/ARXIV.2305.17855},
eprinttype = {arXiv},
eprint = {2305.17855},
timestamp = {Wed, 07 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-17855.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-00570,
author = {Kong Yao Chee and
Thales C. Silva and
M. Ani Hsieh and
George J. Pappas},
title = {Enhancing Sample Efficiency and Uncertainty Compensation in Learning-based
Model Predictive Control for Aerial Robots},
journal = {CoRR},
volume = {abs/2308.00570},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.00570},
doi = {10.48550/ARXIV.2308.00570},
eprinttype = {arXiv},
eprint = {2308.00570},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-00570.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-06261,
author = {Sathiya Kumaran Mani and
Yajie Zhou and
Kevin Hsieh and
Santiago Segarra and
Ranveer Chandra and
Srikanth Kandula},
title = {Enhancing Network Management Using Code Generated by Large Language
Models},
journal = {CoRR},
volume = {abs/2308.06261},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.06261},
doi = {10.48550/ARXIV.2308.06261},
eprinttype = {arXiv},
eprint = {2308.06261},
timestamp = {Wed, 23 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-06261.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-08086,
author = {Shaoru Chen and
Kong Yao Chee and
Nikolai Matni and
M. Ani Hsieh and
George J. Pappas},
title = {Safety Filter Design for Neural Network Systems via Convex Optimization},
journal = {CoRR},
volume = {abs/2308.08086},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.08086},
doi = {10.48550/ARXIV.2308.08086},
eprinttype = {arXiv},
eprint = {2308.08086},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-08086.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-09514,
author = {Yu{-}Cheng Hsieh and
Cheng Sun and
Suraj Dengale and
Min Sun},
title = {PanoMixSwap Panorama Mixing via Structural Swapping for Indoor Scene
Understanding},
journal = {CoRR},
volume = {abs/2309.09514},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2309.09514},
doi = {10.48550/ARXIV.2309.09514},
eprinttype = {arXiv},
eprint = {2309.09514},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2309-09514.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-09515,
author = {Ting{-}Ying Lin and
Lin{-}Yung Hsieh and
Fu{-}En Wang and
Wen{-}Shen Wuen and
Min Sun},
title = {Sparse and Privacy-enhanced Representation for Human Pose Estimation},
journal = {CoRR},
volume = {abs/2309.09515},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2309.09515},
doi = {10.48550/ARXIV.2309.09515},
eprinttype = {arXiv},
eprint = {2309.09515},
timestamp = {Tue, 16 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2309-09515.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-11637,
author = {Katherine Mao and
Igor Spasojevic and
M. Ani Hsieh and
Vijay Kumar},
title = {TOPPQuad: Dynamically-Feasible Time Optimal Path Parametrization for
Quadrotors},
journal = {CoRR},
volume = {abs/2309.11637},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2309.11637},
doi = {10.48550/ARXIV.2309.11637},
eprinttype = {arXiv},
eprint = {2309.11637},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2309-11637.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-13494,
author = {Alysson Ribeiro Da Silva and
Luiz Chaimowicz and
Vijay Kumar and
Thales Costa Silva and
M. Ani Hsieh},
title = {Communication-Constrained Multi-Robot Exploration with Intermittent
Rendezvous},
journal = {CoRR},
volume = {abs/2309.13494},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2309.13494},
doi = {10.48550/ARXIV.2309.13494},
eprinttype = {arXiv},
eprint = {2309.13494},
timestamp = {Wed, 27 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2309-13494.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-05175,
author = {Lu Yin and
You Wu and
Zhenyu Zhang and
Cheng{-}Yu Hsieh and
Yaqing Wang and
Yiling Jia and
Mykola Pechenizkiy and
Yi Liang and
Zhangyang Wang and
Shiwei Liu},
title = {Outlier Weighed Layerwise Sparsity {(OWL):} {A} Missing Secret Sauce
for Pruning LLMs to High Sparsity},
journal = {CoRR},
volume = {abs/2310.05175},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.05175},
doi = {10.48550/ARXIV.2310.05175},
eprinttype = {arXiv},
eprint = {2310.05175},
timestamp = {Fri, 02 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-05175.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-15479,
author = {Namjoon Suh and
Xiaofeng Lin and
Din{-}Yin Hsieh and
Merhdad Honarkhah and
Guang Cheng},
title = {AutoDiff: combining Auto-encoder and Diffusion model for tabular data
synthesizing},
journal = {CoRR},
volume = {abs/2310.15479},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.15479},
doi = {10.48550/ARXIV.2310.15479},
eprinttype = {arXiv},
eprint = {2310.15479},
timestamp = {Fri, 09 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-15479.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-09354,
author = {Kylie J. Trettner and
Jeremy Hsieh and
Weikun Xiao and
Jerry S. H. Lee and
Andrea M. Armani},
title = {Nondestructive, quantitative viability analysis of 3D tissue cultures
using machine learning image segmentation},
journal = {CoRR},
volume = {abs/2311.09354},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.09354},
doi = {10.48550/ARXIV.2311.09354},
eprinttype = {arXiv},
eprint = {2311.09354},
timestamp = {Thu, 23 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-09354.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-10480,
author = {Kuo{-}Chin Chen and
Simon Apers and
Min{-}Hsiu Hsieh},
title = {(Quantum) complexity of testing signed graph clusterability},
journal = {CoRR},
volume = {abs/2311.10480},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.10480},
doi = {10.48550/ARXIV.2311.10480},
eprinttype = {arXiv},
eprint = {2311.10480},
timestamp = {Thu, 23 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-10480.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-02429,
author = {Wei{-}Cheng Chang and
Jyun{-}Yu Jiang and
Jiong Zhang and
Mutasem Al{-}Darabsah and
Choon Hui Teo and
Cho{-}Jui Hsieh and
Hsiang{-}Fu Yu and
S. V. N. Vishwanathan},
title = {{PEFA:} Parameter-Free Adapters for Large-scale Embedding-based Retrieval
Models},
journal = {CoRR},
volume = {abs/2312.02429},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.02429},
doi = {10.48550/ARXIV.2312.02429},
eprinttype = {arXiv},
eprint = {2312.02429},
timestamp = {Wed, 13 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-02429.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-14248,
author = {Alice Kate Li and
Yue Mao and
Sandeep Manjanna and
Sixuan Liu and
Jasleen Dhanoa and
Bharg Mehta and
Victoria M. Edwards and
Fernando Cladera Ojeda and
Ma{\"{e}}l Le Men and
Eric Sigg and
Hugo N. Ulloa and
Douglas J. Jerolmack and
M. Ani Hsieh},
title = {Towards Understanding Underwater Weather Events in Rivers Using Autonomous
Surface Vehicles},
journal = {CoRR},
volume = {abs/2312.14248},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.14248},
doi = {10.48550/ARXIV.2312.14248},
eprinttype = {arXiv},
eprint = {2312.14248},
timestamp = {Wed, 17 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-14248.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-15320,
author = {Da Wu and
Jingye Yang and
Steven Klein and
Cong Liu and
Tzung{-}Chien Hsieh and
Peter Krawitz and
Chunhua Weng and
Gholson J. Lyon and
Jennifer M. Kalish and
Kai Wang},
title = {Multimodal Machine Learning Combining Facial Images and Clinical Texts
Improves Diagnosis of Rare Genetic Diseases},
journal = {CoRR},
volume = {abs/2312.15320},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.15320},
doi = {10.48550/ARXIV.2312.15320},
eprinttype = {arXiv},
eprint = {2312.15320},
timestamp = {Wed, 10 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-15320.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/HsiehCJLS22,
author = {Cheng{-}Hsiung Hsieh and
Kuan{-}Yu Chen and
Meng{-}Yuan Jiang and
Jiun{-}Jian Liaw and
Jungpil Shin},
title = {Estimation of PM\({}_{\mbox{2.5}}\) Concentration Based on Support
Vector Regression With Improved Dark Channel Prior and High Frequency
Information in Images},
journal = {{IEEE} Access},
volume = {10},
pages = {48486--48498},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3172468},
doi = {10.1109/ACCESS.2022.3172468},
timestamp = {Mon, 13 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/HsiehCJLS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/arobots/ManjannaHD22,
author = {Sandeep Manjanna and
M. Ani Hsieh and
Greogory Dudek},
title = {Scalable multirobot planning for informed spatial sampling},
journal = {Auton. Robots},
volume = {46},
number = {7},
pages = {817--829},
year = {2022},
url = {https://doi.org/10.1007/s10514-022-10048-7},
doi = {10.1007/S10514-022-10048-7},
timestamp = {Tue, 18 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/arobots/ManjannaHD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/comsis/NayakPPNH22,
author = {Suvra Nayak and
Chhabi Rani Panigrahi and
Bibudhendu Pati and
Sarmistha Nanda and
Meng{-}Yen Hsieh},
title = {Comparative analysis of {HAR} datasets using classification algorithms},
journal = {Comput. Sci. Inf. Syst.},
volume = {19},
number = {1},
pages = {47--63},
year = {2022},
url = {https://doi.org/10.2298/csis201221043n},
doi = {10.2298/CSIS201221043N},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/comsis/NayakPPNH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/connection/HuLHHS22,
author = {Jianqiang Hu and
Wei Liang and
Osama Hosam and
Meng{-}Yen Hsieh and
Xin Su},
title = {5GSS: a framework for 5G-secure-smart healthcare monitoring},
journal = {Connect. Sci.},
volume = {34},
number = {1},
pages = {139--161},
year = {2022},
url = {https://doi.org/10.1080/09540091.2021.1977243},
doi = {10.1080/09540091.2021.1977243},
timestamp = {Fri, 13 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/connection/HuLHHS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/connection/LiSLLHCLZ22,
author = {Tianyuan Li and
Xin Su and
Wei Liu and
Wei Liang and
Meng{-}Yen Hsieh and
Zhuhui Chen and
Xuchong Liu and
Hong Zhang},
title = {Memory-augmented meta-learning on meta-path for fast adaptation cold-start
recommendation},
journal = {Connect. Sci.},
volume = {34},
number = {1},
pages = {301--318},
year = {2022},
url = {https://doi.org/10.1080/09540091.2021.1996537},
doi = {10.1080/09540091.2021.1996537},
timestamp = {Fri, 13 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/connection/LiSLLHCLZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/connection/WeiLZZH22,
author = {Zhongliang Wei and
Wenjuan Liu and
Guangli Zhu and
Shunxiang Zhang and
Meng{-}Yen Hsieh},
title = {Sentiment classification of Chinese Weibo based on extended sentiment
dictionary and organisational structure of comments},
journal = {Connect. Sci.},
volume = {34},
number = {1},
pages = {409--428},
year = {2022},
url = {https://doi.org/10.1080/09540091.2021.2006146},
doi = {10.1080/09540091.2021.2006146},
timestamp = {Fri, 13 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/connection/WeiLZZH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/connection/ZhangWXZH22,
author = {Shunxiang Zhang and
Houyue Wu and
Xin Xu and
Guangli Zhu and
Meng{-}Yen Hsieh},
title = {{CL-ECPE:} contrastive learning with adversarial samples for emotion-cause
pair extraction},
journal = {Connect. Sci.},
volume = {34},
number = {1},
pages = {1877--1894},
year = {2022},
url = {https://doi.org/10.1080/09540091.2022.2082383},
doi = {10.1080/09540091.2022.2082383},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/connection/ZhangWXZH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cviu/SuCCTHSSABYG22,
author = {Yu{-}Chuan Su and
Soravit Changpinyo and
Xiangning Chen and
Sathish Thoppay and
Cho{-}Jui Hsieh and
Lior Shapira and
Radu Soricut and
Hartwig Adam and
Matthew Brown and
Ming{-}Hsuan Yang and
Boqing Gong},
title = {2.5D visual relationship detection},
journal = {Comput. Vis. Image Underst.},
volume = {224},
pages = {103557},
year = {2022},
url = {https://doi.org/10.1016/j.cviu.2022.103557},
doi = {10.1016/J.CVIU.2022.103557},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cviu/SuCCTHSSABYG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ecra/HsiehLWHOL22,
author = {Mi{-}Tsuen Hsieh and
Shie{-}Jue Lee and
Chih{-}Hung Wu and
Chun{-}Liang Hou and
Chen{-}Sen Ouyang and
Zhan{-}Pei Lin},
title = {Leveraging attribute latent features for addressing new item cold-start
issue},
journal = {Electron. Commer. Res. Appl.},
volume = {54},
pages = {101177},
year = {2022},
url = {https://doi.org/10.1016/j.elerap.2022.101177},
doi = {10.1016/J.ELERAP.2022.101177},
timestamp = {Tue, 20 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ecra/HsiehLWHOL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fdgth/HsiehFFCGS22,
author = {Katherine L. Hsieh and
Mikaela L. Frechette and
Jason Fanning and
Lingjun Chen and
Aileen Griffin and
Jacob J. Sosnoff},
title = {The Developments and Iterations of a Mobile Technology-Based Fall
Risk Health Application},
journal = {Frontiers Digit. Health},
volume = {4},
pages = {828686},
year = {2022},
url = {https://doi.org/10.3389/fdgth.2022.828686},
doi = {10.3389/FDGTH.2022.828686},
timestamp = {Mon, 16 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fdgth/HsiehFFCGS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SuSCCHTLLLWCRCW22,
author = {Jian{-}Wei Su and
Xin Si and
Yen{-}Chi Chou and
Ting{-}Wei Chang and
Wei{-}Hsing Huang and
Yung{-}Ning Tu and
Ruhui Liu and
Pei{-}Jung Lu and
Ta{-}Wei Liu and
Jing{-}Hong Wang and
Yen{-}Lin Chung and
Jin{-}Sheng Ren and
Fu{-}Chun Chang and
Yuan Wu and
Hongwu Jiang and
Shanshi Huang and
Sih{-}Han Li and
Shyh{-}Shyuan Sheu and
Chih{-}I Wu and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Shimeng Yu and
Meng{-}Fan Chang},
title = {Two-Way Transpose Multibit 6T {SRAM} Computing-in-Memory Macro for
Inference-Training {AI} Edge Chips},
journal = {{IEEE} J. Solid State Circuits},
volume = {57},
number = {2},
pages = {609--624},
year = {2022},
url = {https://doi.org/10.1109/JSSC.2021.3108344},
doi = {10.1109/JSSC.2021.3108344},
timestamp = {Tue, 20 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/SuSCCHTLLLWCRCW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/ChenHCLLHCHCLLL22,
author = {Pin{-}Hsiu Chen and
Cheng{-}Hsien Huang and
Wen{-}Tse Chiu and
Chen{-}Mao Liao and
Yu{-}Ruei Lin and
Shih{-}Kai Hung and
Liang{-}Cheng Chen and
Hui{-}Ling Hsieh and
Wen{-}Yen Chiou and
Moon{-}Sing Lee and
Hon{-}Yi Lin and
Wei{-}Min Liu},
title = {A multiple organ segmentation system for {CT} image series using Attention-LSTM
fused U-Net},
journal = {Multim. Tools Appl.},
volume = {81},
number = {9},
pages = {11881--11895},
year = {2022},
url = {https://doi.org/10.1007/s11042-021-11889-7},
doi = {10.1007/S11042-021-11889-7},
timestamp = {Wed, 27 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mta/ChenHCLLHCHCLLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/KimCJWWYHETLWSH22,
author = {Chris K. Kim and
Ji Whae Choi and
Zhicheng Jiao and
Dongcui Wang and
Jing Wu and
Thomas Y. Yi and
Kasey C. Halsey and
Feyisope Eweje and
Thi My Linh Tran and
Chang Liu and
Robin Wang and
John Sollee and
Celina Hsieh and
Ken Chang and
Fang{-}Xue Yang and
Ritambhara Singh and
Jie{-}Lin Ou and
Raymond Y. Huang and
Cai Feng and
Michael D. Feldman and
Tao Liu and
Ji Sheng Gong and
Shaolei Lu and
Carsten Eickhoff and
Xue Feng and
Ihab Kamel and
Ronnie Sebro and
Michael Atalay and
Terrance Healey and
Yong Fan and
Wei{-}hua Liao and
Jianxin Wang and
Harrison Bai},
title = {An automated {COVID-19} triage pipeline using artificial intelligence
based on chest radiographs and clinical data},
journal = {npj Digit. Medicine},
volume = {5},
year = {2022},
url = {https://doi.org/10.1038/s41746-021-00546-w},
doi = {10.1038/S41746-021-00546-W},
timestamp = {Fri, 19 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/KimCJWWYHETLWSH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/ShandhiCRSWESST22,
author = {Md. Mobashir Hasan Shandhi and
Peter J. Cho and
Ali R. Roghanizad and
Karnika Singh and
Will Ke Wang and
Oana M. Enache and
Amanda Stern and
Rami Sbahi and
Bilge Tatar and
Sean Fiscus and
Qi Xuan Khoo and
Yvonne Kuo and
Xiao Lu and
Joseph Hsieh and
Alena Kalodzitsa and
Amir Bahmani and
Arash Alavi and
Utsab Ray and
Michael P. Snyder and
Geoffrey S. Ginsburg and
Dana K. Pasquale and
Christopher W. Woods and
Ryan J. Shaw and
Jessilyn Dunn},
title = {A method for intelligent allocation of diagnostic testing by leveraging
data from commercial wearable devices: a case study on {COVID-19}},
journal = {npj Digit. Medicine},
volume = {5},
year = {2022},
url = {https://doi.org/10.1038/s41746-022-00672-z},
doi = {10.1038/S41746-022-00672-Z},
timestamp = {Sun, 16 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/ShandhiCRSWESST22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmhci/AgapieAHM22,
author = {Elena Agapie and
Patricia A. Are{\'{a}}n and
Gary Hsieh and
Sean A. Munson},
title = {A Longitudinal Goal Setting Model for Addressing Complex Personal
Problems in Mental Health},
journal = {Proc. {ACM} Hum. Comput. Interact.},
volume = {6},
number = {{CSCW2}},
pages = {1--28},
year = {2022},
url = {https://doi.org/10.1145/3555160},
doi = {10.1145/3555160},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pacmhci/AgapieAHM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ral/SalamEH22,
author = {Tahiya Salam and
Victoria M. Edwards and
M. Ani Hsieh},
title = {Learning and Leveraging Features in Flow-Like Environments to Improve
Situational Awareness},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {7},
number = {2},
pages = {2071--2078},
year = {2022},
url = {https://doi.org/10.1109/LRA.2022.3141762},
doi = {10.1109/LRA.2022.3141762},
timestamp = {Wed, 17 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ral/SalamEH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ral/ShuSCSBLYCSHH22,
author = {Tony Shu and
Christopher Shallal and
Ethan Chun and
Aashini Shah and
Angel Bu and
Daniel S. Levine and
Seong Ho Yeon and
Matthew E. Carney and
Hyungeun Song and
Tsung{-}Han Hsieh and
Hugh M. Herr},
title = {Modulation of Prosthetic Ankle Plantarflexion Through Direct Myoelectric
Control of a Subject-Optimized Neuromuscular Model},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {7},
number = {3},
pages = {7620--7627},
year = {2022},
url = {https://doi.org/10.1109/LRA.2022.3183762},
doi = {10.1109/LRA.2022.3183762},
timestamp = {Thu, 29 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ral/ShuSCSBLYCSHH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ram/LiMMLYFSST22,
author = {Hsieh{-}Yu Li and
Yuchen Ma and
M. Naufal A. Bin Miswadi and
Long Nguyen Nguyen Luu and
Liangjing Yang and
Shaohui Foong and
Gim Song Soh and
Espen Sivertsen and
U{-}Xuan Tan},
title = {Detect-Remove-Replace: {A} Robotic Solution That Enables Unmanned
Continuous 3D Printing},
journal = {{IEEE} Robotics Autom. Mag.},
volume = {29},
number = {2},
pages = {33--45},
year = {2022},
url = {https://doi.org/10.1109/MRA.2021.3103478},
doi = {10.1109/MRA.2021.3103478},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ram/LiMMLYFSST22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scirobotics/SaeidiOKWLHKK22,
author = {Hamed Saeidi and
Justin D. Opfermann and
Michael Kam and
Shuwen Wei and
Simon L{\'{e}}onard and
Michael H. Hsieh and
Jin U. Kang and
Axel Krieger},
title = {Autonomous robotic laparoscopic surgery for intestinal anastomosis},
journal = {Sci. Robotics},
volume = {7},
number = {62},
year = {2022},
url = {https://doi.org/10.1126/scirobotics.abj2908},
doi = {10.1126/SCIROBOTICS.ABJ2908},
timestamp = {Wed, 23 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/scirobotics/SaeidiOKWLHKK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/OtgonboldGAATHC22,
author = {Munkh{-}Erdene Otgonbold and
Munkhjargal Gochoo and
Fady Alnajjar and
Luqman Ali and
Tan{-}Hsu Tan and
Jun{-}Wei Hsieh and
Ping{-}Yang Chen},
title = {{SHEL5K:} An Extended Dataset and Benchmarking for Safety Helmet Detection},
journal = {Sensors},
volume = {22},
number = {6},
pages = {2315},
year = {2022},
url = {https://doi.org/10.3390/s22062315},
doi = {10.3390/S22062315},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/OtgonboldGAATHC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sj/WuSLYCHHCTCLHLJ22,
author = {Cheng{-}Wen Wu and
Ming{-}Der Shieh and
Jenn{-}Jier James Lien and
Jar{-}Ferr Yang and
Wei{-}Ta Chu and
Tsang{-}Hai Huang and
Han{-}Chuan Hsieh and
Hung{-}Ta Chiu and
Kuo{-}Cheng Tu and
Yen{-}Ting Chen and
Shian{-}Yu Lin and
Jia{-}Jun Hu and
Chen{-}Huan Lin and
Cheng{-}Siang Jheng},
title = {Enhancing Fan Engagement in a 5G Stadium With AI-Based Technologies
and Live Streaming},
journal = {{IEEE} Syst. J.},
volume = {16},
number = {4},
pages = {6590--6601},
year = {2022},
url = {https://doi.org/10.1109/JSYST.2022.3169553},
doi = {10.1109/JSYST.2022.3169553},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sj/WuSLYCHHCTCLHLJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tacl/NanHMLVZKSKTMRT22,
author = {Linyong Nan and
Chiachun Hsieh and
Ziming Mao and
Xi Victoria Lin and
Neha Verma and
Rui Zhang and
Wojciech Kryscinski and
Hailey Schoelkopf and
Riley Kong and
Xiangru Tang and
Mutethia Mutuma and
Ben Rosand and
Isabel Trindade and
Renusree Bandaru and
Jacob Cunningham and
Caiming Xiong and
Dragomir R. Radev},
title = {FeTaQA: Free-form Table Question Answering},
journal = {Trans. Assoc. Comput. Linguistics},
volume = {10},
pages = {35--49},
year = {2022},
url = {https://doi.org/10.1162/tacl\_a\_00446},
doi = {10.1162/TACL\_A\_00446},
timestamp = {Wed, 19 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tacl/NanHMLVZKSKTMRT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/HsiehLSJMM22,
author = {Chiao Hsieh and
Yangge Li and
Dawei Sun and
Keyur Joshi and
Sasa Misailovic and
Sayan Mitra},
title = {Verifying Controllers With Vision-Based Perception Using Safe Approximate
Abstractions},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {41},
number = {11},
pages = {4205--4216},
year = {2022},
url = {https://doi.org/10.1109/TCAD.2022.3197508},
doi = {10.1109/TCAD.2022.3197508},
timestamp = {Thu, 27 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcad/HsiehLSJMM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/SieLCYLLHCT22,
author = {Syuan{-}Hao Sie and
Jye{-}Luen Lee and
Yi{-}Ren Chen and
Zuo{-}Wei Yeh and
Zhaofang Li and
Chih{-}Cheng Lu and
Chih{-}Cheng Hsieh and
Meng{-}Fan Chang and
Kea{-}Tiong Tang},
title = {{MARS:} Multimacro Architecture {SRAM} CIM-Based Accelerator With
Co-Designed Compressed Neural Networks},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {41},
number = {5},
pages = {1550--1562},
year = {2022},
url = {https://doi.org/10.1109/TCAD.2021.3082107},
doi = {10.1109/TCAD.2021.3082107},
timestamp = {Tue, 26 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcad/SieLCYLLHCT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tiis/HsiehWMTV22,
author = {Sheng{-}Jen Hsieh and
Andy R. Wang and
Anna Madison and
Chad Tossell and
Ewart de Visser},
title = {Adaptive Driving Assistant Model {(ADAM)} for Advising Drivers of
Autonomous Vehicles},
journal = {{ACM} Trans. Interact. Intell. Syst.},
volume = {12},
number = {3},
pages = {21:1--21:28},
year = {2022},
url = {https://doi.org/10.1145/3545994},
doi = {10.1145/3545994},
timestamp = {Thu, 15 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tiis/HsiehWMTV22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tit/DuHLYT22,
author = {Yuxuan Du and
Min{-}Hsiu Hsieh and
Tongliang Liu and
Shan You and
Dacheng Tao},
title = {Quantum Differentially Private Sparse Regression Learning},
journal = {{IEEE} Trans. Inf. Theory},
volume = {68},
number = {8},
pages = {5217--5233},
year = {2022},
url = {https://doi.org/10.1109/TIT.2022.3164726},
doi = {10.1109/TIT.2022.3164726},
timestamp = {Mon, 25 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tit/DuHLYT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/ZhengLSGYEH22,
author = {Jingyi Zheng and
Mingli Liang and
Sujata Sinha and
Linqiang Ge and
Wei Yu and
Arne D. Ekstrom and
Fushing Hsieh},
title = {Time-Frequency Analysis of Scalp {EEG} With Hilbert-Huang Transform
and Deep Learning},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {26},
number = {4},
pages = {1549--1559},
year = {2022},
url = {https://doi.org/10.1109/JBHI.2021.3110267},
doi = {10.1109/JBHI.2021.3110267},
timestamp = {Wed, 27 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/titb/ZhengLSGYEH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tjs/PuCTLHL22,
author = {Ying{-}Hung Pu and
Po{-}Sheng Chiu and
Yu{-}Shiuan Tsai and
Meng{-}Tsung Liu and
Yi{-}Zeng Hsieh and
Shih{-}Syun Lin},
title = {Aerial face recognition and absolute distance estimation using drone
and deep learning},
journal = {J. Supercomput.},
volume = {78},
number = {4},
pages = {5285--5305},
year = {2022},
url = {https://doi.org/10.1007/s11227-021-04088-6},
doi = {10.1007/S11227-021-04088-6},
timestamp = {Fri, 01 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tjs/PuCTLHL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/trob/YuSSH22,
author = {Xi Yu and
David Salda{\~{n}}a and
Daigo Shishika and
M. Ani Hsieh},
title = {Resilient Consensus in Robot Swarms With Periodic Motion and Intermittent
Communication},
journal = {{IEEE} Trans. Robotics},
volume = {38},
number = {1},
pages = {110--125},
year = {2022},
url = {https://doi.org/10.1109/TRO.2021.3088765},
doi = {10.1109/TRO.2021.3088765},
timestamp = {Tue, 15 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/trob/YuSSH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aicas/HsiehLLLCT22,
author = {Chia{-}Yu Hsieh and
Shih{-}Ting Lin and
Zhaofang Li and
Chih{-}Cheng Lu and
Meng{-}Fan Chang and
Kea{-}Tiong Tang},
title = {MARSv2: Multicore and Programmable Reconstruction Architecture {SRAM}
CIM-Based Accelerator with Lightweight Network},
booktitle = {4th {IEEE} International Conference on Artificial Intelligence Circuits
and Systems, {AICAS} 2022, Incheon, Republic of Korea, June 13-15,
2022},
pages = {383--386},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/AICAS54282.2022.9870005},
doi = {10.1109/AICAS54282.2022.9870005},
timestamp = {Fri, 16 Sep 2022 20:28:36 +0200},
biburl = {https://dblp.org/rec/conf/aicas/HsiehLLLCT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/ShenYH22,
author = {Li Shen and
Xi Yu and
M. Ani Hsieh},
title = {Topology Control of a Periodic Time-varying Communication Network
with Stochastic Temporal Links},
booktitle = {American Control Conference, {ACC} 2022, Atlanta, GA, USA, June 8-10,
2022},
pages = {4211--4217},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.23919/ACC53348.2022.9867517},
doi = {10.23919/ACC53348.2022.9867517},
timestamp = {Mon, 06 Nov 2023 12:57:51 +0100},
biburl = {https://dblp.org/rec/conf/amcc/ShenYH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biorob/ShuSCSBLYCSHH22,
author = {Tony Shu and
Christopher Shallal and
Ethan Chun and
Aashini Shah and
Angel Bu and
Daniel S. Levine and
Seong Ho Yeon and
Matthew E. Carney and
Hyungeun Song and
Tsung{-}Han Hsieh and
Hugh M. Herr},
title = {Modulation of Prosthetic Ankle Plantarflexion Through Direct Myoelectric
Control of a Subject-Optimized Neuromuscular Model},
booktitle = {9th {IEEE} {RAS/EMBS} International Conference for Biomedical Robotics
and Biomechatronics, BioRob 2022, Seoul, Korea, Republic of, August
21-24, 2022},
pages = {1--8},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/BioRob52689.2022.9925293},
doi = {10.1109/BIOROB52689.2022.9925293},
timestamp = {Thu, 29 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/biorob/ShuSCSBLYCSHH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/case/HsiehWKM22,
author = {Chiao Hsieh and
Daniel Wu and
Yubin Koh and
Sayan Mitra},
title = {Programming Abstractions for Simulation and Testing on Smart Manufacturing
Systems},
booktitle = {18th {IEEE} International Conference on Automation Science and Engineering,
{CASE} 2022, Mexico City, Mexico, August 20-24, 2022},
pages = {2287--2292},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/CASE49997.2022.9926564},
doi = {10.1109/CASE49997.2022.9926564},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/case/HsiehWKM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coco/HsiehMX22,
author = {Jun{-}Ting Hsieh and
Sidhanth Mohanty and
Jeff Xu},
editor = {Shachar Lovett},
title = {Certifying Solution Geometry in Random CSPs: Counts, Clusters and
Balance},
booktitle = {37th Computational Complexity Conference, {CCC} 2022, July 20-23,
2022, Philadelphia, PA, {USA}},
series = {LIPIcs},
volume = {234},
pages = {11:1--11:18},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2022},
url = {https://doi.org/10.4230/LIPIcs.CCC.2022.11},
doi = {10.4230/LIPICS.CCC.2022.11},
timestamp = {Wed, 21 Aug 2024 22:46:00 +0200},
biburl = {https://dblp.org/rec/conf/coco/HsiehMX22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/LiuMCHY22,
author = {Yong Liu and
Siqi Mai and
Xiangning Chen and
Cho{-}Jui Hsieh and
Yang You},
title = {Towards Efficient and Scalable Sharpness-Aware Minimization},
booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2022, New Orleans, LA, USA, June 18-24, 2022},
pages = {12350--12360},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/CVPR52688.2022.01204},
doi = {10.1109/CVPR52688.2022.01204},
timestamp = {Mon, 29 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/LiuMCHY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dars/EdwardsSH22,
author = {Victoria M. Edwards and
Thales C. Silva and
M. Ani Hsieh},
editor = {Julien Bourgeois and
Jamie Paik and
Beno{\^{\i}}t Piranda and
Justin Werfel and
Sabine Hauert and
Alyssa Pierson and
Heiko Hamann and
Tin Lun Lam and
Fumitoshi Matsuno and
Negar Mehr and
Abdallah Makhoul},
title = {Stochastic Nonlinear Ensemble Modeling and Control for Robot Team
Environmental Monitoring},
booktitle = {Distributed Autonomous Robotic Systems - 16th International Symposium,
{DARS} 2022, Montb{\'{e}}liard, France, 28-30 November 2022},
series = {Springer Proceedings in Advanced Robotics},
volume = {28},
pages = {83--99},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-51497-5\_7},
doi = {10.1007/978-3-031-51497-5\_7},
timestamp = {Tue, 13 Feb 2024 17:24:09 +0100},
biburl = {https://dblp.org/rec/conf/dars/EdwardsSH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dars/PanMH22,
author = {Lishuo Pan and
Sandeep Manjanna and
M. Ani Hsieh},
editor = {Julien Bourgeois and
Jamie Paik and
Beno{\^{\i}}t Piranda and
Justin Werfel and
Sabine Hauert and
Alyssa Pierson and
Heiko Hamann and
Tin Lun Lam and
Fumitoshi Matsuno and
Negar Mehr and
Abdallah Makhoul},
title = {{MARLAS:} Multi Agent Reinforcement Learning for Cooperated Adaptive
Sampling},
booktitle = {Distributed Autonomous Robotic Systems - 16th International Symposium,
{DARS} 2022, Montb{\'{e}}liard, France, 28-30 November 2022},
series = {Springer Proceedings in Advanced Robotics},
volume = {28},
pages = {347--362},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-51497-5\_25},
doi = {10.1007/978-3-031-51497-5\_25},
timestamp = {Tue, 13 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dars/PanMH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dars/SilvaEH22,
author = {Thales C. Silva and
Victoria Edwards and
M. Ani Hsieh},
editor = {Julien Bourgeois and
Jamie Paik and
Beno{\^{\i}}t Piranda and
Justin Werfel and
Sabine Hauert and
Alyssa Pierson and
Heiko Hamann and
Tin Lun Lam and
Fumitoshi Matsuno and
Negar Mehr and
Abdallah Makhoul},
title = {Proportional Control for Stochastic Regulation on Allocation of Multi-robots},
booktitle = {Distributed Autonomous Robotic Systems - 16th International Symposium,
{DARS} 2022, Montb{\'{e}}liard, France, 28-30 November 2022},
series = {Springer Proceedings in Advanced Robotics},
volume = {28},
pages = {363--377},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-51497-5\_26},
doi = {10.1007/978-3-031-51497-5\_26},
timestamp = {Tue, 13 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dars/SilvaEH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dars/SilvaS0H22,
author = {Thales C. Silva and
Li Shen and
Xi Yu and
M. Ani Hsieh},
editor = {Julien Bourgeois and
Jamie Paik and
Beno{\^{\i}}t Piranda and
Justin Werfel and
Sabine Hauert and
Alyssa Pierson and
Heiko Hamann and
Tin Lun Lam and
Fumitoshi Matsuno and
Negar Mehr and
Abdallah Makhoul},
title = {Receding Horizon Control on the Broadcast of Information in Stochastic
Networks},
booktitle = {Distributed Autonomous Robotic Systems - 16th International Symposium,
{DARS} 2022, Montb{\'{e}}liard, France, 28-30 November 2022},
series = {Springer Proceedings in Advanced Robotics},
volume = {28},
pages = {216--230},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-51497-5\_16},
doi = {10.1007/978-3-031-51497-5\_16},
timestamp = {Tue, 13 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dars/SilvaS0H22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/TevershamWHRTSZ22,
author = {James Teversham and
Steven S. Wong and
Bryan Hsieh and
Adrien Rapeaux and
Francesca Troiani and
Oscar Savolainen and
Zheng Zhang and
Michal Maslik and
Timothy G. Constandinou},
title = {Development of an Ultra Low-Cost SSVEP-based {BCI} Device for Real-Time
On-Device Decoding},
booktitle = {44th Annual International Conference of the {IEEE} Engineering in
Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland,
United Kingdom, July 11-15, 2022},
pages = {208--213},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/EMBC48229.2022.9871064},
doi = {10.1109/EMBC48229.2022.9871064},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/embc/TevershamWHRTSZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/DengWHWGSSXH22,
author = {Mingkai Deng and
Jianyu Wang and
Cheng{-}Ping Hsieh and
Yihan Wang and
Han Guo and
Tianmin Shu and
Meng Song and
Eric P. Xing and
Zhiting Hu},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {RLPrompt: Optimizing Discrete Text Prompts with Reinforcement Learning},
booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates,
December 7-11, 2022},
pages = {3369--3391},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.emnlp-main.222},
doi = {10.18653/V1/2022.EMNLP-MAIN.222},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/DengWHWGSSXH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emsoft/AbrahamMPOYHLSM22,
author = {Michael Abraham and
Aaron Mayne and
Tristan Perez and
{\'{I}}talo Romani de Oliveira and
Huafeng Yu and
Chiao Hsieh and
Yangge Li and
Dawei Sun and
Sayan Mitra},
title = {Industry-track: Challenges in Rebooting Autonomy with Deep Learned
Perception},
booktitle = {International Conference on Embedded Software, {EMSOFT} 2022, Shanghai,
China, October 7-14, 2022},
pages = {17--20},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/EMSOFT55006.2022.00016},
doi = {10.1109/EMSOFT55006.2022.00016},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emsoft/AbrahamMPOYHLSM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gcce/IshibashiZLHY22,
author = {A. Ishibashi and
Z. Zhou and
S. Liang and
T. Hsieh and
M. Yasutake},
title = {Compact Clean Unit System Platform {(CUSP)} for Quality-of-life Improvement},
booktitle = {11th {IEEE} Global Conference on Consumer Electronics, {GCCE} 2022,
Osaka, Japan, October 18-21, 2022},
pages = {710--711},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/GCCE56475.2022.10014219},
doi = {10.1109/GCCE56475.2022.10014219},
timestamp = {Sat, 28 Jan 2023 23:52:06 +0100},
biburl = {https://dblp.org/rec/conf/gcce/IshibashiZLHY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/WeiHLT22,
author = {Crystal T. Wei and
Ming{-}En Hsieh and
Chien{-}Liang Liu and
Vincent S. Tseng},
title = {Contrastive Heartbeats: Contrastive Learning for Self-Supervised {ECG}
Representation and Phenotyping},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2022, Virtual and Singapore, 23-27 May 2022},
pages = {1126--1130},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICASSP43922.2022.9746887},
doi = {10.1109/ICASSP43922.2022.9746887},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/WeiHLT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/ChangHH22,
author = {Chuan{-}Yu Chang and
Min{-}Hong Hsieh and
Shao{-}Min Hsu},
title = {Localization of Fresh and Old Fracture in Spine {CT} Images Using
{YOLOR}},
booktitle = {{IEEE} International Conference on Consumer Electronics - Taiwan,
{ICCE-TW} 2022, Taipei, Taiwan, July 6-8, 2022},
pages = {253--254},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICCE-Taiwan55306.2022.9869285},
doi = {10.1109/ICCE-TAIWAN55306.2022.9869285},
timestamp = {Fri, 09 Sep 2022 16:55:40 +0200},
biburl = {https://dblp.org/rec/conf/icce-tw/ChangHH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/ChienCHYZMD22,
author = {Eli Chien and
Wei{-}Cheng Chang and
Cho{-}Jui Hsieh and
Hsiang{-}Fu Yu and
Jiong Zhang and
Olgica Milenkovic and
Inderjit S. Dhillon},
title = {Node Feature Extraction by Self-Supervised Multi-scale Neighborhood
Prediction},
booktitle = {The Tenth International Conference on Learning Representations, {ICLR}
2022, Virtual Event, April 25-29, 2022},
publisher = {OpenReview.net},
year = {2022},
url = {https://openreview.net/forum?id=KJggliHbs8},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iclr/ChienCHYZMD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/ChengLCDH22,
author = {Minhao Cheng and
Qi Lei and
Pin{-}Yu Chen and
Inderjit S. Dhillon and
Cho{-}Jui Hsieh},
editor = {Luc De Raedt},
title = {{CAT:} Customized Adversarial Training for Improved Robustness},
booktitle = {Proceedings of the Thirty-First International Joint Conference on
Artificial Intelligence, {IJCAI} 2022, Vienna, Austria, 23-29 July
2022},
pages = {673--679},
publisher = {ijcai.org},
year = {2022},
url = {https://doi.org/10.24963/ijcai.2022/95},
doi = {10.24963/IJCAI.2022/95},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/ChengLCDH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/YuFH0R22,
author = {Cheng Yu and
Szu{-}Wei Fu and
Tsun{-}An Hsieh and
Yu Tsao and
Mirco Ravanelli},
editor = {Hanseok Ko and
John H. L. Hansen},
title = {{OSSEM:} one-shot speaker adaptive speech enhancement using meta learning},
booktitle = {23rd Annual Conference of the International Speech Communication Association,
Interspeech 2022, Incheon, Korea, September 18-22, 2022},
pages = {981--985},
publisher = {{ISCA}},
year = {2022},
url = {https://doi.org/10.21437/Interspeech.2022-10283},
doi = {10.21437/INTERSPEECH.2022-10283},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/YuFH0R22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/MalenciaMHP022,
author = {Matthew Malencia and
Sandeep Manjanna and
M. Ani Hsieh and
George J. Pappas and
Vijay Kumar},
title = {Adaptive Sampling of Latent Phenomena using Heterogeneous Robot Teams
(ASLaP-HR)},
booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems,
{IROS} 2022, Kyoto, Japan, October 23-27, 2022},
pages = {8762--8769},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/IROS47612.2022.9982270},
doi = {10.1109/IROS47612.2022.9982270},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iros/MalenciaMHP022.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isqed/LiuCWHLCLC22,
author = {Shi{-}Tang Liu and
Jia{-}Xian Chen and
Yu{-}Tsung Wu and
Chao{-}Ho Hsieh and
Chien{-}Mo James Li and
Norman Chang and
Ying{-}Shiun Li and
Wentze Chuang},
title = {Low-IR-Drop Test Pattern Regeneration Using {A} Fast Predictor},
booktitle = {23rd International Symposium on Quality Electronic Design, {ISQED}
2022, Santa Clara, CA, USA, April 6-7, 2022},
pages = {27--32},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISQED54688.2022.9806245},
doi = {10.1109/ISQED54688.2022.9806245},
timestamp = {Mon, 04 Jul 2022 17:06:19 +0200},
biburl = {https://dblp.org/rec/conf/isqed/LiuCWHLCLC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ChiuYTHCWCHLLCP22,
author = {Yen{-}Cheng Chiu and
Chia{-}Sheng Yang and
Shih{-}Hsih Teng and
Hsiao{-}Yu Huang and
Fu{-}Chun Chang and
Yuan Wu and
Yu{-}An Chien and
Fang{-}Ling Hsieh and
Chung{-}Yuan Li and
Guan{-}Yi Lin and
Po{-}Jung Chen and
Tsen{-}Hsiang Pan and
Chung{-}Chuan Lo and
Win{-}San Khwa and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Chieh{-}Pu Lo and
Yu{-}Der Chih and
Tsung{-}Yung Jonathan Chang and
Meng{-}Fan Chang},
title = {A 22nm 4Mb {STT-MRAM} Data-Encrypted Near-Memory Computation Macro
with a 192GB/s Read-and-Decryption Bandwidth and 25.1-55.1TOPS/W 8b
{MAC} for {AI} Operations},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2022,
San Francisco, CA, USA, February 20-26, 2022},
pages = {178--180},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISSCC42614.2022.9731621},
doi = {10.1109/ISSCC42614.2022.9731621},
timestamp = {Tue, 20 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/ChiuYTHCWCHLLCP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/HungHHCWSKLLHTC22,
author = {Je{-}Min Hung and
Yen{-}Hsiang Huang and
Sheng{-}Po Huang and
Fu{-}Chun Chang and
Tai{-}Hao Wen and
Chin{-}I Su and
Win{-}San Khwa and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Yu{-}Der Chih and
Tsung{-}Yung Jonathan Chang and
Meng{-}Fan Chang},
title = {An 8-Mb DC-Current-Free Binary-to-8b Precision ReRAM Nonvolatile Computing-in-Memory
Macro using Time-Space-Readout with 1286.4-21.6TOPS/W for Edge-AI
Devices},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2022,
San Francisco, CA, USA, February 20-26, 2022},
pages = {1--3},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISSCC42614.2022.9731715},
doi = {10.1109/ISSCC42614.2022.9731715},
timestamp = {Mon, 21 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/HungHHCWSKLLHTC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/WuSCHRCWCLHLSCL22,
author = {Ping{-}Chun Wu and
Jian{-}Wei Su and
Yen{-}Lin Chung and
Li{-}Yang Hong and
Jin{-}Sheng Ren and
Fu{-}Chun Chang and
Yuan Wu and
Ho{-}Yu Chen and
Chen{-}Hsun Lin and
Hsu{-}Ming Hsiao and
Sih{-}Han Li and
Shyh{-}Shyuan Sheu and
Shih{-}Chieh Chang and
Wei{-}Chung Lo and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Chih{-}I Wu and
Meng{-}Fan Chang},
title = {A 28nm 1Mb Time-Domain Computing-in-Memory 6T-SRAM Macro with a 6.6ns
Latency, 1241GOPS and 37.01TOPS/W for 8b-MAC Operations for Edge-AI
Devices},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2022,
San Francisco, CA, USA, February 20-26, 2022},
pages = {1--3},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISSCC42614.2022.9731681},
doi = {10.1109/ISSCC42614.2022.9731681},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/WuSCHRCWCLHLSCL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc/LinCHLFH22,
author = {Wei{-}Chen Lin and
Chun Chen and
Chao{-}Ho Hsieh and
James Chien{-}Mo Li and
Eric Jia{-}Wei Fang and
Sung S.{-}Y. Hsueh},
title = {ML-Assisted VminBinning with Multiple Guard Bands for Low Power Consumption},
booktitle = {{IEEE} International Test Conference, {ITC} 2022, Anaheim, CA, USA,
September 23-30, 2022},
pages = {213--218},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ITC50671.2022.00029},
doi = {10.1109/ITC50671.2022.00029},
timestamp = {Thu, 05 Jan 2023 13:13:27 +0100},
biburl = {https://dblp.org/rec/conf/itc/LinCHLFH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/TsengSCCKH22,
author = {Yu{-}Hsiang Tseng and
Cing{-}Fang Shih and
Pin{-}Er Chen and
Hsin{-}Yu Chou and
Mao{-}Chang Ku and
Shu{-}Kai Hsieh},
editor = {Nicoletta Calzolari and
Fr{\'{e}}d{\'{e}}ric B{\'{e}}chet and
Philippe Blache and
Khalid Choukri and
Christopher Cieri and
Thierry Declerck and
Sara Goggi and
Hitoshi Isahara and
Bente Maegaard and
Joseph Mariani and
H{\'{e}}l{\`{e}}ne Mazo and
Jan Odijk and
Stelios Piperidis},
title = {CxLM: {A} Construction and Context-aware Language Model},
booktitle = {Proceedings of the Thirteenth Language Resources and Evaluation Conference,
{LREC} 2022, Marseille, France, 20-25 June 2022},
pages = {6361--6369},
publisher = {European Language Resources Association},
year = {2022},
url = {https://aclanthology.org/2022.lrec-1.683},
timestamp = {Mon, 10 Oct 2022 16:57:52 +0200},
biburl = {https://dblp.org/rec/conf/lrec/TsengSCCKH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micro/HuW0LLWLHLSHHLC22,
author = {Han{-}Wen Hu and
Wei{-}Chen Wang and
Yuan{-}Hao Chang and
Yung{-}Chun Lee and
Bo{-}Rong Lin and
Huai{-}Mu Wang and
Yen{-}Po Lin and
Yu{-}Ming Huang and
Chong{-}Ying Lee and
Tzu{-}Hsiang Su and
Chih{-}Chang Hsieh and
Chia{-}Ming Hu and
Yi{-}Ting Lai and
Chung Kuang Chen and
Han{-}Sung Chen and
Hsiang{-}Pang Li and
Tei{-}Wei Kuo and
Meng{-}Fan Chang and
Keh{-}Chung Wang and
Chun{-}Hsiung Hung and
Chih{-}Yuan Lu},
title = {{ICE:} An Intelligent Cognition Engine with 3D NAND-based In-Memory
Computing for Vector Similarity Search Acceleration},
booktitle = {55th {IEEE/ACM} International Symposium on Microarchitecture, {MICRO}
2022, Chicago, IL, USA, October 1-5, 2022},
pages = {763--783},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/MICRO56248.2022.00058},
doi = {10.1109/MICRO56248.2022.00058},
timestamp = {Wed, 04 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/micro/HuW0LLWLHLSHHLC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miipop/PillaiHHCFM22,
author = {Parvathy Sudhir Pillai and
Scott S. Hsieh and
David R. Holmes III and
Rickey E. Carter and
Joel G. Fletcher and
Cynthia H. McCollough},
editor = {Claudia R. Mello{-}Thoms and
Sian Taylor{-}Phillips},
title = {Individualized and generalized learner models for predicting missed
hepatic metastases},
booktitle = {Medical Imaging 2022: Image Perception, Observer Performance, and
Technology Assessment, San Diego, CA, USA, February 20-24, 2022 /
Online, March 21-27, 2022},
series = {{SPIE} Proceedings},
volume = {12035},
publisher = {{SPIE}},
year = {2022},
url = {https://doi.org/10.1117/12.2612745},
doi = {10.1117/12.2612745},
timestamp = {Thu, 21 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/miipop/PillaiHHCFM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/0002KLLHS22,
author = {Qin Ding and
Yue Kang and
Yi{-}Wei Liu and
Thomas Chun Man Lee and
Cho{-}Jui Hsieh and
James Sharpnack},
editor = {Sanmi Koyejo and
S. Mohamed and
A. Agarwal and
Danielle Belgrave and
K. Cho and
A. Oh},
title = {Syndicated Bandits: {A} Framework for Auto Tuning Hyper-parameters
in Contextual Bandit Algorithms},
booktitle = {Advances in Neural Information Processing Systems 35: Annual Conference
on Neural Information Processing Systems 2022, NeurIPS 2022, New Orleans,
LA, USA, November 28 - December 9, 2022},
year = {2022},
url = {http://papers.nips.cc/paper\_files/paper/2022/hash/082e82cae0232f45f27fdd2612c31f8a-Abstract-Conference.html},
timestamp = {Mon, 08 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/0002KLLHS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LiuMCCHY22,
author = {Yong Liu and
Siqi Mai and
Minhao Cheng and
Xiangning Chen and
Cho{-}Jui Hsieh and
Yang You},
editor = {Sanmi Koyejo and
S. Mohamed and
A. Agarwal and
Danielle Belgrave and
K. Cho and
A. Oh},
title = {Random Sharpness-Aware Minimization},
booktitle = {Advances in Neural Information Processing Systems 35: Annual Conference
on Neural Information Processing Systems 2022, NeurIPS 2022, New Orleans,
LA, USA, November 28 - December 9, 2022},
year = {2022},
url = {http://papers.nips.cc/paper\_files/paper/2022/hash/9b79416c0dc4b09feaa169ed5cdd63d4-Abstract-Conference.html},
timestamp = {Mon, 29 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nips/LiuMCCHY22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggrapha/YangHLSO22,
author = {Ting{-}Hua Yang and
Hsien{-}Yuan Hsieh and
Tse{-}Han Lin and
Wei{-}Zen Sun and
Ming Ouhyoung},
editor = {Soon Ki Jung and
Neil A. Dodgson},
title = {A High Frame Rate Affordable Nystagmus Detection Method with Smartphones
Used in Outpatient Clinic},
booktitle = {{SIGGRAPH} Asia 2022 Posters, {SA} 2022, Daegu, Republic of Korea,
December 6-9, 2022},
pages = {12:1--12:2},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3550082.3564164},
doi = {10.1145/3550082.3564164},
timestamp = {Sun, 25 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/siggrapha/YangHLSO22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ssrr/KumarDSH22,
author = {Arjun Kumar and
Alexandra Davatzes and
Thomas F. Shipley and
M. Ani Hsieh},
title = {{LIDAR} SLAM-Based Dense Reconstructions of Natural Environments:
Field Evaluations},
booktitle = {{IEEE} International Symposium on Safety, Security, and Rescue Robotics,
{SSRR} 2022, Sevilla, Spain, November 8-10, 2022},
pages = {116--121},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/SSRR56537.2022.10018616},
doi = {10.1109/SSRR56537.2022.10018616},
timestamp = {Wed, 08 Feb 2023 22:09:23 +0100},
biburl = {https://dblp.org/rec/conf/ssrr/KumarDSH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/HongLHHWCLC22,
author = {Zhong{-}Jie Hong and
Demin Liu and
Shu{-}Ting Hsieh and
Han{-}Wen Hu and
Ming{-}Wei Weng and
Chih{-}I Cho and
Jui{-}Han Liu and
Kuan{-}Neng Chen},
title = {Room Temperature Cu-Cu Direct Bonding Using Wetting/Passivation Scheme
for 3D Integration and Packaging},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022},
pages = {387--388},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830175},
doi = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830175},
timestamp = {Thu, 04 Aug 2022 10:53:40 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/HongLHHWCLC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/HsiehCTLLLHSGC22,
author = {E. R. Hsieh and
J. K. Chang and
T. Y. Tang and
Y. J. Li and
C. W. Liang and
M. Y. Lin and
S. Y. Huang and
C. J. Su and
J. C. Guo and
Steve S. Chung},
title = {NVDimm-FE: {A} High-density 3D Architecture of 3-bit/c 2TnCFE to Break
Great Memory Wall with 10 ns of PGM-pulse, 10\({}^{\mbox{10}}\) Cycles
of Endurance, and Decade Lifetime at 103 {\textdegree}C},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022},
pages = {359--360},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830515},
doi = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830515},
timestamp = {Thu, 04 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsit/HsiehCTLLLHSGC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/LeeLCLHHWLSC22,
author = {Shuenn{-}Yuh Lee and
Hao{-}Yun Lee and
Ding{-}Siang Ciou and
Zhan{-}Xian Liao and
Peng{-}Wei Huang and
Yi{-}Ting Hsieh and
Yi{-}Chieh Wei and
Chia{-}Yu Lin and
Meng{-}Dar Shieh and
Ju{-}Yi Chen},
title = {A Wireless Urine Detection System and Platform with Power-Efficient
Electrochemical Readout {ASIC} and {ABTS-CNT} Biosensor},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022},
pages = {246--247},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830325},
doi = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830325},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsit/LeeLCLHHWLSC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsit/LiaoHLTLLHWCRTC22,
author = {C.{-}Y. Liao and
K.{-}Y. Hsiang and
Z.{-}F. Lou and
H.{-}C. Tseng and
C.{-}Y. Lin and
Z.{-}X. Li and
F.{-}C. Hsieh and
C. C. Wang and
F.{-}S. Chang and
W.{-}C. Ray and
Y.{-}Y. Tseng and
Shu{-}Tong Chang and
T. C. Chen and
Min{-}Hung Lee},
title = {Endurance {\textgreater} 10\({}^{\mbox{11}}\) Cycling of 3D {GAA}
Nanosheet Ferroelectric {FET} with Stacked HfZrO2 to Homogenize Corner
Field Toward Mitigate Dead Zone for High-Density eNVM},
booktitle = {{IEEE} Symposium on {VLSI} Technology and Circuits {(VLSI} Technology
and Circuits 2022), Honolulu, HI, USA, June 12-17, 2022},
pages = {1--2},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/VLSITechnologyandCir46769.2022.9830345},
doi = {10.1109/VLSITECHNOLOGYANDCIR46769.2022.9830345},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsit/LiaoHLTLLHWCRTC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/YuanHRVCG22,
author = {Shuai Yuan and
Frank Hsieh and
Shahzada Rasool and
Eugene Visotsky and
Mark Cudak and
Amitava Ghosh},
title = {Interference Analysis of {HAPS} Coexistence on Terrestrial Mobile
Networks},
booktitle = {{IEEE} Wireless Communications and Networking Conference, {WCNC} 2022,
Austin, TX, USA, April 10-13, 2022},
pages = {2494--2499},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/WCNC51071.2022.9771541},
doi = {10.1109/WCNC51071.2022.9771541},
timestamp = {Tue, 24 May 2022 15:39:22 +0200},
biburl = {https://dblp.org/rec/conf/wcnc/YuanHRVCG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cscw/2022c,
editor = {Gary Hsieh and
Anthony Tang and
Morgan G. Ames and
Sharon Ding and
Susan R. Fussell and
Vera Liao and
Andr{\'{e}}s Monroy{-}Hern{\'{a}}ndez and
Sean Munson and
Irina Shklovski and
John Tang},
title = {Companion Computer Supported Cooperative Work and Social Computing,
{CSCW} 2022, Virtual Event, Taiwan, November 8-22, 2022},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3500868},
doi = {10.1145/3500868},
isbn = {978-1-4503-9190-0},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cscw/2022c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-09208,
author = {I{-}Hsi Kao and
Ya{-}Zhu Yian and
Jian{-}an Su and
Yi{-}Horng Lai and
Jau{-}Woei Perng and
Tung{-}Li Hsieh and
Yi{-}Shueh Tsai and
Min{-}Shiu Hsieh},
title = {Design of Sensor Fusion Driver Assistance System for Active Pedestrian
Safety},
journal = {CoRR},
volume = {abs/2201.09208},
year = {2022},
url = {https://arxiv.org/abs/2201.09208},
eprinttype = {arXiv},
eprint = {2201.09208},
timestamp = {Tue, 01 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2201-09208.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2202-00480,
author = {Alvin Chaidrata and
Mariyam Imtha Shafeeu and
Sze Ker Chew and
Zhiyuan Chen and
Jin Sheng Cham and
Zi Li Yong and
Uen Hsieh Yap and
Dania Imanina Binti Kamarul Bahrin},
title = {Intent Matching based Customer Services Chatbot with Natural Language
Understanding},
journal = {CoRR},
volume = {abs/2202.00480},
year = {2022},
url = {https://arxiv.org/abs/2202.00480},
eprinttype = {arXiv},
eprint = {2202.00480},
timestamp = {Wed, 09 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2202-00480.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-02714,
author = {Yong Liu and
Siqi Mai and
Xiangning Chen and
Cho{-}Jui Hsieh and
Yang You},
title = {Towards Efficient and Scalable Sharpness-Aware Minimization},
journal = {CoRR},
volume = {abs/2203.02714},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2203.02714},
doi = {10.48550/ARXIV.2203.02714},
eprinttype = {arXiv},
eprint = {2203.02714},
timestamp = {Tue, 30 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2203-02714.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-12548,
author = {Mingkai Deng and
Jianyu Wang and
Cheng{-}Ping Hsieh and
Yihan Wang and
Han Guo and
Tianmin Shu and
Meng Song and
Eric P. Xing and
Zhiting Hu},
title = {RLPrompt: Optimizing Discrete Text Prompts With Reinforcement Learning},
journal = {CoRR},
volume = {abs/2205.12548},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.12548},
doi = {10.48550/ARXIV.2205.12548},
eprinttype = {arXiv},
eprint = {2205.12548},
timestamp = {Mon, 30 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-12548.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-03066,
author = {Jinkai Tian and
Xiaoyu Sun and
Yuxuan Du and
Shanshan Zhao and
Qing Liu and
Kaining Zhang and
Wei Yi and
Wanrong Huang and
Chaoyue Wang and
Xingyao Wu and
Min{-}Hsiu Hsieh and
Tongliang Liu and
Wenjing Yang and
Dacheng Tao},
title = {Recent Advances for Quantum Neural Networks in Generative Learning},
journal = {CoRR},
volume = {abs/2206.03066},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.03066},
doi = {10.48550/ARXIV.2206.03066},
eprinttype = {arXiv},
eprint = {2206.03066},
timestamp = {Tue, 21 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-03066.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2207-07751,
author = {Lishuo Pan and
Sandeep Manjanna and
Vijay Kumar and
M. Ani Hsieh},
title = {{MARLAS:} Multi Agent Reinforcement Learning for cooperated Adaptive
Sampling},
journal = {CoRR},
volume = {abs/2207.07751},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2207.07751},
doi = {10.48550/ARXIV.2207.07751},
eprinttype = {arXiv},
eprint = {2207.07751},
timestamp = {Tue, 19 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2207-07751.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2207-10850,
author = {Jun{-}Ting Hsieh and
Pravesh K. Kothari and
Sidhanth Mohanty},
title = {A simple and sharper proof of the hypergraph Moore bound},
journal = {CoRR},
volume = {abs/2207.10850},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2207.10850},
doi = {10.48550/ARXIV.2207.10850},
eprinttype = {arXiv},
eprint = {2207.10850},
timestamp = {Mon, 25 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2207-10850.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-02232,
author = {Keyur Joshi and
Chiao Hsieh and
Sayan Mitra and
Sasa Misailovic},
title = {Estimating Uncertainty of Autonomous Vehicle Systems with Generalized
Polynomial Chaos},
journal = {CoRR},
volume = {abs/2208.02232},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2208.02232},
doi = {10.48550/ARXIV.2208.02232},
eprinttype = {arXiv},
eprint = {2208.02232},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2208-02232.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-06053,
author = {Matthew Malencia and
Sandeep Manjanna and
M. Ani Hsieh and
George J. Pappas and
Vijay Kumar},
title = {Adaptive Sampling of Latent Phenomena using Heterogeneous Robot Teams
(ASLaP-HR)},
journal = {CoRR},
volume = {abs/2208.06053},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2208.06053},
doi = {10.48550/ARXIV.2208.06053},
eprinttype = {arXiv},
eprint = {2208.06053},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2208-06053.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-00982,
author = {Chiao Hsieh and
Yangge Li and
Yubin Koh and
Sayan Mitra},
title = {Assuring safety of vision-based swarm formation control},
journal = {CoRR},
volume = {abs/2210.00982},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.00982},
doi = {10.48550/ARXIV.2210.00982},
eprinttype = {arXiv},
eprint = {2210.00982},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-00982.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-13291,
author = {Holger R. Roth and
Yan Cheng and
Yuhong Wen and
Isaac Yang and
Ziyue Xu and
Yuan{-}Ting Hsieh and
Kristopher Kersten and
Ahmed Harouni and
Can Zhao and
Kevin Lu and
Zhihong Zhang and
Wenqi Li and
Andriy Myronenko and
Dong Yang and
Sean Yang and
Nicola Rieke and
Abood Quraini and
Chester Chen and
Daguang Xu and
Nic Ma and
Prerna Dogra and
Mona Flores and
Andrew Feng},
title = {{NVIDIA} {FLARE:} Federated Learning from Simulation to Real-World},
journal = {CoRR},
volume = {abs/2210.13291},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.13291},
doi = {10.48550/ARXIV.2210.13291},
eprinttype = {arXiv},
eprint = {2210.13291},
timestamp = {Tue, 26 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-13291.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-00635,
author = {Yihan Wang and
Si Si and
Daliang Li and
Michal Lukasik and
Felix X. Yu and
Cho{-}Jui Hsieh and
Inderjit S. Dhillon and
Sanjiv Kumar},
title = {Preserving In-Context Learning ability in Large Language Model Fine-tuning},
journal = {CoRR},
volume = {abs/2211.00635},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.00635},
doi = {10.48550/ARXIV.2211.00635},
eprinttype = {arXiv},
eprint = {2211.00635},
timestamp = {Fri, 04 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-00635.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-01189,
author = {Tsun{-}An Hsieh and
Chao{-}Han Huck Yang and
Pin{-}Yu Chen and
Sabato Marco Siniscalchi and
Yu Tsao},
title = {Inference and Denoise: Causal Inference-based Neural Speech Enhancement},
journal = {CoRR},
volume = {abs/2211.01189},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.01189},
doi = {10.48550/ARXIV.2211.01189},
eprinttype = {arXiv},
eprint = {2211.01189},
timestamp = {Fri, 04 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-01189.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-01503,
author = {Tahiya Salam and
Alice Kate Li and
M. Ani Hsieh},
title = {Online Estimation of the Koopman Operator Using Fourier Features},
journal = {CoRR},
volume = {abs/2212.01503},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.01503},
doi = {10.48550/ARXIV.2212.01503},
eprinttype = {arXiv},
eprint = {2212.01503},
timestamp = {Thu, 08 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-01503.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-09808,
author = {Thales C. Silva and
Li Shen and
Xi Yu and
M. Ani Hsieh},
title = {Receding Horizon Control on the Broadcast of Information in Stochastic
Networks},
journal = {CoRR},
volume = {abs/2212.09808},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.09808},
doi = {10.48550/ARXIV.2212.09808},
eprinttype = {arXiv},
eprint = {2212.09808},
timestamp = {Mon, 30 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-09808.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-09816,
author = {Thales C. Silva and
Victoria M. Edwards and
M. Ani Hsieh},
title = {Proportional Control for Stochastic Regulation on Allocation of Multi-Robots},
journal = {CoRR},
volume = {abs/2212.09816},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.09816},
doi = {10.48550/ARXIV.2212.09816},
eprinttype = {arXiv},
eprint = {2212.09816},
timestamp = {Wed, 17 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-09816.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-11447,
author = {Victoria M. Edwards and
Thales C. Silva and
M. Ani Hsieh},
title = {Stochastic Nonlinear Ensemble Modeling and Control for Robot Team
Environmental Monitoring},
journal = {CoRR},
volume = {abs/2212.11447},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.11447},
doi = {10.48550/ARXIV.2212.11447},
eprinttype = {arXiv},
eprint = {2212.11447},
timestamp = {Wed, 17 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-11447.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:series/sbcysec/WangH21,
author = {Shun{-}Yung Kevin Wang and
Ming{-}Li Hsieh},
title = {Digital Robbery - {ATM} Hacking and Implications},
series = {Springer Briefs in Cybersecurity},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-70706-4},
doi = {10.1007/978-3-030-70706-4},
isbn = {978-3-030-70705-7},
timestamp = {Mon, 03 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/series/sbcysec/WangH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/JangHYJ21,
author = {Sheng{-}Lyang Jang and
Chia{-}Tung Hsieh and
Tzu{-}Chin Yang and
Miin{-}Horng Juang},
title = {Current Reused 8: 1 Injection Locked Frequency Divider Using Unbalanced
Ring Oscillator Frequency Divider},
journal = {{IEEE} Access},
volume = {9},
pages = {124921--124930},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3111084},
doi = {10.1109/ACCESS.2021.3111084},
timestamp = {Wed, 06 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/JangHYJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/arobots/SaldanaAHCK21,
author = {David Salda{\~{n}}a and
Renato M. Assun{\c{c}}{\~{a}}o and
M. Ani Hsieh and
Mario F. M. Campos and
Vijay Kumar},
title = {Estimating boundary dynamics using robotic sensor networks with pointwise
measurements},
journal = {Auton. Robots},
volume = {45},
number = {2},
pages = {193--208},
year = {2021},
url = {https://doi.org/10.1007/s10514-020-09954-5},
doi = {10.1007/S10514-020-09954-5},
timestamp = {Tue, 23 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/arobots/SaldanaAHCK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ce/LiuHWCCTCH21,
author = {Chen{-}Chung Liu and
I{-}Chen Hsieh and
Cai{-}Ting Wen and
Ming{-}Hua Chang and
Shih{-}Hsun Fan Chiang and
Meng{-}Jung Tsai and
Chia{-}Jung Chang and
Fu{-}Kwun Hwang},
title = {The affordances and limitations of collaborative science simulations:
The analysis from multiple evidences},
journal = {Comput. Educ.},
volume = {160},
pages = {104029},
year = {2021},
url = {https://doi.org/10.1016/j.compedu.2020.104029},
doi = {10.1016/J.COMPEDU.2020.104029},
timestamp = {Wed, 16 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ce/LiuHWCCTCH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cnsns/MancasRH21,
author = {Stefan C. Mancas and
Haret C. Rosu and
Chun{-}Chung Hsieh},
title = {Radius evolution for bubbles with elastic shells},
journal = {Commun. Nonlinear Sci. Numer. Simul.},
volume = {103},
pages = {106003},
year = {2021},
url = {https://doi.org/10.1016/j.cnsns.2021.106003},
doi = {10.1016/J.CNSNS.2021.106003},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cnsns/MancasRH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ixda/AndolinaHKNCSGM21,
author = {Salvatore Andolina and
Yi{-}Ta Hsieh and
Denis Kalkofen and
Antti Nurminen and
Diogo Cabral and
Anna Spagnolli and
Luciano Gamberini and
Ann Morrison and
Dieter Schmalstieg and
Giulio Jacucci},
title = {Designing for Mixed Reality Urban Exploration},
journal = {IxD{\&}A},
volume = {48},
pages = {33--49},
year = {2021},
url = {http://ixdea.uniroma2.it/inevent/events/idea2010/index.php?s=10\&a=10\&link=ToC\_48\_P\&link=48\_2\_abstract},
timestamp = {Wed, 08 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ixda/AndolinaHKNCSGM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcal/HwangCSH21,
author = {Gwo{-}Jen Hwang and
Shao{-}Chen Chang and
Yanjie Song and
Min{-}Chuan Hsieh},
title = {Powering up flipped learning: An online learning environment with
a concept map-guided problem-posing strategy},
journal = {J. Comput. Assist. Learn.},
volume = {37},
number = {2},
pages = {429--445},
year = {2021},
url = {https://doi.org/10.1111/jcal.12499},
doi = {10.1111/JCAL.12499},
timestamp = {Fri, 12 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcal/HwangCSH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jdi/YiPCCCHHSYLMBM21,
author = {Thomas Yi and
Ian Pan and
Scott Collins and
Fiona Chen and
Robert Cueto and
Ben Hsieh and
Celina Hsieh and
Jessica L. Smith and
Li Yang and
Wei{-}hua Liao and
Lisa H. Merck and
Harrison X. Bai and
Derek Merck},
title = {{DICOM} Image ANalysis and Archive {(DIANA):} an Open-Source System
for Clinical {AI} Applications},
journal = {J. Digit. Imaging},
volume = {34},
number = {6},
pages = {1405--1413},
year = {2021},
url = {https://doi.org/10.1007/s10278-021-00488-5},
doi = {10.1007/S10278-021-00488-5},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jdi/YiPCCCHHSYLMBM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jifs/FongSCTSWH21,
author = {Cher{-}Min Fong and
Ming{-}Hung Shu and
Chao{-}Cheng Chung and
Tung{-}Lin Tsai and
I{-}Sheng Sun and
Hui{-}Wen Wang and
Pei{-}Chun Hsieh},
title = {Monolingual Consumers' Reactions in Cyber Market to GCCP, FCCP, and
{LCCP} Ad Appeals in Taiwan},
journal = {J. Intell. Fuzzy Syst.},
volume = {40},
number = {4},
pages = {8623--8637},
year = {2021},
url = {https://doi.org/10.3233/JIFS-189681},
doi = {10.3233/JIFS-189681},
timestamp = {Wed, 12 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jifs/FongSCTSWH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SiTHSLWLWLCCSLL21,
author = {Xin Si and
Yung{-}Ning Tu and
Wei{-}Hsing Huang and
Jian{-}Wei Su and
Pei{-}Jung Lu and
Jing{-}Hong Wang and
Ta{-}Wei Liu and
Ssu{-}Yen Wu and
Ruhui Liu and
Yen{-}Chi Chou and
Yen{-}Lin Chung and
William Shih and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Nan{-}Chun Lien and
Wei{-}Chiang Shih and
Yajuan He and
Qiang Li and
Meng{-}Fan Chang},
title = {A Local Computing Cell and 6T SRAM-Based Computing-in-Memory Macro
With 8-b {MAC} Operation for Edge {AI} Chips},
journal = {{IEEE} J. Solid State Circuits},
volume = {56},
number = {9},
pages = {2817--2831},
year = {2021},
url = {https://doi.org/10.1109/JSSC.2021.3073254},
doi = {10.1109/JSSC.2021.3073254},
timestamp = {Thu, 16 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/SiTHSLWLWLCCSLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/monet/HsuAHPL21,
author = {Chia{-}Ming Hsu and
Muhammad Zulfan Azhari and
He{-}Yen Hsieh and
Setya Widyawan Prakosa and
Jenq{-}Shiou Leu},
title = {Robust Network Intrusion Detection Scheme Using Long-Short Term Memory
Based Convolutional Neural Networks},
journal = {Mob. Networks Appl.},
volume = {26},
number = {3},
pages = {1137--1144},
year = {2021},
url = {https://doi.org/10.1007/s11036-020-01623-2},
doi = {10.1007/S11036-020-01623-2},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/monet/HsuAHPL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/natmi/PavlovicSMKKVWB21,
author = {Milena Pavlovic and
Lonneke Scheffer and
Keshav Motwani and
Chakravarthi Kanduri and
Radmila Kompova and
Nikolay Vazov and
Knut Waagan and
Fabian L. M. Bernal and
Alexandre Almeida Costa and
Brian Corrie and
Rahmad Akbar and
Ghadi S. Al Hajj and
Gabriel Balaban and
Todd M. Brusko and
Maria Chernigovskaya and
Scott Christley and
Lindsay G. Cowell and
Robert Frank and
Ivar Grytten and
Sveinung Gundersen and
Ingrid Hob{\ae}k Haff and
Eivind Hovig and
Ping{-}Han Hsieh and
G{\"{u}}nter Klambauer and
Marieke L. Kuijjer and
Christin Lund{-}Andersen and
Antonio Martini and
Thomas Minotto and
Johan Pensar and
Knut D. Rand and
Enrico Riccardi and
Philippe A. Robert and
Artur Rocha and
Andrei Slabodkin and
Igor Snapkov and
Ludvig Magne Sollid and
Dmytro Titov and
C{\'{e}}dric R. Weber and
Michael Widrich and
Gur Yaari and
Victor Greiff and
Geir Kjetil Sandve},
title = {The immuneML ecosystem for machine learning analysis of adaptive immune
receptor repertoires},
journal = {Nat. Mach. Intell.},
volume = {3},
number = {11},
pages = {936--944},
year = {2021},
url = {https://doi.org/10.1038/s42256-021-00413-z},
doi = {10.1038/S42256-021-00413-Z},
timestamp = {Thu, 18 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/natmi/PavlovicSMKKVWB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/ShihLHC21,
author = {Chia{-}Ming Shih and
Hsin{-}Chih Lo and
Meng{-}Chi Hsieh and
Jyh{-}Horng Chen},
title = {Functional quantitative susceptibility mapping (fQSM) of rat brain
during flashing light stimulation},
journal = {NeuroImage},
volume = {233},
pages = {117924},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2021.117924},
doi = {10.1016/J.NEUROIMAGE.2021.117924},
timestamp = {Sun, 16 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/ShihLHC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ojcands/HoHMC21,
author = {Wei{-}Hsiang Ho and
Yi{-}Hsun Hsieh and
Boris Murmann and
Wei{-}Zen Chen},
title = {A 32 Gb/s {PAM-4} Optical Transceiver With Active Back Termination
in 40 nm {CMOS} Technology},
journal = {{IEEE} Open J. Circuits Syst.},
volume = {2},
pages = {56--64},
year = {2021},
url = {https://doi.org/10.1109/OJCAS.2020.3036531},
doi = {10.1109/OJCAS.2020.3036531},
timestamp = {Thu, 29 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ojcands/HoHMC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/percom/VenkateswaranBH21,
author = {Praveen Venkateswaran and
Kyle E. Benson and
Chia{-}Ying Hsieh and
Cheng{-}Hsin Hsu and
Sharad Mehrotra and
Nalini Venkatasubramanian},
title = {{REAM:} {A} Framework for Resource Efficient Adaptive Monitoring of
Community Spaces},
journal = {Pervasive Mob. Comput.},
volume = {76},
pages = {101459},
year = {2021},
url = {https://doi.org/10.1016/j.pmcj.2021.101459},
doi = {10.1016/J.PMCJ.2021.101459},
timestamp = {Tue, 05 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/percom/VenkateswaranBH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/WillsWFWJLTHPPG21,
author = {Christopher Wills and
Bin Wang and
Shuai Fang and
Yunquan Wang and
Yi Jin and
James A. Lutz and
Jill Thompson and
Kyle E. Harms and
Sandeep Pulla and
Bonifacio Pasion and
Sara Germain and
Heming Liu and
Joseph Smokey and
Sheng{-}Hsin Su and
Nathalie Butt and
Chengjin Chu and
George Chuyong and
Chia{-}Hao Chang{-}Yang and
H. S. Dattaraja and
Stuart Davies and
Sisira Ediriweera and
Shameema Esufali and
Christine Dawn Fletcher and
Nimal Gunatilleke and
Savi Gunatilleke and
Chang{-}Fu Hsieh and
Fangliang He and
Stephen Hubbell and
Zhanqing Hao and
Akira Itoh and
David Kenfack and
Buhang Li and
Xiankun Li and
Keping Ma and
Michael Morecroft and
Xiangcheng Mi and
Yadvinder Malhi and
Perry Ong and
Lillian Jennifer Rodriguez and
H. S. Suresh and
I Fang Sun and
Raman Sukumar and
Sylvester Tan and
Duncan Thomas and
Mar{\'{\i}}a Uriarte and
Xihua Wang and
Xugao Wang and
T. L. Yao and
Jess Zimmermann},
title = {Interactions between all pairs of neighboring trees in 16 forests
worldwide reveal details of unique ecological processes in each forest,
and provide windows into their evolutionary histories},
journal = {PLoS Comput. Biol.},
volume = {17},
number = {4},
year = {2021},
url = {https://doi.org/10.1371/journal.pcbi.1008853},
doi = {10.1371/JOURNAL.PCBI.1008853},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/WillsWFWJLTHPPG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/ChangYCH21,
author = {Herng{-}Hua Chang and
Shin{-}Joe Yeh and
Ming{-}Chang Chiang and
Sung{-}Tsang Hsieh},
title = {Segmentation of Rat Brains and Cerebral Hemispheres in Triphenyltetrazolium
Chloride-Stained Images after Stroke},
journal = {Sensors},
volume = {21},
number = {21},
pages = {7171},
year = {2021},
url = {https://doi.org/10.3390/s21217171},
doi = {10.3390/S21217171},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/ChangYCH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/TanBZGAH21,
author = {Tan{-}Hsu Tan and
Luubaatar Badarch and
Wei{-}Xiang Zeng and
Munkhjargal Gochoo and
Fady S. Alnajjar and
Jun{-}Wei Hsieh},
title = {Binary Sensors-Based Privacy-Preserved Activity Recognition of Elderly
Living Alone Using an {RNN}},
journal = {Sensors},
volume = {21},
number = {16},
pages = {5371},
year = {2021},
url = {https://doi.org/10.3390/s21165371},
doi = {10.3390/S21165371},
timestamp = {Wed, 01 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/TanBZGAH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/software/LongTHY21,
author = {Ju Long and
Hung{-}Ying Tai and
Shen{-}Ta Hsieh and
Michael Juntao Yuan},
title = {A Lightweight Design for Serverless Function as a Service},
journal = {{IEEE} Softw.},
volume = {38},
number = {1},
pages = {75--80},
year = {2021},
url = {https://doi.org/10.1109/MS.2020.3028991},
doi = {10.1109/MS.2020.3028991},
timestamp = {Tue, 23 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/software/LongTHY21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/LeeLCLHHWLSC21,
author = {Shuenn{-}Yuh Lee and
Hao{-}Yun Lee and
Ding{-}Siang Ciou and
Zhan{-}Xian Liao and
Peng{-}Wei Huang and
Yi{-}Ting Hsieh and
Yi{-}Chieh Wei and
Chia{-}Yu Lin and
Meng{-}Dar Shieh and
Ju{-}Yi Chen},
title = {A Portable Wireless Urine Detection System With Power-Efficient Electrochemical
Readout {ASIC} and {ABTS-CNT} Biosensor for {UACR} Detection},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {15},
number = {3},
pages = {537--548},
year = {2021},
url = {https://doi.org/10.1109/TBCAS.2021.3087475},
doi = {10.1109/TBCAS.2021.3087475},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbcas/LeeLCLHHWLSC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tce/SuCCH21,
author = {Mu{-}Chun Su and
Chun{-}Ting Cheng and
Ming{-}Ching Chang and
Yi{-}Zeng Hsieh},
title = {A Video Analytic In-Class Student Concentration Monitoring System},
journal = {{IEEE} Trans. Consumer Electron.},
volume = {67},
number = {4},
pages = {294--304},
year = {2021},
url = {https://doi.org/10.1109/TCE.2021.3126877},
doi = {10.1109/TCE.2021.3126877},
timestamp = {Sat, 08 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tce/SuCCH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ChengC0CHD21,
author = {Minhao Cheng and
Pin{-}Yu Chen and
Sijia Liu and
Shiyu Chang and
Cho{-}Jui Hsieh and
Payel Das},
title = {Self-Progressing Robust Training},
booktitle = {Thirty-Fifth {AAAI} Conference on Artificial Intelligence, {AAAI}
2021, Thirty-Third Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2021, The Eleventh Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2021, Virtual Event, February 2-9,
2021},
pages = {7107--7115},
publisher = {{AAAI} Press},
year = {2021},
url = {https://doi.org/10.1609/aaai.v35i8.16874},
doi = {10.1609/AAAI.V35I8.16874},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/ChengC0CHD21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmvc/HuangHCKLS21,
author = {Yao{-}Hui Huang and
Jun{-}Wei Hsieh and
Ming{-}Ching Chang and
Lipeng Ke and
Siwei Lyu and
Arpita Samanta Santra},
title = {Multi-Teacher Single-Student Visual Transformer with Multi-Level Attention
for Face Spoofing Detection},
booktitle = {32nd British Machine Vision Conference 2021, {BMVC} 2021, Online,
November 22-25, 2021},
pages = {125},
publisher = {{BMVA} Press},
year = {2021},
url = {https://www.bmvc2021-virtualconference.com/assets/papers/0113.pdf},
timestamp = {Wed, 22 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bmvc/HuangHCKLS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmvc/WangHCCKL21,
author = {Bor{-}Shiun Wang and
Jun{-}Wei Hsieh and
Ping{-}Yang Chen and
Ming{-}Ching Chang and
Lipeng Ke and
Siwei Lyu},
title = {Learnable Discrete Wavelet Pooling (LDW-Pooling) for Convolutional
Networks},
booktitle = {32nd British Machine Vision Conference 2021, {BMVC} 2021, Online,
November 22-25, 2021},
pages = {200},
publisher = {{BMVA} Press},
year = {2021},
url = {https://www.bmvc2021-virtualconference.com/assets/papers/1204.pdf},
timestamp = {Wed, 22 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bmvc/WangHCCKL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/MallariWH21,
author = {Keri Mallari and
Spencer Williams and
Gary Hsieh},
editor = {Yoshifumi Kitamura and
Aaron Quigley and
Katherine Isbister and
Takeo Igarashi and
Pernille Bj{\o}rn and
Steven Mark Drucker},
title = {Understanding Analytics Needs of Video Game Streamers},
booktitle = {{CHI} '21: {CHI} Conference on Human Factors in Computing Systems,
Virtual Event / Yokohama, Japan, May 8-13, 2021},
pages = {337:1--337:12},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3411764.3445320},
doi = {10.1145/3411764.3445320},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/MallariWH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/LinHHHTL21,
author = {Hsuan Lin and
Ming{-}Yu Hsiao and
Yu{-}Chen Hsieh and
Kuo{-}Liang Huang and
Chia{-}Wen Tsai and
Wei Lin},
editor = {Pei{-}Luen Patrick Rau},
title = {A Preliminary Study on the Effect of Somatosensory Games upon Children's
Activity Space and Bodily Movements},
booktitle = {Cross-Cultural Design. Experience and Product Design Across Cultures
- 13th International Conference, {CCD} 2021, Held as Part of the 23rd
{HCI} International Conference, {HCII} 2021, Virtual Event, July 24-29,
2021, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {12771},
pages = {127--140},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-77074-7\_10},
doi = {10.1007/978-3-030-77074-7\_10},
timestamp = {Thu, 21 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hci/LinHHHTL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/DingHMWW21,
author = {Ing{-}Jr Ding and
Meng{-}Chuan Hsieh and
Xue{-}Lin Mo and
Sheng{-}Qi Wang and
Dai{-}Ru Wu},
title = {Performance Evaluations of Hand Number Gesture Recognition by Convolution-Based
Deep Neural Networks},
booktitle = {{IEEE} International Conference on Consumer Electronics-Taiwan, {ICCE-TW}
2021, Penghu, Taiwan, September 15-17, 2021},
pages = {1--2},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICCE-TW52618.2021.9602995},
doi = {10.1109/ICCE-TW52618.2021.9602995},
timestamp = {Tue, 23 Nov 2021 09:27:55 +0100},
biburl = {https://dblp.org/rec/conf/icce-tw/DingHMWW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ickii/HsiehHW21,
author = {Meng{-}Ju Hsieh and
Shih{-}Chang Hsia and
Szu{-}Hong Wang},
editor = {Teen{-}Hang Meen},
title = {Chip Design of Convolution Computation for {AI} Network},
booktitle = {4th {IEEE} International Conference on Knowledge Innovation and Invention,
{ICKII} 2021, Taichung, Taiwan, July 23-25, 2021},
pages = {49--53},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICKII51822.2021.9574782},
doi = {10.1109/ICKII51822.2021.9574782},
timestamp = {Mon, 08 Nov 2021 09:04:12 +0100},
biburl = {https://dblp.org/rec/conf/ickii/HsiehHW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/KamSHKK21,
author = {Michael Kam and
Hamed Saeidi and
Michael H. Hsieh and
Jin U. Kang and
Axel Krieger},
title = {A Confidence-Based Supervised-Autonomous Control Strategy for Robotic
Vaginal Cuff Closure},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2021, Xi'an, China, May 30 - June 5, 2021},
pages = {12261--12267},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICRA48506.2021.9561685},
doi = {10.1109/ICRA48506.2021.9561685},
timestamp = {Mon, 25 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/KamSHKK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsse/LiuCLTHW21,
author = {Po{-}Yi Liu and
Chih{-}Cheng Chen and
Sze{-}Teng Liong and
Ming{-}Han Tsai and
Ping{-}Cheng Hsieh and
Kun{-}Ching Wang},
title = {Intelligent Fault Diagnosis Based on Multi-Resolution and One-Dimension
Convolutional Neural Networks},
booktitle = {International Conference on System Science and Engineering, {ICSSE}
2021, Ho Chi Minh City, Vietnam, August 26-28, 2021},
pages = {319--322},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ICSSE52999.2021.9538454},
doi = {10.1109/ICSSE52999.2021.9538454},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icsse/LiuCLTHW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/FuYHPRL021,
author = {Szu{-}Wei Fu and
Cheng Yu and
Tsun{-}An Hsieh and
Peter Plantinga and
Mirco Ravanelli and
Xugang Lu and
Yu Tsao},
editor = {Hynek Hermansky and
Honza Cernock{\'{y}} and
Luk{\'{a}}s Burget and
Lori Lamel and
Odette Scharenborg and
Petr Motl{\'{\i}}cek},
title = {MetricGAN+: An Improved Version of MetricGAN for Speech Enhancement},
booktitle = {22nd Annual Conference of the International Speech Communication Association,
Interspeech 2021, Brno, Czechia, August 30 - September 3, 2021},
pages = {201--205},
publisher = {{ISCA}},
year = {2021},
url = {https://doi.org/10.21437/Interspeech.2021-599},
doi = {10.21437/INTERSPEECH.2021-599},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/FuYHPRL021.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/LiHALDGTWNTOTHT21,
author = {Hsieh{-}Yu Li and
Lay Siong Ho and
Achala Athukorala and
Wan Yun Lu and
Audelia Gumarus Dharmawan and
Jane Li Feng Guo and
Mabel May Leng Tan and
Kok Cheong Wong and
Nuri Syahida Ng and
Maxim Mei Xin Tan and
Hong Choon Oh and
Daniel Tiang and
Wei Wei Hong and
Franklin Chee Ping Tan and
Gek Kheng Png and
Ivan Khoo and
Chau Yuen and
Pon Poh Hsu and
Lee Chen Ee and
U{-}Xuan Tan},
title = {Towards a Manipulator System for Disposal of Waste from Patients Undergoing
Chemotherapy},
booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems,
{IROS} 2021, Prague, Czech Republic, September 27 - Oct. 1, 2021},
pages = {2949--2955},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IROS51168.2021.9636865},
doi = {10.1109/IROS51168.2021.9636865},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iros/LiHALDGTWNTOTHT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/MansfieldMMH21,
author = {Ariella Mansfield and
Sandeep Manjanna and
Douglas G. Macharet and
M. Ani Hsieh},
title = {Multi-robot Scheduling for Environmental Monitoring as a Team Orienteering
Problem},
booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems,
{IROS} 2021, Prague, Czech Republic, September 27 - Oct. 1, 2021},
pages = {6398--6404},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/IROS51168.2021.9636854},
doi = {10.1109/IROS51168.2021.9636854},
timestamp = {Wed, 22 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iros/MansfieldMMH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isit/ShiHGZZ21,
author = {Haowei Shi and
Min{-}Hsiu Hsieh and
Saikat Guha and
Zheshen Zhang and
Quntao Zhuang},
title = {Entanglement-assisted multiple-access channels: capacity regions and
protocol designs},
booktitle = {{IEEE} International Symposium on Information Theory, {ISIT} 2021,
Melbourne, Australia, July 12-20, 2021},
pages = {408--413},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISIT45174.2021.9518082},
doi = {10.1109/ISIT45174.2021.9518082},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isit/ShiHGZZ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ChenLNMMWGHRYMJ21,
author = {HsinChen Chen and
Rolf Lagerquist and
Ashish Nayak and
Hugh Mair and
Gokulakrishnan Manoharan and
Ericbill Wang and
Gordon Gammie and
Efron Ho and
Anand Rajagopalan and
Lee{-}Kee Yong and
Ramu Madhavaram and
Madhur Jagota and
Chi{-}Jui Chung and
Sudhakar Maruthi and
Jenny Wiedemeier and
Tao Chen and
Henry Hsieh and
Daniel Dia and
Amjad Sikiligiri and
Manzur Rahman and
Barry Chen and
Curtis Lin and
Vincent Lin and
Elly Chiang and
Cheng{-}Yuh Wu and
Po{-}Yang Hsu and
Jason Tsai and
Wade Wu and
Achuta Thippana and
S. A. Huang},
title = {A 7nm 5G Mobile SoC Featuring a 3.0GHz Tri-Gear Application Processor
Subsystem},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2021,
San Francisco, CA, USA, February 13-22, 2021},
pages = {54--56},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISSCC42613.2021.9365774},
doi = {10.1109/ISSCC42613.2021.9365774},
timestamp = {Wed, 10 Mar 2021 15:02:58 +0100},
biburl = {https://dblp.org/rec/conf/isscc/ChenLNMMWGHRYMJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/HsiehSB21,
author = {Ping{-}Hsuan Hsieh and
Mingoo Seok and
Keith A. Bowman},
title = {Session 29 Overview: Digital Circuits for Computing, Clocking and
Power Management {DIGITAL} {CIRCUITS} {SUBCOMMITTEE}},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2021,
San Francisco, CA, USA, February 13-22, 2021},
pages = {402--403},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISSCC42613.2021.9365765},
doi = {10.1109/ISSCC42613.2021.9365765},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/HsiehSB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/SuCLLLWCHRPLCSL21,
author = {Jian{-}Wei Su and
Yen{-}Chi Chou and
Ruhui Liu and
Ta{-}Wei Liu and
Pei{-}Jung Lu and
Ping{-}Chun Wu and
Yen{-}Lin Chung and
Li{-}Yang Hung and
Jin{-}Sheng Ren and
Tianlong Pan and
Sih{-}Han Li and
Shih{-}Chieh Chang and
Shyh{-}Shyuan Sheu and
Wei{-}Chung Lo and
Chih{-}I Wu and
Xin Si and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Meng{-}Fan Chang},
title = {16.3 {A} 28nm 384kb 6T-SRAM Computation-in-Memory Macro with 8b Precision
for {AI} Edge Chips},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2021,
San Francisco, CA, USA, February 13-22, 2021},
pages = {250--252},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISSCC42613.2021.9365984},
doi = {10.1109/ISSCC42613.2021.9365984},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/SuCLLLWCHRPLCSL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/XueHKHHCCLJSKLL21,
author = {Cheng{-}Xin Xue and
Je{-}Min Hung and
Hui{-}Yao Kao and
Yen{-}Hsiang Huang and
Sheng{-}Po Huang and
Fu{-}Chun Chang and
Peng Chen and
Ta{-}Wei Liu and
Chuan{-}Jia Jhang and
Chin{-}I Su and
Win{-}San Khwa and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Yu{-}Der Chih and
Tsung{-}Yung Jonathan Chang and
Meng{-}Fan Chang},
title = {A 22nm 4Mb 8b-Precision ReRAM Computing-in-Memory Macro with 11.91
to 195.7TOPS/W for Tiny {AI} Edge Devices},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2021,
San Francisco, CA, USA, February 13-22, 2021},
pages = {245--247},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISSCC42613.2021.9365769},
doi = {10.1109/ISSCC42613.2021.9365769},
timestamp = {Wed, 10 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/XueHKHHCCLJSKLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc/KuoLCHLFH21,
author = {Yen{-}Ting Kuo and
Wei{-}Chen Lin and
Chun Chen and
Chao{-}Ho Hsieh and
James Chien{-}Mo Li and
Eric Jia{-}Wei Fang and
Sung S.{-}Y. Hsueh},
title = {Minimum Operating Voltage Prediction in Production Test Using Accumulative
Learning},
booktitle = {{IEEE} International Test Conference, {ITC} 2021, Anaheim, CA, USA,
October 10-15, 2021},
pages = {47--52},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ITC50571.2021.00012},
doi = {10.1109/ITC50571.2021.00012},
timestamp = {Mon, 29 Nov 2021 13:19:22 +0100},
biburl = {https://dblp.org/rec/conf/itc/KuoLCHLFH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itsc/HsiehSTNM21,
author = {Chiao Hsieh and
Hussein Sibai and
Hebron Taylor and
Yifeng Ni and
Sayan Mitra},
title = {SkyTrakx: {A} Toolkit for Simulation and Verification of Unmanned
Air-Traffic Management Systems},
booktitle = {24th {IEEE} International Intelligent Transportation Systems Conference,
{ITSC} 2021, Indianapolis, IN, USA, September 19-22, 2021},
pages = {372--379},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ITSC48978.2021.9564492},
doi = {10.1109/ITSC48978.2021.9564492},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/itsc/HsiehSTNM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kdd/DevSDH21,
author = {Sunipa Dev and
Mehrnoosh Sameki and
Jwala Dhamala and
Cho{-}Jui Hsieh},
editor = {Feida Zhu and
Beng Chin Ooi and
Chunyan Miao},
title = {Measures and Best Practices for Responsible {AI}},
booktitle = {{KDD} '21: The 27th {ACM} {SIGKDD} Conference on Knowledge Discovery
and Data Mining, Virtual Event, Singapore, August 14-18, 2021},
pages = {4118},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3447548.3469458},
doi = {10.1145/3447548.3469458},
timestamp = {Mon, 16 Aug 2021 16:18:31 +0200},
biburl = {https://dblp.org/rec/conf/kdd/DevSDH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miip/HuberMGHLYM21,
author = {Nathan R. Huber and
Andrew D. Missert and
Hao Gong and
Scott S. Hsieh and
Shuai Leng and
Lifeng Yu and
Cynthia H. McCollough},
editor = {Ivana Isgum and
Bennett A. Landman},
title = {Random search as a neural network optimization strategy for Convolutional-Neural-Network
(CNN)-based noise reduction in {CT}},
booktitle = {Medical Imaging 2021: Image Processing, Online, February 15-19, 2021},
series = {{SPIE} Proceedings},
volume = {11596},
publisher = {{SPIE}},
year = {2021},
url = {https://doi.org/10.1117/12.2582143},
doi = {10.1117/12.2582143},
timestamp = {Mon, 11 Mar 2024 15:57:50 +0100},
biburl = {https://dblp.org/rec/conf/miip/HuberMGHLYM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/NanRZRSHTVVKLIP21,
author = {Linyong Nan and
Dragomir R. Radev and
Rui Zhang and
Amrit Rau and
Abhinand Sivaprasad and
Chiachun Hsieh and
Xiangru Tang and
Aadit Vyas and
Neha Verma and
Pranav Krishna and
Yangxiaokang Liu and
Nadia Irwanto and
Jessica Pan and
Faiaz Rahman and
Ahmad Zaidi and
Mutethia Mutuma and
Yasin Tarabar and
Ankit Gupta and
Tao Yu and
Yi Chern Tan and
Xi Victoria Lin and
Caiming Xiong and
Richard Socher and
Nazneen Fatema Rajani},
editor = {Kristina Toutanova and
Anna Rumshisky and
Luke Zettlemoyer and
Dilek Hakkani{-}T{\"{u}}r and
Iz Beltagy and
Steven Bethard and
Ryan Cotterell and
Tanmoy Chakraborty and
Yichao Zhou},
title = {{DART:} Open-Domain Structured Data Record to Text Generation},
booktitle = {Proceedings of the 2021 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL-HLT} 2021, Online, June 6-11, 2021},
pages = {432--447},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.naacl-main.37},
doi = {10.18653/V1/2021.NAACL-MAIN.37},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/NanRZRSHTVVKLIP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pacis/ChouMHPH21,
author = {Shih{-}Wei Chou and
Hui{-}Tzu Min and
Ming{-}Chia Hsieh and
Hui{-}Chun Pan and
Chia{-}Shiang Hsu},
editor = {Doug Vogel and
Kathy Ning Shen and
Pan Shan Ling and
M. N. Ravishankar and
Jacky Xi Zhang},
title = {Understanding E-learners' Mindfulness of {IT} Use That Affects Value
Creation},
booktitle = {25th Pacific Asia Conference on Information Systems, {PACIS} 2021,
Virtual Event / Dubai, UAE, July 12-14, 2021},
pages = {186},
year = {2021},
url = {https://aisel.aisnet.org/pacis2021/186},
timestamp = {Tue, 20 Sep 2022 19:48:12 +0200},
biburl = {https://dblp.org/rec/conf/pacis/ChouMHPH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rocling/ChangLWKH21,
author = {Yu{-}Lin Chang and
Yongfu Liao and
Po{-}Ya Angela Wang and
Mao{-}Chang Ku and
Shu{-}Kai Hsieh},
editor = {Lung{-}Hao Lee and
Chia{-}Hui Chang and
Kuan{-}Yu Chen},
title = {Keyword-centered Collocating Topic Analysis},
booktitle = {Proceedings of the 33rd Conference on Computational Linguistics and
Speech Processing, {ROCLING} 2021, Taoyuan, Taiwan, October 15-16,
2021},
pages = {310--317},
publisher = {The Association for Computational Linguistics and Chinese Language
Processing {(ACLCLP)}},
year = {2021},
url = {https://aclanthology.org/2021.rocling-1.40},
timestamp = {Tue, 26 Oct 2021 14:09:04 +0200},
biburl = {https://dblp.org/rec/conf/rocling/ChangLWKH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/taai/SunKH21,
author = {Min{-}Te Sun and
Kotcharat Kitchat and
Li{-}Chung Hsieh},
title = {TCN-based Futures Prediction Using Financial Indices, Bargain Chips,
and Forum Messages},
booktitle = {2021 International Conference on Technologies and Applications of
Artificial Intelligence, {TAAI} 2021, Taichung, Taiwan, November 18-20,
2021},
pages = {72--77},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/TAAI54685.2021.00022},
doi = {10.1109/TAAI54685.2021.00022},
timestamp = {Wed, 08 Jun 2022 16:30:07 +0200},
biburl = {https://dblp.org/rec/conf/taai/SunKH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/rss/2021,
editor = {Dylan A. Shell and
Marc Toussaint and
M. Ani Hsieh},
title = {Robotics: Science and Systems XVII, Virtual Event, July 12-16, 2021},
year = {2021},
url = {http://www.roboticsproceedings.org/rss17/},
isbn = {978-0-9923747-7-8},
timestamp = {Wed, 21 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/rss/2021.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2101-07069,
author = {Seong{-}Eun Moon and
Chun{-}Jui Chen and
Cho{-}Jui Hsieh and
Jane{-}Ling Wang and
Jong{-}Seok Lee},
title = {Emotional {EEG} Classification using Connectivity Features and Convolutional
Neural Networks},
journal = {CoRR},
volume = {abs/2101.07069},
year = {2021},
url = {https://arxiv.org/abs/2101.07069},
eprinttype = {arXiv},
eprint = {2101.07069},
timestamp = {Fri, 22 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2101-07069.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2101-12173,
author = {Haowei Shi and
Min{-}Hsiu Hsieh and
Saikat Guha and
Zheshen Zhang and
Quntao Zhuang},
title = {Entanglement-assisted multiple-access channels: capacity regions and
protocol designs},
journal = {CoRR},
volume = {abs/2101.12173},
year = {2021},
url = {https://arxiv.org/abs/2101.12173},
eprinttype = {arXiv},
eprint = {2101.12173},
timestamp = {Fri, 08 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2101-12173.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-10383,
author = {Tahiya Salam and
M. Ani Hsieh},
title = {Heterogeneous robot teams for modeling and prediction of multiscale
environmental processes},
journal = {CoRR},
volume = {abs/2103.10383},
year = {2021},
url = {https://arxiv.org/abs/2103.10383},
eprinttype = {arXiv},
eprint = {2103.10383},
timestamp = {Wed, 24 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2103-10383.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2104-00369,
author = {Linyong Nan and
Chiachun Hsieh and
Ziming Mao and
Xi Victoria Lin and
Neha Verma and
Rui Zhang and
Wojciech Kryscinski and
Nick Schoelkopf and
Riley Kong and
Xiangru Tang and
Murori Mutuma and
Ben Rosand and
Isabel Trindade and
Renusree Bandaru and
Jacob Cunningham and
Caiming Xiong and
Dragomir R. Radev},
title = {FeTaQA: Free-form Table Question Answering},
journal = {CoRR},
volume = {abs/2104.00369},
year = {2021},
url = {https://arxiv.org/abs/2104.00369},
eprinttype = {arXiv},
eprint = {2104.00369},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2104-00369.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2104-03538,
author = {Szu{-}Wei Fu and
Cheng Yu and
Tsun{-}An Hsieh and
Peter Plantinga and
Mirco Ravanelli and
Xugang Lu and
Yu Tsao},
title = {MetricGAN+: An Improved Version of MetricGAN for Speech Enhancement},
journal = {CoRR},
volume = {abs/2104.03538},
year = {2021},
url = {https://arxiv.org/abs/2104.03538},
eprinttype = {arXiv},
eprint = {2104.03538},
timestamp = {Tue, 13 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2104-03538.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2104-12727,
author = {Yu{-}Chuan Su and
Soravit Changpinyo and
Xiangning Chen and
Sathish Thoppay and
Cho{-}Jui Hsieh and
Lior Shapira and
Radu Soricut and
Hartwig Adam and
Matthew Brown and
Ming{-}Hsuan Yang and
Boqing Gong},
title = {2.5D Visual Relationship Detection},
journal = {CoRR},
volume = {abs/2104.12727},
year = {2021},
url = {https://arxiv.org/abs/2104.12727},
eprinttype = {arXiv},
eprint = {2104.12727},
timestamp = {Mon, 03 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2104-12727.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2105-10018,
author = {Sandeep Manjanna and
Ani Hsieh and
Gregory Dudek},
title = {Scalable Multi-Robot System for Non-myopic Spatial Sampling},
journal = {CoRR},
volume = {abs/2105.10018},
year = {2021},
url = {https://arxiv.org/abs/2105.10018},
eprinttype = {arXiv},
eprint = {2105.10018},
timestamp = {Mon, 31 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2105-10018.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-12710,
author = {Jun{-}Ting Hsieh and
Sidhanth Mohanty and
Jeff Xu},
title = {Certifying solution geometry in random CSPs: counts, clusters and
balance},
journal = {CoRR},
volume = {abs/2106.12710},
year = {2021},
url = {https://arxiv.org/abs/2106.12710},
eprinttype = {arXiv},
eprint = {2106.12710},
timestamp = {Wed, 30 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-12710.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-00734,
author = {Daniel C. Hackett and
Chung{-}Chun Hsieh and
Michael S. Albergo and
Denis Boyda and
Jiunn{-}Wei Chen and
Kai{-}Feng Chen and
Kyle Cranmer and
Gurtej Kanwar and
Phiala E. Shanahan},
title = {Flow-based sampling for multimodal distributions in lattice field
theory},
journal = {CoRR},
volume = {abs/2107.00734},
year = {2021},
url = {https://arxiv.org/abs/2107.00734},
eprinttype = {arXiv},
eprint = {2107.00734},
timestamp = {Wed, 07 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2107-00734.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-01288,
author = {Hamed Saeidi and
Justin D. Opfermann and
Michael Kam and
Shuwen Wei and
Simon L{\'{e}}onard and
Michael H. Hsieh and
Jin U. Kang and
Axel Krieger},
title = {Breaking Barriers in Robotic Soft Tissue Surgery: Conditional Autonomous
Intestinal Anastomosis},
journal = {CoRR},
volume = {abs/2107.01288},
year = {2021},
url = {https://arxiv.org/abs/2107.01288},
eprinttype = {arXiv},
eprint = {2107.01288},
timestamp = {Tue, 08 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2107-01288.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2108-09996,
author = {Jun{-}Wei Hsieh and
Ming{-}Ching Chang and
Ping{-}Yang Chen and
Santanu Santra and
Cheng{-}Han Chou and
Chih{-}Sheng Huang},
title = {{MS-DARTS:} Mean-Shift Based Differentiable Architecture Search},
journal = {CoRR},
volume = {abs/2108.09996},
year = {2021},
url = {https://arxiv.org/abs/2108.09996},
eprinttype = {arXiv},
eprint = {2108.09996},
timestamp = {Thu, 02 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2108-09996.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-06107,
author = {Tahiya Salam and
Victoria M. Edwards and
M. Ani Hsieh},
title = {Learning and Leveraging Environmental Features to Improve Robot Awareness},
journal = {CoRR},
volume = {abs/2109.06107},
year = {2021},
url = {https://arxiv.org/abs/2109.06107},
eprinttype = {arXiv},
eprint = {2109.06107},
timestamp = {Wed, 17 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-06107.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-06638,
author = {Jun{-}Wei Hsieh and
Ming{-}Ching Chang and
Bor{-}Shiun Wang and
Ping{-}Yang Chen and
Lipeng Ke and
Siwei Lyu},
title = {Learnable Discrete Wavelet Pooling (LDW-Pooling) For Convolutional
Networks},
journal = {CoRR},
volume = {abs/2109.06638},
year = {2021},
url = {https://arxiv.org/abs/2109.06638},
eprinttype = {arXiv},
eprint = {2109.06638},
timestamp = {Tue, 21 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-06638.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-14676,
author = {Cheng{-}Yu Hsieh and
Wei{-}I Lin and
Miao Xu and
Gang Niu and
Hsuan{-}Tien Lin and
Masashi Sugiyama},
title = {Active Refinement for Multi-Label Learning: {A} Pseudo-Label Approach},
journal = {CoRR},
volume = {abs/2109.14676},
year = {2021},
url = {https://arxiv.org/abs/2109.14676},
eprinttype = {arXiv},
eprint = {2109.14676},
timestamp = {Mon, 04 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-14676.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-00064,
author = {Eli Chien and
Wei{-}Cheng Chang and
Cho{-}Jui Hsieh and
Hsiang{-}Fu Yu and
Jiong Zhang and
Olgica Milenkovic and
Inderjit S. Dhillon},
title = {Node Feature Extraction by Self-Supervised Multi-scale Neighborhood
Prediction},
journal = {CoRR},
volume = {abs/2111.00064},
year = {2021},
url = {https://arxiv.org/abs/2111.00064},
eprinttype = {arXiv},
eprint = {2111.00064},
timestamp = {Fri, 05 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-00064.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-05534,
author = {Chiao Hsieh and
Keyur Joshi and
Sasa Misailovic and
Sayan Mitra},
title = {Verifying Controllers with Convolutional Neural Network-based Perception:
{A} Case for Intelligible, Safe, and Precise Abstractions},
journal = {CoRR},
volume = {abs/2111.05534},
year = {2021},
url = {https://arxiv.org/abs/2111.05534},
eprinttype = {arXiv},
eprint = {2111.05534},
timestamp = {Wed, 14 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-05534.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-05703,
author = {Cheng Yu and
Szu{-}Wei Fu and
Tsun{-}An Hsieh and
Yu Tsao and
Mirco Ravanelli},
title = {{OSSEM:} one-shot speaker adaptive speech enhancement using meta learning},
journal = {CoRR},
volume = {abs/2111.05703},
year = {2021},
url = {https://arxiv.org/abs/2111.05703},
eprinttype = {arXiv},
eprint = {2111.05703},
timestamp = {Tue, 16 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-05703.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-11139,
author = {Tom Gur and
Min{-}Hsiu Hsieh and
Sathyawageeswar Subramanian},
title = {Sublinear quantum algorithms for estimating von Neumann entropy},
journal = {CoRR},
volume = {abs/2111.11139},
year = {2021},
url = {https://arxiv.org/abs/2111.11139},
eprinttype = {arXiv},
eprint = {2111.11139},
timestamp = {Fri, 26 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-11139.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-09177,
author = {Kang Zheng and
Yirui Wang and
Chen{-}I Hsieh and
Le Lu and
Jing Xiao and
Chang{-}Fu Kuo and
Shun Miao},
title = {Coherence Learning using Keypoint-based Pooling Network for Accurately
Assessing Radiographic Knee Osteoarthritis},
journal = {CoRR},
volume = {abs/2112.09177},
year = {2021},
url = {https://arxiv.org/abs/2112.09177},
eprinttype = {arXiv},
eprint = {2112.09177},
timestamp = {Fri, 07 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-09177.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eccc/GurHS21,
author = {Tom Gur and
Min{-}Hsiu Hsieh and
Sathyawageeswar Subramanian},
title = {Sublinear quantum algorithms for estimating von Neumann entropy},
journal = {Electron. Colloquium Comput. Complex.},
volume = {{TR21-174}},
year = {2021},
url = {https://eccc.weizmann.ac.il/report/2021/174},
eprinttype = {ECCC},
eprint = {TR21-174},
timestamp = {Tue, 27 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eccc/GurHS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/ChangWHTHYGOC20,
author = {Yu{-}Chuan Chang and
June{-}Tai Wu and
Ming{-}Yi Hong and
Yi{-}An Tung and
Ping{-}Han Hsieh and
Sook Wah Yee and
Kathleen M. Giacomini and
Yen{-}Jen Oyang and
Chien{-}Yu Chen},
title = {GenEpi: gene-based epistasis discovery using machine learning},
journal = {{BMC} Bioinform.},
volume = {21},
number = {1},
pages = {68},
year = {2020},
url = {https://doi.org/10.1186/s12859-020-3368-2},
doi = {10.1186/S12859-020-3368-2},
timestamp = {Mon, 26 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/ChangWHTHYGOC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bspc/MekonnenYHLY20,
author = {Bitewulign Kassa Mekonnen and
Webb Yang and
Tung{-}Han Hsieh and
Shien{-}Kuei Liaw and
Fu{-}Liang Yang},
title = {Accurate prediction of glucose concentration and identification of
major contributing features from hardly distinguishable near-infrared
spectroscopy},
journal = {Biomed. Signal Process. Control.},
volume = {59},
pages = {101923},
year = {2020},
url = {https://doi.org/10.1016/j.bspc.2020.101923},
doi = {10.1016/J.BSPC.2020.101923},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bspc/MekonnenYHLY20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csse/ZhuYZWZH20,
author = {Hai Yang Zhu and
Xiaobo Yin and
Shunxiang Zhang and
Zhongliang Wei and
Guangli Zhu and
Meng{-}Yen Hsieh},
title = {A Discovery Method for New Words From Mobile Product Comments},
journal = {Comput. Syst. Sci. Eng.},
volume = {35},
number = {6},
pages = {399--410},
year = {2020},
url = {https://doi.org/10.32604/csse.2020.35.399},
doi = {10.32604/CSSE.2020.35.399},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csse/ZhuYZWZH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/WangLHSHW20,
author = {Meng{-}Hui Wang and
Shiue{-}Der Lu and
Mei{-}Ling Huang and
Hong{-}Wei Sian and
Cheng{-}Che Hsieh and
Shao{-}En Wei},
title = {Hybrid methodology based on extension theory for partial discharge
fault diagnosis of power capacitors},
journal = {{IEICE} Electron. Express},
volume = {17},
number = {18},
pages = {20200250},
year = {2020},
url = {https://doi.org/10.1587/elex.17.20200250},
doi = {10.1587/ELEX.17.20200250},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieiceee/WangLHSHW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijstm/HsiehFM20,
author = {Tsung{-}Yu Hsieh and
Ying{-}Fen Fu and
Shih{-}Ya Ma},
title = {Impacts of day trading on the intraday pattern of market quality},
journal = {Int. J. Serv. Technol. Manag.},
volume = {26},
number = {1},
pages = {20--37},
year = {2020},
url = {https://doi.org/10.1504/IJSTM.2020.105396},
doi = {10.1504/IJSTM.2020.105396},
timestamp = {Thu, 30 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijstm/HsiehFM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ile/LuLCH20,
author = {Su{-}Ju Lu and
Ying{-}Chieh Liu and
Po{-}Ju Chen and
Mu{-}Rong Hsieh},
title = {Evaluation of {AR} embedded physical puzzle game on students' learning
achievement and motivation on elementary natural science},
journal = {Interact. Learn. Environ.},
volume = {28},
number = {4},
pages = {451--463},
year = {2020},
url = {https://doi.org/10.1080/10494820.2018.1541908},
doi = {10.1080/10494820.2018.1541908},
timestamp = {Mon, 18 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ile/LuLCH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocn/LiuRHHNLCR20,
author = {Xiaonan L. Liu and
Charan Ranganath and
Liang{-}Tien Hsieh and
Mitzi Hurtado and
Tara A. Niendam and
Tyler A. Lesh and
Cameron S. Carter and
John Daniel Ragland},
title = {Task-specific Disruptions in Theta Oscillations during Working Memory
for Temporal Order in People with Schizophrenia},
journal = {J. Cogn. Neurosci.},
volume = {32},
number = {11},
pages = {2117--2130},
year = {2020},
url = {https://doi.org/10.1162/jocn\_a\_01598},
doi = {10.1162/JOCN\_A\_01598},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jocn/LiuRHHNLCR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/ChiuZCSLTSHWWHS20,
author = {Yen{-}Cheng Chiu and
Zhixiao Zhang and
Jia{-}Jing Chen and
Xin Si and
Ruhui Liu and
Yung{-}Ning Tu and
Jian{-}Wei Su and
Wei{-}Hsing Huang and
Jing{-}Hong Wang and
Wei{-}Chen Wei and
Je{-}Min Hung and
Shyh{-}Shyuan Sheu and
Sih{-}Han Li and
Chih{-}I Wu and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Meng{-}Fan Chang},
title = {A 4-Kb 1-to-8-bit Configurable 6T SRAM-Based Computation-in-Memory
Unit-Macro for CNN-Based {AI} Edge Processors},
journal = {{IEEE} J. Solid State Circuits},
volume = {55},
number = {10},
pages = {2790--2801},
year = {2020},
url = {https://doi.org/10.1109/JSSC.2020.3005754},
doi = {10.1109/JSSC.2020.3005754},
timestamp = {Tue, 06 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/ChiuZCSLTSHWWHS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/LinHTTHCHHCGFRL20,
author = {Mu{-}Shan Lin and
Tze{-}Chiang Huang and
Chien{-}Chun Tsai and
King{-}Ho Tam and
Kenny Cheng{-}Hsiang Hsieh and
Ching{-}Fang Chen and
Wen{-}Hung Huang and
Chi{-}Wei Hu and
Yu{-}Chi Chen and
Sandeep Kumar Goel and
Chin{-}Ming Fu and
Stefan Rusu and
Chao{-}Chieh Li and
Sheng{-}Yao Yang and
Mei Wong and
Shu{-}Chun Yang and
Frank Lee},
title = {A 7-nm 4-GHz Arm{\({^1}\)}-Core-Based CoWoS{\({^1}\)} Chiplet Design
for High-Performance Computing},
journal = {{IEEE} J. Solid State Circuits},
volume = {55},
number = {4},
pages = {956--966},
year = {2020},
url = {https://doi.org/10.1109/JSSC.2019.2960207},
doi = {10.1109/JSSC.2019.2960207},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/LinHTTHCHHCGFRL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/SiLYLHTLCCTHWCW20,
author = {Xin Si and
Rui Liu and
Shimeng Yu and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Qiang Li and
Meng{-}Fan Chang and
Jia{-}Jing Chen and
Yung{-}Ning Tu and
Wei{-}Hsing Huang and
Jing{-}Hong Wang and
Yen{-}Cheng Chiu and
Wei{-}Chen Wei and
Ssu{-}Yen Wu and
Xiaoyu Sun},
title = {A Twin-8T {SRAM} Computation-in-Memory Unit-Macro for Multibit CNN-Based
{AI} Edge Processors},
journal = {{IEEE} J. Solid State Circuits},
volume = {55},
number = {1},
pages = {189--202},
year = {2020},
url = {https://doi.org/10.1109/JSSC.2019.2952773},
doi = {10.1109/JSSC.2019.2952773},
timestamp = {Wed, 26 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/SiLYLHTLCCTHWCW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/ChenCSH20,
author = {Mu{-}Yen Chen and
Hsiu{-}Sen Chiang and
Arun Kumar Sangaiah and
Tsung{-}Che Hsieh},
title = {Recurrent neural network with attention mechanism for language model},
journal = {Neural Comput. Appl.},
volume = {32},
number = {12},
pages = {7915--7923},
year = {2020},
url = {https://doi.org/10.1007/s00521-019-04301-x},
doi = {10.1007/S00521-019-04301-X},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nca/ChenCSH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nn/MoonCHWL20,
author = {Seong{-}Eun Moon and
Chun{-}Jui Chen and
Cho{-}Jui Hsieh and
Jane{-}Ling Wang and
Jong{-}Seok Lee},
title = {Emotional {EEG} classification using connectivity features and convolutional
neural networks},
journal = {Neural Networks},
volume = {132},
pages = {96--107},
year = {2020},
url = {https://doi.org/10.1016/j.neunet.2020.08.009},
doi = {10.1016/J.NEUNET.2020.08.009},
timestamp = {Thu, 29 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nn/MoonCHWL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmhci/SuhWFFBH20,
author = {Jina Suh and
Spencer Williams and
Jesse R. Fann and
James Fogarty and
Amy M. Bauer and
Gary Hsieh},
title = {Parallel Journeys of Patients with Cancer and Depression: Challenges
and Opportunities for Technology-Enabled Collaborative Care},
journal = {Proc. {ACM} Hum. Comput. Interact.},
volume = {4},
number = {{CSCW}},
pages = {038:1--038:36},
year = {2020},
url = {https://doi.org/10.1145/3392843},
doi = {10.1145/3392843},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pacmhci/SuhWFFBH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pacmpl/GhoshHMM20,
author = {Ritwika Ghosh and
Chiao Hsieh and
Sasa Misailovic and
Sayan Mitra},
title = {Koord: a language for programming and verifying distributed robotics
application},
journal = {Proc. {ACM} Program. Lang.},
volume = {4},
number = {{OOPSLA}},
pages = {232:1--232:30},
year = {2020},
url = {https://doi.org/10.1145/3428300},
doi = {10.1145/3428300},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pacmpl/GhoshHMM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/SuUHYLL20,
author = {Mu{-}Chun Su and
Tat{-}Meng U and
Yi{-}Zeng Hsieh and
Zhe{-}Fu Yeh and
Shu{-}Fang Lee and
Shih{-}Syun Lin},
title = {An Eye-Tracking System based on Inner Corner-Pupil Center Vector and
Deep Neural Network},
journal = {Sensors},
volume = {20},
number = {1},
pages = {25},
year = {2020},
url = {https://doi.org/10.3390/s20010025},
doi = {10.3390/S20010025},
timestamp = {Tue, 16 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/SuUHYLL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/soco/HuangSHWC20,
author = {Mu{-}Jung Huang and
Hsiu{-}Shu Sung and
Tsu{-}Jen Hsieh and
Ming{-}Cheng Wu and
Shao{-}Hsi Chung},
title = {Applying data-mining techniques for discovering association rules},
journal = {Soft Comput.},
volume = {24},
number = {11},
pages = {8069--8075},
year = {2020},
url = {https://doi.org/10.1007/s00500-019-04163-4},
doi = {10.1007/S00500-019-04163-4},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/soco/HuangSHWC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/HsiehHCCKYS20,
author = {Yun{-}Shan Hsieh and
Po{-}Chun Huang and
Ping{-}Xiang Chen and
Yuan{-}Hao Chang and
Wang Kang and
Ming{-}Chang Yang and
Wei{-}Kuan Shih},
title = {Shift-Limited Sort: Optimizing Sorting Performance on Skyrmion Memory-Based
Systems},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {39},
number = {11},
pages = {4115--4128},
year = {2020},
url = {https://doi.org/10.1109/TCAD.2020.3012880},
doi = {10.1109/TCAD.2020.3012880},
timestamp = {Wed, 07 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcad/HsiehHCCKYS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcs/WangMHW20,
author = {Zhao Wang and
Yaping Mao and
Sun{-}Yuan Hsieh and
Jichang Wu},
title = {On the \emph{g}-good-neighbor connectivity of graphs},
journal = {Theor. Comput. Sci.},
volume = {804},
pages = {139--148},
year = {2020},
url = {https://doi.org/10.1016/j.tcs.2019.11.021},
doi = {10.1016/J.TCS.2019.11.021},
timestamp = {Thu, 04 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcs/WangMHW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tit/SalekAHJF20,
author = {Farzin Salek and
Anurag Anshu and
Min{-}Hsiu Hsieh and
Rahul Jain and
Javier Rodr{\'{\i}}guez Fonollosa},
title = {One-Shot Capacity Bounds on the Simultaneous Transmission of Classical
and Quantum Information},
journal = {{IEEE} Trans. Inf. Theory},
volume = {66},
number = {4},
pages = {2141--2164},
year = {2020},
url = {https://doi.org/10.1109/TIT.2019.2945800},
doi = {10.1109/TIT.2019.2945800},
timestamp = {Thu, 09 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tit/SalekAHJF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tit/SalekHF20,
author = {Farzin Salek and
Min{-}Hsiu Hsieh and
Javier Rodr{\'{\i}}guez Fonollosa},
title = {Single-Serving Quantum Broadcast Channel With Common, Individualized,
and Confidential Messages},
journal = {{IEEE} Trans. Inf. Theory},
volume = {66},
number = {12},
pages = {7752--7771},
year = {2020},
url = {https://doi.org/10.1109/TIT.2020.3013098},
doi = {10.1109/TIT.2020.3013098},
timestamp = {Thu, 31 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tit/SalekHF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvt/0003WH0HL20,
author = {Kai Sun and
Jingmiao Wu and
Wei Huang and
Haijun Zhang and
Hung{-}Yun Hsieh and
Victor C. M. Leung},
title = {Uplink Performance Improvement for Downlink-Uplink Decoupled HetNets
With Non-Uniform User Distribution},
journal = {{IEEE} Trans. Veh. Technol.},
volume = {69},
number = {7},
pages = {7518--7530},
year = {2020},
url = {https://doi.org/10.1109/TVT.2020.2993729},
doi = {10.1109/TVT.2020.2993729},
timestamp = {Thu, 01 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvt/0003WH0HL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/0001SSH20,
author = {Xi Yu and
Daigo Shishika and
David Salda{\~{n}}a and
M. Ani Hsieh},
title = {Modular Robot Formation and Routing for Resilient Consensus},
booktitle = {2020 American Control Conference, {ACC} 2020, Denver, CO, USA, July
1-3, 2020},
pages = {2464--2471},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.23919/ACC45564.2020.9147563},
doi = {10.23919/ACC45564.2020.9147563},
timestamp = {Sun, 08 Aug 2021 01:40:57 +0200},
biburl = {https://dblp.org/rec/conf/amcc/0001SSH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bcb/MitchellBMWKCMK20,
author = {Keith Mitchell and
Jaqueline J. Brito and
Igor Mandric and
Qiaozhen Wu and
Sergey Knyazev and
Sei Chang and
Lana S. Martin and
Aaron Karlsberg and
Ekaterina Gerasimov and
Russell Littman and
Brian L. Hill and
Nicholas C. Wu and
Harry (Taegyun) Yang and
Kevin Hsieh and
Linus Chen and
Eli Littman and
Taylor Shabani and
German Enik and
Douglas Yao and
Ren Sun and
Jan Schroeder and
Eleazar Eskin and
Alex Zelikovsky and
Pavel Skums and
Mihai Pop and
Serghei Mangul},
title = {Benchmarking of computational error-correction methods for next-generation
sequencing data},
booktitle = {{BCB} '20: 11th {ACM} International Conference on Bioinformatics,
Computational Biology and Health Informatics, Virtual Event, USA,
September 21-24, 2020},
pages = {63:1},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3388440.3414209},
doi = {10.1145/3388440.3414209},
timestamp = {Fri, 13 Nov 2020 11:27:35 +0100},
biburl = {https://dblp.org/rec/conf/bcb/MitchellBMWKCMK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biorob/YeonSRSHFH20,
author = {Seong Ho Yeon and
Tony Shu and
Emily A. Rogers and
Hyungeun Song and
Tsung{-}Han Hsieh and
Lisa E. Freed and
Hugh M. Herr},
title = {Flexible Dry Electrodes for {EMG} Acquisition within Lower Extremity
Prosthetic Sockets},
booktitle = {8th {IEEE} {RAS/EMBS} International Conference for Biomedical Robotics
and Biomechatronics, BioRob 2020, New York City, NY, USA, November
29 - December 1, 2020},
pages = {1088--1095},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/BioRob49111.2020.9224338},
doi = {10.1109/BIOROB49111.2020.9224338},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/biorob/YeonSRSHFH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/ChangYCH20,
author = {Herng{-}Hua Chang and
Shin{-}Joe Yeh and
Ming{-}Chang Chiang and
Sung{-}Tsang Hsieh},
title = {Automated Brain Extraction and Separation in Triphenyltetrazolium
Chloride-Stained Rat Images},
booktitle = {28th European Signal Processing Conference, {EUSIPCO} 2020, Amsterdam,
Netherlands, January 18-21, 2021},
pages = {1362--1366},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.23919/Eusipco47968.2020.9287866},
doi = {10.23919/EUSIPCO47968.2020.9287866},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eusipco/ChangYCH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/GochooTAHC20,
author = {Munkhjargal Gochoo and
Tan{-}Hsu Tan and
Fady Alnajjar and
Jun{-}Wei Hsieh and
Ping{-}Yang Chen},
title = {Lownet: Privacy Preserved Ultra-Low Resolution Posture Image Classification},
booktitle = {{IEEE} International Conference on Image Processing, {ICIP} 2020,
Abu Dhabi, United Arab Emirates, October 25-28, 2020},
pages = {663--667},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICIP40778.2020.9190922},
doi = {10.1109/ICIP40778.2020.9190922},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icip/GochooTAHC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icis/LiuMHP20,
author = {CheWei Liu and
Sunil Mithas and
JJ Po{-}An Hsieh and
Yang Pan},
editor = {Joey F. George and
Souren Paul and
Rahul De' and
Elena Karahanna and
Suprateek Sarker and
Gal Oestreicher{-}Singer},
title = {Do Financial Advisors Matter? Online Channels and Investors' Gambling
Preferences},
booktitle = {Proceedings of the 41st International Conference on Information Systems,
{ICIS} 2020, Making Digital Inclusive: Blending the Locak and the
Global, Hyderabad, India, December 13-16, 2020},
publisher = {Association for Information Systems},
year = {2020},
url = {https://aisel.aisnet.org/icis2020/digital\_commerce/digital\_commerce/15},
timestamp = {Tue, 04 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icis/LiuMHP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/ChengSCC0H20,
author = {Minhao Cheng and
Simranjit Singh and
Patrick H. Chen and
Pin{-}Yu Chen and
Sijia Liu and
Cho{-}Jui Hsieh},
title = {Sign-OPT: {A} Query-Efficient Hard-label Adversarial Attack},
booktitle = {8th International Conference on Learning Representations, {ICLR} 2020,
Addis Ababa, Ethiopia, April 26-30, 2020},
publisher = {OpenReview.net},
year = {2020},
url = {https://openreview.net/forum?id=SklTQCNtvS},
timestamp = {Thu, 29 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iclr/ChengSCC0H20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/ShiZCHH20,
author = {Zhouxing Shi and
Huan Zhang and
Kai{-}Wei Chang and
Minlie Huang and
Cho{-}Jui Hsieh},
title = {Robustness Verification for Transformers},
booktitle = {8th International Conference on Learning Representations, {ICLR} 2020,
Addis Ababa, Ethiopia, April 26-30, 2020},
publisher = {OpenReview.net},
year = {2020},
url = {https://openreview.net/forum?id=BJxwPJHFwS},
timestamp = {Fri, 23 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/ShiZCHH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/GhoshJHGJTDMD20,
author = {Ritwika Ghosh and
Joao P. Jansch{-}Porto and
Chiao Hsieh and
Amelia Gosse and
Minghao Jiang and
Hebron Taylor and
Peter Du and
Sayan Mitra and
Geir E. Dullerud},
title = {CyPhyHouse: {A} programming, simulation, and deployment toolchain
for heterogeneous distributed coordination},
booktitle = {2020 {IEEE} International Conference on Robotics and Automation, {ICRA}
2020, Paris, France, May 31 - August 31, 2020},
pages = {6654--6660},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICRA40945.2020.9196513},
doi = {10.1109/ICRA40945.2020.9196513},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/GhoshJHGJTDMD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/MansfieldKSH20,
author = {Ariella Mansfield and
Dhanushka Kularatne and
Edward B. Steager and
M. Ani Hsieh},
title = {A Topological Approach to Path Planning for a Magnetic Millirobot},
booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems,
{IROS} 2020, Las Vegas, NV, USA, October 24, 2020 - January 24, 2021},
pages = {7493--7500},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IROS45743.2020.9341740},
doi = {10.1109/IROS45743.2020.9341740},
timestamp = {Thu, 10 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iros/MansfieldKSH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/RovinaSKH20,
author = {Hannes Rovina and
Tahiya Salam and
Yiannis Kantaros and
M. Ani Hsieh},
title = {Asynchronous Adaptive Sampling and Reduced-Order Modeling of Dynamic
Processes by Robot Teams via Intermittently Connected Networks},
booktitle = {{IEEE/RSJ} International Conference on Intelligent Robots and Systems,
{IROS} 2020, Las Vegas, NV, USA, October 24, 2020 - January 24, 2021},
pages = {4798--4805},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IROS45743.2020.9341636},
doi = {10.1109/IROS45743.2020.9341636},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iros/RovinaSKH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/irps/ChenLLCCSTYHCLC20,
author = {Kuan{-}Ting Chen and
C. Lo and
Y.{-}Y. Lin and
C.{-}Y. Chueh and
C. Chang and
G.{-}Y. Siang and
Y.{-}J. Tseng and
Y.{-}J. Yang and
F.{-}C. Hsieh and
S.{-}H. Chang and
H. Liang and
S.{-}H. Chiang and
J.{-}H. Liu and
Y.{-}D. Lin and
P.{-}C. Yeh and
C.{-}Y. Wang and
H.{-}Y. Yang and
P.{-}J. Tzeng and
M.{-}H. Liao and
Shu{-}Tong Chang and
Y.{-}Y. Tseng and
Min{-}Hung Lee},
title = {Double Layers Omega FETs with Ferroelectric HfZrO2 for One-Transistor
Memory},
booktitle = {2020 {IEEE} International Reliability Physics Symposium, {IRPS} 2020,
Dallas, TX, USA, April 28 - May 30, 2020},
pages = {1--4},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IRPS45951.2020.9129088},
doi = {10.1109/IRPS45951.2020.9129088},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/irps/ChenLLCCSTYHCLC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/irps/HsiehCCLL20,
author = {M. H. Hsieh and
W. S. Chiang and
Harry H. Chen and
M. Z. Lin and
M. J. Lin},
title = {Comprehensive Quality and Reliability Management for Automotive Product},
booktitle = {2020 {IEEE} International Reliability Physics Symposium, {IRPS} 2020,
Dallas, TX, USA, April 28 - May 30, 2020},
pages = {1--5},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IRPS45951.2020.9128795},
doi = {10.1109/IRPS45951.2020.9128795},
timestamp = {Mon, 17 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/irps/HsiehCCLL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/HoHMC20,
author = {Wei{-}Hsiang Ho and
Yi{-}Hsun Hsieh and
Boris Murmann and
Wei{-}Zen Chen},
title = {A 32 Gb/s {PAM-4} Optical Transceiver with Active Back Termination
in 40 nm {CMOS} Technology},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2020,
Sevilla, Spain, October 10-21, 2020},
pages = {1--4},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISCAS45731.2020.9180483},
doi = {10.1109/ISCAS45731.2020.9180483},
timestamp = {Mon, 18 Jan 2021 08:38:59 +0100},
biburl = {https://dblp.org/rec/conf/iscas/HoHMC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/HsuCWTWYSCLLTCH20,
author = {Tzu{-}Hsiang Hsu and
Yen{-}Kai Chen and
Jun{-}Shen Wu and
Wen{-}Chien Ting and
Cheng{-}Te Wang and
Chen{-}Fu Yeh and
Syuan{-}Hao Sie and
Yi{-}Ren Chen and
Ren{-}Shuo Liu and
Chung{-}Chuan Lo and
Kea{-}Tiong Tang and
Meng{-}Fan Chang and
Chih{-}Cheng Hsieh},
title = {5.9 {A} 0.8V Multimode Vision Sensor for Motion and Saliency Detection
with Ping-Pong {PWM} Pixel},
booktitle = {2020 {IEEE} International Solid- State Circuits Conference, {ISSCC}
2020, San Francisco, CA, USA, February 16-20, 2020},
pages = {110--112},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISSCC19947.2020.9062926},
doi = {10.1109/ISSCC19947.2020.9062926},
timestamp = {Sat, 18 Apr 2020 17:41:44 +0200},
biburl = {https://dblp.org/rec/conf/isscc/HsuCWTWYSCLLTCH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/SiTHSLWLWLCZSWL20,
author = {Xin Si and
Yung{-}Ning Tu and
Wei{-}Hsing Huang and
Jian{-}Wei Su and
Pei{-}Jung Lu and
Jing{-}Hong Wang and
Ta{-}Wei Liu and
Ssu{-}Yen Wu and
Ruhui Liu and
Yen{-}Chi Chou and
Zhixiao Zhang and
Syuan{-}Hao Sie and
Wei{-}Chen Wei and
Yun{-}Chen Lo and
Tai{-}Hsing Wen and
Tzu{-}Hsiang Hsu and
Yen{-}Kai Chen and
William Shih and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Nan{-}Chun Lien and
Wei{-}Chiang Shih and
Yajuan He and
Qiang Li and
Meng{-}Fan Chang},
title = {15.5 {A} 28nm 64Kb 6T {SRAM} Computing-in-Memory Macro with 8b {MAC}
Operation for {AI} Edge Chips},
booktitle = {2020 {IEEE} International Solid- State Circuits Conference, {ISSCC}
2020, San Francisco, CA, USA, February 16-20, 2020},
pages = {246--248},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISSCC19947.2020.9062995},
doi = {10.1109/ISSCC19947.2020.9062995},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/SiTHSLWLWLCZSWL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/SuSCCHTLLLWZJHL20,
author = {Jian{-}Wei Su and
Xin Si and
Yen{-}Chi Chou and
Ting{-}Wei Chang and
Wei{-}Hsing Huang and
Yung{-}Ning Tu and
Ruhui Liu and
Pei{-}Jung Lu and
Ta{-}Wei Liu and
Jing{-}Hong Wang and
Zhixiao Zhang and
Hongwu Jiang and
Shanshi Huang and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Shyh{-}Shyuan Sheu and
Sih{-}Han Li and
Heng{-}Yuan Lee and
Shih{-}Chieh Chang and
Shimeng Yu and
Meng{-}Fan Chang},
title = {15.2 {A} 28nm 64Kb Inference-Training Two-Way Transpose Multibit 6T
{SRAM} Compute-in-Memory Macro for {AI} Edge Chips},
booktitle = {2020 {IEEE} International Solid- State Circuits Conference, {ISSCC}
2020, San Francisco, CA, USA, February 16-20, 2020},
pages = {240--242},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISSCC19947.2020.9062949},
doi = {10.1109/ISSCC19947.2020.9062949},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/SuSCCHTLLLWZJHL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/XueHLCKWLWHWCHC20,
author = {Cheng{-}Xin Xue and
Tsung{-}Yuan Huang and
Je{-}Syu Liu and
Ting{-}Wei Chang and
Hui{-}Yao Kao and
Jing{-}Hong Wang and
Ta{-}Wei Liu and
Shih{-}Ying Wei and
Sheng{-}Po Huang and
Wei{-}Chen Wei and
Yi{-}Ren Chen and
Tzu{-}Hsiang Hsu and
Yen{-}Kai Chen and
Yun{-}Chen Lo and
Tai{-}Hsing Wen and
Chung{-}Chuan Lo and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Meng{-}Fan Chang},
title = {15.4 {A} 22nm 2Mb ReRAM Compute-in-Memory Macro with 121-28TOPS/W
for Multibit {MAC} Computing for Tiny {AI} Edge Devices},
booktitle = {2020 {IEEE} International Solid- State Circuits Conference, {ISSCC}
2020, San Francisco, CA, USA, February 16-20, 2020},
pages = {244--246},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISSCC19947.2020.9063078},
doi = {10.1109/ISSCC19947.2020.9063078},
timestamp = {Sat, 18 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/XueHLCKWLWHWCHC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc-asia/LeeWLHL20,
author = {Ming{-}Ting Lee and
Chen{-}Hung Wu and
Shi{-}Tang Liu and
Cheng{-}Yun Hsieh and
James Chien{-}Mo Li},
title = {High Efficiency and Low Overkill Testing for Probabilistic Circuits},
booktitle = {{IEEE} International Test Conference in Asia, ITC-Asia 2020, Taipei,
Taiwan, September 23-25, 2020},
pages = {83--87},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ITC-Asia51099.2020.00026},
doi = {10.1109/ITC-ASIA51099.2020.00026},
timestamp = {Thu, 22 Oct 2020 12:38:36 +0200},
biburl = {https://dblp.org/rec/conf/itc-asia/LeeWLHL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mhci/LaiH0HLPCC20,
author = {Sih{-}Pin Lai and
Cheng{-}An Hsieh and
Yu{-}Hsin Lin and
Teepob Harutaipree and
Shih{-}Chin Lin and
Yi{-}Hao Peng and
Lung{-}Pan Cheng and
Mike Y. Chen},
editor = {Susanne Boll and
Simon T. Perrault},
title = {StrengthGaming: Enabling Dynamic Repetition Tempo in Strength Training-based
Exergame Design},
booktitle = {MobileHCI '20: 22nd International Conference on Human-Computer Interaction
with Mobile Devices and Services, Oldenburg, Germany, October 5-9,
2020},
pages = {7:1--7:8},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3379503.3403529},
doi = {10.1145/3379503.3403529},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mhci/LaiH0HLPCC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mhci/LaiH0HLPCC20a,
author = {Sih{-}Pin Lai and
Cheng{-}An Hsieh and
Yu{-}Hsin Lin and
Teepob Harutaipree and
Shih{-}Chin Lin and
Yi{-}Hao Peng and
Lung{-}Pan Cheng and
Mike Y. Chen},
editor = {Susanne Boll and
Simon T. Perrault},
title = {StrengthGaming: Enabling Dynamic Repetition Tempo in Strength Training-based
Exergame Design},
booktitle = {MobileHCI '20: 22nd International Conference on Human-Computer Interaction
with Mobile Devices and Services: Expanding the Horizon of Mobile
Interaction, Extented Abstracts, Oldenburg, Germany, October 5-9,
2020},
pages = {30:1--30:3},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3406324.3410541},
doi = {10.1145/3406324.3410541},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mhci/LaiH0HLPCC20a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mibam/ChangYCH20,
author = {Herng{-}Hua Chang and
Shin{-}Joe Yeh and
Ming{-}Chang Chiang and
Sung{-}Tsang Hsieh},
editor = {Andrzej Kr{\'{o}}l and
Barjor S. Gimi},
title = {Infarct region segmentation in rat brain {T2} {MR} images after stroke
based on fully convolutional networks},
booktitle = {Medical Imaging 2020: Biomedical Applications in Molecular, Structural,
and Functional Imaging, Houston, TX, USA, February 15-20, 2020},
series = {{SPIE} Proceedings},
volume = {11317},
pages = {113172G},
publisher = {{SPIE}},
year = {2020},
url = {https://doi.org/10.1117/12.2548561},
doi = {10.1117/12.2548561},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mibam/ChangYCH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micad/AcciavattiCMGPH20,
author = {Raymond Joseph Acciavatti and
Eric A. Cohen and
Omid Haji Maghsoudi and
Aimilia Gastounioti and
Lauren Pantalone and
Meng{-}Kang Hsieh and
Emily F. Conant and
Christopher G. Scott and
Stacey J. Winham and
Karla Kerlikowske and
Celine Vachon and
Andrew D. A. Maidment and
Despina Kontos},
editor = {Horst K. Hahn and
Maciej A. Mazurowski},
title = {Robust radiomic feature selection in digital mammography: understanding
the effect of imaging acquisition physics using phantom and clinical
data analysis},
booktitle = {Medical Imaging 2020: Computer-Aided Diagnosis, Houston, TX, USA,
February 16-19, 2020},
series = {{SPIE} Proceedings},
volume = {11314},
publisher = {{SPIE}},
year = {2020},
url = {https://doi.org/10.1117/12.2549163},
doi = {10.1117/12.2549163},
timestamp = {Tue, 05 Mar 2024 15:24:16 +0100},
biburl = {https://dblp.org/rec/conf/micad/AcciavattiCMGPH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miip/SanthanamLSESHC20,
author = {Anand P. Santhanam and
Michael Lauria and
Brad Stiehl and
Daniel Elliott and
Saty Seshan and
Scott Hsieh and
Minsong Cao and
Daniel Low},
editor = {Ivana Isgum and
Bennett A. Landman},
title = {An adversarial machine-learning-based approach and biomechanically
guided validation for improving deformable image registration accuracy
between a planning {CT} and cone-beam {CT} for adaptive prostate radiotherapy
applications},
booktitle = {Medical Imaging 2020: Image Processing, Houston, TX, USA, February
15-20, 2020},
series = {{SPIE} Proceedings},
volume = {11313},
pages = {113130P},
publisher = {{SPIE}},
year = {2020},
url = {https://doi.org/10.1117/12.2550493},
doi = {10.1117/12.2550493},
timestamp = {Tue, 21 Jul 2020 15:32:21 +0200},
biburl = {https://dblp.org/rec/conf/miip/SanthanamLSESHC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/ShaoHZKW20,
author = {Fangchi Shao and
Kuangwen Hsieh and
Pengfei Zhang and
Aniruddha M. Kaushik and
Tza{-}Huei Wang},
title = {A Programmable Nanodroplet Device with Direct Sample-to-Droplet Interface
toward High-Throughput Screening},
booktitle = {15th {IEEE} International Conference on Nano/Micro Engineered and
Molecular System, {NEMS} 2020, San Diego, CA, USA, September 27-30,
2020},
pages = {255--260},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/NEMS50311.2020.9265519},
doi = {10.1109/NEMS50311.2020.9265519},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nems/ShaoHZKW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/0001CX0LBH20,
author = {Huan Zhang and
Hongge Chen and
Chaowei Xiao and
Bo Li and
Mingyan Liu and
Duane S. Boning and
Cho{-}Jui Hsieh},
editor = {Hugo Larochelle and
Marc'Aurelio Ranzato and
Raia Hadsell and
Maria{-}Florina Balcan and
Hsuan{-}Tien Lin},
title = {Robust Deep Reinforcement Learning against Adversarial Perturbations
on State Observations},
booktitle = {Advances in Neural Information Processing Systems 33: Annual Conference
on Neural Information Processing Systems 2020, NeurIPS 2020, December
6-12, 2020, virtual},
year = {2020},
url = {https://proceedings.neurips.cc/paper/2020/hash/f0eb6568ea114ba6e293f903c34d7488-Abstract.html},
timestamp = {Tue, 19 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/0001CX0LBH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/XuS0WCHKLH20,
author = {Kaidi Xu and
Zhouxing Shi and
Huan Zhang and
Yihan Wang and
Kai{-}Wei Chang and
Minlie Huang and
Bhavya Kailkhura and
Xue Lin and
Cho{-}Jui Hsieh},
editor = {Hugo Larochelle and
Marc'Aurelio Ranzato and
Raia Hadsell and
Maria{-}Florina Balcan and
Hsuan{-}Tien Lin},
title = {Automatic Perturbation Analysis for Scalable Certified Robustness
and Beyond},
booktitle = {Advances in Neural Information Processing Systems 33: Annual Conference
on Neural Information Processing Systems 2020, NeurIPS 2020, December
6-12, 2020, virtual},
year = {2020},
url = {https://proceedings.neurips.cc/paper/2020/hash/0cbc5671ae26f67871cb914d81ef8fc1-Abstract.html},
timestamp = {Tue, 19 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/XuS0WCHKLH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nsdi/LiCHDHSYLWLC20,
author = {Ze Li and
Qian Cheng and
Ken Hsieh and
Yingnong Dang and
Peng Huang and
Pankaj Singh and
Xinsheng Yang and
Qingwei Lin and
Youjiang Wu and
Sebastien Levy and
Murali Chintalapati},
editor = {Ranjita Bhagwan and
George Porter},
title = {Gandalf: An Intelligent, End-To-End Analytics Service for Safe Deployment
in Large-Scale Cloud Infrastructure},
booktitle = {17th {USENIX} Symposium on Networked Systems Design and Implementation,
{NSDI} 2020, Santa Clara, CA, USA, February 25-27, 2020},
pages = {389--402},
publisher = {{USENIX} Association},
year = {2020},
url = {https://www.usenix.org/conference/nsdi20/presentation/li},
timestamp = {Tue, 02 Feb 2021 08:04:59 +0100},
biburl = {https://dblp.org/rec/conf/nsdi/LiCHDHSYLWLC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/paclic/HsiehTCLLKS20,
author = {Shu{-}Kai Hsieh and
Yu{-}Hsiang Tseng and
Chiung{-}Yu Chiang and
Richard Lian and
Yong{-}fu Liao and
Mao{-}Chang Ku and
Ching{-}Fang Shih},
editor = {Minh Le Nguyen and
Mai Chi Luong and
Sanghoun Song},
title = {From Sense to Action: {A} Word-Action Disambiguation Task in {NLP}},
booktitle = {Proceedings of the 34th Pacific Asia Conference on Language, Information
and Computation, {PACLIC} 2020, Hanoi, Vietnam, October 24-26, 2020},
pages = {107--112},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://aclanthology.org/2020.paclic-1.13/},
timestamp = {Tue, 18 Oct 2022 10:42:25 +0200},
biburl = {https://dblp.org/rec/conf/paclic/HsiehTCLLKS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rocling/ShihKH20,
author = {Cing{-}Fang Shih and
Mao{-}Chang Ku and
Shu{-}Kai Hsieh},
editor = {Jenq{-}Haur Wang and
Ying{-}Hui Lai},
title = {Lectal Variation of the Two Chinese Causative Auxiliaries},
booktitle = {Proceedings of the 32nd Conference on Computational Linguistics and
Speech Processing, {ROCLING} 2020, Taipei, Taiwan, September 24-26,
2020},
pages = {163--177},
publisher = {The Association for Computational Linguistics and Chinese Language
Processing {(ACLCLP)}},
year = {2020},
url = {https://aclanthology.org/2020.rocling-1.18},
timestamp = {Thu, 27 Oct 2022 16:33:44 +0200},
biburl = {https://dblp.org/rec/conf/rocling/ShihKH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/MallisseryWHB20,
author = {Sanoop Mallissery and
Yu{-}Sung Wu and
Chih{-}Hao Hsieh and
Chun{-}An Bau},
editor = {Chih{-}Cheng Hung and
Tom{\'{a}}s Cern{\'{y}} and
Dongwan Shin and
Alessio Bechini},
title = {Identification of data propagation paths for efficient dynamic information
flow tracking},
booktitle = {{SAC} '20: The 35th {ACM/SIGAPP} Symposium on Applied Computing, online
event, [Brno, Czech Republic], March 30 - April 3, 2020},
pages = {92--99},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3341105.3373876},
doi = {10.1145/3341105.3373876},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sac/MallisseryWHB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vcip/FuFCKLHHLHY20,
author = {Hao{-}Lun Fu and
Po{-}Hsiang Fang and
Chan{-}Yu Chi and
Chung{-}ting Kuo and
Meng{-}Hsuan Liu and
Howard Muchen Hsu and
Cheng{-}Hsun Hsieh and
Sheng{-}Fu Liang and
Shulan Hsieh and
Cheng{-}Ta Yang},
title = {Application of Brain-Computer Interface and Virtual Reality in Advancing
Cultural Experience},
booktitle = {2020 {IEEE} International Conference on Visual Communications and
Image Processing, {VCIP} 2020, Macau, China, December 1-4, 2020},
pages = {351--354},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/VCIP49819.2020.9301801},
doi = {10.1109/VCIP49819.2020.9301801},
timestamp = {Wed, 27 Jan 2021 14:35:05 +0100},
biburl = {https://dblp.org/rec/conf/vcip/FuFCKLHHLHY20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/ChouCTLLKSCHL020,
author = {Mao{-}Hsuan Chou and
Ya{-}Tin Chang and
Tsung{-}Hsien Tsai and
Tsung{-}Che Lu and
Chia{-}Chun Liao and
Hung{-}Yi Kuo and
Ruey{-}Bin Sheen and
Chih{-}Hsien Chang and
Kenny C.{-}H. Hsieh and
Alvin Leng Sun Loke and
Mark Chen},
title = {Embedded {PLL} Phase Noise Measurement Based on a {PFD/CP} {MASH}
1-1-1 {\(\Delta\)}{\(\Sigma\)} Time-to-Digital Converter in 7nm {CMOS}},
booktitle = {{IEEE} Symposium on {VLSI} Circuits, {VLSI} Circuits 2020, Honolulu,
HI, USA, June 16-19, 2020},
pages = {1--2},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/VLSICircuits18222.2020.9162789},
doi = {10.1109/VLSICIRCUITS18222.2020.9162789},
timestamp = {Fri, 01 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/ChouCTLLKSCHL020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vr/WuCHTC20,
author = {Shengzhi Wu and
Siyu Chen and
Mong{-}Yah Hsieh and
Conor Triplett and
Calla Carter},
title = {The other way: immersive {VR} storytelling through biking},
booktitle = {2020 {IEEE} Conference on Virtual Reality and 3D User Interfaces Abstracts
and Workshops, {VR} Workshops, Atlanta, GA, USA, March 22-26, 2020},
pages = {853},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/VRW50115.2020.00277},
doi = {10.1109/VRW50115.2020.00277},
timestamp = {Tue, 19 May 2020 13:38:21 +0200},
biburl = {https://dblp.org/rec/conf/vr/WuCHTC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2002-06622,
author = {Zhouxing Shi and
Huan Zhang and
Kai{-}Wei Chang and
Minlie Huang and
Cho{-}Jui Hsieh},
title = {Robustness Verification for Transformers},
journal = {CoRR},
volume = {abs/2002.06622},
year = {2020},
url = {https://arxiv.org/abs/2002.06622},
eprinttype = {arXiv},
eprint = {2002.06622},
timestamp = {Wed, 06 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2002-06622.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2002-06789,
author = {Minhao Cheng and
Qi Lei and
Pin{-}Yu Chen and
Inderjit S. Dhillon and
Cho{-}Jui Hsieh},
title = {{CAT:} Customized Adversarial Training for Improved Robustness},
journal = {CoRR},
volume = {abs/2002.06789},
year = {2020},
url = {https://arxiv.org/abs/2002.06789},
eprinttype = {arXiv},
eprint = {2002.06789},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2002-06789.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2002-12920,
author = {Kaidi Xu and
Zhouxing Shi and
Huan Zhang and
Minlie Huang and
Kai{-}Wei Chang and
Bhavya Kailkhura and
Xue Lin and
Cho{-}Jui Hsieh},
title = {Automatic Perturbation Analysis on General Computational Graphs},
journal = {CoRR},
volume = {abs/2002.12920},
year = {2020},
url = {https://arxiv.org/abs/2002.12920},
eprinttype = {arXiv},
eprint = {2002.12920},
timestamp = {Wed, 06 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2002-12920.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2007-02871,
author = {Dragomir R. Radev and
Rui Zhang and
Amrit Rau and
Abhinand Sivaprasad and
Chiachun Hsieh and
Nazneen Fatema Rajani and
Xiangru Tang and
Aadit Vyas and
Neha Verma and
Pranav Krishna and
Yangxiaokang Liu and
Nadia Irwanto and
Jessica Pan and
Faiaz Rahman and
Ahmad Zaidi and
Murori Mutuma and
Yasin Tarabar and
Ankit Gupta and
Tao Yu and
Yi Chern Tan and
Xi Victoria Lin and
Caiming Xiong and
Richard Socher},
title = {{DART:} Open-Domain Structured Data Record to Text Generation},
journal = {CoRR},
volume = {abs/2007.02871},
year = {2020},
url = {https://arxiv.org/abs/2007.02871},
eprinttype = {arXiv},
eprint = {2007.02871},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2007-02871.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2007-11921,
author = {Yuxuan Du and
Min{-}Hsiu Hsieh and
Tongliang Liu and
Shan You and
Dacheng Tao},
title = {Quantum differentially private sparse regression learning},
journal = {CoRR},
volume = {abs/2007.11921},
year = {2020},
url = {https://arxiv.org/abs/2007.11921},
eprinttype = {arXiv},
eprint = {2007.11921},
timestamp = {Wed, 29 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2007-11921.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2009-04655,
author = {Chiao Hsieh and
Hussein Sibai and
Hebron Taylor and
Sayan Mitra},
title = {Unmanned air-traffic management {(UTM):} Formalization, a prototype
implementation, and performance evaluation},
journal = {CoRR},
volume = {abs/2009.04655},
year = {2020},
url = {https://arxiv.org/abs/2009.04655},
eprinttype = {arXiv},
eprint = {2009.04655},
timestamp = {Thu, 17 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2009-04655.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-06201,
author = {Heliang Huang and
Yuxuan Du and
Ming Gong and
Youwei Zhao and
Yulin Wu and
Chaoyue Wang and
Shaowei Li and
Futian Liang and
Jin Lin and
Yu Xu and
Rui Yang and
Tongliang Liu and
Min{-}Hsiu Hsieh and
Hui Deng and
Hao Rong and
Cheng{-}Zhi Peng and
Chao{-}Yang Lu and
Yu{-}Ao Chen and
Dacheng Tao and
Xiaobo Zhu and
Jian{-}Wei Pan},
title = {Experimental Quantum Generative Adversarial Networks for Image Generation},
journal = {CoRR},
volume = {abs/2010.06201},
year = {2020},
url = {https://arxiv.org/abs/2010.06201},
eprinttype = {arXiv},
eprint = {2010.06201},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-06201.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-07115,
author = {Ju Long and
Hung{-}Ying Tai and
Shen{-}Ta Hsieh and
Michael Juntao Yuan},
title = {A lightweight design for serverless Function-as-a-Service},
journal = {CoRR},
volume = {abs/2010.07115},
year = {2020},
url = {https://arxiv.org/abs/2010.07115},
eprinttype = {arXiv},
eprint = {2010.07115},
timestamp = {Tue, 20 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-07115.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-10217,
author = {Yuxuan Du and
Tao Huang and
Shan You and
Min{-}Hsiu Hsieh and
Dacheng Tao},
title = {Quantum circuit architecture search: error mitigation and trainability
enhancement for variational quantum solvers},
journal = {CoRR},
volume = {abs/2010.10217},
year = {2020},
url = {https://arxiv.org/abs/2010.10217},
eprinttype = {arXiv},
eprint = {2010.10217},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-10217.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-12861,
author = {Syuan{-}Hao Sie and
Jye{-}Luen Lee and
Yi{-}Ren Chen and
Chih{-}Cheng Lu and
Chih{-}Cheng Hsieh and
Meng{-}Fan Chang and
Kea{-}Tiong Tang},
title = {{MARS:} Multi-macro Architecture {SRAM} CIM-Based Accelerator with
Co-designed Compressed Neural Networks},
journal = {CoRR},
volume = {abs/2010.12861},
year = {2020},
url = {https://arxiv.org/abs/2010.12861},
eprinttype = {arXiv},
eprint = {2010.12861},
timestamp = {Mon, 02 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-12861.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-14031,
author = {Devvrit and
Minhao Cheng and
Cho{-}Jui Hsieh and
Inderjit S. Dhillon},
title = {Voting based ensemble improves robustness of defensive models},
journal = {CoRR},
volume = {abs/2011.14031},
year = {2020},
url = {https://arxiv.org/abs/2011.14031},
eprinttype = {arXiv},
eprint = {2011.14031},
timestamp = {Tue, 01 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-14031.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2012-11769,
author = {Minhao Cheng and
Pin{-}Yu Chen and
Sijia Liu and
Shiyu Chang and
Cho{-}Jui Hsieh and
Payel Das},
title = {Self-Progressing Robust Training},
journal = {CoRR},
volume = {abs/2012.11769},
year = {2020},
url = {https://arxiv.org/abs/2012.11769},
eprinttype = {arXiv},
eprint = {2012.11769},
timestamp = {Mon, 04 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2012-11769.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/arobots/DiganiHSS19,
author = {Valerio Digani and
M. Ani Hsieh and
Lorenzo Sabattini and
Cristian Secchi},
title = {Coordination of multiple AGVs: a quadratic optimization method},
journal = {Auton. Robots},
volume = {43},
number = {3},
pages = {539--555},
year = {2019},
url = {https://doi.org/10.1007/s10514-018-9730-9},
doi = {10.1007/S10514-018-9730-9},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/arobots/DiganiHSS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/LeeLHHTLLSHYYZH19,
author = {Peisan Lee and
Ju{-}Chi Liu and
Ming{-}Hsiung Hsieh and
Wen{-}Rui Hao and
Yuan{-}Teng Tseng and
Shuen{-}Hsin Liu and
Yung{-}Kuo Lin and
Li{-}Chin Sung and
Jen{-}Hung Huang and
Hung{-}Yu Yang and
Jong{-}Shiuan Ye and
He{-}Shun Zheng and
Min{-}Huei Hsu and
Shabbir Syed{-}Abdul and
Richard Lu and
Phung Anh Nguyen and
Usman Iqbal and
Chih{-}Wei Huang and
Yu{-}Chuan (Jack) Li},
title = {Corrigendum to "Cloud-based {BP} system integrated with {CPOE} improves
self-management of the hypertensive patients: {A} randomized controlled
trial" Comput Methods Programs Biomed 2016;132: 105-113},
journal = {Comput. Methods Programs Biomed.},
volume = {176},
pages = {237--238},
year = {2019},
url = {https://doi.org/10.1016/j.cmpb.2019.04.031},
doi = {10.1016/J.CMPB.2019.04.031},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmpb/LeeLHHTLLSHYYZH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/KuoHLSH19,
author = {Po{-}Yu Kuo and
Chia{-}Hsin Hsieh and
Jin{-}Fa Lin and
Ming{-}Hwa Sheu and
Yi{-}Ting Hung},
title = {Low Complexity and Low Power Sense-Amplifier Based Flip-Flop Design},
journal = {{IEICE} Trans. Electron.},
volume = {102-C},
number = {11},
pages = {833--838},
year = {2019},
url = {https://doi.org/10.1587/transele.2018ECP5059},
doi = {10.1587/TRANSELE.2018ECP5059},
timestamp = {Mon, 18 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieicet/KuoHLSH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijes/WengWHJSL19,
author = {Tien{-}Hsiung Weng and
Teng{-}Xian Wang and
Meng{-}Yen Hsieh and
Hai Jiang and
Jun Shen and
Kuan{-}Ching Li},
title = {Parallel fast Fourier transform in {SPMD} style of Cilk},
journal = {Int. J. Embed. Syst.},
volume = {11},
number = {6},
pages = {778--787},
year = {2019},
url = {https://doi.org/10.1504/IJES.2019.103998},
doi = {10.1504/IJES.2019.103998},
timestamp = {Fri, 11 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijes/WengWHJSL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhci/LinH19,
author = {Sunny S. J. Lin and
Ming{-}Yi Hsieh},
title = {Differences between {EFL} Beginners and Intermediate Level Readers
When Reading Onscreen Narrative Text with Pictures: {A} Study of Eye
Movements as a Guide to Personalization},
journal = {Int. J. Hum. Comput. Interact.},
volume = {35},
number = {4-5},
pages = {299--312},
year = {2019},
url = {https://doi.org/10.1080/10447318.2018.1543089},
doi = {10.1080/10447318.2018.1543089},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhci/LinH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijnsec/ChiouPCH19,
author = {Shu{-}Fen Chiou and
Hsieh{-}Tsen Pan and
Eko Fajar Cahyadi and
Min{-}Shiang Hwang},
title = {Cryptanalysis of the Mutual Authentication and Key Agreement Protocol
with Smart Cards for Wireless Communications},
journal = {Int. J. Netw. Secur.},
volume = {21},
number = {1},
pages = {100--104},
year = {2019},
url = {http://ijns.jalaxy.com.tw/contents/ijns-v21-n1/ijns-2019-v21-n1-p100-104.pdf},
timestamp = {Mon, 04 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijnsec/ChiouPCH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijnsec/PanCCH19,
author = {Hsieh{-}Tsen Pan and
Eko Fajar Cahyadi and
Shu{-}Fen Chiou and
Min{-}Shiang Hwang},
title = {Research on Batch Verification Schemes for Identifying Illegal Signatures},
journal = {Int. J. Netw. Secur.},
volume = {21},
number = {6},
pages = {1062--1070},
year = {2019},
url = {http://ijns.jalaxy.com.tw/contents/ijns-v21-n6/ijns-2019-v21-n6-p1062-1070.pdf},
timestamp = {Mon, 04 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijnsec/PanCCH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iotj/GochooTHBHAC19,
author = {Munkhjargal Gochoo and
Tan{-}Hsu Tan and
Shih{-}Chia Huang and
Tsedevdorj Batjargal and
Jun{-}Wei Hsieh and
Fady S. Alnajjar and
Yung{-}Fu Chen},
title = {Novel IoT-Based Privacy-Preserving Yoga Posture Recognition System
Using Low-Resolution Infrared Sensors and Deep Learning},
journal = {{IEEE} Internet Things J.},
volume = {6},
number = {4},
pages = {7192--7200},
year = {2019},
url = {https://doi.org/10.1109/JIOT.2019.2915095},
doi = {10.1109/JIOT.2019.2915095},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iotj/GochooTHBHAC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/SuhH19,
author = {Minhyang (Mia) Suh and
Gary Hsieh},
title = {The "Had Mores": Exploring korean immigrants' information behavior
and {ICT} usage when settling in the United States},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {70},
number = {1},
pages = {38--48},
year = {2019},
url = {https://doi.org/10.1002/asi.24078},
doi = {10.1002/ASI.24078},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasis/SuhH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jisys/HsiehWA19,
author = {Tien{-}Shih Hsieh and
Zhihong Wang and
Mohammad Abdolmohammadi},
title = {Factors Associated with Companies' Choices of {XBRL} Implementation
Strategies: Evidence from the {U.S.} Market},
journal = {J. Inf. Syst.},
volume = {33},
number = {3},
pages = {75--91},
year = {2019},
url = {https://doi.org/10.2308/isys-52185},
doi = {10.2308/ISYS-52185},
timestamp = {Sun, 21 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jisys/HsiehWA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/ZhouFSZHL19,
author = {Qingguo Zhou and
Fang Feng and
Zebang Shen and
Rui Zhou and
Meng{-}Yen Hsieh and
Kuan{-}Ching Li},
title = {A novel approach for mobile malware classification and detection in
Android systems},
journal = {Multim. Tools Appl.},
volume = {78},
number = {3},
pages = {3529--3552},
year = {2019},
url = {https://doi.org/10.1007/s11042-018-6498-z},
doi = {10.1007/S11042-018-6498-Z},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mta/ZhouFSZHL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ral/SalamH19,
author = {Tahiya Salam and
M. Ani Hsieh},
title = {Adaptive Sampling and Reduced-Order Modeling of Dynamic Processes
by Robot Teams},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {4},
number = {2},
pages = {477--484},
year = {2019},
url = {https://doi.org/10.1109/LRA.2019.2891475},
doi = {10.1109/LRA.2019.2891475},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ral/SalamH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/HsiehLPSCH19,
author = {Yi{-}Zeng Hsieh and
Yu{-}Cin Luo and
Chen Pan and
Mu{-}Chun Su and
Chi{-}Jen Chen and
Kevin Li{-}Chun Hsieh},
title = {Cerebral Small Vessel Disease Biomarkers Detection on MRI-Sensor-Based
Image and Deep Learning},
journal = {Sensors},
volume = {19},
number = {11},
pages = {2573},
year = {2019},
url = {https://doi.org/10.3390/s19112573},
doi = {10.3390/S19112573},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/HsiehLPSCH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taffco/HsiaoSHTTL19,
author = {Shan{-}Wen Hsiao and
Hung{-}Ching Sun and
Ming{-}Chuan Hsieh and
Ming{-}Hsueh Tsai and
Yu Tsao and
Chi{-}Chun Lee},
title = {Toward Automating Oral Presentation Scoring During Principal Certification
Program Using Audio-Video Low-Level Behavior Profiles},
journal = {{IEEE} Trans. Affect. Comput.},
volume = {10},
number = {4},
pages = {552--567},
year = {2019},
url = {https://doi.org/10.1109/TAFFC.2017.2749569},
doi = {10.1109/TAFFC.2017.2749569},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/taffco/HsiaoSHTTL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/WeiWHPK19,
author = {Dong Wei and
Susan Weinstein and
Meng{-}Kang Hsieh and
Lauren Pantalone and
Despina Kontos},
title = {Three-Dimensional Whole Breast Segmentation in Sagittal and Axial
Breast {MRI} With Dense Depth Field Modeling and Localized Self-Adaptation
for Chest-Wall Line Detection},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {66},
number = {6},
pages = {1567--1579},
year = {2019},
url = {https://doi.org/10.1109/TBME.2018.2875955},
doi = {10.1109/TBME.2018.2875955},
timestamp = {Wed, 21 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/WeiWHPK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcad/HsiehWSHPCL19,
author = {Shih{-}An Hsieh and
Ying{-}Hsu Wang and
Ting{-}Yu Shen and
Kuan{-}Yen Huang and
Chia{-}Cheng Pai and
Tsai{-}Chieh Chen and
James Chien{-}Mo Li},
title = {DR-Scan: Dual-Rail Asynchronous Scan DfT and {ATPG}},
journal = {{IEEE} Trans. Comput. Aided Des. Integr. Circuits Syst.},
volume = {38},
number = {1},
pages = {136--148},
year = {2019},
url = {https://doi.org/10.1109/TCAD.2018.2801226},
doi = {10.1109/TCAD.2018.2801226},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcad/HsiehWSHPCL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tecs/YimMHB19,
author = {Keun Soo Yim and
Iliyan Malchev and
Andrew Hsieh and
Dave Burke},
title = {Treble: Fast Software Updates by Creating an Equilibrium in an Active
Software Ecosystem of Globally Distributed Stakeholders},
journal = {{ACM} Trans. Embed. Comput. Syst.},
volume = {18},
number = {5s},
pages = {104:1--104:23},
year = {2019},
url = {https://doi.org/10.1145/3358237},
doi = {10.1145/3358237},
timestamp = {Sat, 08 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tecs/YimMHB19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tit/ZhuZHS19,
author = {Elton Yechao Zhu and
Quntao Zhuang and
Min{-}Hsiu Hsieh and
Peter W. Shor},
title = {Superadditivity in Trade-Off Capacities of Quantum Channels},
journal = {{IEEE} Trans. Inf. Theory},
volume = {65},
number = {6},
pages = {3973--3989},
year = {2019},
url = {https://doi.org/10.1109/TIT.2018.2889082},
doi = {10.1109/TIT.2018.2889082},
timestamp = {Tue, 10 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tit/ZhuZHS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/MirandaDLWHS19,
author = {Fabio Miranda and
Harish Doraiswamy and
Marcos Lage and
Luc Wilson and
Mondrian Hsieh and
Cl{\'{a}}udio T. Silva},
title = {Shadow Accrual Maps: Efficient Accumulation of City-Scale Shadows
Over Time},
journal = {{IEEE} Trans. Vis. Comput. Graph.},
volume = {25},
number = {3},
pages = {1559--1574},
year = {2019},
url = {https://doi.org/10.1109/TVCG.2018.2802945},
doi = {10.1109/TVCG.2018.2802945},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvcg/MirandaDLWHS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aina/HsiehLYCLN19,
author = {Meng{-}Ling Hsieh and
Wei{-}Tsen Lin and
Suhan Yu and
Yi{-}Chi Chen and
Jung{-}Shan Lin and
Lin{-}Hui Nung},
editor = {Leonard Barolli and
Makoto Takizawa and
Fatos Xhafa and
Tomoya Enokido},
title = {The Case Study of Software Build-in Design Based on Quality Factors
and {FMEA}},
booktitle = {Web, Artificial Intelligence and Network Applications - Proceedings
of the Workshops of the 33rd International Conference on Advanced
Information Networking and Applications, {AINA} Workshops 2019, Matsue,
Japan, March 27-29, 2019},
series = {Advances in Intelligent Systems and Computing},
volume = {927},
pages = {451--458},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-15035-8\_42},
doi = {10.1007/978-3-030-15035-8\_42},
timestamp = {Fri, 29 Mar 2019 10:44:54 +0100},
biburl = {https://dblp.org/rec/conf/aina/HsiehLYCLN19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asscc/ZhangCSTSHWWCHS19,
author = {Zhixiao Zhang and
Jia{-}Jing Chen and
Xin Si and
Yung{-}Ning Tu and
Jian{-}Wei Su and
Wei{-}Hsing Huang and
Jing{-}Hong Wang and
Wei{-}Chen Wei and
Yen{-}Cheng Chiu and
Je{-}Min Hong and
Shyh{-}Shyuan Sheu and
Sih{-}Han Li and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Meng{-}Fan Chang},
title = {A 55nm 1-to-8 bit Configurable 6T {SRAM} based Computing-in-Memory
Unit-Macro for CNN-based {AI} Edge Processors},
booktitle = {{IEEE} Asian Solid-State Circuits Conference, {A-SSCC} 2019, Macau,
SAR, China, November 4-6, 2019},
pages = {217--218},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/A-SSCC47793.2019.9056933},
doi = {10.1109/A-SSCC47793.2019.9056933},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asscc/ZhangCSTSHWWCHS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bea/YoonHZMWM19,
author = {Su{-}Youn Yoon and
Ching{-}Ni Hsieh and
Klaus Zechner and
Matthew Mulholland and
Yuan Wang and
Nitin Madnani},
editor = {Helen Yannakoudakis and
Ekaterina Kochmar and
Claudia Leacock and
Nitin Madnani and
Ildik{\'{o}} Pil{\'{a}}n and
Torsten Zesch},
title = {Toward Automated Content Feedback Generation for Non-native Spontaneous
Speech},
booktitle = {Proceedings of the Fourteenth Workshop on Innovative Use of {NLP}
for Building Educational Applications, BEA@ACL 2019, Florence, Italy,
August 2, 2019},
pages = {306--315},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/w19-4432},
doi = {10.18653/V1/W19-4432},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bea/YoonHZMWM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/ShishikaPDH019,
author = {Daigo Shishika and
James Paulos and
Michael R. Dorothy and
M. Ani Hsieh and
Vijay Kumar},
title = {Team Composition for Perimeter Defense with Patrollers and Defenders},
booktitle = {58th {IEEE} Conference on Decision and Control, {CDC} 2019, Nice,
France, December 11-13, 2019},
pages = {7325--7332},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CDC40024.2019.9030082},
doi = {10.1109/CDC40024.2019.9030082},
timestamp = {Fri, 04 Mar 2022 13:30:46 +0100},
biburl = {https://dblp.org/rec/conf/cdc/ShishikaPDH019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/ColussoJMH19,
author = {Lucas Colusso and
Ridley Jones and
Sean A. Munson and
Gary Hsieh},
editor = {Stephen A. Brewster and
Geraldine Fitzpatrick and
Anna L. Cox and
Vassilis Kostakos},
title = {A Translational Science Model for {HCI}},
booktitle = {Proceedings of the 2019 {CHI} Conference on Human Factors in Computing
Systems, {CHI} 2019, Glasgow, Scotland, UK, May 04-09, 2019},
pages = {1},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3290605.3300231},
doi = {10.1145/3290605.3300231},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/ColussoJMH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/NilssonRSLCMMK19,
author = {Tommy Nilsson and
Tessa Roper and
Emily Shaw and
Glyn Lawson and
Sue Valerie Gray Cobb and
Hsieh Meng{-}Ko and
Daniel Miller and
James Khan},
editor = {Regan L. Mandryk and
Stephen A. Brewster and
Mark Hancock and
Geraldine Fitzpatrick and
Anna L. Cox and
Vassilis Kostakos and
Mark Perry},
title = {Multisensory Virtual Environment for Fire Evacuation Training},
booktitle = {Extended Abstracts of the 2019 {CHI} Conference on Human Factors in
Computing Systems, {CHI} 2019, Glasgow, Scotland, UK, May 04-09, 2019},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3290607.3313283},
doi = {10.1145/3290607.3313283},
timestamp = {Tue, 21 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/NilssonRSLCMMK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chiplay/LaiHHLPCC19,
author = {Sih{-}Pin Lai and
Cheng{-}An Hsieh and
Teepob Harutaipree and
Shih{-}Chin Lin and
Yi{-}Hao Peng and
Lung{-}Pan Cheng and
Mike Y. Chen},
editor = {Joan Arnedo and
Lennart E. Nacke and
Vero Vanden Abeele and
Phoebe O. Toups Dugas},
title = {FitBird: Improving Free-weight Training Experience using Wearable
Sensors for Game Control},
booktitle = {Extended Abstracts of the Annual Symposium on Computer-Human Interaction
in Play Companion Extended Abstracts, Barcelona, Spain, October 22-25,
2019},
pages = {475--481},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3341215.3356258},
doi = {10.1145/3341215.3356258},
timestamp = {Tue, 06 Sep 2022 13:45:09 +0200},
biburl = {https://dblp.org/rec/conf/chiplay/LaiHHLPCC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/criwg/HsiehLTWCCC19,
author = {I{-}Chen Hsieh and
Chen{-}Chung Liu and
Meng{-}Jung Tsai and
Cai{-}Ting Wen and
Ming{-}Hua Chang and
Shih{-}Hsun Fan Chiang and
Chia{-}Jung Chang},
editor = {Hideyuki Nakanishi and
Hironori Egi and
Irene{-}Angelica Chounta and
Hideyuki Takada and
Satoshi Ichimura and
Ulrich Hoppe},
title = {The Analysis of Collaborative Science Learning with Simulations Through
Dual Eye-Tracking Techniques},
booktitle = {Collaboration Technologies and Social Computing - 25th International
Conference, CRIWG/CollabTech 2019, Kyoto, Japan, September 4-6, 2019,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {11677},
pages = {36--44},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-28011-6\_3},
doi = {10.1007/978-3-030-28011-6\_3},
timestamp = {Fri, 30 Aug 2019 09:05:12 +0200},
biburl = {https://dblp.org/rec/conf/criwg/HsiehLTWCCC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/AlzantotSCZHS19,
author = {Moustafa Alzantot and
Yash Sharma and
Supriyo Chakraborty and
Huan Zhang and
Cho{-}Jui Hsieh and
Mani B. Srivastava},
editor = {Anne Auger and
Thomas St{\"{u}}tzle},
title = {GenAttack: practical black-box attacks with gradient-free optimization},
booktitle = {Proceedings of the Genetic and Evolutionary Computation Conference,
{GECCO} 2019, Prague, Czech Republic, July 13-17, 2019},
pages = {1111--1119},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3321707.3321749},
doi = {10.1145/3321707.3321749},
timestamp = {Mon, 02 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/gecco/AlzantotSCZHS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ghtc/HuynhCNWAGHHMWO19,
author = {Toan Huynh and
David M. Cate and
Kevin P. Nichols and
Bernhard H. Weigl and
Caitlin E. Anderson and
David J. Gasperino and
Stephen P. Harston and
Helen V. Hsieh and
Rosemichelle Marzan and
John R. Williford and
Ciela I. Oncina and
Veronika A. Glukhova},
title = {Integrated Robotic System for the Development Lateral Flow Assays},
booktitle = {{IEEE} Global Humanitarian Technology Conference, {GHTC} 2019, Seattle,
WA, USA, October 17-20, 2019},
pages = {1--4},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/GHTC46095.2019.9033066},
doi = {10.1109/GHTC46095.2019.9033066},
timestamp = {Mon, 23 Mar 2020 14:36:57 +0100},
biburl = {https://dblp.org/rec/conf/ghtc/HuynhCNWAGHHMWO19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccsce/HsiehMHLC19,
author = {Yao{-}Ching Hsieh and
Chin{-}Sien Moo and
You{-}Chun Huang and
Shun{-}Yi Liu and
Yong{-}Nong Chang},
title = {Distributive Maximum Power Point Tracking for Serial Photovoltaic
Panels with Partial Power Regulation},
booktitle = {9th {IEEE} International Conference on Control System, Computing and
Engineering, {ICCSCE} 2019, Penang, Malaysia, November 29 - Dec. 1,
2019},
pages = {110--114},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICCSCE47578.2019.9068557},
doi = {10.1109/ICCSCE47578.2019.9068557},
timestamp = {Thu, 07 May 2020 14:36:34 +0200},
biburl = {https://dblp.org/rec/conf/iccsce/HsiehMHLC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icit2/LinLHHCM19,
author = {Shian{-}Nan Lin and
Tung{-}Yen Lee and
Zheng{-}Yan He and
Yao Ching Hsieh and
Yong{-}Nong Chang and
Chin{-}Sien Moo},
title = {An {LED} Driver with Wide Operation Range for Automotive Lighting},
booktitle = {{IEEE} International Conference on Industrial Technology, {ICIT} 2019,
Melbourne, Australia, February 13-15, 2019},
pages = {1--4},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICIT.2019.8755135},
doi = {10.1109/ICIT.2019.8755135},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/icit2/LinLHHCM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/HsiehZEME19,
author = {Jun{-}Ting Hsieh and
Shengjia Zhao and
Stephan Eismann and
Lucia Mirabella and
Stefano Ermon},
title = {Learning Neural {PDE} Solvers with Convergence Guarantees},
booktitle = {7th International Conference on Learning Representations, {ICLR} 2019,
New Orleans, LA, USA, May 6-9, 2019},
publisher = {OpenReview.net},
year = {2019},
url = {https://openreview.net/forum?id=rklaWn0qK7},
timestamp = {Thu, 25 Jul 2019 13:03:15 +0200},
biburl = {https://dblp.org/rec/conf/iclr/HsiehZEME19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/HsiehNS19,
author = {Yu{-}Guan Hsieh and
Gang Niu and
Masashi Sugiyama},
editor = {Kamalika Chaudhuri and
Ruslan Salakhutdinov},
title = {Classification from Positive, Unlabeled and Biased Negative Data},
booktitle = {Proceedings of the 36th International Conference on Machine Learning,
{ICML} 2019, 9-15 June 2019, Long Beach, California, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {97},
pages = {2820--2829},
publisher = {{PMLR}},
year = {2019},
url = {http://proceedings.mlr.press/v97/hsieh19c.html},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/HsiehNS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/SaeidiLOLKHKK19,
author = {Hamed Saeidi and
Hanh N. D. Le and
Justin D. Opfermann and
Simon L{\'{e}}onard and
A. Kim and
Michael H. Hsieh and
Jin U. Kang and
Axel Krieger},
title = {Autonomous Laparoscopic Robotic Suturing with a Novel Actuated Suturing
Tool and 3D Endoscope},
booktitle = {International Conference on Robotics and Automation, {ICRA} 2019,
Montreal, QC, Canada, May 20-24, 2019},
pages = {1541--1547},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICRA.2019.8794306},
doi = {10.1109/ICRA.2019.8794306},
timestamp = {Mon, 25 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/SaeidiLOLKHKK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifm/HsiehM19,
author = {Chiao Hsieh and
Sayan Mitra},
editor = {Wolfgang Ahrendt and
Silvia Lizeth Tapia Tarifa},
title = {Dione: {A} Protocol Verification System Built with Dafny for {I/O}
Automata},
booktitle = {Integrated Formal Methods - 15th International Conference, {IFM} 2019,
Bergen, Norway, December 2-6, 2019, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {11918},
pages = {227--245},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-34968-4\_13},
doi = {10.1007/978-3-030-34968-4\_13},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifm/HsiehM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipmi/HsiehACMY19,
author = {Dai{-}Ni Hsieh and
Sylvain Arguill{\`{e}}re and
Nicolas Charon and
Michael I. Miller and
Laurent Younes},
editor = {Albert C. S. Chung and
James C. Gee and
Paul A. Yushkevich and
Siqi Bao},
title = {A Model for Elastic Evolution on Foliated Shapes},
booktitle = {Information Processing in Medical Imaging - 26th International Conference,
{IPMI} 2019, Hong Kong, China, June 2-7, 2019, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {11492},
pages = {644--655},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-20351-1\_50},
doi = {10.1007/978-3-030-20351-1\_50},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ipmi/HsiehACMY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/irps/LiuHCJLFL19,
author = {S. E. Liu and
M. H. Hsieh and
Y. R. Chen and
J. Y. Jao and
M. Z. Lin and
Y. H. Fang and
M. J. Lin},
title = {High Voltage Tolerant Design with Advanced Process for {TV} Application},
booktitle = {{IEEE} International Reliability Physics Symposium, {IRPS} 2019, Monterey,
CA, USA, March 31 - April 4, 2019},
pages = {1--4},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/IRPS.2019.8720421},
doi = {10.1109/IRPS.2019.8720421},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/irps/LiuHCJLFL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/BoroumandGPHLAH19,
author = {Amirali Boroumand and
Saugata Ghose and
Minesh Patel and
Hasan Hassan and
Brandon Lucia and
Rachata Ausavarungnirun and
Kevin Hsieh and
Nastaran Hajinazar and
Krishna T. Malladi and
Hongzhong Zheng and
Onur Mutlu},
editor = {Srilatha Bobbie Manne and
Hillery C. Hunter and
Erik R. Altman},
title = {CoNDA: efficient cache coherence support for near-data accelerators},
booktitle = {Proceedings of the 46th International Symposium on Computer Architecture,
{ISCA} 2019, Phoenix, AZ, USA, June 22-26, 2019},
pages = {629--642},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3307650.3322266},
doi = {10.1145/3307650.3322266},
timestamp = {Fri, 09 Jul 2021 15:51:20 +0200},
biburl = {https://dblp.org/rec/conf/isca/BoroumandGPHLAH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/ChangWH19,
author = {Yung{-}Te Chang and
Min{-}Rui Wu and
Chih{-}Cheng Hsieh},
title = {A 40MS/s 12-bit Zero-Crossing Based SAR-Assisted Two-Stage Pipelined
{ADC} with Adaptive Level Shifting},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2019,
Sapporo, Japan, May 26-29, 2019},
pages = {1--4},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISCAS.2019.8702449},
doi = {10.1109/ISCAS.2019.8702449},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/ChangWH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/HsiehTHLC19,
author = {Ping{-}Hsuan Hsieh and
Ming{-}Li Tang and
Sheng{-}Yen Hsu and
Meng{-}Hung Lin and
Yi{-}Hsiu Chen},
title = {Design and Implementation of a Memristor-Based Oscillator},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2019,
Sapporo, Japan, May 26-29, 2019},
pages = {1--4},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISCAS.2019.8702394},
doi = {10.1109/ISCAS.2019.8702394},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iscas/HsiehTHLC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isit/SalekHF19,
author = {Farzin Salek and
Min{-}Hsiu Hsieh and
Javier R. Fonollosa},
title = {Publicness, Privacy and Confidentiality in the Single-Serving Quantum
Broadcast Channel},
booktitle = {{IEEE} International Symposium on Information Theory, {ISIT} 2019,
Paris, France, July 7-12, 2019},
pages = {1712--1716},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISIT.2019.8849633},
doi = {10.1109/ISIT.2019.8849633},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isit/SalekHF19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispacs/JhuoHWCYY19,
author = {Sing{-}Ling Jhuo and
Mi{-}Tren Hsieh and
Ting{-}Chien Weng and
Mei{-}Juan Chen and
Chieh{-}Ming Yang and
Chia{-}Hung Yeh},
title = {Trend Prediction of Influenza and the Associated Pneumonia in Taiwan
Using Machine Learning},
booktitle = {2019 International Symposium on Intelligent Signal Processing and
Communication Systems, {ISPACS} 2019, Taipei, Taiwan, December 3-6,
2019},
pages = {1--2},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISPACS48206.2019.8986244},
doi = {10.1109/ISPACS48206.2019.8986244},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ispacs/JhuoHWCYY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/HungLPWHLHZJLLH19,
author = {Chih{-}Ming Hung and
Alex T. C. Lin and
B. C. Peng and
Hua Wang and
Jui{-}Lin Hsu and
Yen{-}Ju Lu and
Wei{-}Show Hsu and
Jing{-}Hong Conan Zhan and
Brian Juan and
Chi{-}Hang Lok and
Sam Lee and
P. C. Hsiao and
Qiang Zhou and
Mark Wei and
Hsiang{-}Yun Chu and
Yu{-}Lun Chen and
Chao{-}Ching Hung and
Kevin Fong and
Po{-}Chun Huang and
Pierce Chen and
Sheng{-}Yuan Su and
Yan{-}Jiun Chen and
Kehou Chen and
Chun{-}Chao Tung and
Yi{-}Jhan Hsieh and
Tzung{-}Chuen Tsai and
Yi{-}Fu Chen and
Wei{-}Kuo Hsin and
Liang Guo and
Hanfei Liu and
Dapeng Jin},
title = {Toward Automotive Surround-View Radars},
booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2019,
San Francisco, CA, USA, February 17-21, 2019},
pages = {162--164},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISSCC.2019.8662489},
doi = {10.1109/ISSCC.2019.8662489},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/HungLPWHLHZJLLH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/SiCTHWCWWSLYLHT19,
author = {Xin Si and
Jia{-}Jing Chen and
Yung{-}Ning Tu and
Wei{-}Hsing Huang and
Jing{-}Hong Wang and
Yen{-}Cheng Chiu and
Wei{-}Chen Wei and
Ssu{-}Yen Wu and
Xiaoyu Sun and
Rui Liu and
Shimeng Yu and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Qiang Li and
Meng{-}Fan Chang},
title = {A Twin-8T {SRAM} Computation-In-Memory Macro for Multiple-Bit CNN-Based
Machine Learning},
booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2019,
San Francisco, CA, USA, February 17-21, 2019},
pages = {396--398},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISSCC.2019.8662392},
doi = {10.1109/ISSCC.2019.8662392},
timestamp = {Wed, 26 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/SiCTHWCWWSLYLHT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/TangLSLSWCCBCHR19,
author = {Chih{-}Chun Tang and
Yi{-}Bin Lee and
Chih{-}hao Eric Sun and
Cheng{-}Chieh Lin and
Jin{-}Siang Syu and
Min{-}Hua Wu and
YangChuan Chen and
Tzu{-}Chan Chueh and
Carl Bryant and
Manel Collados and
Mohammed Hassan and
Joao Ramos and
Yu{-}Lin Hsieh and
Hsinhung Chen and
Xiaochuan Guo and
Hsinhua Chen and
Changhua Cao and
Daniel Li and
Jon Strange and
Caiyi Wang and
Guang{-}Kaai Dehng},
title = {An {LTE-A} Multimode Multiband {RF} Transceiver with 4RX/2TX Inter-Band
Carrier Aggregation, 2-Carrier 4{\texttimes}4 {MIMO} with 256QAM and
{HPUE} Capability in 28nm {CMOS}},
booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2019,
San Francisco, CA, USA, February 17-21, 2019},
pages = {350--352},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISSCC.2019.8662362},
doi = {10.1109/ISSCC.2019.8662362},
timestamp = {Tue, 12 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/TangLSLSWCCBCHR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/XueCLLLLWWCCHKW19,
author = {Cheng{-}Xin Xue and
Wei{-}Hao Chen and
Je{-}Syu Liu and
Jia{-}Fang Li and
Wei{-}Yu Lin and
Wei{-}En Lin and
Jing{-}Hong Wang and
Wei{-}Chen Wei and
Ting{-}Wei Chang and
Tung{-}Cheng Chang and
Tsung{-}Yuan Huang and
Hui{-}Yao Kao and
Shih{-}Ying Wei and
Yen{-}Cheng Chiu and
Chun{-}Ying Lee and
Chung{-}Chuan Lo and
Ya{-}Chin King and
Chorng{-}Jung Lin and
Ren{-}Shuo Liu and
Chih{-}Cheng Hsieh and
Kea{-}Tiong Tang and
Meng{-}Fan Chang},
title = {A 1Mb Multibit ReRAM Computing-In-Memory Macro with 14.6ns Parallel
{MAC} Computing Time for {CNN} Based {AI} Edge Processors},
booktitle = {{IEEE} International Solid- State Circuits Conference, {ISSCC} 2019,
San Francisco, CA, USA, February 17-21, 2019},
pages = {388--390},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ISSCC.2019.8662395},
doi = {10.1109/ISSCC.2019.8662395},
timestamp = {Tue, 12 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/XueCLLLLWWCCHKW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micad/NavaratnaGHPSCK19,
author = {Ruvini Navaratna and
Aimilia Gastounioti and
Meng{-}Kang Hsieh and
Lauren Pantalone and
Marie Shelanski and
Emily F. Conant and
Despina Kontos},
editor = {Kensaku Mori and
Horst K. Hahn},
title = {Associations between mammographic phenotypes and histopathologic features
in ductal carcinoma in situ},
booktitle = {Medical Imaging 2019: Computer-Aided Diagnosis, San Diego, California,
United States, 16-21 February 2019},
series = {{SPIE} Proceedings},
volume = {10950},
pages = {109502K},
publisher = {{SPIE}},
year = {2019},
url = {https://doi.org/10.1117/12.2512464},
doi = {10.1117/12.2512464},
timestamp = {Wed, 17 Apr 2019 09:20:02 +0200},
biburl = {https://dblp.org/rec/conf/micad/NavaratnaGHPSCK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/KamSWOLHKK19,
author = {Michael Kam and
Hamed Saeidi and
Shuwen Wei and
Justin D. Opfermann and
Simon L{\'{e}}onard and
Michael H. Hsieh and
Jin U. Kang and
Axel Krieger},
editor = {Dinggang Shen and
Tianming Liu and
Terry M. Peters and
Lawrence H. Staib and
Caroline Essert and
Sean Zhou and
Pew{-}Thian Yap and
Ali R. Khan},
title = {Semi-autonomous Robotic Anastomoses of Vaginal Cuffs Using Marker
Enhanced 3D Imaging and Path Planning},
booktitle = {Medical Image Computing and Computer Assisted Intervention - {MICCAI}
2019 - 22nd International Conference, Shenzhen, China, October 13-17,
2019, Proceedings, Part {V}},
series = {Lecture Notes in Computer Science},
volume = {11768},
pages = {65--73},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-32254-0\_8},
doi = {10.1007/978-3-030-32254-0\_8},
timestamp = {Mon, 19 Feb 2024 14:24:13 +0100},
biburl = {https://dblp.org/rec/conf/miccai/KamSWOLHKK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ner/SongHS19,
author = {Christian Y. Song and
Han{-}Lin Hsieh and
Maryam M. Shanechi},
title = {Decoder for Switching State-Space Models with Spike-Field Observations},
booktitle = {2019 9th International {IEEE/EMBS} Conference on Neural Engineering
(NER), San Francisco, CA, USA, March 20-23, 2019},
pages = {199--202},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/NER.2019.8716970},
doi = {10.1109/NER.2019.8716970},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ner/SongHS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/photoptics/SuTHYH19,
author = {Fang{-}Ci Su and
Hsin{-}Yi Tsai and
Yu{-}Chen Hsieh and
Chih{-}Chung Yang and
Min{-}Wei Hung},
editor = {Maria Raposo and
Paulo A. Ribeiro and
David Andrews},
title = {Study on Aging Effect of Optical Film under High Intensity of {UV}
Exposure},
booktitle = {Proceedings of the 7th International Conference on Photonics, Optics
and Laser Technology, {PHOTOPTICS} 2019, Prague, Czech Republic, February
25-27, 2019},
pages = {174--180},
publisher = {SciTePress},
year = {2019},
url = {https://doi.org/10.5220/0007377201740180},
doi = {10.5220/0007377201740180},
timestamp = {Thu, 05 Dec 2019 18:13:27 +0100},
biburl = {https://dblp.org/rec/conf/photoptics/SuTHYH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/GochooHLCS19,
author = {Munkhjargal Gochoo and
Jun{-}Wei Hsieh and
Chien{-}Hung Lee and
Yun{-}Chih Chen and
Yu{-}Chi Shih},
title = {Chronic Kidney Disease Stage Classification Using Renal Artery Doppler-Derived
Parameters},
booktitle = {2019 {IEEE} International Conference on Systems, Man and Cybernetics,
{SMC} 2019, Bari, Italy, October 6-9, 2019},
pages = {2502--2505},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/SMC.2019.8913899},
doi = {10.1109/SMC.2019.8913899},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/smc/GochooHLCS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/snpd/JhangGWH19,
author = {Wun{-}Syun Jhang and
Shao{-}En Gao and
Chuin{-}Mu Wang and
Ming{-}Chu Hsieh},
editor = {Masahide Nakamura and
Hiroaki Hirata and
Takayuki Ito and
Takanobu Otsuka and
Shun Okuhara},
title = {Share Price Trend Prediction Using Attention with {LSTM} Structure},
booktitle = {20th {IEEE/ACIS} International Conference on Software Engineering,
Artificial Intelligence, Networking and Parallel/Distributed Computing,
{SNPD} 2019, Toyama, Japan, July 8-11, 2019},
pages = {208--211},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/SNPD.2019.8935806},
doi = {10.1109/SNPD.2019.8935806},
timestamp = {Tue, 07 Sep 2021 18:19:39 +0200},
biburl = {https://dblp.org/rec/conf/snpd/JhangGWH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/spml/ChangHFC19,
author = {Ming{-}Jen Chang and
Jih{-}Tang Hsieh and
Chiung{-}Yao Fang and
Sei{-}Wang Chen},
title = {A Vision-based Human Action Recognition System for Moving Cameras
Through Deep Learning},
booktitle = {2nd International Conference on Signal Processing and Machine Learning,
{SPML} 2019, Hangzhou, China, November, 27-29, 2019},
pages = {85--91},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3372806.3372815},
doi = {10.1145/3372806.3372815},
timestamp = {Thu, 23 Jan 2020 16:32:27 +0100},
biburl = {https://dblp.org/rec/conf/spml/ChangHFC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/taai/LeeTWSHHSY19,
author = {Chang{-}Shing Lee and
Yi{-}Lin Tsai and
Mei{-}Hui Wang and
Haruka Sekino and
Tzong{-}Xiang Huang and
Wei{-}Fen Hsieh and
Eri Sato{-}Shimokawara and
Toru Yamaguchi},
title = {FML-based Machine Learning Tool for Human Emotional Agent with {BCI}
on Music Application},
booktitle = {2019 International Conference on Technologies and Applications of
Artificial Intelligence, {TAAI} 2019, Kaohsiung, Taiwan, November
21-23, 2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/TAAI48200.2019.8959849},
doi = {10.1109/TAAI48200.2019.8959849},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/taai/LeeTWSHHSY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uist/LiuHHZDBTKM19,
author = {Michael Xieyang Liu and
Jane Hsieh and
Nathan Hahn and
Angelina Zhou and
Emily Deng and
Shaun Burley and
Cynthia Bagier Taylor and
Aniket Kittur and
Brad A. Myers},
editor = {Fran{\c{c}}ois Guimbreti{\`{e}}re and
Michael S. Bernstein and
Katharina Reinecke},
title = {Unakite: Scaffolding Developers' Decision-Making Using the Web},
booktitle = {Proceedings of the 32nd Annual {ACM} Symposium on User Interface Software
and Technology, {UIST} 2019, New Orleans, LA, USA, October 20-23,
2019},
pages = {67--80},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3332165.3347908},
doi = {10.1145/3332165.3347908},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/uist/LiuHHZDBTKM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/usenix/ZhangLXQ0QDYCCW19,
author = {Xu Zhang and
Qingwei Lin and
Yong Xu and
Si Qin and
Hongyu Zhang and
Bo Qiao and
Yingnong Dang and
Xinsheng Yang and
Qian Cheng and
Murali Chintalapati and
Youjiang Wu and
Ken Hsieh and
Kaixin Sui and
Xin Meng and
Yaohai Xu and
Wenchi Zhang and
Furao Shen and
Dongmei Zhang},
editor = {Dahlia Malkhi and
Dan Tsafrir},
title = {Cross-dataset Time Series Anomaly Detection for Cloud Systems},
booktitle = {Proceedings of the 2019 {USENIX} Annual Technical Conference, {USENIX}
{ATC} 2019, Renton, WA, USA, July 10-12, 2019},
pages = {1063--1076},
publisher = {{USENIX} Association},
year = {2019},
url = {https://www.usenix.org/conference/atc19/presentation/zhang-xu},
timestamp = {Thu, 01 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/usenix/ZhangLXQ0QDYCCW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/KoKSCH019,
author = {Chen{-}Ting Ko and
Ting{-}Kuei Kuan and
Ruei{-}Pin Shen and
Chih{-}Hsien Chang and
Kenny Hsieh and
Mark Chen},
title = {A 387.6fs Integrated Jitter and -80dBc Reference Spurs Ring based
{PLL} with Track- and-Hold Charge Pump and Automatic Loop Gain Control
in 7nm FinFET {CMOS}},
booktitle = {2019 Symposium on {VLSI} Circuits, Kyoto, Japan, June 9-14, 2019},
pages = {164},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.23919/VLSIC.2019.8777946},
doi = {10.23919/VLSIC.2019.8777946},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/KoKSCH019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/LinHTTHCHHCGFRL19,
author = {Mu{-}Shan Lin and
Tze{-}Chiang Huang and
Chien{-}Chun Tsai and
King{-}Ho Tam and
Kenny Cheng{-}Hsiang Hsieh and
Tom Chen and
Wen{-}Hung Huang and
Jack Hu and
Yu{-}Chi Chen and
Sandeep Kumar Goel and
Chin{-}Ming Fu and
Stefan Rusu and
Chao{-}Chieh Li and
Sheng{-}Yao Yang and
Mei Wong and
Shu{-}Chun Yang and
Frank Lee},
title = {A 7nm 4GHz Arm\({}^{\mbox{{\textregistered}}}\)-core-based CoWoS\({}^{\mbox{{\textregistered}}}\)
Chiplet Design for High Performance Computing},
booktitle = {2019 Symposium on {VLSI} Circuits, Kyoto, Japan, June 9-14, 2019},
pages = {28},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.23919/VLSIC.2019.8778161},
doi = {10.23919/VLSIC.2019.8778161},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/LinHTTHCHHCGFRL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/PfaffMGCWPARAHL19,
author = {Dirk Pfaff and
Shahaboddin Moazzeni and
Leisheng Gao and
Mei{-}Chen Chuang and
Xin{-}Jie Wang and
Chai Palusa and
Robert Abbott and
Rolando Ramirez and
Maher Amer and
Ming{-}Chieh Huang and
Chih{-}Chang Lin and
Fred Kuo and
Wei{-}Li Chen and
Tae Young Goh and
Kenny Hsieh},
title = {A 56Gb/s Long Reach Fully Adaptive Wireline {PAM-4} Transceiver in
7nm FinFET},
booktitle = {2019 Symposium on {VLSI} Circuits, Kyoto, Japan, June 9-14, 2019},
pages = {270},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.23919/VLSIC.2019.8778051},
doi = {10.23919/VLSIC.2019.8778051},
timestamp = {Mon, 05 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/PfaffMGCWPARAHL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1903-04463,
author = {Farzin Salek and
Min{-}Hsiu Hsieh and
Javier R. Fonollosa},
title = {Publicness, Privacy and Confidentiality in the Single-Serving Quantum
Broadcast Channel},
journal = {CoRR},
volume = {abs/1903.04463},
year = {2019},
url = {http://arxiv.org/abs/1903.04463},
eprinttype = {arXiv},
eprint = {1903.04463},
timestamp = {Sun, 31 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1903-04463.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1906-01200,
author = {Jun{-}Ting Hsieh and
Shengjia Zhao and
Stephan Eismann and
Lucia Mirabella and
Stefano Ermon},
title = {Learning Neural {PDE} Solvers with Convergence Guarantees},
journal = {CoRR},
volume = {abs/1906.01200},
year = {2019},
url = {http://arxiv.org/abs/1906.01200},
eprinttype = {arXiv},
eprint = {1906.01200},
timestamp = {Thu, 13 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1906-01200.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-04435,
author = {Fabio Miranda and
Harish Doraiswamy and
Marcos Lage and
Luc Wilson and
Mondrian Hsieh and
Cl{\'{a}}udio T. Silva},
title = {Shadow Accrual Maps: Efficient Accumulation of City-Scale Shadows
Over Time},
journal = {CoRR},
volume = {abs/1907.04435},
year = {2019},
url = {http://arxiv.org/abs/1907.04435},
eprinttype = {arXiv},
eprint = {1907.04435},
timestamp = {Thu, 09 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1907-04435.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-10773,
author = {Minhao Cheng and
Simranjit Singh and
Patrick H. Chen and
Pin{-}Yu Chen and
Sijia Liu and
Cho{-}Jui Hsieh},
title = {Sign-OPT: {A} Query-Efficient Hard-label Adversarial Attack},
journal = {CoRR},
volume = {abs/1909.10773},
year = {2019},
url = {http://arxiv.org/abs/1909.10773},
eprinttype = {arXiv},
eprint = {1909.10773},
timestamp = {Thu, 29 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-10773.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1910-01557,
author = {Ritwika Ghosh and
Joao P. Jansch{-}Porto and
Chiao Hsieh and
Amelia Gosse and
Minghao Jiang and
Hebron Taylor and
Peter Du and
Sayan Mitra and
Geir E. Dullerud},
title = {CyPhyHouse: {A} Programming, Simulation, and Deployment Toolchain
for Heterogeneous Distributed Coordination},
journal = {CoRR},
volume = {abs/1910.01557},
year = {2019},
url = {http://arxiv.org/abs/1910.01557},
eprinttype = {arXiv},
eprint = {1910.01557},
timestamp = {Fri, 04 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1910-01557.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1910-14540,
author = {Yi{-}Wei Huang and
Tzu{-}Kuan Chuang and
Ni{-}Ching Lin and
Yu{-}Chieh Hsiao and
Pin{-}Wei Chen and
Ching{-}Tang Hung and
Shih{-}Hsing Liu and
Hsiao{-}Sheng Chen and
Ya{-}Hsiu Hsieh and
Yen{-}Hsiang Huang and
Yu{-}Xuan Chen and
Kuan{-}Lin Chen and
Ya{-}Jou Lan and
Chao{-}Chun Hsu and
Chun{-}Yi Lin and
Jhih{-}Ying Li and
Jui{-}Te Huang and
Yu{-}Jen Menn and
Sin{-}Kiat Lim and
Kim{-}Boon Lua and
Chia{-}Hung Dylan Tsai and
Chi{-}Fang Chen and
Hsueh{-}Cheng Wang},
title = {Team {NCTU:} Toward AI-Driving for Autonomous Surface Vehicles - From
Duckietown to RobotX},
journal = {CoRR},
volume = {abs/1910.14540},
year = {2019},
url = {http://arxiv.org/abs/1910.14540},
eprinttype = {arXiv},
eprint = {1910.14540},
timestamp = {Wed, 06 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1910-14540.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/HsiehSCBS18,
author = {Yi{-}Zeng Hsieh and
Mu{-}Chun Su and
Jieh{-}Haur Chen and
Bevan Annuerine Badjie and
Yu{-}Min Su},
title = {Developing a PSO-Based Projection Algorithm for a Porosity Detection
System Using X-Ray {CT} Images of Permeable Concrete},
journal = {{IEEE} Access},
volume = {6},
pages = {64406--64415},
year = {2018},
url = {https://doi.org/10.1109/ACCESS.2018.2877157},
doi = {10.1109/ACCESS.2018.2877157},
timestamp = {Wed, 26 Dec 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/HsiehSCBS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/arobots/KularatneBH18,
author = {Dhanushka Kularatne and
Subhrajit Bhattacharya and
M. Ani Hsieh},
title = {Going with the flow: a graph based approach to optimal path planning
in general flows},
journal = {Auton. Robots},
volume = {42},
number = {7},
pages = {1369--1387},
year = {2018},
url = {https://doi.org/10.1007/s10514-018-9741-6},
doi = {10.1007/S10514-018-9741-6},
timestamp = {Sat, 11 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/arobots/KularatneBH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ce/ChangHL18,
author = {Shan{-}Mei Chang and
Grace M. Y. Hsieh and
Sunny S. J. Lin},
title = {The mediation effects of gaming motives between game involvement and
problematic Internet use: Escapism, advancement and socializing},
journal = {Comput. Educ.},
volume = {122},
pages = {43--53},
year = {2018},
url = {https://doi.org/10.1016/j.compedu.2018.03.007},
doi = {10.1016/J.COMPEDU.2018.03.007},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ce/ChangHL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/KekadeHIAKLA18,
author = {Shwetambara Kekade and
Chung{-}Ho Hsieh and
Md. Mohaimenul Islam and
Suleman Atique and
Abdulwahed Mohammed Khalfan and
Yu{-}Chuan Li and
Syed Abdul Shabbir},
title = {The usefulness and actual use of wearable devices among the elderly
population},
journal = {Comput. Methods Programs Biomed.},
volume = {153},
pages = {137--159},
year = {2018},
url = {https://doi.org/10.1016/j.cmpb.2017.10.008},
doi = {10.1016/J.CMPB.2017.10.008},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmpb/KekadeHIAKLA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cssp/MajidiHY18,
author = {Mohammad Ali Majidi and
Chien{-}Shu Hsieh and
Hadi Sadoghi Yazdi},
title = {Kalman Filter Reinforced by Least Mean Square for Systems with Unknown
Inputs},
journal = {Circuits Syst. Signal Process.},
volume = {37},
number = {11},
pages = {4955--4972},
year = {2018},
url = {https://doi.org/10.1007/s00034-018-0792-x},
doi = {10.1007/S00034-018-0792-X},
timestamp = {Sat, 25 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cssp/MajidiHY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/integration/HsiehLHS18,
author = {Jui{-}Hung Hsieh and
Rong{-}Choi Lee and
King{-}Chu Hung and
Meng{-}Ju Shih},
title = {Rapid and coding-efficient {SPIHT} algorithm for wavelet-based {ECG}
data compression},
journal = {Integr.},
volume = {60},
pages = {248--256},
year = {2018},
url = {https://doi.org/10.1016/j.vlsi.2017.10.006},
doi = {10.1016/J.VLSI.2017.10.006},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/integration/HsiehLHS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iotj/ChenHHHLM18,
author = {Ling{-}Jyh Chen and
Yao{-}Hua Ho and
Hsin{-}Hung Hsieh and
Shih{-}Ting Huang and
Hu{-}Cheng Lee and
Sachit Mahajan},
title = {{ADF:} An Anomaly Detection Framework for Large-Scale {PM2.5} Sensing
Systems},
journal = {{IEEE} Internet Things J.},
volume = {5},
number = {2},
pages = {559--570},
year = {2018},
url = {https://doi.org/10.1109/JIOT.2017.2766085},
doi = {10.1109/JIOT.2017.2766085},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iotj/ChenHHHLM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jihmsp/HsiehHW18,
author = {Chaur{-}Heh Hsieh and
Mao{-}Hsiung Hung and
Shiuh{-}Ku Weng},
title = {Visual Object Tracking Based on Color and Implicit Shape Features},
journal = {J. Inf. Hiding Multim. Signal Process.},
volume = {9},
number = {1},
pages = {198--210},
year = {2018},
url = {http://bit.kuas.edu.tw/\&\#126;jihmsp/2018/vol9/JIH-MSP-2018-01-020.pdf},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jihmsp/HsiehHW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocn/GruberHSEFAR18,
author = {Matthias J. Gruber and
Liang{-}Tien Hsieh and
Bernhard P. Staresina and
Christian Erich Elger and
J{\"{u}}rgen Fell and
Nikolai Axmacher and
Charan Ranganath},
title = {Theta Phase Synchronization between the Human Hippocampus and Prefrontal
Cortex Increases during Encoding of Unexpected Information: {A} Case
Study},
journal = {J. Cogn. Neurosci.},
volume = {30},
number = {11},
year = {2018},
url = {https://doi.org/10.1162/jocn\_a\_01302},
doi = {10.1162/JOCN\_A\_01302},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jocn/GruberHSEFAR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/ChouSYCLLHSTLCT18,
author = {Chih{-}Hung Chou and
Sirjana Shrestha and
Chi{-}Dung Yang and
Nai{-}Wen Chang and
Yu{-}Ling Lin and
Kuang{-}Wen Liao and
Wei{-}Chih Huang and
Ting{-}Hsuan Sun and
Siang{-}Jyun Tu and
Wei{-}Hsiang Lee and
Men{-}Yee Chiew and
Chun{-}San Tai and
Ting{-}Yen Wei and
Tzi{-}Ren Tsai and
Hsin{-}Tzu Huang and
Chung{-}Yu Wang and
Hsin{-}Yi Wu and
Shu{-}Yi Ho and
Pin{-}Rong Chen and
Cheng{-}Hsun Chuang and
Pei{-}Jung Hsieh and
Yi{-}Shin Wu and
Wen{-}Liang Chen and
Meng{-}Ju Li and
Yu{-}chun Wu and
Xin{-}Yi Huang and
Fung Ling Ng and
Waradee Buddhakosai and
Pei{-}Chun Huang and
Kuan{-}Chun Lan and
Chia{-}Yen Huang and
Shun{-}Long Weng and
Yeong{-}Nan Cheng and
Chao Liang and
Wen{-}Lian Hsu and
Hsien{-}Da Huang},
title = {miRTarBase update 2018: a resource for experimentally validated microRNA-target
interactions},
journal = {Nucleic Acids Res.},
volume = {46},
number = {Database-Issue},
pages = {D296--D302},
year = {2018},
url = {https://doi.org/10.1093/nar/gkx1067},
doi = {10.1093/NAR/GKX1067},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/ChouSYCLLHSTLCT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/PerngHMC18,
author = {Jau{-}Woei Perng and
Shan{-}Chang Hsieh and
Li{-}Shan Ma and
Guan{-}Yan Chen},
title = {Design of robust {PI} control systems based on sensitivity analysis
and genetic algorithms},
journal = {Neural Comput. Appl.},
volume = {29},
number = {4},
pages = {913--923},
year = {2018},
url = {https://doi.org/10.1007/s00521-016-2506-2},
doi = {10.1007/S00521-016-2506-2},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nca/PerngHMC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/HsiehS18,
author = {Han{-}Lin Hsieh and
Maryam M. Shanechi},
title = {Optimizing the learning rate for adaptive estimation of neural encoding
models},
journal = {PLoS Comput. Biol.},
volume = {14},
number = {5},
year = {2018},
url = {https://doi.org/10.1371/journal.pcbi.1006168},
doi = {10.1371/JOURNAL.PCBI.1006168},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/HsiehS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ral/KularatneBH18,
author = {Dhanushka Kularatne and
Subhrajit Bhattacharya and
M. Ani Hsieh},
title = {Optimal Path Planning in Time-Varying Flows Using Adaptive Discretization},
journal = {{IEEE} Robotics Autom. Lett.},
volume = {3},
number = {1},
pages = {458--465},
year = {2018},
url = {https://doi.org/10.1109/LRA.2017.2761939},
doi = {10.1109/LRA.2017.2761939},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ral/KularatneBH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/HsiehSH18,
author = {Jui{-}Hung Hsieh and
Meng{-}Ju Shih and
Xin{-}Hao Huang},
title = {Algorithm and {VLSI} Architecture Design of Low-Power {SPIHT} Decoder
for mHealth Applications},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {12},
number = {6},
pages = {1450--1457},
year = {2018},
url = {https://doi.org/10.1109/TBCAS.2018.2871184},
doi = {10.1109/TBCAS.2018.2871184},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbcas/HsiehSH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/ChouCJCWYCCHCT18,
author = {Ting{-}I Chou and
Kwuang{-}Han Chang and
Jia{-}Yin Jhang and
Shih{-}Wen Chiu and
Guoxing Wang and
Chia{-}Hsiang Yang and
Herming Chiueh and
Hsin Chen and
Chih{-}Cheng Hsieh and
Meng{-}Fan Chang and
Kea{-}Tiong Tang},
title = {A 1-V 2.6-mW Environmental Compensated Fully Integrated Nose-on-a-Chip},
journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
volume = {65-II},
number = {10},
pages = {1365--1369},
year = {2018},
url = {https://doi.org/10.1109/TCSII.2018.2854588},
doi = {10.1109/TCSII.2018.2854588},
timestamp = {Wed, 27 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcas/ChouCJCWYCCHCT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/LinLHSC18,
author = {Shih{-}Chun Lin and
Chien{-}Chi Liu and
Min{-}Yen Hsieh and
Shih{-}Tang Su and
Wei{-}Ho Chung},
title = {Coded Quickest Classification With Applications in Bandwidth-Efficient
Smart Grid Monitoring},
journal = {{IEEE} Trans. Inf. Forensics Secur.},
volume = {13},
number = {12},
pages = {3122--3136},
year = {2018},
url = {https://doi.org/10.1109/TIFS.2018.2837658},
doi = {10.1109/TIFS.2018.2837658},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tifs/LinLHSC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/HsiehHLS18,
author = {Jui{-}Hung Hsieh and
King{-}Chu Hung and
Yu{-}Ling Lin and
Meng{-}Ju Shih},
title = {A Speed- and Power-Efficient {SPIHT} Design for Wearable Quality-On-Demand
{ECG} Applications},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {22},
number = {5},
pages = {1456--1465},
year = {2018},
url = {https://doi.org/10.1109/JBHI.2017.2773097},
doi = {10.1109/JBHI.2017.2773097},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/titb/HsiehHLS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ACMdis/HsiehOACCSGJ18,
author = {Yi{-}Ta Hsieh and
Valeria Orso and
Salvatore Andolina and
Manuela Canaveras and
Diogo Cabral and
Anna Spagnolli and
Luciano Gamberini and
Giulio Jacucci},
editor = {Ilpo Koskinen and
Youn{-}Kyung Lim and
Teresa Cerratto Pargman and
Kenny K. N. Chow and
William Odom},
title = {Interweaving Visual and Audio-Haptic Augmented Reality for Urban Exploration},
booktitle = {Proceedings of the 2018 on Designing Interactive Systems Conference
2018, {DIS} 2018, Hong Kong, China, June 09-13, 2018},
pages = {215--226},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3196709.3196733},
doi = {10.1145/3196709.3196733},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ACMdis/HsiehOACCSGJ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/BallingerHSSWTM18,
author = {Brandon Ballinger and
Johnson Hsieh and
Avesh Singh and
Nimit Sohoni and
Jack Wang and
Geoffrey H. Tison and
Gregory M. Marcus and
Jose M. Sanchez and
Carol Maguire and
Jeffrey E. Olgin and
Mark J. Pletcher},
editor = {Sheila A. McIlraith and
Kilian Q. Weinberger},
title = {DeepHeart: Semi-Supervised Sequence Learning for Cardiovascular Risk
Prediction},
booktitle = {Proceedings of the Thirty-Second {AAAI} Conference on Artificial Intelligence,
(AAAI-18), the 30th innovative Applications of Artificial Intelligence
(IAAI-18), and the 8th {AAAI} Symposium on Educational Advances in
Artificial Intelligence (EAAI-18), New Orleans, Louisiana, USA, February
2-7, 2018},
pages = {2079--2086},
publisher = {{AAAI} Press},
year = {2018},
url = {https://doi.org/10.1609/aaai.v32i1.11891},
doi = {10.1609/AAAI.V32I1.11891},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/BallingerHSSWTM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bcb/HsiehOC18,
author = {Min{-}Wei Hsieh and
Hayato Ohwada and
Sheng{-}I Chen},
editor = {Amarda Shehu and
Cathy H. Wu and
Christina Boucher and
Jing Li and
Hongfang Liu and
Mihai Pop},
title = {Practical Feature Selection for Lung Cancer Gene Detection},
booktitle = {Proceedings of the 2018 {ACM} International Conference on Bioinformatics,
Computational Biology, and Health Informatics, {BCB} 2018, Washington,
DC, USA, August 29 - September 01, 2018},
pages = {522},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3233547.3233631},
doi = {10.1145/3233547.3233631},
timestamp = {Mon, 10 Jun 2024 20:41:10 +0200},
biburl = {https://dblp.org/rec/conf/bcb/HsiehOC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/AgapieCPOWHM18,
author = {Elena Agapie and
Bonnie Chinh and
Laura R. Pina and
Diana Oviedo and
Molly C. Welsh and
Gary Hsieh and
Sean Munson},
editor = {Regan L. Mandryk and
Mark Hancock and
Mark Perry and
Anna L. Cox},
title = {Crowdsourcing Exercise Plans Aligned with Expert Guidelines and Everyday
Constraints},
booktitle = {Proceedings of the 2018 {CHI} Conference on Human Factors in Computing
Systems, {CHI} 2018, Montreal, QC, Canada, April 21-26, 2018},
pages = {324},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3173574.3173898},
doi = {10.1145/3173574.3173898},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/AgapieCPOWHM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icaisc/SinagaHBY18,
author = {Kristina P. Sinaga and
June{-}Nan Hsieh and
Josephine Bernadette M. Benjamin and
Miin{-}Shen Yang},
editor = {Leszek Rutkowski and
Rafal Scherer and
Marcin Korytkowski and
Witold Pedrycz and
Ryszard Tadeusiewicz and
Jacek M. Zurada},
title = {Modified Relational Mountain Clustering Method},
booktitle = {Artificial Intelligence and Soft Computing - 17th International Conference,
{ICAISC} 2018, Zakopane, Poland, June 3-7, 2018, Proceedings, Part
{I}},
series = {Lecture Notes in Computer Science},
volume = {10841},
pages = {690--701},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-319-91253-0\_64},
doi = {10.1007/978-3-319-91253-0\_64},
timestamp = {Thu, 23 Jun 2022 19:57:15 +0200},
biburl = {https://dblp.org/rec/conf/icaisc/SinagaHBY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdm/HsiehCSC18,
author = {Yu{-}Heng Hsieh and
Chun{-}Chieh Chen and
Hong{-}Han Shuai and
Ming{-}Syan Chen},
title = {Highly Parallel Sequential Pattern Mining on a Heterogeneous Platform},
booktitle = {{IEEE} International Conference on Data Mining, {ICDM} 2018, Singapore,
November 17-20, 2018},
pages = {1037--1042},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/ICDM.2018.00131},
doi = {10.1109/ICDM.2018.00131},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/icdm/HsiehCSC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmcs/ChenLHW18,
author = {Sih{-}Huei Chen and
Yuan{-}Shan Lee and
Min{-}Che Hsieh and
Jia{-}Ching Wang},
title = {Playing Technique Classification Based on Deep Collaborative Learning
of Variational Auto-Encoder and Gaussian Process},
booktitle = {2018 {IEEE} International Conference on Multimedia and Expo, {ICME}
2018, San Diego, CA, USA, July 23-27, 2018},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/ICME.2018.8486467},
doi = {10.1109/ICME.2018.8486467},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmcs/ChenLHW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/KangarshahiHSC18,
author = {Ehsan Asadi Kangarshahi and
Ya{-}Ping Hsieh and
Mehmet Fatih Sahin and
Volkan Cevher},
editor = {Jennifer G. Dy and
Andreas Krause},
title = {Let's be Honest: An Optimal No-Regret Framework for Zero-Sum Games},
booktitle = {Proceedings of the 35th International Conference on Machine Learning,
{ICML} 2018, Stockholmsm{\"{a}}ssan, Stockholm, Sweden, July
10-15, 2018},
series = {Proceedings of Machine Learning Research},
volume = {80},
pages = {2493--2501},
publisher = {{PMLR}},
year = {2018},
url = {http://proceedings.mlr.press/v80/kangarshahi18a.html},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/KangarshahiHSC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmlc/TsaiSHC18,
author = {Chun{-}Ming Tsai and
Tawei David Shou and
Jun{-}Wei Hsieh and
Mu{-}Tsai Chang},
title = {Binarization of Call Number Images For Helping Elderly Retired Volunteer
to Manage Books in Library},
booktitle = {2018 International Conference on Machine Learning and Cybernetics,
{ICMLC} 2018, Chengdu, China, July 15-18, 2018},
pages = {456--461},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ICMLC.2018.8527062},
doi = {10.1109/ICMLC.2018.8527062},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/icmlc/TsaiSHC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictc/ChangCCHHHHLLSS18,
author = {Andy R. K. Chang and
Yu{-}Ling Chen and
Po{-}Yu Chou and
Yen{-}Zhou Huang and
Hung{-}Chang Hsiao and
Tsung{-}Ting Hsieh and
Michael Hsu and
Chia{-}Chee Lee and
Hsin{-}Yin Lee and
Yun{-}Chi Shih and
Wei{-}An Shih and
Chien{-}Hsiang Tang and
Chia{-}Ping Tsai and
Kuan{-}Po Tseng},
title = {The Case of Big Data Platform Services for Semiconductor Wafer Fabrication
Foundries},
booktitle = {International Conference on Information and Communication Technology
Convergence, {ICTC} 2018, Jeju Island, Korea (South), October 17-19,
2018},
pages = {41--45},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ICTC.2018.8539541},
doi = {10.1109/ICTC.2018.8539541},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/ictc/ChangCCHHHHLLSS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/YaoZYHKAMSFB18,
author = {Jianhua Yao and
Robert Zhu and
Pomi Yun and
Nathan Hsieh and
William Kovacs and
Andrew E. Arai and
Ami Mankodi and
Ronald M. Summers and
A. Reghan Foley and
Carsten G. B{\"{o}}nnemann},
title = {Tracking diaphragm and chest wall movement on cine-MRI},
booktitle = {15th {IEEE} International Symposium on Biomedical Imaging, {ISBI}
2018, Washington, DC, USA, April 4-7, 2018},
pages = {1301--1304},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ISBI.2018.8363810},
doi = {10.1109/ISBI.2018.8363810},
timestamp = {Wed, 04 Oct 2023 17:01:25 +0200},
biburl = {https://dblp.org/rec/conf/isbi/YaoZYHKAMSFB18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isit/SalekAH0F18,
author = {Farzin Salek and
Anurag Anshu and
Min{-}Hsiu Hsieh and
Rahul Jain and
Javier R. Fonollosa},
title = {One-shot Capacity Bounds on the Simultaneous Transmission of Public
and Private Information Over Quantum Channels},
booktitle = {2018 {IEEE} International Symposium on Information Theory, {ISIT}
2018, Vail, CO, USA, June 17-22, 2018},
pages = {296--300},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ISIT.2018.8437856},
doi = {10.1109/ISIT.2018.8437856},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isit/SalekAH0F18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isit/ZhuZHS18,
author = {Elton Yechao Zhu and
Quntao Zhuang and
Min{-}Hsiu Hsieh and
Peter W. Shor},
title = {Superadditivity in Trade-Off Capacities of Quantum Channels},
booktitle = {2018 {IEEE} International Symposium on Information Theory, {ISIT}
2018, Vail, CO, USA, June 17-22, 2018},
pages = {251--255},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ISIT.2018.8437934},
doi = {10.1109/ISIT.2018.8437934},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isit/ZhuZHS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/TamMHIRSQCWHVW18,
author = {Simon M. Tam and
Harry Muljono and
Min Huang and
Sitaraman Iyer and
Kalapi Royneogi and
Nagmohan Satti and
Rizwan Qureshi and
Wei Chen and
Tom Wang and
Hubert Hsieh and
Sujal Vora and
Eddie Wang},
title = {SkyLake-SP: {A} 14nm 28-Core xeon{\textregistered} processor},
booktitle = {2018 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2018, San Francisco, CA, USA, February 11-15, 2018},
pages = {34--36},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ISSCC.2018.8310170},
doi = {10.1109/ISSCC.2018.8310170},
timestamp = {Thu, 09 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/TamMHIRSQCWHVW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micad/JahaniCHWPDK18,
author = {Nariman Jahani and
Eric A. Cohen and
Meng{-}Kang Hsieh and
Susan P. Weinstein and
Lauren Pantalone and
Christos Davatzikos and
Despina Kontos},
editor = {Nicholas A. Petrick and
Kensaku Mori},
title = {Deformable image registration as a tool to improve survival prediction
after neoadjuvant chemotherapy for breast cancer: results from the
{ACRIN} 6657/I-SPY-1 trial},
booktitle = {Medical Imaging 2018: Computer-Aided Diagnosis, Houston, Texas, USA,
10-15 February 2018},
series = {{SPIE} Proceedings},
volume = {10575},
pages = {105752S},
publisher = {{SPIE}},
year = {2018},
url = {https://doi.org/10.1117/12.2293720},
doi = {10.1117/12.2293720},
timestamp = {Thu, 19 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/micad/JahaniCHWPDK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micad/WuPHDLZSMP18,
author = {Jimmy Wu and
Diondra Peck and
Scott Hsieh and
Vandana Dialani and
Constance D. Lehman and
Bolei Zhou and
Vasilis Syrgkanis and
Lester W. Mackey and
Genevieve Patterson},
editor = {Nicholas A. Petrick and
Kensaku Mori},
title = {Expert identification of visual primitives used by CNNs during mammogram
classification},
booktitle = {Medical Imaging 2018: Computer-Aided Diagnosis, Houston, Texas, USA,
10-15 February 2018},
series = {{SPIE} Proceedings},
volume = {10575},
pages = {105752T},
publisher = {{SPIE}},
year = {2018},
url = {https://doi.org/10.1117/12.2293890},
doi = {10.1117/12.2293890},
timestamp = {Sat, 21 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/micad/WuPHDLZSMP18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/noms/HsiehHTWZUVH18,
author = {Yu{-}Chen Hsieh and
Hua{-}Jun Hong and
Pei{-}Hsuan Tsai and
Yu{-}Rong Wang and
Qiuxi Zhu and
Md. Yusuf Sarwar Uddin and
Nalini Venkatasubramanian and
Cheng{-}Hsin Hsu},
title = {Managed edge computing on Internet-of-Things devices for smart city
applications},
booktitle = {2018 {IEEE/IFIP} Network Operations and Management Symposium, {NOMS}
2018, Taipei, Taiwan, April 23-27, 2018},
pages = {1--2},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/NOMS.2018.8406133},
doi = {10.1109/NOMS.2018.8406133},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/noms/HsiehHTWZUVH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/osdi/HsiehABVBPGM18,
author = {Kevin Hsieh and
Ganesh Ananthanarayanan and
Peter Bod{\'{\i}}k and
Shivaram Venkataraman and
Paramvir Bahl and
Matthai Philipose and
Phillip B. Gibbons and
Onur Mutlu},
editor = {Andrea C. Arpaci{-}Dusseau and
Geoff Voelker},
title = {Focus: Querying Large Video Datasets with Low Latency and Low Cost},
booktitle = {13th {USENIX} Symposium on Operating Systems Design and Implementation,
{OSDI} 2018, Carlsbad, CA, USA, October 8-10, 2018},
pages = {269--286},
publisher = {{USENIX} Association},
year = {2018},
url = {https://www.usenix.org/conference/osdi18/presentation/hsieh},
timestamp = {Tue, 02 Feb 2021 08:06:02 +0100},
biburl = {https://dblp.org/rec/conf/osdi/HsiehABVBPGM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/qrs/ChangMHW18,
author = {Shu{-}Hao Chang and
Sanoop Mallissery and
Chih{-}Hao Hsieh and
Yu{-}Sung Wu},
title = {Hypervisor-Based Sensitive Data Leakage Detector},
booktitle = {2018 {IEEE} International Conference on Software Quality, Reliability
and Security, {QRS} 2018, Lisbon, Portugal, July 16-20, 2018},
pages = {155--162},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/QRS.2018.00029},
doi = {10.1109/QRS.2018.00029},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/qrs/ChangMHW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigsoft/LinHDZSXLLWYCZ18,
author = {Qingwei Lin and
Ken Hsieh and
Yingnong Dang and
Hongyu Zhang and
Kaixin Sui and
Yong Xu and
Jian{-}Guang Lou and
Chenggang Li and
Youjiang Wu and
Randolph Yao and
Murali Chintalapati and
Dongmei Zhang},
editor = {Gary T. Leavens and
Alessandro Garcia and
Corina S. Pasareanu},
title = {Predicting Node failure in cloud service systems},
booktitle = {Proceedings of the 2018 {ACM} Joint Meeting on European Software Engineering
Conference and Symposium on the Foundations of Software Engineering,
{ESEC/SIGSOFT} {FSE} 2018, Lake Buena Vista, FL, USA, November 04-09,
2018},
pages = {480--490},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3236024.3236060},
doi = {10.1145/3236024.3236060},
timestamp = {Thu, 01 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigsoft/LinHDZSXLLWYCZ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/taai/MatsufujiHHSYC18,
author = {Akihiro Matsufuji and
Wei{-}Fen Hsieh and
Hao{-}Ming Hung and
Eri Shimokawara and
Toru Yamaguchi and
Lieu{-}Hen Chen},
title = {A Method of Action Recognition in Ego-Centric Videos by Using Object-Hand
Relations},
booktitle = {Conference on Technologies and Applications of Artificial Intelligence,
{TAAI} 2018, Taichung, Taiwan, November 30 - December 2, 2018},
pages = {54--59},
publisher = {{IEEE} Computer Society},
year = {2018},
url = {https://doi.org/10.1109/TAAI.2018.00021},
doi = {10.1109/TAAI.2018.00021},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/taai/MatsufujiHHSYC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/KuanWSCHC18,
author = {Ting{-}Kuei Kuan and
Chin{-}Yang Wu and
Ruei{-}Pin Shen and
Chih{-}Hsien Chang and
Kenny Hsieh and
Mark Chen},
title = {A Digital Bang-Bang Phase-Locked Loop with Background Injection Timing
Calibration and Automatic Loop Gain Control in 7NM FinFET {CMOS}},
booktitle = {2018 {IEEE} Symposium on {VLSI} Circuits, Honolulu, HI, USA, June
18-22, 2018},
pages = {179--180},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/VLSIC.2018.8502365},
doi = {10.1109/VLSIC.2018.8502365},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/KuanWSCHC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vric/HsiehHMASS18,
author = {Rex Hsieh and
Marika Higashida and
Yuya Mochizuki and
Takaya Asano and
Akihiko Shirai and
Hisashi Sato},
editor = {Simon Richir},
title = {MasQueRade: Onsite {QR} Code based {VR} Experience Evaluation System
using Sanitary Mask},
booktitle = {Proceedings of the Virtual Reality International Conference - Laval
Virtual, {VRIC} 2018, Laval, France, April 04-06, 2018},
pages = {25:1--25:3},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3234253.3234315},
doi = {10.1145/3234253.3234315},
timestamp = {Thu, 29 Nov 2018 08:40:08 +0100},
biburl = {https://dblp.org/rec/conf/vric/HsiehHMASS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wicon/HsuHPAL18,
author = {Chia{-}Ming Hsu and
He{-}Yen Hsieh and
Setya Widyawan Prakosa and
Muhammad Zulfan Azhari and
Jenq{-}Shiou Leu},
editor = {Jiann{-}Liang Chen and
Ai{-}Chun Pang and
Der{-}Jiunn Deng and
Chun{-}Cheng Lin},
title = {Using Long-Short-Term Memory Based Convolutional Neural Networks for
Network Intrusion Detection},
booktitle = {Wireless Internet - 11th {EAI} International Conference, WiCON 2018,
Taipei, Taiwan, October 15-16, 2018, Proceedings},
series = {Lecture Notes of the Institute for Computer Sciences, Social Informatics
and Telecommunications Engineering},
volume = {264},
pages = {86--94},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-030-06158-6\_9},
doi = {10.1007/978-3-030-06158-6\_9},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wicon/HsuHPAL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/ChenHSCHY18,
author = {Mu{-}Yen Chen and
Tien{-}Chi Huang and
Vera Yu Shu and
Chia{-}Chen Chen and
Tsung{-}Che Hsieh and
Neil Y. Yen},
editor = {Pierre{-}Antoine Champin and
Fabien Gandon and
Mounia Lalmas and
Panagiotis G. Ipeirotis},
title = {Learning the Chinese Sentence Representation with {LSTM} Autoencoder},
booktitle = {Companion of the The Web Conference 2018 on The Web Conference 2018,
{WWW} 2018, Lyon , France, April 23-27, 2018},
pages = {403--408},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3184558.3186355},
doi = {10.1145/3184558.3186355},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/www/ChenHSCHY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1802-00320,
author = {Saugata Ghose and
Kevin Hsieh and
Amirali Boroumand and
Rachata Ausavarungnirun and
Onur Mutlu},
title = {Enabling the Adoption of Processing-in-Memory: Challenges, Mechanisms,
Future Research Directions},
journal = {CoRR},
volume = {abs/1802.00320},
year = {2018},
url = {http://arxiv.org/abs/1802.00320},
eprinttype = {arXiv},
eprint = {1802.00320},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1802-00320.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1802-02511,
author = {Brandon Ballinger and
Johnson Hsieh and
Avesh Singh and
Nimit Sohoni and
Jack Wang and
Geoffrey H. Tison and
Gregory M. Marcus and
Jose M. Sanchez and
Carol Maguire and
Jeffrey E. Olgin and
Mark J. Pletcher},
title = {DeepHeart: Semi-Supervised Sequence Learning for Cardiovascular Risk
Prediction},
journal = {CoRR},
volume = {abs/1802.02511},
year = {2018},
url = {http://arxiv.org/abs/1802.02511},
eprinttype = {arXiv},
eprint = {1802.02511},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1802-02511.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1802-02573,
author = {Nandita Vijaykumar and
Kevin Hsieh and
Gennady Pekhimenko and
Samira Manabi Khan and
Ashish Shrestha and
Saugata Ghose and
Phillip B. Gibbons and
Onur Mutlu},
title = {Zorua: Enhancing Programming Ease, Portability, and Performance in
GPUs by Decoupling Programming Models from Resource Management},
journal = {CoRR},
volume = {abs/1802.02573},
year = {2018},
url = {http://arxiv.org/abs/1802.02573},
eprinttype = {arXiv},
eprint = {1802.02573},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1802-02573.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1802-04221,
author = {Ehsan Asadi Kangarshahi and
Ya{-}Ping Hsieh and
Mehmet Fatih Sahin and
Volkan Cevher},
title = {Let's be honest: An optimal no-regret framework for zero-sum games},
journal = {CoRR},
volume = {abs/1802.04221},
year = {2018},
url = {http://arxiv.org/abs/1802.04221},
eprinttype = {arXiv},
eprint = {1802.04221},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1802-04221.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1803-04858,
author = {Jimmy Wu and
Diondra Peck and
Scott Hsieh and
Vandana Dialani and
Constance D. Lehman and
Bolei Zhou and
Vasilis Syrgkanis and
Lester W. Mackey and
Genevieve Patterson},
title = {Expert identification of visual primitives used by CNNs during mammogram
classification},
journal = {CoRR},
volume = {abs/1803.04858},
year = {2018},
url = {http://arxiv.org/abs/1803.04858},
eprinttype = {arXiv},
eprint = {1803.04858},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1803-04858.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-02498,
author = {Nandita Vijaykumar and
Kevin Hsieh and
Gennady Pekhimenko and
Samira Manabi Khan and
Ashish Shrestha and
Saugata Ghose and
Adwait Jog and
Phillip B. Gibbons and
Onur Mutlu},
title = {Decoupling {GPU} Programming Models from Resource Management for Enhanced
Programming Ease, Portability, and Performance},
journal = {CoRR},
volume = {abs/1805.02498},
year = {2018},
url = {http://arxiv.org/abs/1805.02498},
eprinttype = {arXiv},
eprint = {1805.02498},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-02498.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-03154,
author = {Kevin K. Chang and
Abhijith Kashyap and
Hasan Hassan and
Saugata Ghose and
Kevin Hsieh and
Donghyuk Lee and
Tianshi Li and
Gennady Pekhimenko and
Samira Manabi Khan and
Onur Mutlu},
title = {Flexible-Latency {DRAM:} Understanding and Exploiting Latency Variation
in Modern {DRAM} Chips},
journal = {CoRR},
volume = {abs/1805.03154},
year = {2018},
url = {http://arxiv.org/abs/1805.03154},
eprinttype = {arXiv},
eprint = {1805.03154},
timestamp = {Thu, 02 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-03154.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-11867,
author = {Chao{-}Chun Hsu and
Szu{-}Min Chen and
Ming{-}Hsun Hsieh and
Lun{-}Wei Ku},
title = {Using Inter-Sentence Diverse Beam Search to Reduce Redundancy in Visual
Storytelling},
journal = {CoRR},
volume = {abs/1805.11867},
year = {2018},
url = {http://arxiv.org/abs/1805.11867},
eprinttype = {arXiv},
eprint = {1805.11867},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-11867.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-12323,
author = {Jimmy Wu and
Bolei Zhou and
Diondra Peck and
Scott Hsieh and
Vandana Dialani and
Lester W. Mackey and
Genevieve Patterson},
title = {DeepMiner: Discovering Interpretable Representations for Mammogram
Classification and Explanation},
journal = {CoRR},
volume = {abs/1805.12323},
year = {2018},
url = {http://arxiv.org/abs/1805.12323},
eprinttype = {arXiv},
eprint = {1805.12323},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-12323.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1807-04465,
author = {Miguel Campo and
Cheng{-}Kang Hsieh and
Matt Nickens and
J. J. Espinoza and
Abhinav Taliyan and
Julie Rieger and
Jean Ho and
Bettina Sherick},
title = {Competitive Analysis System for Theatrical Movie Releases Based on
Movie Trailer Deep Video Representation},
journal = {CoRR},
volume = {abs/1807.04465},
year = {2018},
url = {http://arxiv.org/abs/1807.04465},
eprinttype = {arXiv},
eprint = {1807.04465},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1807-04465.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-07104,
author = {Farzin Salek and
Anurag Anshu and
Min{-}Hsiu Hsieh and
Rahul Jain and
Javier R. Fonollosa},
title = {One-shot Capacity bounds on the Simultaneous Transmission of Classical
and Quantum Information},
journal = {CoRR},
volume = {abs/1809.07104},
year = {2018},
url = {http://arxiv.org/abs/1809.07104},
eprinttype = {arXiv},
eprint = {1809.07104},
timestamp = {Fri, 05 Oct 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1809-07104.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1810-00846,
author = {Yu{-}Guan Hsieh and
Gang Niu and
Masashi Sugiyama},
title = {Classification from Positive, Unlabeled and Biased Negative Data},
journal = {CoRR},
volume = {abs/1810.00846},
year = {2018},
url = {http://arxiv.org/abs/1810.00846},
eprinttype = {arXiv},
eprint = {1810.00846},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1810-00846.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1812-00169,
author = {David Xue and
Anin Sayana and
Evan Darke and
Kelly Shen and
Jun{-}Ting Hsieh and
Zelun Luo and
Li{-}Jia Li and
N. Lance Downing and
Arnold Milstein and
Li Fei{-}Fei},
title = {Vision-Based Gait Analysis for Senior Care},
journal = {CoRR},
volume = {abs/1812.00169},
year = {2018},
url = {http://arxiv.org/abs/1812.00169},
eprinttype = {arXiv},
eprint = {1812.00169},
timestamp = {Mon, 22 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1812-00169.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SuHWW17,
author = {Mu{-}Chun Su and
Yi{-}Zeng Hsieh and
Chen{-}Hsu Wang and
Pa{-}Chun Wang},
title = {A Jacobian Matrix-Based Learning Machine and Its Applications in Medical
Diagnosis},
journal = {{IEEE} Access},
volume = {5},
pages = {20036--20045},
year = {2017},
url = {https://doi.org/10.1109/ACCESS.2017.2677458},
doi = {10.1109/ACCESS.2017.2677458},
timestamp = {Wed, 04 Jul 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/SuHWW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cal/BoroumandGPHLHM17,
author = {Amirali Boroumand and
Saugata Ghose and
Minesh Patel and
Hasan Hassan and
Brandon Lucia and
Kevin Hsieh and
Krishna T. Malladi and
Hongzhong Zheng and
Onur Mutlu},
title = {LazyPIM: An Efficient Cache Coherence Mechanism for Processing-in-Memory},
journal = {{IEEE} Comput. Archit. Lett.},
volume = {16},
number = {1},
pages = {46--50},
year = {2017},
url = {https://doi.org/10.1109/LCA.2016.2577557},
doi = {10.1109/LCA.2016.2577557},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cal/BoroumandGPHLHM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/AtiqueHHINILHCS17,
author = {Suleman Atique and
Chung{-}Ho Hsieh and
Ruei{-}Ting Hsiao and
Usman Iqbal and
Phung{-}Anh (Alex) Nguyen and
Md. Mohaimenul Islam and
Yu{-}Chuan (Jack) Li and
Chien{-}Yeh Hsu and
Ting{-}Wu Chuang and
Syed Abdul Shabbir},
title = {Viral warts (Human Papilloma Virus) as a potential risk for breast
cancer among younger females},
journal = {Comput. Methods Programs Biomed.},
volume = {144},
pages = {203--207},
year = {2017},
url = {https://doi.org/10.1016/j.cmpb.2017.03.024},
doi = {10.1016/J.CMPB.2017.03.024},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmpb/AtiqueHHINILHCS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-spr/ChinHSLCW17,
author = {Yu{-}Hao Chin and
Yi{-}Zeng Hsieh and
Mu{-}Chun Su and
Shu{-}Fang Lee and
Miao{-}Wen Chen and
Jia{-}Ching Wang},
title = {Music emotion recognition using PSO-based fuzzy hyper-rectangular
composite neural networks},
journal = {{IET} Signal Process.},
volume = {11},
number = {7},
pages = {884--891},
year = {2017},
url = {https://doi.org/10.1049/iet-spr.2016.0021},
doi = {10.1049/IET-SPR.2016.0021},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iet-spr/ChinHSLCW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijais/AbdolmohammadiD17,
author = {Mohammad Abdolmohammadi and
Steven M. DeSimone and
Tien{-}Shih Hsieh and
Zhihong Wang},
title = {Factors associated with internal audit function involvement with {XBRL}
implementation in public companies: An international study},
journal = {Int. J. Account. Inf. Syst.},
volume = {25},
pages = {45--56},
year = {2017},
url = {https://doi.org/10.1016/j.accinf.2017.03.002},
doi = {10.1016/J.ACCINF.2017.03.002},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijais/AbdolmohammadiD17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijvr/HsiehMAHS17,
author = {Rex Hsieh and
Yuya Mochizuki and
Takaya Asano and
Marika Higashida and
Akihiko Shirai},
title = {"Real Baby - Real Family" Multi-Sensory Feedback Tangible Baby {VR}},
journal = {Int. J. Virtual Real.},
volume = {17},
number = {2},
pages = {72--78},
year = {2017},
url = {https://doi.org/10.20870/IJVR.2017.17.2.2893},
doi = {10.20870/IJVR.2017.17.2.2893},
timestamp = {Fri, 05 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijvr/HsiehMAHS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YanYKMSWSKOZMT17,
author = {Shing Tak Yan and
Lu Ye and
Raghavendra Kulkarni and
Edward Myers and
Hsieh{-}Chih Shih and
Hongbing Wu and
Shadi Saberi and
Darshan Kadia and
Dizle Ozis and
Lei Zhou and
Eric Middleton and
Joo Leong Tham},
title = {An 802.11a/b/g/n/ac {WLAN} Transceiver for 2{\texttimes}2 {MIMO} and
Simultaneous Dual-Band Operation With +29 dBm P\({}_{\mbox{sat}}\)
Integrated Power Amplifiers},
journal = {{IEEE} J. Solid State Circuits},
volume = {52},
number = {7},
pages = {1798--1813},
year = {2017},
url = {https://doi.org/10.1109/JSSC.2017.2704595},
doi = {10.1109/JSSC.2017.2704595},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/YanYKMSWSKOZMT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HungMRNTVDTAGH17,
author = {Shao{-}Min Hung and
Dan Milea and
Annadata Venkata Rukmini and
Raymond P. Najjar and
Joo Huang Tan and
Fran{\c{c}}oise Vi{\'{e}}not and
Marie Dubail and
Sharon Lee Choon Tow and
Tin Aung and
Joshua J. Gooley and
Po{-}Jang Hsieh},
title = {Cerebral neural correlates of differential melanopic photic stimulation
in humans},
journal = {NeuroImage},
volume = {146},
pages = {763--769},
year = {2017},
url = {https://doi.org/10.1016/j.neuroimage.2016.09.061},
doi = {10.1016/J.NEUROIMAGE.2016.09.061},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/HungMRNTVDTAGH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/SadrawiLLHKCHAS17,
author = {Muammar Sadrawi and
Chien{-}Hung Lin and
Yin{-}Tsong Lin and
Yi{-}Ta Hsieh and
Chia{-}Chun Kuo and
Jen{-}Chien Chien and
Koichi Haraikawa and
Maysam F. Abbod and
Jiann{-}Shing Shieh},
title = {Arrhythmia Evaluation in Wearable {ECG} Devices},
journal = {Sensors},
volume = {17},
number = {11},
pages = {2445},
year = {2017},
url = {https://doi.org/10.3390/s17112445},
doi = {10.3390/S17112445},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/SadrawiLLHKCHAS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tase/HsiehS17,
author = {M. Ani Hsieh and
Yu Sun},
title = {Guest Editorial Special Section on the Thirteenth {IEEE} International
Symposium on Safety, Security, and Rescue Robotics},
journal = {{IEEE} Trans Autom. Sci. Eng.},
volume = {14},
number = {1},
pages = {3--4},
year = {2017},
url = {https://doi.org/10.1109/TASE.2016.2630238},
doi = {10.1109/TASE.2016.2630238},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tase/HsiehS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/MirandaDLZGWHS17,
author = {Fabio Miranda and
Harish Doraiswamy and
Marcos Lage and
Kai Zhao and
Bruno Gon{\c{c}}alves and
Luc Wilson and
Mondrian Hsieh and
Cl{\'{a}}udio T. Silva},
title = {Urban Pulse: Capturing the Rhythm of Cities},
journal = {{IEEE} Trans. Vis. Comput. Graph.},
volume = {23},
number = {1},
pages = {791--800},
year = {2017},
url = {https://doi.org/10.1109/TVCG.2016.2598585},
doi = {10.1109/TVCG.2016.2598585},
timestamp = {Thu, 09 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvcg/MirandaDLZGWHS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ACMdis/ColussoBHM17,
author = {Lucas Colusso and
Cynthia L. Bennett and
Gary Hsieh and
Sean A. Munson},
editor = {Oli H. Mival and
Michael Smyth and
Peter Dalsgaard},
title = {Translational Resources: Reducing the Gap Between Academic Research
and {HCI} Practice},
booktitle = {Proceedings of the 2017 Conference on Designing Interactive Systems,
{DIS} '17, Edinburgh, United Kingdom, June 10-14, 2017},
pages = {957--968},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3064663.3064667},
doi = {10.1145/3064663.3064667},
timestamp = {Sat, 19 Mar 2022 22:55:57 +0100},
biburl = {https://dblp.org/rec/conf/ACMdis/ColussoBHM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acssc/AbbaspourazadHS17,
author = {Hamidreza Abbaspourazad and
Han{-}Lin Hsieh and
Maryam M. Shanechi},
editor = {Michael B. Matthews},
title = {Multiscale modeling of dependencies between spikes and fields},
booktitle = {51st Asilomar Conference on Signals, Systems, and Computers, {ACSSC}
2017, Pacific Grove, CA, USA, October 29 - November 1, 2017},
pages = {719--723},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ACSSC.2017.8335438},
doi = {10.1109/ACSSC.2017.8335438},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acssc/AbbaspourazadHS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/LeiSGPMACH17,
author = {Lily Lei and
Vishwas Shetty and
Karan Gupta and
Janine Polifka and
Glen Markham and
Sarah Albee and
Carol Collins and
Gary Hsieh},
title = {Exploring the Design and Role of Mobile Apps for Healthcare Providers
to Find Teratogenic Information},
booktitle = {{AMIA} 2017, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 4-8, 2017},
publisher = {{AMIA}},
year = {2017},
url = {https://knowledge.amia.org/65881-amiab-1.4254737/t003-1.4258387/f003-1.4258388/2732286-1.4258653/2719470-1.4258650},
timestamp = {Wed, 17 Apr 2024 11:47:24 +0200},
biburl = {https://dblp.org/rec/conf/amia/LeiSGPMACH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bcb/FarhoodiSHHHJ17,
author = {Roshanak Farhoodi and
Max Shelbourne and
Rebecca Hsieh and
Nurit Haspel and
Brian Hutchinson and
Filip Jagodzinski},
editor = {Nurit Haspel and
Lenore J. Cowen and
Amarda Shehu and
Tamer Kahveci and
Giuseppe Pozzi},
title = {Predicting the Effect of Point Mutations on Protein Structural Stability},
booktitle = {Proceedings of the 8th {ACM} International Conference on Bioinformatics,
Computational Biology, and Health Informatics, {BCB} 2017, Boston,
MA, USA, August 20-23, 2017},
pages = {247--252},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3107411.3107492},
doi = {10.1145/3107411.3107492},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bcb/FarhoodiSHHHJ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/HongSLHC17,
author = {Hsiang{-}Ting Hong and
Tzu{-}Yu Su and
Po{-}Hsun Lee and
Ping{-}Chun Hsieh and
Mian{-}Jhong Chiu},
editor = {Gloria Mark and
Susan R. Fussell and
Cliff Lampe and
m. c. schraefel and
Juan Pablo Hourcade and
Caroline Appert and
Daniel Wigdor},
title = {VisualLink: Strengthening the Connection between Hearing-impaired
Elderly and their Family},
booktitle = {Proceedings of the 2017 {CHI} Conference on Human Factors in Computing
Systems, Denver, CO, USA, May 06-11, 2017, Extended Abstracts},
pages = {67--73},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3027063.3049269},
doi = {10.1145/3027063.3049269},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/HongSLHC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/WuSCHC17,
author = {Chin{-}Yang Wu and
Ruei{-}Pin Shen and
Chih{-}Hsien Chang and
Kenny Hsieh and
Mark Chen},
title = {A 0.031mm\({}^{\mbox{2}}\), 910fs, 0.5-4GHz injection type {SOC} {PLL}
with 90dB built-in supply noise rejection in 10nm FinFET {CMOS}},
booktitle = {2017 {IEEE} Custom Integrated Circuits Conference, {CICC} 2017, Austin,
TX, USA, April 30 - May 3, 2017},
pages = {1--4},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/CICC.2017.7993676},
doi = {10.1109/CICC.2017.7993676},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cicc/WuSCHC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/HsiehWPS17,
author = {Han{-}Lin Hsieh and
Yan Tat Wong and
Bijan Pesaran and
Maryam Modir Shanechi},
title = {Multiscale decoding for reliable brain-machine interface performance
over time},
booktitle = {2017 39th Annual International Conference of the {IEEE} Engineering
in Medicine and Biology Society (EMBC), Jeju Island, South Korea,
July 11-15, 2017},
pages = {197--200},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/EMBC.2017.8036796},
doi = {10.1109/EMBC.2017.8036796},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/embc/HsiehWPS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/SiZKMDH17,
author = {Si Si and
Huan Zhang and
S. Sathiya Keerthi and
Dhruv Mahajan and
Inderjit S. Dhillon and
Cho{-}Jui Hsieh},
editor = {Doina Precup and
Yee Whye Teh},
title = {Gradient Boosted Decision Trees for High Dimensional Sparse Output},
booktitle = {Proceedings of the 34th International Conference on Machine Learning,
{ICML} 2017, Sydney, NSW, Australia, 6-11 August 2017},
series = {Proceedings of Machine Learning Research},
volume = {70},
pages = {3182--3190},
publisher = {{PMLR}},
year = {2017},
url = {http://proceedings.mlr.press/v70/si17a.html},
timestamp = {Mon, 28 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/SiZKMDH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwl/HsiehSJ17,
author = {Yi{-}Zeng Hsieh and
Mu{-}Chun Su and
Yu{-}Lin Jeng},
editor = {Tien{-}Chi Huang and
Rynson W. H. Lau and
Yueh{-}Min Huang and
Marc Spaniol and
Chun{-}Hung Yuen},
title = {The Jacobian Matrix-Based Learning Machine in Student},
booktitle = {Emerging Technologies for Education - Second International Symposium,
{SETE} 2017, Held in Conjunction with {ICWL} 2017, Cape Town, South
Africa, September 20-22, 2017, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {10676},
pages = {469--474},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-71084-6\_55},
doi = {10.1007/978-3-319-71084-6\_55},
timestamp = {Tue, 14 May 2019 10:00:36 +0200},
biburl = {https://dblp.org/rec/conf/icwl/HsiehSJ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/SyuYCLHCHY17,
author = {Fu{-}Ciao Syu and
Shang{-}Che Yeh and
Yu{-}Chen Chang and
Jing{-}Yuan Lin and
Yao{-}Ching Hsieh and
Huang{-}Jen Chiu and
Masahide Hojo and
Kenji Yamanaka},
title = {Design and implementation of 1 MHz active-clamped resonant flyback
converter},
booktitle = {{IECON} 2017 - 43rd Annual Conference of the {IEEE} Industrial Electronics
Society, Beijing, China, October 29 - November 1, 2017},
pages = {4438--4442},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/IECON.2017.8216764},
doi = {10.1109/IECON.2017.8216764},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iecon/SyuYCLHCHY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieeesensors/GhoshKBHNBFMLK17,
author = {Chayanjit Ghosh and
Shakir{-}Ul Khan and
Samuel John Broadbent and
Hao{-}Chieh Hsieh and
Seungbeom Noh and
Aishwaryadev Banerjee and
Navid Farhoudi and
Carlos H. Mastrangelo and
Ryan Looper and
Hanseup Kim},
title = {Nano-gap vapor sensor},
booktitle = {2017 {IEEE} SENSORS, Glasgow, United Kingdom, October 29 - November
1, 2017},
pages = {1--3},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICSENS.2017.8234278},
doi = {10.1109/ICSENS.2017.8234278},
timestamp = {Fri, 29 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ieeesensors/GhoshKBHNBFMLK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnlp/PeineltLH17,
author = {Nicole Peinelt and
Maria Liakata and
Shu{-}Kai Hsieh},
editor = {Seong{-}Bae Park and
Thepchai Supnithi},
title = {ClassifierGuesser: {A} Context-based Classifier Prediction System
for Chinese Language Learners},
booktitle = {Proceedings of the {IJCNLP} 2017, Tapei, Taiwan, November 27 - December
1, 2017, System Demonstrations},
pages = {41--44},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://aclanthology.org/I17-3011/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnlp/PeineltLH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ClintonCLLWYHWY17,
author = {Michael Clinton and
Hank Cheng and
Hung{-}Jen Liao and
Robin Lee and
Ching{-}Wei Wu and
Johnny Yang and
Hau{-}Tai Hsieh and
Frank Wu and
Jung{-}Ping Yang and
Atul Katoch and
Arun Achyuthan and
Donald Mikan and
Bryan Sheffield and
Jonathan Chang},
title = {12.3 {A} low-power and high-performance 10nm {SRAM} architecture for
mobile applications},
booktitle = {2017 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2017, San Francisco, CA, USA, February 5-9, 2017},
pages = {210--211},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ISSCC.2017.7870335},
doi = {10.1109/ISSCC.2017.7870335},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/ClintonCLLWYHWY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/LiYCLLHCS17,
author = {Chao{-}Chieh Li and
Min{-}Shueh Yuan and
Chih{-}Hsien Chang and
Yu{-}Tso Lin and
Chia{-}Chun Liao and
Kenny Hsieh and
Mark Chen and
Robert Bogdan Staszewski},
title = {19.6 {A} 0.2V trifilar-coil {DCO} with {DC-DC} converter in 16nm FinFET
{CMOS} with 188dB FOM, 1.3kHz resolution, and frequency pushing of
38MHz/V for energy harvesting applications},
booktitle = {2017 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2017, San Francisco, CA, USA, February 5-9, 2017},
pages = {332--333},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ISSCC.2017.7870396},
doi = {10.1109/ISSCC.2017.7870396},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/LiYCLLHCS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/MairWWKTGLSGLTL17,
author = {Hugh Mair and
Ericbill Wang and
Alice Wang and
Ping Kao and
Yuwen Tsai and
Sumanth Gururajarao and
Rolf Lagerquist and
Jin Son and
Gordon Gammie and
Gordon Lin and
Achuta Thippana and
Kent Li and
Manzur Rahman and
Wuan Kuo and
David Yen and
Yi{-}Chang Zhuang and
Ue Fu and
Hung{-}Wei Wang and
Mark Peng and
Cheng{-}Yuh Wu and
Taner Dosluoglu and
Anatoly Gelman and
Daniel Dia and
Girishankar Gurumurthy and
Tony Hsieh and
W. X. Lin and
Ray Tzeng and
Jengding Wu and
C. H. Wang and
Uming Ko},
title = {3.4 {A} 10nm FinFET 2.8GHz tri-gear deca-core {CPU} complex with optimized
power-delivery network for mobile SoC performance},
booktitle = {2017 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2017, San Francisco, CA, USA, February 5-9, 2017},
pages = {56--57},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ISSCC.2017.7870258},
doi = {10.1109/ISSCC.2017.7870258},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/MairWWKTGLSGLTL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/TingWWWWLTYHLHH17,
author = {Tah{-}Kang Joseph Ting and
Gyh{-}Bin Wang and
Ming{-}Hung Wang and
Chun{-}Peng Wu and
Chun{-}Kai Wang and
Chun{-}Wei Lo and
Li{-}Chin Tien and
Der{-}Min Yuan and
Yung{-}Ching Hsieh and
Jenn{-}Shiang Lai and
Wen{-}Pin Hsu and
Chien{-}Chih Huang and
Chi{-}Kang Chen and
Yung{-}Fa Chou and
Ding{-}Ming Kwai and
Zhe Wang and
Wei Wu and
Shigeki Tomishima and
Patrick Stolt and
Shih{-}Lien Lu},
title = {23.9 An 8-channel 4.5Gb 180GB/s 18ns-row-latency {RAM} for the last
level cache},
booktitle = {2017 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2017, San Francisco, CA, USA, February 5-9, 2017},
pages = {404--405},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ISSCC.2017.7870432},
doi = {10.1109/ISSCC.2017.7870432},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/TingWWWWLTYHLHH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itsc/HsiehLLY17,
author = {Min{-}Shiu Hsieh and
Siang{-}You Luo and
Po{-}Hsiang Liao and
De{-}Qiang Ye},
title = {Implementation of dynamic boundary on multiple Kalman trackings using
radar},
booktitle = {20th {IEEE} International Conference on Intelligent Transportation
Systems, {ITSC} 2017, Yokohama, Japan, October 16-19, 2017},
pages = {1--6},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ITSC.2017.8317677},
doi = {10.1109/ITSC.2017.8317677},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/itsc/HsiehLLY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwsda/HsiehTLS17,
author = {Jui{-}Hsien Hsieh and
Ming{-}Fu Tang and
Mao{-}Chao Lin and
Borching Su},
title = {The effect of carrier frequency offsets on an {IDMA-UFMC} system},
booktitle = {Eighth International Workshop on Signal Design and Its Applications
in Communications, {IWSDA} 2017, Sapporo, Japan, September 24-28,
2017},
pages = {89--93},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/IWSDA.2017.8097062},
doi = {10.1109/IWSDA.2017.8097062},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/iwsda/HsiehTLS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/YaoKHLS17,
author = {Jianhua Yao and
William Kovacs and
Nathan Hsieh and
Chia{-}Ying Liu and
Ronald M. Summers},
editor = {Maxime Descoteaux and
Lena Maier{-}Hein and
Alfred M. Franz and
Pierre Jannin and
D. Louis Collins and
Simon Duchesne},
title = {Holistic Segmentation of Intermuscular Adipose Tissues on Thigh {MRI}},
booktitle = {Medical Image Computing and Computer Assisted Intervention - {MICCAI}
2017 - 20th International Conference, Quebec City, QC, Canada, September
11-13, 2017, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {10433},
pages = {737--745},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-66182-7\_84},
doi = {10.1007/978-3-319-66182-7\_84},
timestamp = {Fri, 07 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miccai/YaoKHLS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miip/WeiWHPSK17,
author = {Dong Wei and
Susan Weinstein and
Meng{-}Kang Hsieh and
Lauren Pantalone and
Mitchell D. Schnall and
Despina Kontos},
editor = {Martin A. Styner and
Elsa D. Angelini},
title = {Three-dimensional whole breast segmentation in sagittal {MR} images
with dense depth field modeling and localized self-adaptation},
booktitle = {Medical Imaging 2017: Image Processing, Orlando, Florida, United States,
11-16 February 2017},
series = {{SPIE} Proceedings},
volume = {10133},
pages = {1013314},
publisher = {{SPIE}},
year = {2017},
url = {https://doi.org/10.1117/12.2248626},
doi = {10.1117/12.2248626},
timestamp = {Wed, 21 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miip/WeiWHPSK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mobihoc/Al-AnwarFHTMHS17,
author = {Amr Al{-}Anwar and
Henrique Ferraz and
Kevin Hsieh and
Rohit Thazhath and
Paul Martin and
Jo{\~{a}}o Pedro Hespanha and
Mani B. Srivastava},
editor = {Sharayu Moharir and
Aditya Gopalan},
title = {{D-SLATS:} Distributed Simultaneous Localization and Time Synchronization},
booktitle = {Proceedings of the 18th {ACM} International Symposium on Mobile Ad
Hoc Networking and Computing, Chennai, India, July 10-14, 2017},
pages = {14:1--14:10},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3084041.3084049},
doi = {10.1145/3084041.3084049},
timestamp = {Tue, 15 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mobihoc/Al-AnwarFHTMHS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mrs/SaldanaAHC017,
author = {David Saldana and
Renato M. Assun{\c{c}}{\~{a}}o and
M. Ani Hsieh and
Mario F. M. Campos and
Vijay Kumar},
title = {Cooperative prediction of time-varying boundaries with a team of robots},
booktitle = {2017 International Symposium on Multi-Robot and Multi-Agent Systems
(MRS), Los Angeles, CA, USA, December 4-5, 2017},
pages = {9--16},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/MRS.2017.8250925},
doi = {10.1109/MRS.2017.8250925},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mrs/SaldanaAHC017.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ofc/BavejaLWHZMWLLW17,
author = {Prashant P. Baveja and
Mingshan Li and
Ding Wang and
Chiuhui Hsieh and
Huanlin Zhang and
Ning Ma and
Yi Wang and
Justin Lii and
Yongxuan Liang and
Chong Wang and
I{-}Lung Ho and
Jun Zheng},
title = {56 Gb/s {PAM-4} directly modulated laser for 200G/400G data-center
optical links},
booktitle = {Optical Fiber Communications Conference and Exhibition, {OFC} 2017,
Los Angeles, CA, USA, March 19-23, 2017},
pages = {1--3},
publisher = {{IEEE}},
year = {2017},
url = {https://ieeexplore.ieee.org/document/7937125},
timestamp = {Thu, 26 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ofc/BavejaLWHZMWLLW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/HsiehMAHS17,
author = {Rex Hsieh and
Yuya Mochizuki and
Takaya Asano and
Marika Higashida and
Akihiko Shirai},
title = {"Real baby - real family": {VR} entertainment baby interaction system},
booktitle = {Special Interest Group on Computer Graphics and Interactive Techniques
Conference, {SIGGRAPH} 2017, Los Angeles, CA, USA, July 30 - August
3, 2017, Emerging Technologies},
pages = {20:1--20:2},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3084822.3084830},
doi = {10.1145/3084822.3084830},
timestamp = {Tue, 06 Apr 2021 12:32:08 +0200},
biburl = {https://dblp.org/rec/conf/siggraph/HsiehMAHS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/taai/MatsufujiSHSYC17,
author = {Akihiro Matsufuji and
Tatsuya Shiozawa and
Wei{-}Fen Hsieh and
Eri Sato{-}Shimokawara and
Toru Yamaguchi and
Lieu{-}Hen Chen},
title = {The Analysis of Nonverbal Behavior for Detecting Awkward Situation
in Communication},
booktitle = {Conference on Technologies and Applications of Artificial Intelligence,
{TAAI} 2017, Taipei, Taiwan, December 1-3, 2017},
pages = {118--123},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/TAAI.2017.12},
doi = {10.1109/TAAI.2017.12},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/taai/MatsufujiSHSYC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vric/MochizukiHAAHNS17,
author = {Yuya Mochizuki and
Rex Hsieh and
Daiki Agatsuma and
Takaya Asano and
Marika Higashida and
Tatsuya Nishikizawa and
Akihiko Shirai},
title = {Real Baby - Real Family: Holdable tangible baby {VR}},
booktitle = {Proceedings of the Virtual Reality International Conference - Laval
Virtual 2017, {VRIC} 2017, Laval, France, March 22-24, 2017},
pages = {4:1--4:4},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3110292.3110297},
doi = {10.1145/3110292.3110297},
timestamp = {Fri, 28 Jan 2022 16:17:04 +0100},
biburl = {https://dblp.org/rec/conf/vric/MochizukiHAAHNS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/BoroumandGPHLHH17,
author = {Amirali Boroumand and
Saugata Ghose and
Minesh Patel and
Hasan Hassan and
Brandon Lucia and
Nastaran Hajinazar and
Kevin Hsieh and
Krishna T. Malladi and
Hongzhong Zheng and
Onur Mutlu},
title = {LazyPIM: Efficient Support for Cache Coherence in Processing-in-Memory
Architectures},
journal = {CoRR},
volume = {abs/1706.03162},
year = {2017},
url = {http://arxiv.org/abs/1706.03162},
eprinttype = {arXiv},
eprint = {1706.03162},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/BoroumandGPHLHH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/KappelLHHM17,
author = {David Kappel and
Robert Legenstein and
Stefan Habenschuss and
Michael Hsieh and
Wolfgang Maass},
title = {Reward-based stochastic self-configuration of neural circuits},
journal = {CoRR},
volume = {abs/1704.04238},
year = {2017},
url = {http://arxiv.org/abs/1704.04238},
eprinttype = {arXiv},
eprint = {1704.04238},
timestamp = {Thu, 09 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/KappelLHHM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1708-04314,
author = {Elton Yechao Zhu and
Quntao Zhuang and
Min{-}Hsiu Hsieh and
Peter W. Shor},
title = {Superadditivity in trade-off capacities of quantum channels},
journal = {CoRR},
volume = {abs/1708.04314},
year = {2017},
url = {http://arxiv.org/abs/1708.04314},
eprinttype = {arXiv},
eprint = {1708.04314},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1708-04314.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1711-03906,
author = {Amr Al{-}Anwar and
Henrique Ferraz and
Kevin Hsieh and
Rohit Thazhath and
Paul Martin and
Jo{\~{a}}o Pedro Hespanha and
Mani B. Srivastava},
title = {{D-SLATS:} Distributed Simultaneous Localization and Time Synchronization},
journal = {CoRR},
volume = {abs/1711.03906},
year = {2017},
url = {http://arxiv.org/abs/1711.03906},
eprinttype = {arXiv},
eprint = {1711.03906},
timestamp = {Tue, 15 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1711-03906.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ManWKOHP16,
author = {Ruben De Man and
Ge Wang and
Mannudeep K. Kalra and
Alexi Otrakji and
Scott S. Hsieh and
Norbert J. Pelc},
title = {Upper-Bound on Dose Reduction in {CT} Reconstruction for Nodule Detection},
journal = {{IEEE} Access},
volume = {4},
pages = {4247--4253},
year = {2016},
url = {https://doi.org/10.1109/ACCESS.2016.2592941},
doi = {10.1109/ACCESS.2016.2592941},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/ManWKOHP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/LeeLHHTLLSHYYZH16,
author = {Peisan Lee and
Ju{-}Chi Liu and
Ming{-}Hsiung Hsieh and
Wen{-}Rui Hao and
Yuan{-}Teng Tseng and
Shuen{-}Hsin Liu and
Yung{-}Kuo Lin and
Li{-}Chin Sung and
Jen{-}Hung Huang and
Hung{-}Yu Yang and
Jong{-}Shiuan Ye and
He{-}Shun Zheng and
Min{-}Huei Hsu and
Syed Abdul Shabbir and
Richard Lu and
Phung Anh Nguyen and
Usman Iqbal and
Chih{-}Wei Huang and
Wen{-}Shan Jian and
Yu{-}Chuan (Jack) Li},
title = {Cloud-based {BP} system integrated with {CPOE} improves self-management
of the hypertensive patients: {A} randomized controlled trial},
journal = {Comput. Methods Programs Biomed.},
volume = {132},
pages = {105--113},
year = {2016},
url = {https://doi.org/10.1016/j.cmpb.2016.04.003},
doi = {10.1016/J.CMPB.2016.04.003},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmpb/LeeLHHTLLSHYYZH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/compnet/FriedmanLOHKM16,
author = {Eric J. Friedman and
Adam Scott Landsberg and
Julia P. Owen and
Wenson Hsieh and
Leo Kam and
Pratik Mukherjee},
title = {Edge correlations in spatial networks},
journal = {J. Complex Networks},
volume = {4},
number = {1},
pages = {1--14},
year = {2016},
url = {https://doi.org/10.1093/comnet/cnv015},
doi = {10.1093/COMNET/CNV015},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/compnet/FriedmanLOHKM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/information/HeinzCKMWFHB16,
author = {Melinda Heinz and
Jinmyoung Cho and
Norene Kelly and
Peter Martin and
Johnny Wong and
Warren Franke and
Wen{-}Hua Hsieh and
Joan Blaser},
title = {The Potential of Three Computer-Based Communication Activities for
Supporting Older Adult Independent Living},
journal = {Inf.},
volume = {7},
number = {2},
pages = {26},
year = {2016},
url = {https://doi.org/10.3390/info7020026},
doi = {10.3390/INFO7020026},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/information/HeinzCKMWFHB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/js/ShiangHLWYMT16,
author = {Tzyy{-}Yuang Shiang and
Tsung{-}Yu Hsieh and
Yin{-}Shin Lee and
Chen{-}Chi Wu and
Meng{-}Chieh Yu and
Chung{-}Huan Mei and
I{-}Han Tai},
title = {Determine the Foot Strike Pattern Using Inertial Sensors},
journal = {J. Sensors},
volume = {2016},
pages = {4759626:1--4759626:6},
year = {2016},
url = {https://doi.org/10.1155/2016/4759626},
doi = {10.1155/2016/4759626},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/js/ShiangHLWYMT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/HsiehCLC16,
author = {Min{-}Han Hsieh and
Liang{-}Hsin Chen and
Shen{-}Iuan Liu and
Charlie Chung{-}Ping Chen},
title = {A 6.7 MHz to 1.24 GHz 0.0318 mm \({}^{\mbox{2}}\) Fast-Locking All-Digital
{DLL} Using Phase-Tracing Delay Unit in 90 nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {51},
number = {2},
pages = {412--427},
year = {2016},
url = {https://doi.org/10.1109/JSSC.2015.2494603},
doi = {10.1109/JSSC.2015.2494603},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/HsiehCLC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/WuCCWSPHCHTPYUW16,
author = {Jiangfeng Wu and
Giuseppe Cusmai and
Acer Wei{-}Te Chou and
Tao Wang and
Bo Shen and
Vijayaramalingam Periasamy and
Ming{-}Hung Hsieh and
Chun{-}Ying Chen and
Lin He and
Loke Kun Tan and
Aravind Padyana and
Vincent Cheng{-}Hsun Yang and
Gregory Unruh and
Jackie Koon Lun Wong and
Bryan Juo{-}Jung Hung and
Massimo Brandolini and
Maco Sha{-}Ting Lin and
Xi Chen and
Yen Ding and
Yen{-}Jen Ko and
Young J. Shin and
Ada Hing T. Hung and
Binning Chen and
Cynthia Dang and
Deepak Lakshminarasimhan and
Iris Hong Liu and
Jerry Lin and
Kowen Lai and
Larry Wassermann and
Ayaskant Shrivastava and
Chi{-}Ming Hsiao and
Chun{-}Sheng Huang and
Jianlong Chen and
Lakshminarasimhan Krishnan and
Ning{-}Yi Wang and
Pin{-}En Su and
Tianwei Li and
Wei{-}Ta Shih and
Yau{-}Cheng Yang and
Peter Cangiane and
Randall Perlow and
William Ngai and
Hanson Hung{-}Sen Huang and
James Y. C. Chang and
Xicheng Jiang and
Ardie G. Venes and
Ramon Ray Gomez},
title = {A 2.7 mW/Channel 48-1000 MHz Direct Sampling Full-Band Cable Receiver},
journal = {{IEEE} J. Solid State Circuits},
volume = {51},
number = {4},
pages = {845--859},
year = {2016},
url = {https://doi.org/10.1109/JSSC.2015.2511164},
doi = {10.1109/JSSC.2015.2511164},
timestamp = {Tue, 05 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/WuCCWSPHCHTPYUW16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jstsp/AungAHRYPEC16,
author = {Min S. Hane Aung and
Faisal Alquaddoomi and
Cheng{-}Kang Hsieh and
Mashfiqui Rabbi and
Longqi Yang and
John P. Pollak and
Deborah Estrin and
Tanzeem Choudhury},
title = {Leveraging Multi-Modal Sensing for Mobile Health: {A} Case Review
in Chronic Pain},
journal = {{IEEE} J. Sel. Top. Signal Process.},
volume = {10},
number = {5},
pages = {962--974},
year = {2016},
url = {https://doi.org/10.1109/JSTSP.2016.2565381},
doi = {10.1109/JSTSP.2016.2565381},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jstsp/AungAHRYPEC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/HuangSKHJCHL16,
author = {Kai{-}Yao Huang and
Min{-}Gang Su and
Hui{-}Ju Kao and
Yun{-}Chung Hsieh and
Jhih{-}Hua Jhong and
Kuang{-}Hao Cheng and
Hsien{-}Da Huang and
Tzong{-}Yi Lee},
title = {dbPTM 2016: 10-year anniversary of a resource for post-translational
modification of proteins},
journal = {Nucleic Acids Res.},
volume = {44},
number = {Database-Issue},
pages = {435--446},
year = {2016},
url = {https://doi.org/10.1093/nar/gkv1240},
doi = {10.1093/NAR/GKV1240},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/HuangSKHJCHL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/HsiehS16,
author = {Yi{-}Zeng Hsieh and
Mu{-}Chun Su},
title = {A Q-learning-based swarm optimization algorithm for economic dispatch
problem},
journal = {Neural Comput. Appl.},
volume = {27},
number = {8},
pages = {2333--2350},
year = {2016},
url = {https://doi.org/10.1007/s00521-015-2070-1},
doi = {10.1007/S00521-015-2070-1},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nca/HsiehS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/EavaniHAEBRD16,
author = {Harini Eavani and
Meng{-}Kang Hsieh and
Yang An and
G{\"{u}}ray Erus and
Lori L. Beason{-}Held and
Susan M. Resnick and
Christos Davatzikos},
title = {Capturing heterogeneous group differences using mixture-of-experts:
Application to a study of aging},
journal = {NeuroImage},
volume = {125},
pages = {498--514},
year = {2016},
url = {https://doi.org/10.1016/j.neuroimage.2015.10.045},
doi = {10.1016/J.NEUROIMAGE.2015.10.045},
timestamp = {Mon, 30 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/EavaniHAEBRD16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tit/HsiehW16,
author = {Min{-}Hsiu Hsieh and
Shun Watanabe},
title = {Channel Simulation and Coded Source Compression},
journal = {{IEEE} Trans. Inf. Theory},
volume = {62},
number = {11},
pages = {6609--6619},
year = {2016},
url = {https://doi.org/10.1109/TIT.2016.2597853},
doi = {10.1109/TIT.2016.2597853},
timestamp = {Tue, 10 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tit/HsiehW16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tr/XuLZH16,
author = {Li Xu and
Limei Lin and
Shuming Zhou and
Sun{-}Yuan Hsieh},
title = {The Extra Connectivity, Extra Conditional Diagnosability, and t/m-Diagnosability
of Arrangement Graphs},
journal = {{IEEE} Trans. Reliab.},
volume = {65},
number = {3},
pages = {1248--1262},
year = {2016},
url = {https://doi.org/10.1109/TR.2016.2570559},
doi = {10.1109/TR.2016.2570559},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tr/XuLZH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biocas/ChouCCCTSHCYCT16,
author = {Ting{-}I Chou and
Shih{-}Wen Chiu and
Kwuang{-}Han Chang and
Yi{-}Ju Chen and
Chen{-}Ting Tang and
Chung{-}Hung Shih and
Chih{-}Cheng Hsieh and
Meng{-}Fan Chang and
Chia{-}Hsiang Yang and
Herming Chiueh and
Kea{-}Tiong Tang},
title = {Design of a 0.5 {V} 1.68mW nose-on-a-chip for rapid screen of chronic
obstructive pulmonary disease},
booktitle = {{IEEE} Biomedical Circuits and Systems Conference, BioCAS 2016, Shanghai,
China, October 17-19, 2016},
pages = {592--595},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/BioCAS.2016.7833864},
doi = {10.1109/BIOCAS.2016.7833864},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/biocas/ChouCCCTSHCYCT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/ColussoHM16,
author = {Lucas Colusso and
Gary Hsieh and
Sean A. Munson},
editor = {Jofish Kaye and
Allison Druin and
Cliff Lampe and
Dan Morris and
Juan Pablo Hourcade},
title = {Designing Closeness to Increase Gamers' Performance},
booktitle = {Proceedings of the 2016 {CHI} Conference on Human Factors in Computing
Systems, San Jose, CA, USA, May 7-12, 2016},
pages = {3020--3024},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2858036.2858206},
doi = {10.1145/2858036.2858206},
timestamp = {Wed, 01 Jun 2022 08:38:38 +0200},
biburl = {https://dblp.org/rec/conf/chi/ColussoHM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/EpsteinCFHM16,
author = {Daniel A. Epstein and
Felicia Cordeiro and
James Fogarty and
Gary Hsieh and
Sean A. Munson},
editor = {Jofish Kaye and
Allison Druin and
Cliff Lampe and
Dan Morris and
Juan Pablo Hourcade},
title = {Crumbs: Lightweight Daily Food Challenges to Promote Engagement and
Mindfulness},
booktitle = {Proceedings of the 2016 {CHI} Conference on Human Factors in Computing
Systems, San Jose, CA, USA, May 7-12, 2016},
pages = {5632--5644},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2858036.2858044},
doi = {10.1145/2858036.2858044},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/EpsteinCFHM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/SuhH16,
author = {Minhyang (Mia) Suh and
Gary Hsieh},
editor = {Jofish Kaye and
Allison Druin and
Cliff Lampe and
Dan Morris and
Juan Pablo Hourcade},
title = {Designing for Future Behaviors: Understanding the Effect of Temporal
Distance on Planned Behaviors},
booktitle = {Proceedings of the 2016 {CHI} Conference on Human Factors in Computing
Systems, San Jose, CA, USA, May 7-12, 2016},
pages = {1084--1096},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2858036.2858591},
doi = {10.1145/2858036.2858591},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/chi/SuhH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cis/PanPTH16,
author = {Hsieh{-}Tsen Pan and
Chiu{-}Shu Pan and
Shyh{-}Chang Tsaur and
Min{-}Shiang Hwang},
title = {Cryptanalysis of Efficient Dynamic {ID} Based Remote User Authentication
Scheme in Multi-Server Environment Using Smart Card},
booktitle = {12th International Conference on Computational Intelligence and Security,
{CIS} 2016, Wuxi, China, December 16-19, 2016},
pages = {590--593},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/CIS.2016.0143},
doi = {10.1109/CIS.2016.0143},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cis/PanPTH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clsw/ShihH16,
author = {Meng{-}Hsien Shih and
Shu{-}Kai Hsieh},
editor = {Minghui Dong and
Jingxia Lin and
Xuri Tang},
title = {Yet Another Resource to Sketch Word Behavior in Chinese Variation},
booktitle = {Chinese Lexical Semantics - 17th Workshop, {CLSW} 2016, Singapore,
Singapore, May 20-22, 2016, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {10085},
pages = {325--332},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-49508-8\_31},
doi = {10.1007/978-3-319-49508-8\_31},
timestamp = {Tue, 14 May 2019 10:00:51 +0200},
biburl = {https://dblp.org/rec/conf/clsw/ShihH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cscw/AgapieCMH16,
author = {Elena Agapie and
Lucas Colusso and
Sean A. Munson and
Gary Hsieh},
editor = {Darren Gergle and
Meredith Ringel Morris and
Pernille Bj{\o}rn and
Joseph A. Konstan},
title = {PlanSourcing: Generating Behavior Change Plans with Friends and Crowds},
booktitle = {Proceedings of the 19th {ACM} Conference on Computer-Supported Cooperative
Work {\&} Social Computing, {CSCW} 2016, San Francisco, CA, USA,
February 27 - March 2, 2016},
pages = {119--133},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2818048.2819943},
doi = {10.1145/2818048.2819943},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cscw/AgapieCMH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/BurnsHMCSLCAF16,
author = {John R. Burns and
Yee{-}Hsee Hsieh and
Andrew Mueller and
Juliette Chevallier and
Tirunelveli S. Sriram and
Stephen J. Lewis and
Daniel Chew and
Anil Achyuta and
Jason Fiering},
title = {High density penetrating electrode arrays for autonomic nerves},
booktitle = {38th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2016, Orlando, FL, USA, August
16-20, 2016},
pages = {2802--2805},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/EMBC.2016.7591312},
doi = {10.1109/EMBC.2016.7591312},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/embc/BurnsHMCSLCAF16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/HsiehS16,
author = {Han{-}Lin Hsieh and
Maryam Modir Shanechi},
title = {Multiscale brain-machine interface decoders},
booktitle = {38th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2016, Orlando, FL, USA, August
16-20, 2016},
pages = {6361--6364},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/EMBC.2016.7592183},
doi = {10.1109/EMBC.2016.7592183},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/embc/HsiehS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/YanYWKMSSKOZMT16,
author = {Shing Tak Yan and
Lu Ye and
Hongbing Wu and
Raghavendra Kulkarni and
Edward Myers and
Hsieh{-}Chih Shih and
Shadi Saberi and
Darshan Kadia and
Dizle Ozis and
Lei Zhou and
Eric Middleton and
Joo Leong Tham},
title = {An 802.11a/b/g/n/ac {WLAN} Transceiver for 2{\texttimes}2 {MIMO} and
simultaneous dual-band operation with +29 dBm Psat integrated power
amplifiers},
booktitle = {{ESSCIRC} Conference 2016: 42\({}^{\mbox{nd}}\) European Solid-State
Circuits Conference, Lausanne, Switzerland, September 12-15, 2016},
pages = {121--124},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ESSCIRC.2016.7598257},
doi = {10.1109/ESSCIRC.2016.7598257},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/esscirc/YanYWKMSSKOZMT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ets/MarinissenZKHHC16,
author = {Erik Jan Marinissen and
Yervant Zorian and
Mario Konijnenburg and
Chih{-}Tsun Huang and
Ping{-}Hsuan Hsieh and
Peter Cockburn and
Jeroen Delvaux and
Vladimir Rozic and
Bohan Yang and
Dave Singel{\'{e}}e and
Ingrid Verbauwhede and
Cedric Mayor and
Robert Van Rijsinge and
Cocoy Reyes},
title = {IoT: Source of test challenges},
booktitle = {21th {IEEE} European Test Symposium, {ETS} 2016, Amsterdam, Netherlands,
May 23-27, 2016},
pages = {1--10},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ETS.2016.7519331},
doi = {10.1109/ETS.2016.7519331},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ets/MarinissenZKHHC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/LinHSG16,
author = {Rungtai Lin and
Hui Yueh Hsieh and
Ming{-}Xean Sun and
Ya{-}Juan Gao},
editor = {Pei{-}Luen Patrick Rau},
title = {From Ideality to Reality- a Case Study of Mondrian Style},
booktitle = {Cross-Cultural Design - 8th International Conference, {CCD} 2016,
Held as Part of {HCI} International 2016, Toronto, ON, Canada, July
17-22, 2016, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9741},
pages = {365--376},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-40093-8\_37},
doi = {10.1007/978-3-319-40093-8\_37},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hci/LinHSG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hotchips/LinTHHCYFZCLCKT16,
author = {Mu{-}Shan Lin and
Chien{-}Chun Tsai and
Kenny Cheng{-}Hsiang Hsieh and
Wen{-}Hung Huang and
Yu{-}Chi Chen and
Shu{-}Chun Yang and
Chin{-}Ming Fu and
Hao{-}Jie Zhan and
Jinn{-}Yeh Chien and
Shao{-}Yu Li and
Y.{-}H. Chen and
C.{-}C. Kuo and
Shih{-}Peng Tai and
Kazuyoshi Yamada},
title = {A 16nm 256-bit wide 89.6GByte/s total bandwidth in-package interconnect
with 0.3V swing and 0.062pJ/bit power in InFO package},
booktitle = {2016 {IEEE} Hot Chips 28 Symposium (HCS), Cupertino, CA, USA, August
21-23, 2016},
pages = {1--32},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/HOTCHIPS.2016.7936211},
doi = {10.1109/HOTCHIPS.2016.7936211},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hotchips/LinTHHCYFZCLCKT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccd/HsiehKVCBGM16,
author = {Kevin Hsieh and
Samira Manabi Khan and
Nandita Vijaykumar and
Kevin K. Chang and
Amirali Boroumand and
Saugata Ghose and
Onur Mutlu},
title = {Accelerating pointer chasing in 3D-stacked memory: Challenges, mechanisms,
evaluation},
booktitle = {34th {IEEE} International Conference on Computer Design, {ICCD} 2016,
Scottsdale, AZ, USA, October 2-5, 2016},
pages = {25--32},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/ICCD.2016.7753257},
doi = {10.1109/ICCD.2016.7753257},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccd/HsiehKVCBGM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmlc/HsiehYK16,
author = {Shu{-}Ming Hsieh and
Mao{-}Hsu Yen and
Li{-}Jen Kao},
title = {Semantic-based graph data anonymization for big data analysis},
booktitle = {International Conference on Machine Learning and Cybernetics, {ICMLC}
2016, Jeju Island, South Korea, July 10-13, 2016},
pages = {600--605},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICMLC.2016.7872955},
doi = {10.1109/ICMLC.2016.7872955},
timestamp = {Wed, 16 Oct 2019 14:14:56 +0200},
biburl = {https://dblp.org/rec/conf/icmlc/HsiehYK16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/LaskeySHMPDG16,
author = {Michael Laskey and
Sam Staszak and
Wesley Yu{-}Shu Hsieh and
Jeffrey Mahler and
Florian T. Pokorny and
Anca D. Dragan and
Ken Goldberg},
editor = {Danica Kragic and
Antonio Bicchi and
Alessandro De Luca},
title = {{SHIV:} Reducing supervisor burden in DAgger using support vectors
for efficient learning from demonstrations in high dimensional state
spaces},
booktitle = {2016 {IEEE} International Conference on Robotics and Automation, {ICRA}
2016, Stockholm, Sweden, May 16-21, 2016},
pages = {462--469},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICRA.2016.7487167},
doi = {10.1109/ICRA.2016.7487167},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/icra/LaskeySHMPDG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/SartorettiSH16,
author = {Guillaume Sartoretti and
Samuel Shaw and
M. Ani Hsieh},
editor = {Danica Kragic and
Antonio Bicchi and
Alessandro De Luca},
title = {Distributed planar manipulation in fluidic environments},
booktitle = {2016 {IEEE} International Conference on Robotics and Automation, {ICRA}
2016, Stockholm, Sweden, May 16-21, 2016},
pages = {5322--5327},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/ICRA.2016.7487743},
doi = {10.1109/ICRA.2016.7487743},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icra/SartorettiSH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/HuangHSHTL16,
author = {Wen{-}Yu Huang and
Shan{-}Wen Hsiao and
Hung{-}Ching Sun and
Ming{-}Chuan Hsieh and
Ming{-}Hsueh Tsai and
Chi{-}Chun Lee},
editor = {Nelson Morgan},
title = {Enhancement of Automatic Oral Presentation Assessment System Using
Latent N-Grams Word Representation and Part-of-Speech Information},
booktitle = {17th Annual Conference of the International Speech Communication Association,
Interspeech 2016, San Francisco, CA, USA, September 8-12, 2016},
pages = {1432--1436},
publisher = {{ISCA}},
year = {2016},
url = {https://doi.org/10.21437/Interspeech.2016-400},
doi = {10.21437/INTERSPEECH.2016-400},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/HuangHSHTL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/HsiehEKCOVMK16,
author = {Kevin Hsieh and
Eiman Ebrahimi and
Gwangsun Kim and
Niladrish Chatterjee and
Mike O'Connor and
Nandita Vijaykumar and
Onur Mutlu and
Stephen W. Keckler},
title = {Transparent Offloading and Mapping {(TOM):} Enabling Programmer-Transparent
Near-Data Processing in {GPU} Systems},
booktitle = {43rd {ACM/IEEE} Annual International Symposium on Computer Architecture,
{ISCA} 2016, Seoul, South Korea, June 18-22, 2016},
pages = {204--216},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/ISCA.2016.27},
doi = {10.1109/ISCA.2016.27},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isca/HsiehEKCOVMK16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micro/VijaykumarHPKSG16,
author = {Nandita Vijaykumar and
Kevin Hsieh and
Gennady Pekhimenko and
Samira Manabi Khan and
Ashish Shrestha and
Saugata Ghose and
Adwait Jog and
Phillip B. Gibbons and
Onur Mutlu},
title = {Zorua: {A} holistic approach to resource virtualization in GPUs},
booktitle = {49th Annual {IEEE/ACM} International Symposium on Microarchitecture,
{MICRO} 2016, Taipei, Taiwan, October 15-19, 2016},
pages = {15:1--15:14},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/MICRO.2016.7783718},
doi = {10.1109/MICRO.2016.7783718},
timestamp = {Tue, 31 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/micro/VijaykumarHPKSG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rss/KularatneBH16,
author = {Dhanushka Kularatne and
Subhrajit Bhattacharya and
M. Ani Hsieh},
editor = {David Hsu and
Nancy M. Amato and
Spring Berman and
Sam Ade Jacobs},
title = {Time and Energy Optimal Path Planning in General Flows},
booktitle = {Robotics: Science and Systems XII, University of Michigan, Ann Arbor,
Michigan, USA, June 18 - June 22, 2016},
year = {2016},
url = {http://www.roboticsproceedings.org/rss12/p47.html},
doi = {10.15607/RSS.2016.XII.047},
timestamp = {Fri, 29 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/rss/KularatneBH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmap/ChenHS16,
author = {Liang{-}Hua Chen and
Meng{-}Chen Hsieh and
Chih{-}Wen Su},
editor = {Christian Callegari and
Marten van Sinderen and
Panagiotis G. Sarigiannidis and
Pierangela Samarati and
Enrique Cabello and
Pascal Lorenz and
Mohammad S. Obaidat},
title = {A Spatio-temporal Approach for Video Caption Extraction},
booktitle = {Proceedings of the 13th International Joint Conference on e-Business
and Telecommunications {(ICETE} 2016) - Volume 5: SIGMAP, Lisbon,
Portugal, July 26-28, 2016},
pages = {83--88},
publisher = {SciTePress},
year = {2016},
url = {https://doi.org/10.5220/0005939300830088},
doi = {10.5220/0005939300830088},
timestamp = {Fri, 19 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigmap/ChenHS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmetrics/ChangKHGHLLPKM16,
author = {Kevin K. Chang and
Abhijith Kashyap and
Hasan Hassan and
Saugata Ghose and
Kevin Hsieh and
Donghyuk Lee and
Tianshi Li and
Gennady Pekhimenko and
Samira Manabi Khan and
Onur Mutlu},
editor = {Sara Alouf and
Alain Jean{-}Marie and
Nidhi Hegde and
Alexandre Prouti{\`{e}}re},
title = {Understanding Latency Variation in Modern {DRAM} Chips: Experimental
Characterization, Analysis, and Optimization},
booktitle = {Proceedings of the 2016 {ACM} {SIGMETRICS} International Conference
on Measurement and Modeling of Computer Science, Antibes Juan-Les-Pins,
France, June 14-18, 2016},
pages = {323--336},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2896377.2901453},
doi = {10.1145/2896377.2901453},
timestamp = {Thu, 02 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigmetrics/ChangKHGHLLPKM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/swarm/HsiehHCH16,
author = {Su{-}Tzu Hsieh and
Ping{-}Yu Hsu and
Ming{-}Shien Cheng and
Hui{-}Ting Huang},
editor = {Ying Tan and
Yuhui Shi and
Li Li},
title = {Pushing Decision Points Backward to the Latest Possible Positions
with a Workflow Log},
booktitle = {Advances in Swarm Intelligence, 7th International Conference, {ICSI}
2016, Bali, Indonesia, June 25-30, 2016, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {9713},
pages = {298--305},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-41009-8\_32},
doi = {10.1007/978-3-319-41009-8\_32},
timestamp = {Tue, 11 Jul 2023 08:21:51 +0200},
biburl = {https://dblp.org/rec/conf/swarm/HsiehHCH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/LiTYLCHLLKHCXS16,
author = {Chao{-}Chieh Li and
Tsung{-}Hsien Tsai and
Min{-}Shueh Yuan and
Chia{-}Chun Liao and
Chih{-}Hsien Chang and
Tien{-}Chien Huang and
Hsien{-}Yuan Liao and
Chung{-}Ting Lu and
Hung{-}Yi Kuo and
Kenny Hsieh and
Mark Chen and
Augusto Ronchini Ximenes and
Robert Bogdan Staszewski},
title = {A 0.034mm\({}^{\mbox{2}}\), 725fs {RMS} jitter, 1.8{\%}/V frequency-pushing,
10.8-19.3GHz transformer-based fractional-N all-digital {PLL} in 10nm
FinFET {CMOS}},
booktitle = {2016 {IEEE} Symposium on {VLSI} Circuits, {VLSIC} 2016, Honolulu,
HI, USA, June 15-17, 2016},
pages = {1--2},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/VLSIC.2016.7573551},
doi = {10.1109/VLSIC.2016.7573551},
timestamp = {Wed, 10 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vlsic/LiTYLCHLLKHCXS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/HsiehSS016,
author = {M. Ani Hsieh and
Srikanth Saripalli and
Gaurav S. Sukhatme and
Vijay Kumar},
title = {Toward a Science of Autonomy for Physical Systems: Aerial Earth Science},
journal = {CoRR},
volume = {abs/1609.05783},
year = {2016},
url = {http://arxiv.org/abs/1609.05783},
eprinttype = {arXiv},
eprint = {1609.05783},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/HsiehSS016.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/MirandaDLZGWHS16,
author = {Fabio Miranda and
Harish Doraiswamy and
Marcos Lage and
Kai Zhao and
Bruno Gon{\c{c}}alves and
Luc Wilson and
Mondrian Hsieh and
Cl{\'{a}}udio T. Silva},
title = {Urban Pulse: Capturing the Rhythm of Cities},
journal = {CoRR},
volume = {abs/1608.06949},
year = {2016},
url = {http://arxiv.org/abs/1608.06949},
eprinttype = {arXiv},
eprint = {1608.06949},
timestamp = {Thu, 09 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/MirandaDLZGWHS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/behaviourIT/HsiehCH15,
author = {Ting{-}Chu Hsieh and
Sing{-}Liang Chen and
Ming{-}Chien Hung},
title = {Longitudinal test of ePortfolio continuous use: an empirical study
on the change of students' beliefs},
journal = {Behav. Inf. Technol.},
volume = {34},
number = {8},
pages = {838--853},
year = {2015},
url = {https://doi.org/10.1080/0144929X.2014.907344},
doi = {10.1080/0144929X.2014.907344},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/behaviourIT/HsiehCH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cal/SeshadriHBLKMGM15,
author = {Vivek Seshadri and
Kevin Hsieh and
Amirali Boroumand and
Donghyuk Lee and
Michael A. Kozuch and
Onur Mutlu and
Phillip B. Gibbons and
Todd C. Mowry},
title = {Fast Bulk Bitwise {AND} and {OR} in {DRAM}},
journal = {{IEEE} Comput. Archit. Lett.},
volume = {14},
number = {2},
pages = {127--131},
year = {2015},
url = {https://doi.org/10.1109/LCA.2015.2434872},
doi = {10.1109/LCA.2015.2434872},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cal/SeshadriHBLKMGM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cluster/EssenHAPG15,
author = {Brian Van Essen and
Henry Hsieh and
Sasha Ames and
Roger A. Pearce and
Maya B. Gokhale},
title = {{DI-MMAP} - a scalable memory-map runtime for out-of-core data-intensive
applications},
journal = {Clust. Comput.},
volume = {18},
number = {1},
pages = {15--28},
year = {2015},
url = {https://doi.org/10.1007/s10586-013-0309-0},
doi = {10.1007/S10586-013-0309-0},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cluster/EssenHAPG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cphysics/TsaiYHLY15,
author = {T. C. Tsai and
H.{-}S. Yu and
M.{-}S. Hsieh and
S. H. Lai and
Y.{-}H. Yang},
title = {Implicit predictor-corrector central finite difference scheme for
the equations of magnetohydrodynamic simulations},
journal = {Comput. Phys. Commun.},
volume = {196},
pages = {1--12},
year = {2015},
url = {https://doi.org/10.1016/j.cpc.2015.05.001},
doi = {10.1016/J.CPC.2015.05.001},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cphysics/TsaiYHLY15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/ChenWKH15,
author = {Hua{-}Pin Chen and
San{-}Fu Wang and
Yi{-}Tsen Ku and
Ming{-}Yuan Hsieh},
title = {Quadrature oscillators using two CFOAs and four passive components},
journal = {{IEICE} Electron. Express},
volume = {12},
number = {2},
pages = {20141148},
year = {2015},
url = {https://doi.org/10.1587/elex.12.20141148},
doi = {10.1587/ELEX.12.20141148},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieiceee/ChenWKH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbi/LenoxWLDBH15,
author = {Mark W. Lenox and
James Wiskin and
Matthew A. Lewis and
Stephen Darrouzet and
David Borup and
Scott Hsieh},
title = {Imaging Performance of Quantitative Transmission Ultrasound},
journal = {Int. J. Biomed. Imaging},
volume = {2015},
pages = {454028:1--454028:8},
year = {2015},
url = {https://doi.org/10.1155/2015/454028},
doi = {10.1155/2015/454028},
timestamp = {Sun, 21 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbi/LenoxWLDBH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcta/LeeLH15,
author = {Shuenn{-}Yuh Lee and
Ming{-}Chun Liang and
Cheng{-}Han Hsieh},
title = {FFT-based calibration method for 1.5 bit/stage pipelined ADCs},
journal = {Int. J. Circuit Theory Appl.},
volume = {43},
number = {4},
pages = {455--469},
year = {2015},
url = {https://doi.org/10.1002/cta.1953},
doi = {10.1002/CTA.1953},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijcta/LeeLH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijrr/HeckmanSH15,
author = {Christoffer R. Heckman and
Ira B. Schwartz and
M. Ani Hsieh},
title = {Toward efficient navigation in uncertain gyre-like flows},
journal = {Int. J. Robotics Res.},
volume = {34},
number = {13},
pages = {1590--1603},
year = {2015},
url = {https://doi.org/10.1177/0278364915585396},
doi = {10.1177/0278364915585396},
timestamp = {Thu, 17 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijrr/HeckmanSH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ile/HsiehSCC15,
author = {Yi{-}Zeng Hsieh and
Mu{-}Chun Su and
Sherry Y. Chen and
Gwo{-}Dong Chen},
title = {The development of a robot-based learning companion: a user-centered
design approach},
journal = {Interact. Learn. Environ.},
volume = {23},
number = {3},
pages = {356--372},
year = {2015},
url = {https://doi.org/10.1080/10494820.2013.765895},
doi = {10.1080/10494820.2013.765895},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ile/HsiehSCC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcamd/SarvagallaSKSLHHC15,
author = {Sailu Sarvagalla and
Vivek Kumar Singh and
Yi{-}Yu Ke and
Hui{-}Yi Shiao and
Wen{-}Hsing Lin and
Hsing{-}Pang Hsieh and
John T. A. Hsu and
Mohane Selvaraj Coumar},
title = {Identification of ligand efficient, fragment-like hits from an {HTS}
library: structure-based virtual screening and docking investigations
of 2H- and 3H-pyrazolo tautomers for Aurora kinase {A} selectivity},
journal = {J. Comput. Aided Mol. Des.},
volume = {29},
number = {1},
pages = {89--100},
year = {2015},
url = {https://doi.org/10.1007/s10822-014-9807-2},
doi = {10.1007/S10822-014-9807-2},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcamd/SarvagallaSKSLHHC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jscic/HsiehLYY15,
author = {Po{-}Wen Hsieh and
Ming{-}Chih Lai and
Suh{-}Yuh Yang and
Cheng{-}Shu You},
title = {An Unconditionally Energy Stable Penalty Immersed Boundary Method
for Simulating the Dynamics of an Inextensible Interface Interacting
with a Solid Particle},
journal = {J. Sci. Comput.},
volume = {64},
number = {2},
pages = {289--316},
year = {2015},
url = {https://doi.org/10.1007/s10915-014-9933-y},
doi = {10.1007/S10915-014-9933-Y},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jscic/HsiehLYY15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BrandoliniSRWWG15,
author = {Massimo Brandolini and
Young Shin and
Karthik Raviprakash and
Tao Wang and
Rong Wu and
Hemasundar Mohan Geddada and
Yen{-}Jen Ko and
Yen Ding and
Chun{-}Sheng Huang and
Wei{-}Ta Shih and
Ming{-}Hung Hsieh and
Wei{-}Te Chou and
Tianwei Li and
Ayaskant Shrivastava and
Yi{-}Chun Chen and
Bryan Juo{-}Jung Hung and
Giuseppe Cusmai and
Jiangfeng Wu and
Mo M. Zhang and
Yuan Yao and
Greg Unruh and
Ardie G. Venes and
Hung Sen Huang and
Chun{-}Ying Chen},
title = {A 5 GS/s 150 mW 10 b SHA-Less Pipelined/SAR Hybrid {ADC} for Direct-Sampling
Systems in 28 nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {50},
number = {12},
pages = {2922--2934},
year = {2015},
url = {https://doi.org/10.1109/JSSC.2015.2464684},
doi = {10.1109/JSSC.2015.2464684},
timestamp = {Tue, 05 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/BrandoliniSRWWG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/DicksonLRAKHBFA15,
author = {Timothy O. Dickson and
Yong Liu and
Sergey V. Rylov and
Ankur Agrawal and
Seongwon Kim and
Ping{-}Hsuan Hsieh and
John F. Bulzacchelli and
Mark A. Ferriss and
Herschel A. Ainspan and
Alexander V. Rylyakov and
Benjamin D. Parker and
Michael P. Beakes and
Christian W. Baks and
Lei Shan and
Young Hoon Kwark and
Jos{\'{e}} A. Tierno and
Daniel J. Friedman},
title = {A 1.4 pJ/bit, Power-Scalable 16{\texttimes}12 Gb/s Source-Synchronous
{I/O} With {DFE} Receiver in 32 nm {SOI} {CMOS} Technology},
journal = {{IEEE} J. Solid State Circuits},
volume = {50},
number = {8},
pages = {1917--1931},
year = {2015},
url = {https://doi.org/10.1109/JSSC.2015.2412688},
doi = {10.1109/JSSC.2015.2412688},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/DicksonLRAKHBFA15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/FransCEAFTJBIUW15,
author = {Yohan Frans and
Declan Carey and
Marc Erett and
Hesam Amir Aslanzadeh and
Wayne Y. Fang and
Didem Turker and
Anup P. Jose and
Adebabay Bekele and
Jay Im and
Parag Upadhyaya and
Zhaoyin Daniel Wu and
Kenny C.{-}H. Hsieh and
Jafar Savoj and
Ken Chang},
title = {A 0.5-16.3 Gb/s Fully Adaptive Flexible-Reach Transceiver for {FPGA}
in 20 nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {50},
number = {8},
pages = {1932--1944},
year = {2015},
url = {https://doi.org/10.1109/JSSC.2015.2413849},
doi = {10.1109/JSSC.2015.2413849},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/FransCEAFTJBIUW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/TsengKCCTH15,
author = {Ming{-}Tsung Tseng and
Yazhuo Kong and
Ming{-}Chang Chiang and
Chi{-}Chao Chao and
Wen{-}Yih Isaac Tseng and
Sung{-}Tsang Hsieh},
title = {Brain imaging signatures of the relationship between epidermal nerve
fibers and heat pain perception},
journal = {NeuroImage},
volume = {122},
pages = {288--297},
year = {2015},
url = {https://doi.org/10.1016/j.neuroimage.2015.08.021},
doi = {10.1016/J.NEUROIMAGE.2015.08.021},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/TsengKCCTH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/HsiehCLCCC15,
author = {Meng{-}Chang Hsieh and
Yi{-}Hsin Chiu and
Sheng{-}Fu Lin and
Jenq{-}Yang Chang and
Chia{-}Ou Chang and
Huihua Kenny Chiang},
title = {Amplification of the Signal Intensity of Fluorescence-Based Fiber-Optic
Biosensors Using a Fabry-Perot Resonator Structure},
journal = {Sensors},
volume = {15},
number = {2},
pages = {3565--3574},
year = {2015},
url = {https://doi.org/10.3390/s150203565},
doi = {10.3390/S150203565},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/HsiehCLCCC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/SuJHYLLT15,
author = {Mu{-}Chun Su and
Jhih{-}Jie Jhang and
Yi{-}Zeng Hsieh and
Shih{-}Ching Yeh and
Shih{-}Chieh Lin and
Shu{-}Fang Lee and
Kai{-}Ping Tseng},
title = {Depth-Sensor-Based Monitoring of Therapeutic Exercises},
journal = {Sensors},
volume = {15},
number = {10},
pages = {25628--25647},
year = {2015},
url = {https://doi.org/10.3390/s151025628},
doi = {10.3390/S151025628},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/SuJHYLLT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/talip/HsiehBHC15,
author = {Yu{-}Ming Hsieh and
Ming{-}Hong Bai and
Shu{-}Ling Huang and
Keh{-}Jiann Chen},
title = {Correcting Chinese Spelling Errors with Word Lattice Decoding},
journal = {{ACM} Trans. Asian Low Resour. Lang. Inf. Process.},
volume = {14},
number = {4},
pages = {18:1--18:23},
year = {2015},
url = {https://doi.org/10.1145/2791389},
doi = {10.1145/2791389},
timestamp = {Fri, 06 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/talip/HsiehBHC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/LeeHHLCL15,
author = {Shuenn{-}Yuh Lee and
Jia{-}Hua Hong and
Cheng{-}Han Hsieh and
Ming{-}Chun Liang and
Shih{-}Yu Chang Chien and
Kuang{-}Hao Lin},
title = {Low-Power Wireless {ECG} Acquisition and Classification System for
Body Sensor Networks},
journal = {{IEEE} J. Biomed. Health Informatics},
volume = {19},
number = {1},
pages = {236--246},
year = {2015},
url = {https://doi.org/10.1109/JBHI.2014.2310354},
doi = {10.1109/JBHI.2014.2310354},
timestamp = {Fri, 13 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/titb/LeeHHLCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/WangHHLCLVMJGCZ15,
author = {Ching{-}Wei Wang and
Cheng{-}Ta Huang and
Meng{-}Che Hsieh and
Chung{-}Hsing Li and
Sheng{-}Wei Chang and
Wei{-}Cheng Li and
Remy Vandaele and
Rapha{\"{e}}l Mar{\'{e}}e and
S{\'{e}}bastien Jodogne and
Pierre Geurts and
Cheng Chen and
Guoyan Zheng and
Chengwen Chu and
Hengameh Mirzaalian and
Ghassan Hamarneh and
Tomaz Vrtovec and
Bulat Ibragimov},
title = {Evaluation and Comparison of Anatomical Landmark Detection Methods
for Cephalometric X-Ray Images: {A} Grand Challenge},
journal = {{IEEE} Trans. Medical Imaging},
volume = {34},
number = {9},
pages = {1890--1900},
year = {2015},
url = {https://doi.org/10.1109/TMI.2015.2412951},
doi = {10.1109/TMI.2015.2412951},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmi/WangHHLCLVMJGCZ15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/SaySAHPE15,
author = {Phillip R. Say and
Daniel M. Stein and
Jessica S. Ancker and
Cheng{-}Kang Hsieh and
John P. Pollak and
Deborah Estrin},
title = {Smartphone Data in Rheumatoid Arthritis - What Do Rheumatologists
Want?},
booktitle = {{AMIA} 2015, American Medical Informatics Association Annual Symposium,
San Francisco, CA, USA, November 14-18, 2015},
publisher = {{AMIA}},
year = {2015},
url = {https://knowledge.amia.org/59310-amia-1.2741865/t004-1.2745466/f004-1.2745467/2248320-1.2745552/2248398-1.2745549},
timestamp = {Wed, 17 Apr 2024 11:47:40 +0200},
biburl = {https://dblp.org/rec/conf/amia/SaySAHPE15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bionetics/SaribudakDHU15,
author = {Aydin Saribudak and
Yiyu Dong and
James Hsieh and
M. {\"{U}}mit Uyar},
editor = {Junichi Suzuki and
Tadashi Nakano and
Henry Hess},
title = {Bio-inspired Computation Approach for Tumor Growth with Spatial Randomness
Analysis of Kidney Cancer Xenograft Pathology Slides},
booktitle = {{BICT} 2015, Proceedings of the 9th {EAI} International Conference
on Bio-inspired Information and Communications Technologies (formerly
BIONETICS), New York City, United States, December 3-5, 2015},
pages = {453--460},
publisher = {{ICST/ACM}},
year = {2015},
url = {http://dl.acm.org/citation.cfm?id=2954797},
timestamp = {Sat, 04 Feb 2017 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bionetics/SaribudakDHU15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/case/DiganiHSS15,
author = {Valerio Digani and
M. Ani Hsieh and
Lorenzo Sabattini and
Cristian Secchi},
title = {A Quadratic Programming approach for coordinating multi-AGV systems},
booktitle = {{IEEE} International Conference on Automation Science and Engineering,
{CASE} 2015, Gothenburg, Sweden, August 24-28, 2015},
pages = {600--605},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/CoASE.2015.7294144},
doi = {10.1109/COASE.2015.7294144},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/case/DiganiHSS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/HuangSHH15,
author = {Shih{-}Wen Huang and
Minhyang (Mia) Suh and
Benjamin Mako Hill and
Gary Hsieh},
editor = {Bo Begole and
Jinwoo Kim and
Kori Inkpen and
Woontack Woo},
title = {How Activists Are Both Born and Made: An Analysis of Users on Change.org},
booktitle = {Proceedings of the 33rd Annual {ACM} Conference on Human Factors in
Computing Systems, {CHI} 2015, Seoul, Republic of Korea, April 18-23,
2015},
pages = {211--220},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2702123.2702559},
doi = {10.1145/2702123.2702559},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/HuangSHH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/HsiehDLKTYHWH15,
author = {Henry Hsieh and
Sang H. Dhong and
Cheng{-}Chung Lin and
Ming{-}Zhang Kuo and
Kuo{-}Feng Tseng and
Ping{-}Lin Yang and
Kevin Huang and
Min{-}Jer Wang and
Wei Hwang},
title = {Custom 6-R, 2- or 4-W multi-port register files in an {ASIC} {SOC}
with a {DVFS} window of 0.5 V, 130 MHz to 0.96 V, 3.2 GHz in a 28-nm
{HKMG} {CMOS} technology},
booktitle = {2015 {IEEE} Custom Integrated Circuits Conference, {CICC} 2015, San
Jose, CA, USA, September 28-30, 2015},
pages = {1--3},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/CICC.2015.7338445},
doi = {10.1109/CICC.2015.7338445},
timestamp = {Wed, 13 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cicc/HsiehDLKTYHWH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clsw/ChenH15,
author = {Minhsin Chen and
Shu{-}Kai Hsieh},
editor = {Qin Lu and
Helena Hong Gao},
title = {Degree Modification in Mandarin: {A} Case Study of Creative Degree
Modifier {\unicode{21508}}{\unicode{31278}} [Gezhong]},
booktitle = {Chinese Lexical Semantics - 16th Workshop, {CLSW} 2015, Beijing, China,
May 9-11, 2015, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {9332},
pages = {255--261},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-27194-1\_26},
doi = {10.1007/978-3-319-27194-1\_26},
timestamp = {Sun, 21 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/clsw/ChenH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cscw/DalyEFHLLMQSV15,
author = {Elizabeth M. Daly and
Sheena Lewis Erete and
Rosta Farzan and
Gary Hsieh and
Cliff Lampe and
Claudia A. L{\'{o}}pez and
Andr{\'{e}}s Monroy{-}Hern{\'{a}}ndez and
Daniele Quercia and
Raz Schwartz and
Amy Voida},
editor = {Dan Cosley and
Andrea Forte and
Luigina Ciolfi and
David McDonald},
title = {Supporting Cities, Neighborhoods, and Local Communities with Information
and Communication Technologies},
booktitle = {18th {ACM} Conference on Computer Supported Cooperative Work {\&}
Social Computing, {CSCW} 2015, Vancouver, BC, Canada, March 14-18,
2015, Companion Volume},
pages = {277--281},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2685553.2685556},
doi = {10.1145/2685553.2685556},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cscw/DalyEFHLLMQSV15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/HsiehS15,
author = {Han{-}Lin Hsieh and
Maryam Modir Shanechi},
title = {Optimal calibration of the learning rate in closed-loop adaptive brain-machine
interfaces},
booktitle = {37th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2015, Milan, Italy, August 25-29,
2015},
pages = {1667--1670},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/EMBC.2015.7318696},
doi = {10.1109/EMBC.2015.7318696},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/embc/HsiehS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/SaribudakDGHU15,
author = {Aydin Saribudak and
Yiyu Dong and
Stephen Gundry and
James Hsieh and
M. {\"{U}}mit Uyar},
title = {Mathematical models of tumor growth using Voronoi tessellations in
pathology slides of kidney cancer},
booktitle = {37th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2015, Milan, Italy, August 25-29,
2015},
pages = {4454--4457},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/EMBC.2015.7319383},
doi = {10.1109/EMBC.2015.7319383},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/embc/SaribudakDGHU15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/ZengCLSHC15,
author = {Yi{-}Chong Zeng and
Ya{-}Hui Chan and
Ting{-}Yu Lin and
Meng{-}Jung Shih and
Pei{-}Yu Hsieh and
Guan{-}Lin Chao},
editor = {Sakae Yamamoto},
title = {Scene Feature Recognition-Enabled Framework for Mobile Service Information
Query System},
booktitle = {Human Interface and the Management of Information. Information and
Knowledge in Context - 17th International Conference, {HCI} International
2015, Los Angeles, CA, USA, August 2-7, 2015, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {9173},
pages = {64--74},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-20618-9\_7},
doi = {10.1007/978-3-319-20618-9\_7},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/hci/ZengCLSHC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/ChenYLHSW15,
author = {Yan Chen and
Yuan En Yu and
Yu Cheng Lin and
Chih Hung Hsieh and
Muh{-}Tian Shiue and
Chih{-}Feng Wu},
title = {Design of digital baseband inner receiver for {PLC} system based on
{IEEE} {P1901} specification},
booktitle = {{IEEE} International Conference on Consumer Electronics - Taiwan,
{ICCE-TW} 2015, Taipei, Taiwan, June 6-8, 2015},
pages = {210--211},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICCE-TW.2015.7216860},
doi = {10.1109/ICCE-TW.2015.7216860},
timestamp = {Fri, 26 Nov 2021 09:37:33 +0100},
biburl = {https://dblp.org/rec/conf/icce-tw/ChenYLHSW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/HsiaoGCHWS15,
author = {Chien{-}Yao Hsiao and
Shu{-}Na Guo and
Chien{-}Hung Chiu and
Tung{-}Yeh Hsieh and
Chih{-}Feng Wu and
Muh{-}Tian Shiue},
title = {Design and implementation of the {OFDM} receiver for visible-light
communication},
booktitle = {{IEEE} International Conference on Consumer Electronics - Taiwan,
{ICCE-TW} 2015, Taipei, Taiwan, June 6-8, 2015},
pages = {208--209},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICCE-TW.2015.7216858},
doi = {10.1109/ICCE-TW.2015.7216858},
timestamp = {Fri, 26 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icce-tw/HsiaoGCHWS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/HsiehWSLYC15,
author = {Yi{-}Zeng Hsieh and
Chen{-}Hsu Wang and
Mu{-}Chun Su and
Ching{-}Hu Lu and
Jen{-}Chih Yu and
Yi Min Chiang},
title = {Prediction of postoperative recovery based on a computational rules
extractor},
booktitle = {{IEEE} International Conference on Consumer Electronics - Taiwan,
{ICCE-TW} 2015, Taipei, Taiwan, June 6-8, 2015},
pages = {332--333},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICCE-TW.2015.7216928},
doi = {10.1109/ICCE-TW.2015.7216928},
timestamp = {Fri, 26 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icce-tw/HsiehWSLYC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccst/HsiehSSSYH15,
author = {Yi{-}Zeng Hsieh and
Mu{-}Chun Su and
Addison Y. S. Su and
Wu{-}Rong Shih and
Jen{-}Chih Yu and
Chien{-}Yeh Huang},
title = {The computational rules extractor in the detection of tax evasion},
booktitle = {International Carnahan Conference on Security Technology, {ICCST}
2015, Taipei, Taiwan, September 21-24, 2015},
pages = {181--184},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/CCST.2015.7389679},
doi = {10.1109/CCST.2015.7389679},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iccst/HsiehSSSYH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdsp/YangHHCC15,
author = {Hsin{-}Ping Yang and
Meng{-}Hsuan Ho and
Hsiao{-}Chi Hsieh and
Po{-}Hsun Cheng and
Sao{-}Jie Chen},
title = {Hardware implementation of a real-time distributed video decoder},
booktitle = {2015 {IEEE} International Conference on Digital Signal Processing,
{DSP} 2015, Singapore, July 21-24, 2015},
pages = {659--664},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICDSP.2015.7251957},
doi = {10.1109/ICDSP.2015.7251957},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/icdsp/YangHHCC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/KularatneSH15,
author = {Dhanushka Kularatne and
Ryan N. Smith and
M. Ani Hsieh},
title = {Zig-zag wanderer: Towards adaptive tracking of time-varying coherent
structures in the ocean},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2015, Seattle, WA, USA, 26-30 May, 2015},
pages = {3253--3258},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ICRA.2015.7139647},
doi = {10.1109/ICRA.2015.7139647},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/icra/KularatneSH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/HsiaoSHTLL15,
author = {Shan{-}Wen Hsiao and
Hung{-}Ching Sun and
Ming{-}Chuan Hsieh and
Ming{-}Hsueh Tsai and
Hsin{-}Chih Lin and
Chi{-}Chun Lee},
title = {A multimodal approach for automatic assessment of school principals'
oral presentation during pre-service training program},
booktitle = {16th Annual Conference of the International Speech Communication Association,
{INTERSPEECH} 2015, Dresden, Germany, September 6-10, 2015},
pages = {2529--2533},
publisher = {{ISCA}},
year = {2015},
url = {https://doi.org/10.21437/Interspeech.2015-545},
doi = {10.21437/INTERSPEECH.2015-545},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/HsiaoSHTLL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/irps/ChenLHCTPCL15,
author = {L. D. Chen and
B. L. Lin and
M.{-}H. Hsieh and
C. W. Chang and
J. S. Tsai and
J. C. Peng and
C. C. Chiu and
Y.{-}H. Lee},
title = {Study of a new electromigration failure mechanism by novel test structure},
booktitle = {{IEEE} International Reliability Physics Symposium, {IRPS} 2015, Monterey,
CA, USA, April 19-23, 2015},
pages = {2},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/IRPS.2015.7112684},
doi = {10.1109/IRPS.2015.7112684},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/irps/ChenLHCTPCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/irps/HuangHYWMLCK15,
author = {Y.{-}C. Huang and
M.{-}H. Hsieh and
T.{-}Y. Yew and
W. Wang and
D. Maji and
Y.{-}H. Lee and
W.{-}S. Chou and
P.{-}Z. Kang},
title = {Delay effects and frequency dependence of {NBTI} with sub-microsecond
measurements},
booktitle = {{IEEE} International Reliability Physics Symposium, {IRPS} 2015, Monterey,
CA, USA, April 19-23, 2015},
pages = {4},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/IRPS.2015.7112724},
doi = {10.1109/IRPS.2015.7112724},
timestamp = {Sun, 21 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/irps/HuangHYWMLCK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/ChienHWLHC15,
author = {Ai Chien and
Shuo{-}Hong Hung and
Kuan{-}I Wu and
Chang{-}Yi Liu and
Min{-}Han Hsieh and
Charlie Chung{-}Ping Chen},
title = {A 8.1/5.4/2.7/1.62 Gb/s receiver for DisplayPort Version 1.3 with
automatic bit-rate tracking scheme},
booktitle = {2015 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
2015, Lisbon, Portugal, May 24-27, 2015},
pages = {2393--2396},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ISCAS.2015.7169166},
doi = {10.1109/ISCAS.2015.7169166},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/ChienHWLHC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/HungKWHHC15,
author = {Shuo{-}Hong Hung and
Wei{-}Hao Kao and
Kuan{-}I Wu and
Yi{-}Wei Huang and
Min{-}Han Hsieh and
Charlie Chung{-}Ping Chen},
title = {A 160MHz-to-2GHz low jitter fast lock all-digital {DLL} with phase
tracking technique},
booktitle = {2015 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
2015, Lisbon, Portugal, May 24-27, 2015},
pages = {553--556},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ISCAS.2015.7168693},
doi = {10.1109/ISCAS.2015.7168693},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/HungKWHHC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isit/HsiehW15,
author = {Min{-}Hsiu Hsieh and
Shun Watanabe},
title = {Source compression with a quantum helper},
booktitle = {{IEEE} International Symposium on Information Theory, {ISIT} 2015,
Hong Kong, China, June 14-19, 2015},
pages = {2762--2766},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ISIT.2015.7282959},
doi = {10.1109/ISIT.2015.7282959},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isit/HsiehW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isrr/HsiehHKHFSY15,
author = {M. Ani Hsieh and
Hadi Hajieghrary and
Dhanushka Kularatne and
Christoffer R. Heckman and
Eric Forgoston and
Ira B. Schwartz and
Philip A. Yecko},
editor = {Antonio Bicchi and
Wolfram Burgard},
title = {Small and Adrift with Self-Control: Using the Environment to Improve
Autonomy},
booktitle = {Robotics Research, Proceedings of the 17th International Symposium
of Robotics Research, {ISRR} 2015, Sestri Levante, Italy, September
12-15, 2015, Volume 2},
series = {Springer Proceedings in Advanced Robotics},
volume = {3},
pages = {387--402},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-60916-4\_22},
doi = {10.1007/978-3-319-60916-4\_22},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isrr/HsiehHKHFSY15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/BrandoliniSRWWG15,
author = {Massimo Brandolini and
Young Shin and
Karthik Raviprakash and
Tao Wang and
Rong Wu and
Hemasundar Mohan Geddada and
Yen{-}Jen Ko and
Yen Ding and
Chun{-}Sheng Huang and
Wei{-}Ta Shih and
Ming{-}Hung Hsieh and
Wei{-}Te Chou and
Tianwei Li and
Ayaskant Shrivastava and
Yi{-}Chun Chen and
Juo{-}Jung Hung and
Giuseppe Cusmai and
Jiangfeng Wu and
Mo M. Zhang and
Greg Unruh and
Ardie G. Venes and
Hung Sen Huang and
Chun{-}Ying Chen},
title = {26.6 {A} 5GS/S 150mW 10b SHA-less pipelined/SAR hybrid {ADC} in 28nm
{CMOS}},
booktitle = {2015 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2015, Digest of Technical Papers, San Francisco, CA, USA, February
22-26, 2015},
pages = {1--3},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ISSCC.2015.7063129},
doi = {10.1109/ISSCC.2015.7063129},
timestamp = {Tue, 05 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/BrandoliniSRWWG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itw/HsiehW15,
author = {Min{-}Hsiu Hsieh and
Shun Watanabe},
title = {Fully quantum source compression with a quantum helper},
booktitle = {2015 {IEEE} Information Theory Workshop - Fall (ITW), Jeju Island,
South Korea, October 11-15, 2015},
pages = {307--311},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ITWF.2015.7360785},
doi = {10.1109/ITWF.2015.7360785},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/itw/HsiehW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/ChangYHLHLKHHS15,
author = {Chun{-}Ming Chang and
Chih{-}Sheng Yu and
Fan{-}Chun Hsieh and
Chun{-}Ting Lin and
Tsung{-}Tao Huang and
Ping{-}Hung Lin and
Jiann{-}Shiun Kao and
Chien{-}Nan Hsiao and
Ming{-}Hua Shiao},
title = {A parametric study of {ICP-RIE} etching on a lithium niobate substrate},
booktitle = {10th {IEEE} International Conference on Nano/Micro Engineered and
Molecular Systems, {NEMS} 2015, Xi'an, China, April 7-11, 2015},
pages = {485--486},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/NEMS.2015.7147473},
doi = {10.1109/NEMS.2015.7147473},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/nems/ChangYHLHLKHHS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/JaoHHLKCC15,
author = {Meng{-}Hsiu Jao and
Ming{-}Hsuan Hsieh and
Kuan{-}Hsien He and
Dai{-}Hua Liu and
Shu{-}Yu Kuo and
Ting{-}Hui Chu and
Yao{-}Hsin Chou},
title = {A Wormhole Attacks Detection Using a {QTS} Algorithm with {MA} in
{WSN}},
booktitle = {2015 {IEEE} International Conference on Systems, Man, and Cybernetics,
Kowloon Tong, Hong Kong, October 9-12, 2015},
pages = {20--25},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/SMC.2015.17},
doi = {10.1109/SMC.2015.17},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/smc/JaoHHLKCC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/taai/HsiehSL15,
author = {Tsung{-}Hao Hsieh and
Ming{-}Jian Sun and
Sheng{-}Fu Liang},
title = {Musical perception scaling of AEPs from musicians, schizophrenia and
normal people},
booktitle = {Conference on Technologies and Applications of Artificial Intelligence,
{TAAI} 2015, Tainan, Taiwan, November 20-22, 2015},
pages = {358--362},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/TAAI.2015.7407066},
doi = {10.1109/TAAI.2015.7407066},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/taai/HsiehSL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/WuCCWSPHCHTPYUW15,
author = {Jiangfeng Wu and
Giuseppe Cusmai and
Acer Wei{-}Te Chou and
Tao Wang and
Bo Shen and
Vijayaramalingam Periasamy and
Ming{-}Hung Hsieh and
Chun{-}Ying Chen and
Lin He and
Loke Tan and
Aravind Padyana and
Cheng{-}Hsun Yang and
Gregory Unruh and
Jackie Koon Lun Wong and
Juo{-}Jung Hung and
Massimo Brandolini and
Sha{-}Ting Lin and
Xi Chen and
Yen Ding and
Yen{-}Jen Ko and
Young Shin and
Ada Hing T. Hung and
Binning Chen and
Cynthia Dang and
Deepak Lakshminarasimhan and
Iris Hong Liu and
Jerry Lin and
Kowen Lai and
Larry Wassermann and
Ayaskant Shrivastava and
Chi{-}Ming Hsiao and
Chun{-}Sheng Huang and
Jianlong Chen and
Lakshminarasimhan Krishnan and
Ning{-}Yi Wang and
Pin{-}En Su and
Tianwei Li and
Wei{-}Ta Shih and
Yau{-}Cheng Yang and
Peter Cangiane and
Randall Perlow and
William Ngai and
Hung Sen Huang and
James Y. C. Chang and
Xicheng Jiang and
Ardie G. Venes and
Ramon Gomez},
title = {A 2.7mW/Channel 48-to-1000MHz Direct Sampling Full-Band Cable Receiver},
booktitle = {Symposium on {VLSI} Circuits, {VLSIC} 2015, Kyoto, Japan, June 17-19,
2015},
pages = {214},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/VLSIC.2015.7231263},
doi = {10.1109/VLSIC.2015.7231263},
timestamp = {Tue, 05 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/WuCCWSPHCHTPYUW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/daglib/p/CrossnoSSHMH15,
author = {Patricia J. Crossno and
Timothy M. Shead and
Milosz A. Sielicki and
Warren L. Hunt and
Shawn Martin and
Ming{-}yu Hsieh},
editor = {Coral Calero and
Mario Piattini},
title = {Slycat Ensemble Analysis of Electrical Circuit Simulations},
booktitle = {Green in Software Engineering},
pages = {279--294},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-662-44900-4\_16},
doi = {10.1007/978-3-662-44900-4\_16},
timestamp = {Mon, 16 Sep 2019 14:43:12 +0200},
biburl = {https://dblp.org/rec/books/daglib/p/CrossnoSSHMH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/HsiehW15,
author = {Min{-}Hsiu Hsieh and
Shun Watanabe},
title = {Source Compression with a Quantum Helper},
journal = {CoRR},
volume = {abs/1501.04366},
year = {2015},
url = {http://arxiv.org/abs/1501.04366},
eprinttype = {arXiv},
eprint = {1501.04366},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/HsiehW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/HsiehW15a,
author = {Min{-}Hsiu Hsieh and
Shun Watanabe},
title = {Fully Quantum Source Compression with a Quantum Helper},
journal = {CoRR},
volume = {abs/1504.05227},
year = {2015},
url = {http://arxiv.org/abs/1504.05227},
eprinttype = {arXiv},
eprint = {1504.05227},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/HsiehW15a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/HsiehW15b,
author = {Min{-}Hsiu Hsieh and
Shun Watanabe},
title = {Channel Simulation and Coded Source Compression},
journal = {CoRR},
volume = {abs/1511.06071},
year = {2015},
url = {http://arxiv.org/abs/1511.06071},
eprinttype = {arXiv},
eprint = {1511.06071},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/HsiehW15b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/amc/BackMHM14,
author = {Julian M. Back and
Scott W. McCue and
Mike H.{-}N. Hsieh and
Timothy J. Moroney},
title = {The effect of surface tension and kinetic undercooling on a radially-symmetric
melting problem},
journal = {Appl. Math. Comput.},
volume = {229},
pages = {41--52},
year = {2014},
url = {https://doi.org/10.1016/j.amc.2013.12.003},
doi = {10.1016/J.AMC.2013.12.003},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/amc/BackMHM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biodb/HuangWCLSHTLHLC14,
author = {Kai{-}Yao Huang and
Hsin{-}Yi Wu and
Yi{-}Ju Chen and
Cheng{-}Tsung Lu and
Min{-}Gang Su and
Yun{-}Chung Hsieh and
Chih{-}Ming Tsai and
Kuo{-}I Lin and
Hsien{-}Da Huang and
Tzong{-}Yi Lee and
Yu{-}Ju Chen},
title = {RegPhos 2.0: an updated resource to explore protein kinase-substrate
phosphorylation networks in mammals},
journal = {Database J. Biol. Databases Curation},
volume = {2014},
year = {2014},
url = {https://doi.org/10.1093/database/bau034},
doi = {10.1093/DATABASE/BAU034},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/biodb/HuangWCLSHTLHLC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/HsiehSWW14,
author = {Yi{-}Zeng Hsieh and
Mu{-}Chun Su and
Chen{-}Hsu Wang and
Pa{-}Chun Wang},
title = {Prediction of survival of {ICU} patients using computational intelligence},
journal = {Comput. Biol. Medicine},
volume = {47},
pages = {13--19},
year = {2014},
url = {https://doi.org/10.1016/j.compbiomed.2013.12.012},
doi = {10.1016/J.COMPBIOMED.2013.12.012},
timestamp = {Wed, 02 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cbm/HsiehSWW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/ChenWH14a,
author = {Hua{-}Pin Chen and
San{-}Fu Wang and
Ming{-}Yuan Hsieh},
title = {Tunable current-mode and voltage-mode quadrature oscillator using
a {DVCCTA}},
journal = {{IEICE} Electron. Express},
volume = {11},
number = {13},
pages = {20140478},
year = {2014},
url = {https://doi.org/10.1587/elex.11.20140478},
doi = {10.1587/ELEX.11.20140478},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieiceee/ChenWH14a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieiceee/ChenWHH14,
author = {Hua{-}Pin Chen and
San{-}Fu Wang and
Wei{-}Yen Huang and
Ming{-}Yuan Hsieh},
title = {Voltage-mode universal biquadratic filter with one input and five
outputs using two DDCCTAs},
journal = {{IEICE} Electron. Express},
volume = {11},
number = {9},
pages = {20140234},
year = {2014},
url = {https://doi.org/10.1587/elex.11.20140234},
doi = {10.1587/ELEX.11.20140234},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieiceee/ChenWHH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdsn/ChenCH14,
author = {Mu{-}Yen Chen and
Da{-}Ren Chen and
Shu{-}Ming Hsieh},
title = {A Blocking-Aware Scheduling for Real-Time Task Synchronization Using
a Leakage-Controlled Method},
journal = {Int. J. Distributed Sens. Networks},
volume = {10},
year = {2014},
url = {https://doi.org/10.1155/2014/428230},
doi = {10.1155/2014/428230},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijdsn/ChenCH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/DoanLCOHFGRJFWAZXK14,
author = {Son Doan and
Ko{-}Wei Lin and
Mike Conway and
Lucila Ohno{-}Machado and
Alexander Hsieh and
Stephanie Feudjio Feupe and
Asher Garland and
Mindy K. Ross and
Xiaoqian Jiang and
Seena Farzaneh and
Rebecca Walker and
Neda Alipanah and
Jing Zhang and
Hua Xu and
Hyeoneui Kim},
title = {PhenDisco: phenotype discovery system for the database of genotypes
and phenotypes},
journal = {J. Am. Medical Informatics Assoc.},
volume = {21},
number = {1},
pages = {31--36},
year = {2014},
url = {https://doi.org/10.1136/amiajnl-2013-001882},
doi = {10.1136/AMIAJNL-2013-001882},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/DoanLCOHFGRJFWAZXK14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/HsiehSW14,
author = {Yi{-}Zeng Hsieh and
Mu{-}Chun Su and
Pa{-}Chun Wang},
title = {A PSO-based rule extractor for medical diagnosis},
journal = {J. Biomed. Informatics},
volume = {49},
pages = {53--60},
year = {2014},
url = {https://doi.org/10.1016/j.jbi.2014.05.001},
doi = {10.1016/J.JBI.2014.05.001},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/HsiehSW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcb/HsiehS14,
author = {Mu{-}Fen Hsieh and
Sing{-}Hoi Sze},
title = {Finding Alignments of Conserved Graphlets in Protein Interaction Networks},
journal = {J. Comput. Biol.},
volume = {21},
number = {3},
pages = {234--246},
year = {2014},
url = {https://doi.org/10.1089/cmb.2013.0130},
doi = {10.1089/CMB.2013.0130},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcb/HsiehS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jise/ChouHS14,
author = {Chien{-}Hsing Chou and
Yi{-}Zeng Hsieh and
Mu{-}Chun Su},
title = {A New Measure of Cluster Validity Using Line Symmetry},
journal = {J. Inf. Sci. Eng.},
volume = {30},
number = {2},
pages = {443--461},
year = {2014},
url = {http://www.iis.sinica.edu.tw/page/jise/2014/201403\_10.html},
timestamp = {Fri, 16 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jise/ChouHS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmlr/HsiehSDR14,
author = {Cho{-}Jui Hsieh and
M{\'{a}}ty{\'{a}}s A. Sustik and
Inderjit S. Dhillon and
Pradeep Ravikumar},
title = {{QUIC:} quadratic approximation for sparse inverse covariance estimation},
journal = {J. Mach. Learn. Res.},
volume = {15},
number = {1},
pages = {2911--2947},
year = {2014},
url = {https://dl.acm.org/doi/10.5555/2627435.2697058},
doi = {10.5555/2627435.2697058},
timestamp = {Thu, 02 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmlr/HsiehSDR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HuangSMH14,
author = {Yu{-}Feng Huang and
Chun Siong Soon and
O'Dhaniel A. Mullette{-}Gillman and
Po{-}Jang Hsieh},
title = {Pre-existing brain states predict risky choices},
journal = {NeuroImage},
volume = {101},
pages = {466--472},
year = {2014},
url = {https://doi.org/10.1016/j.neuroimage.2014.07.036},
doi = {10.1016/J.NEUROIMAGE.2014.07.036},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/HuangSMH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/LinHSW14,
author = {Yi{-}Hsun Lin and
Mei{-}Yu Hsieh and
Fong{-}Chin Su and
Shyh{-}Hau Wang},
title = {Assessment of the Kinetic Trajectory of the Median Nerve in the Wrist
by High-Frequency Ultrasound},
journal = {Sensors},
volume = {14},
number = {5},
pages = {7738--7752},
year = {2014},
url = {https://doi.org/10.3390/s140507738},
doi = {10.3390/S140507738},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/LinHSW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sj/EftekhariMSH14,
author = {Maryam Eftekhari and
Mehdi Moallem and
Saeed Sadri and
Min{-}Fu Hsieh},
title = {Online Detection of Induction Motor's Stator Winding Short-Circuit
Faults},
journal = {{IEEE} Syst. J.},
volume = {8},
number = {4},
pages = {1272--1282},
year = {2014},
url = {https://doi.org/10.1109/JSYST.2013.2288172},
doi = {10.1109/JSYST.2013.2288172},
timestamp = {Fri, 11 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sj/EftekhariMSH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tal/GaumeDNDCHMP14,
author = {Bruno Gaume and
Karine Duvignau and
Emmanuel Navarro and
Yann Desalle and
Hintat Cheung and
Shu{-}Kai Hsieh and
Pierre Magistry and
Laurent Pr{\'{e}}vot},
title = {Skillex : a graph-based lexical score for measuring the semantic efficiency
of used verbs by human subjects describing actions},
journal = {Trait. Autom. des Langues},
volume = {55},
number = {3},
year = {2014},
url = {http://atala.org/Skillex-a-graph-based-lexical},
timestamp = {Thu, 30 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tal/GaumeDNDCHMP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/ChiuWCCWCTCSKWCHCLCYCST14,
author = {Shih{-}Wen Chiu and
Jen{-}Huo Wang and
Kwuang{-}Han Chang and
Ting{-}Hau Chang and
Chia{-}Min Wang and
Chia{-}Lin Chang and
Chen{-}Ting Tang and
Chien{-}Fu Chen and
Chung{-}Hung Shih and
Han{-}Wen Kuo and
Li{-}Chun Wang and
Hsin Chen and
Chih{-}Cheng Hsieh and
Meng{-}Fan Chang and
Yi{-}Wen Liu and
Tsan{-}Jieh Chen and
Chia{-}Hsiang Yang and
Herming Chiueh and
Jyuo{-}Min Shyu and
Kea{-}Tiong Tang},
title = {A Fully Integrated Nose-on-a-Chip for Rapid Diagnosis of Ventilator-Associated
Pneumonia},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {8},
number = {6},
pages = {765--778},
year = {2014},
url = {https://doi.org/10.1109/TBCAS.2014.2377754},
doi = {10.1109/TBCAS.2014.2377754},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbcas/ChiuWCCWCTCSKWCHCLCYCST14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/trob/MichiniHFS14,
author = {Matthew Michini and
M. Ani Hsieh and
Eric Forgoston and
Ira B. Schwartz},
title = {Robotic Tracking of Coherent Structures in Flows},
journal = {{IEEE} Trans. Robotics},
volume = {30},
number = {3},
pages = {593--603},
year = {2014},
url = {https://doi.org/10.1109/TRO.2013.2295655},
doi = {10.1109/TRO.2013.2295655},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/trob/MichiniHFS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/XiongMHC14,
author = {Caiming Xiong and
Scott McCloskey and
Shao{-}Hang Hsieh and
Jason J. Corso},
editor = {Carla E. Brodley and
Peter Stone},
title = {Latent Domains Modeling for Visual Domain Adaptation},
booktitle = {Proceedings of the Twenty-Eighth {AAAI} Conference on Artificial Intelligence,
July 27 -31, 2014, Qu{\'{e}}bec City, Qu{\'{e}}bec, Canada},
pages = {2860--2866},
publisher = {{AAAI} Press},
year = {2014},
url = {https://doi.org/10.1609/aaai.v28i1.9136},
doi = {10.1609/AAAI.V28I1.9136},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/XiongMHC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/HsiehMFS14,
author = {M. Ani Hsieh and
Kenneth Mallory and
Eric Forgoston and
Ira B. Schwartz},
title = {Distributed allocation of mobile sensing agents in geophysical flows},
booktitle = {American Control Conference, {ACC} 2014, Portland, OR, USA, June 4-6,
2014},
pages = {165--171},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ACC.2014.6859084},
doi = {10.1109/ACC.2014.6859084},
timestamp = {Sun, 08 Aug 2021 01:40:57 +0200},
biburl = {https://dblp.org/rec/conf/amcc/HsiehMFS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/MichiniRHJ14,
author = {Matthew Michini and
Hossein Rastgoftar and
M. Ani Hsieh and
Suhada Jayasuriya},
title = {Distributed formation control for collaborative tracking of manifolds
in flows},
booktitle = {American Control Conference, {ACC} 2014, Portland, OR, USA, June 4-6,
2014},
pages = {3874--3880},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ACC.2014.6859204},
doi = {10.1109/ACC.2014.6859204},
timestamp = {Tue, 23 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amcc/MichiniRHJ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biocas/HsiehLCCLL14,
author = {Cheng{-}Han Hsieh and
Ming{-}Chun Liang and
Shih{-}Yu Chang Chien and
Yuan{-}Sun Chu and
Hsing{-}Chen Lin and
Shuenn{-}Yuh Lee},
title = {Wearable electrocardiogram acquisition and classification systems
with different distributive operations},
booktitle = {{IEEE} Biomedical Circuits and Systems Conference, BioCAS 2014, Proceedings,
Lausanne, Switzerland, October 22-24, 2014},
pages = {145--148},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/BioCAS.2014.6981666},
doi = {10.1109/BIOCAS.2014.6981666},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/biocas/HsiehLCCLL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccnc/HerediaKNHM14,
author = {Edwin A. Heredia and
Shailendra Kumar and
Jun Nishimura and
George Hsieh and
Alan Messer},
title = {Contextual proactivity for media sharing scenarios in proximity networks},
booktitle = {11th {IEEE} Consumer Communications and Networking Conference, {CCNC}
2014, Las Vegas, NV, USA, January 10-13, 2014},
pages = {465--470},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/CCNC.2014.6866611},
doi = {10.1109/CCNC.2014.6866611},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/ccnc/HerediaKNHM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/HsiehMKON14,
author = {Gary Hsieh and
Sean A. Munson and
Maurits Clemens Kaptein and
Harri Oinas{-}Kukkonen and
Oded Nov},
editor = {Matt Jones and
Philippe A. Palanque and
Albrecht Schmidt and
Tovi Grossman},
title = {Personalizing behavior change technologies},
booktitle = {{CHI} Conference on Human Factors in Computing Systems, CHI'14, Toronto,
ON, Canada - April 26 - May 01, 2014, Extended Abstracts},
pages = {107--110},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2559206.2560474},
doi = {10.1145/2559206.2560474},
timestamp = {Fri, 12 Mar 2021 15:27:48 +0100},
biburl = {https://dblp.org/rec/conf/chi/HsiehMKON14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/DicksonLRAKHBFARPBSKTF14,
author = {Timothy O. Dickson and
Yong Liu and
Sergey V. Rylov and
Ankur Agrawal and
Seongwon Kim and
Ping{-}Hsuan Hsieh and
John F. Bulzacchelli and
Mark A. Ferriss and
Herschel A. Ainspan and
Alexander V. Rylyakov and
Benjamin D. Parker and
Christian W. Baks and
Lei Shan and
Young Hoon Kwark and
Jos{\'{e}} A. Tierno and
Daniel J. Friedman},
title = {A 1.4-pJ/b, power-scalable 16{\texttimes}12-Gb/s source-synchronous
{I/O} with {DFE} receiver in 32nm {SOI} {CMOS} technology},
booktitle = {Proceedings of the {IEEE} 2014 Custom Integrated Circuits Conference,
{CICC} 2014, San Jose, CA, USA, September 15-17, 2014},
pages = {1--4},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/CICC.2014.6945983},
doi = {10.1109/CICC.2014.6945983},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cicc/DicksonLRAKHBFARPBSKTF14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/KuoHDYLTHWH14,
author = {Ming{-}Zhang Kuo and
Henry Hsieh and
Sang H. Dhong and
Ping{-}Lin Yang and
Cheng{-}Chung Lin and
Ryan Tseng and
Kevin Huang and
Min{-}Jer Wang and
Wei Hwang},
title = {A 16kB tile-able {SRAM} macro prototype for an operating window of
4.8GHz at 1.12V {VDD} to 10 MHz at 0.5V in a 28-nm {HKMG} {CMOS}},
booktitle = {Proceedings of the {IEEE} 2014 Custom Integrated Circuits Conference,
{CICC} 2014, San Jose, CA, USA, September 15-17, 2014},
pages = {1--4},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/CICC.2014.6946030},
doi = {10.1109/CICC.2014.6946030},
timestamp = {Wed, 13 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cicc/KuoHDYLTHWH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/SavojACEFFHIJTUWC14,
author = {Jafar Savoj and
Hesam Amir Aslanzadeh and
Declan Carey and
Marc Erett and
Wayne Fang and
Yohan Frans and
Kenny C.{-}H. Hsieh and
Jay Im and
Anup P. Jose and
Didem Turker and
Parag Upadhyaya and
Zhaoyin Daniel Wu and
Ken Chang},
title = {Wideband flexible-reach techniques for a 0.5-16.3Gb/s fully-adaptive
transceiver in 20nm {CMOS}},
booktitle = {Proceedings of the {IEEE} 2014 Custom Integrated Circuits Conference,
{CICC} 2014, San Jose, CA, USA, September 15-17, 2014},
pages = {1--4},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/CICC.2014.6945980},
doi = {10.1109/CICC.2014.6945980},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cicc/SavojACEFFHIJTUWC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/codes/HsiehSSWWH14,
author = {Chih{-}Ming Hsieh and
Farzad Samie and
M. Sammer Srouji and
Manyi Wang and
Zhonglei Wang and
J{\"{o}}rg Henkel},
editor = {Radu Marculescu and
Gabriela Nicolescu},
title = {Hardware/software co-design for a wireless sensor network platform},
booktitle = {2014 International Conference on Hardware/Software Codesign and System
Synthesis, {CODES+ISSS} 2014, Uttar Pradesh, India, October 12-17,
2014},
pages = {1:1--1:10},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2656075.2656086},
doi = {10.1145/2656075.2656086},
timestamp = {Sun, 08 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/codes/HsiehSSWWH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cogsci/DesalleGDCHMN14,
author = {Yann Desalle and
Bruno Gaume and
Karine Duvignau and
Hintat Cheung and
Shu{-}Kai Hsieh and
Pierre Magistry and
Jean{-}Luc Nespoulous},
editor = {Paul Bello and
Marcello Guarini and
Marjorie McShane and
Brian Scassellati},
title = {Skillex, an action labelling efficiency score: the case for French
and Mandarin},
booktitle = {Proceedings of the 36th Annual Meeting of the Cognitive Science Society,
CogSci 2014, Quebec City, Canada, July 23-26, 2014},
publisher = {cognitivesciencesociety.org},
year = {2014},
url = {https://escholarship.org/uc/item/7j01b13n},
timestamp = {Tue, 30 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cogsci/DesalleGDCHMN14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/collabtech/SuHDHYH14,
author = {Addison Y. S. Su and
Chester S. J. Huang and
Ting{-}Jou Ding and
Angus F. M. Huang and
Stephen J. H. Yang and
Yi{-}Zeng Hsieh},
editor = {Takaya Yuizono and
Gustavo Zurita and
Nelson Baloian and
Tomoo Inoue and
Hiroaki Ogata},
title = {Collaborative Search Research in College Computer Courses},
booktitle = {Collaboration Technologies and Social Computing - 7th International
Conference, CollabTech 2014, Santiago, Chile, September 8-10, 2014.
Proceedings},
series = {Communications in Computer and Information Science},
volume = {460},
pages = {143--152},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-662-44651-5\_13},
doi = {10.1007/978-3-662-44651-5\_13},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/collabtech/SuHDHYH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/LiaoBHRJJ14,
author = {Fuyuan Liao and
Ian Brooks and
Chang{-}Wei Hsieh and
Ian M. Rice and
Maria M. Jankowska and
Yih{-}Kuen Jan},
title = {Assessing complexity of heart rate variability in people with spinal
cord injury using local scale exponents},
booktitle = {36th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2014, Chicago, IL, USA, August
26-30, 2014},
pages = {6381--6384},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/EMBC.2014.6945088},
doi = {10.1109/EMBC.2014.6945088},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/embc/LiaoBHRJJ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fuzzIEEE/WangHLSL14,
author = {Mei{-}Hui Wang and
Pi{-}Jen Hsieh and
Chang{-}Shing Lee and
David Lupien St{-}Pierre and
Che{-}Hung Liu},
title = {An optimization model for FML-based decision support system on energy
management},
booktitle = {{IEEE} International Conference on Fuzzy Systems, {FUZZ-IEEE} 2014,
Beijing, China, July 6-11, 2014},
pages = {850--856},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/FUZZ-IEEE.2014.6891744},
doi = {10.1109/FUZZ-IEEE.2014.6891744},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/fuzzIEEE/WangHLSL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/huc/WangHHLYKYCC14,
author = {Kuo{-}Cheng Wang and
Ming{-}Chyi Huang and
Yi{-}Hsuan Hsieh and
Seng{-}Yong Lau and
Chi{-}Hsien Yen and
Hsin{-}Liu Cindy Kao and
Chuang{-}Wen You and
Hao{-}Hua Chu and
Yen{-}Chang Chen},
editor = {A. J. Brush and
Adrian Friday and
Julie A. Kientz and
James Scott and
Junehwa Song},
title = {SoberDiary: a phone-based support system for assisting recovery from
alcohol dependence},
booktitle = {Proceedings of the 2014 {ACM} International Joint Conference on Pervasive
and Ubiquitous Computing, UbiComp '14 Adjunct Publication, Seattle,
WA, {USA} - September 13 - 17, 2014},
pages = {311--314},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2638728.2638847},
doi = {10.1145/2638728.2638847},
timestamp = {Tue, 26 Mar 2024 11:01:21 +0100},
biburl = {https://dblp.org/rec/conf/huc/WangHHLYKYCC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-tw/HsiehYS14,
author = {Mi{-}Chia Hsieh and
Yu{-}Hua Yen and
Tsung{-}Ying Sun},
title = {Gesture recognition with two 3-axis accelerometers},
booktitle = {{IEEE} International Conference on Consumer Electronics - Taiwan,
{ICCE-TW} 2014, Taipei, Taiwan, May 26-28, 2014},
pages = {239--240},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ICCE-TW.2014.6904078},
doi = {10.1109/ICCE-TW.2014.6904078},
timestamp = {Thu, 25 Nov 2021 16:44:13 +0100},
biburl = {https://dblp.org/rec/conf/icce-tw/HsiehYS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccel/YangYWHLSH14,
author = {C. M. Yang and
T. L. Yang and
C. C. Wu and
S. H. Hung and
M. H. Liao and
M. J. Su and
H. C. Hsieh},
title = {Textile-based capacitive sensor for a wireless wearable breath monitoring
system},
booktitle = {{IEEE} International Conference on Consumer Electronics, {ICCE} 2014,
Las Vegas, NV, USA, January 10-13, 2014},
pages = {232--233},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ICCE.2014.6775985},
doi = {10.1109/ICCE.2014.6775985},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iccel/YangYWHLSH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/MichiniHFS14,
author = {Matthew Michini and
M. Ani Hsieh and
Eric Forgoston and
Ira B. Schwartz},
title = {Experimental validation of robotic manifold tracking in gyre-like
flows},
booktitle = {2014 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, {IROS} 2014, Chicago, IL, USA, September 14-18, 2014},
pages = {2306--2311},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/IROS.2014.6942874},
doi = {10.1109/IROS.2014.6942874},
timestamp = {Tue, 05 Sep 2023 15:07:47 +0200},
biburl = {https://dblp.org/rec/conf/iros/MichiniHFS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/YaoBHDP14,
author = {Yuan Yao and
Hans Bornefalk and
Scott S. Hsieh and
Mats Danielsson and
Norbert J. Pelc},
title = {Utilization of in-depth photon counting detectors towards x-ray spectral
imaging: The benefits from the depth information},
booktitle = {{IEEE} 11th International Symposium on Biomedical Imaging, {ISBI}
2014, April 29 - May 2, 2014, Beijing, Chin, Beijing, China},
pages = {1156--1159},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISBI.2014.6868080},
doi = {10.1109/ISBI.2014.6868080},
timestamp = {Wed, 04 Oct 2023 17:01:25 +0200},
biburl = {https://dblp.org/rec/conf/isbi/YaoBHDP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/LiangHHCL14,
author = {Ming{-}Chun Liang and
Cheng{-}Han Hsieh and
Jia{-}Hua Hong and
Shih{-}Yu Chang Chien and
Shuenn{-}Yuh Lee},
title = {Live demonstration: {A} wearable wireless {ECG} acquisition and specification
system},
booktitle = {{IEEE} International Symposium on Circuits and Systemss, {ISCAS} 2014,
Melbourne, Victoria, Australia, June 1-5, 2014},
pages = {438},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISCAS.2014.6865161},
doi = {10.1109/ISCAS.2014.6865161},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/LiangHHCL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iser/HeckmanHS14,
author = {Christoffer R. Heckman and
M. Ani Hsieh and
Ira B. Schwartz},
editor = {M. Ani Hsieh and
Oussama Khatib and
Vijay Kumar},
title = {Controlling Basin Breakout for Robots Operating in Uncertain Flow
Environments},
booktitle = {Experimental Robotics - The 14th International Symposium on Experimental
Robotics, {ISER} 2014, June 15-18, 2014, Marrakech and Essaouira,
Morocco},
series = {Springer Tracts in Advanced Robotics},
volume = {109},
pages = {561--576},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-23778-7\_37},
doi = {10.1007/978-3-319-23778-7\_37},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iser/HeckmanHS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ChenHCCLHHLL14,
author = {Shang{-}Ping Chen and
Chih{-}Chien Hung and
Qui{-}Ting Chen and
Sheng{-}Ming Chang and
Ming{-}Shi Liou and
Bo{-}Wei Hsieh and
Hsiang{-}I Huang and
Brian Liu and
Yan{-}Bin Luo},
title = {26.6 {A} 2.667Gb/s {DDR3} memory interface with asymmetric {ODT} on
wirebond package and single-side-mounted {PCB}},
booktitle = {2014 {IEEE} International Conference on Solid-State Circuits Conference,
{ISSCC} 2014, Digest of Technical Papers, San Francisco, CA, USA,
February 9-13, 2014},
pages = {448--449},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISSCC.2014.6757508},
doi = {10.1109/ISSCC.2014.6757508},
timestamp = {Mon, 09 Aug 2021 14:54:04 +0200},
biburl = {https://dblp.org/rec/conf/isscc/ChenHCCLHHLL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/TangCSCYYWHCCHC14,
author = {Kea{-}Tiong Tang and
Shih{-}Wen Chiu and
Chung{-}Hung Shih and
Chia{-}Ling Chang and
Chia{-}Min Yang and
Da{-}Jeng Yao and
Jen{-}Huo Wang and
Chien{-}Ming Huang and
Hsin Chen and
Kwuang{-}Han Chang and
Chih{-}Cheng Hsieh and
Ting{-}Hau Chang and
Meng{-}Fan Chang and
Chia{-}Min Wang and
Yi{-}Wen Liu and
Tsan{-}Jieh Chen and
Chia{-}Hsiang Yang and
Herming Chiueh and
Jyuo{-}Min Shyu},
title = {24.5 {A} 0.5V 1.27mW nose-on-a-chip for rapid diagnosis of ventilator-associated
pneumonia},
booktitle = {2014 {IEEE} International Conference on Solid-State Circuits Conference,
{ISSCC} 2014, Digest of Technical Papers, San Francisco, CA, USA,
February 9-13, 2014},
pages = {420--421},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISSCC.2014.6757496},
doi = {10.1109/ISSCC.2014.6757496},
timestamp = {Mon, 04 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/TangCSCYYWHCCHC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc/AdhamCLHH14,
author = {Saman Adham and
Jonathan Chang and
Hung{-}Jen Liao and
John Hung and
Ting{-}Hua Hsieh},
title = {The importance of DFX, a foundry perspective},
booktitle = {2014 International Test Conference, {ITC} 2014, Seattle, WA, USA,
October 20-23, 2014},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/TEST.2014.7035311},
doi = {10.1109/TEST.2014.7035311},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/itc/AdhamCLHH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ithings/HsiehTYL14,
author = {Chih{-}Hung Hsieh and
Hsin{-}Mu Tsai and
Shao{-}Wen Yang and
Shou{-}De Lin},
title = {Predict Scooter's Stopping Event Using Smartphone as the Sensing Device},
booktitle = {2014 {IEEE} International Conference on Internet of Things, {IEEE}
Green Computing and Communications, and {IEEE} Cyber, Physical and
Social Computing, iThings/GreenCom/CPSCom 2014, Taipei, Taiwan, September
1-3, 2014},
pages = {17--23},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/iThings.2014.12},
doi = {10.1109/ITHINGS.2014.12},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ithings/HsiehTYL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mmm/HsiehHCHH14,
author = {Yung{-}Huan Hsieh and
Shintami Chusnul Hidayati and
Wen{-}Huang Cheng and
Min{-}Chun Hu and
Kai{-}Lung Hua},
editor = {Cathal Gurrin and
Frank Hopfgartner and
Wolfgang H{\"{u}}rst and
H{\aa}vard D. Johansen and
Hyowon Lee and
Noel E. O'Connor},
title = {Who's the Best Charades Player? Mining Iconic Movement of Semantic
Concepts},
booktitle = {MultiMedia Modeling - 20th Anniversary International Conference, {MMM}
2014, Dublin, Ireland, January 6-10, 2014, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {8325},
pages = {231--241},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-04114-8\_20},
doi = {10.1007/978-3-319-04114-8\_20},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mmm/HsiehHCHH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/newcas/ChiuWCWCHCWT14,
author = {Shih{-}Wen Chiu and
Jen{-}Huo Wang and
Kwuang{-}Han Chang and
Hsiang{-}Chiu Wu and
Hsin Chen and
Chih{-}Cheng Hsieh and
Meng{-}Fan Chang and
Guoxing Wang and
Kea{-}Tiong Tang},
title = {A signal acquisition and processing chip with built-in cluster for
chemiresistive gas sensor array},
booktitle = {{IEEE} 12th International New Circuits and Systems Conference, {NEWCAS}
2014, Trois-Rivieres, QC, Canada, June 22-25, 2014},
pages = {428--431},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/NEWCAS.2014.6934074},
doi = {10.1109/NEWCAS.2014.6934074},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/newcas/ChiuWCWCHCWT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rocling/Meng-HsienH14,
author = {Meng{-}Hsien Shih and
Shu{-}Kai Hsieh},
title = {Sketching the Dependency Relations of Words in Chinese},
booktitle = {Proceedings of the 26th Conference on Computational Linguistics and
Speech Processing, {ROCLING} 2016, National Central University, Zhongli,
Taiwan, September 25-26, 2014},
publisher = {Association for Computational Linguistics and Chinese Language Processing
(ACLCLP), Taiwan},
year = {2014},
url = {https://aclanthology.org/O14-1014/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/rocling/Meng-HsienH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/JuLWCWHLLCCCWCH14,
author = {Chi{-}Cheng Ju and
Tsu{-}Ming Liu and
Huaide Wang and
Yung{-}Chang Chang and
Chih{-}Ming Wang and
Chang{-}Lin Hsieh and
Brian Liu and
Hue{-}Min Lin and
Chia{-}Yun Cheng and
Chun{-}Chia Chen and
Min{-}Hao Chiu and
Sheng{-}Jen Wang and
Ping Chao and
Meng{-}Jye Hu and
Ryan Yeh and
Ted Chuang and
Hsiu{-}Yi Lin and
Chung{-}Hung Tsai},
title = {A 4K{\texttimes}2K@60fps multi-standard {TV} SoC processor with integrated
{HDMI/MHL} receiver},
booktitle = {Symposium on {VLSI} Circuits, {VLSIC} 2014, Digest of Technical Papers,
Honolulu, HI, USA, June 10-13, 2014},
pages = {1--2},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/VLSIC.2014.6858389},
doi = {10.1109/VLSIC.2014.6858389},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/JuLWCWHLLCCCWCH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/NagarajHPRSH14,
author = {Shirish Nagaraj and
Frank Hsieh and
Deepak Pengoria and
M. R. Raghavendra and
Mark Schamberger and
Michael L. Honig},
title = {Coordinated beamforming in clustered HetNets: System design and performance
evaluation},
booktitle = {2014 {IEEE} Wireless Communications and Networking Conference Workshops,
{WCNC} Workshops, Istanbul, Turkey, April 6-9, 2014},
pages = {70--75},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/WCNCW.2014.6934863},
doi = {10.1109/WCNCW.2014.6934863},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/wcnc/NagarajHPRSH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wf-iot/ChenTHLWYCLSCLPGCYCH14,
author = {Kuan{-}Wen Chen and
Hsin{-}Mu Tsai and
Chih{-}Hung Hsieh and
Shou{-}De Lin and
Chieh{-}Chih Wang and
Shao{-}Wen Yang and
Shao{-}Yi Chien and
Chia{-}Han Lee and
Yu{-}Chi Su and
Chun{-}Ting Chou and
Yuh{-}Jye Lee and
Hsing{-}Kuo Pao and
Ruey{-}Shan Guo and
Chung{-}Jen Chen and
Ming{-}Hsuan Yang and
Bing{-}Yu Chen and
Yi{-}Ping Hung},
title = {Connected vehicle safety science, system, and framework},
booktitle = {{IEEE} World Forum on Internet of Things, WF-IoT 2014, Seoul, South
Korea, March 6-8, 2014},
pages = {235--240},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/WF-IoT.2014.6803165},
doi = {10.1109/WF-IOT.2014.6803165},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wf-iot/ChenTHLWYCLSCLPGCYCH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/daglib/p/BondFHHPV14,
author = {Francis Bond and
Christiane Fellbaum and
Shu{-}Kai Hsieh and
Chu{-}Ren Huang and
Adam Pease and
Piek Vossen},
editor = {Paul Buitelaar and
Philipp Cimiano},
title = {A Multilingual Lexico-Semantic Database and Ontology},
booktitle = {Towards the Multilingual Semantic Web, Principles, Methods and Applications},
pages = {243--258},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-662-43585-4\_15},
doi = {10.1007/978-3-662-43585-4\_15},
timestamp = {Sat, 30 May 2020 19:44:13 +0200},
biburl = {https://dblp.org/rec/books/daglib/p/BondFHHPV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/dars/2012,
editor = {M. Ani Hsieh and
Gregory S. Chirikjian},
title = {Distributed Autonomous Robotic Systems - The 11th International Symposium,
{DARS} 2012, Johns Hopkins University, Baltimore, MD, USA, November
8-11, 2012},
series = {Springer Tracts in Advanced Robotics},
volume = {104},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-642-55146-8},
doi = {10.1007/978-3-642-55146-8},
isbn = {978-3-642-55145-1},
timestamp = {Tue, 23 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dars/2012.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eaai/HsiehCSR13,
author = {Mu{-}Hsien Hsieh and
Fan{-}Chieh Cheng and
Mon{-}Chau Shie and
Shanq{-}Jang Ruan},
title = {Fast and efficient median filter for removing 1-99{\%} levels of salt-and-pepper
noise in images},
journal = {Eng. Appl. Artif. Intell.},
volume = {26},
number = {4},
pages = {1333--1338},
year = {2013},
url = {https://doi.org/10.1016/j.engappai.2012.10.012},
doi = {10.1016/J.ENGAPPAI.2012.10.012},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/eaai/HsiehCSR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ets/HsiehLS13,
author = {Tung{-}Cheng Hsieh and
Ming{-}Che Lee and
Chien{-}Yuan Su},
title = {Designing and implementing a personalized remedial learning system
for enhancing the programming learning},
journal = {J. Educ. Technol. Soc.},
volume = {16},
number = {4},
pages = {32--46},
year = {2013},
url = {http://www.ifets.info/download\_pdf.php?j\_id=61\&a\_id=1407},
timestamp = {Mon, 16 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ets/HsiehLS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gpb/LowTJQCSNTEGPLH13,
author = {Hoi Pang Low and
Ashutosh Tiwari and
Jagadeesh Janjanam and
Li Qiu and
Chien{-}I Chang and
William C. Strohsnitter and
Errol R. Norwitz and
Sun W. Tam and
James E. Evans and
Karin M. Green and
Joao A. Paulo and
Mats Lambe and
Chung{-}Cheng Hsieh},
title = {Screening Preeclamptic Cord Plasma for Proteins Associated with Decreased
Breast Cancer Susceptibility},
journal = {Genom. Proteom. Bioinform.},
volume = {11},
number = {6},
pages = {335--344},
year = {2013},
url = {https://doi.org/10.1016/j.gpb.2013.09.009},
doi = {10.1016/J.GPB.2013.09.009},
timestamp = {Thu, 20 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/gpb/LowTJQCSNTEGPLH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdsn/LinHSH13,
author = {Jin{-}Ling Lin and
Kao{-}Shing Hwang and
Hui{-}Kai Su and
Min{-}Che Hsieh},
title = {Real-Time Seismic Data Acquisition via a Paired Ripple Transmission
Protocol},
journal = {Int. J. Distributed Sens. Networks},
volume = {9},
year = {2013},
url = {https://doi.org/10.1155/2013/765973},
doi = {10.1155/2013/765973},
timestamp = {Sun, 21 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijdsn/LinHSH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isf/LinHYHTK13,
author = {Chinho Lin and
Ming{-}Lung Hsu and
David C. Yen and
Ping{-}Jung Hsieh and
Hua{-}Ling Tsai and
Tsung{-}Hsien Kuo},
title = {Prototype system for pursuing firm's core capability},
journal = {Inf. Syst. Frontiers},
volume = {15},
number = {3},
pages = {497--509},
year = {2013},
url = {https://doi.org/10.1007/s10796-011-9341-x},
doi = {10.1007/S10796-011-9341-X},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/isf/LinHYHTK13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/YehHY13,
author = {Shang{-}Fu Yeh and
Chih{-}Cheng Hsieh and
Ka{-}Yi Yeh},
title = {A 3 Megapixel 100 Fps 2.8 {\(\mathrm{\mu}\)}m Pixel Pitch {CMOS} Image
Sensor Layer With Built-in Self-Test for 3D Integrated Imagers},
journal = {{IEEE} J. Solid State Circuits},
volume = {48},
number = {3},
pages = {839--849},
year = {2013},
url = {https://doi.org/10.1109/JSSC.2012.2233331},
doi = {10.1109/JSSC.2012.2233331},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/YehHY13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kais/HsiehLT13,
author = {Ming{-}Hua Hsieh and
Kawuu Weicheng Lin and
Vincent S. Tseng},
title = {A hybrid scheme for energy-efficient object tracking in sensor networks},
journal = {Knowl. Inf. Syst.},
volume = {36},
number = {2},
pages = {359--384},
year = {2013},
url = {https://doi.org/10.1007/s10115-012-0529-2},
doi = {10.1007/S10115-012-0529-2},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/kais/HsiehLT13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/LiCLNCCHS13,
author = {Lieber Po{-}Hung Li and
Kuang{-}Chao Chen and
Po{-}Lei Lee and
David M. Niddam and
Chou{-}Ming Cheng and
Chih{-}Cher Chou and
Jen{-}Chuen Hsieh and
An{-}Suey Shiao},
title = {Neuromagnetic index of hemispheric asymmetry predicting long-term
outcome in sudden hearing loss},
journal = {NeuroImage},
volume = {64},
pages = {356--364},
year = {2013},
url = {https://doi.org/10.1016/j.neuroimage.2012.09.002},
doi = {10.1016/J.NEUROIMAGE.2012.09.002},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/LiCLNCCHS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/LeeHHLK13,
author = {Shuenn{-}Yuh Lee and
Jia{-}Hua Hong and
Cheng{-}Han Hsieh and
Ming{-}Chun Liang and
Jing{-}Yang Kung},
title = {A Low-Power 13.56 MHz {RF} Front-End Circuit for Implantable Biomedical
Devices},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {7},
number = {3},
pages = {256--265},
year = {2013},
url = {https://doi.org/10.1109/TBCAS.2012.2212276},
doi = {10.1109/TBCAS.2012.2212276},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbcas/LeeHHLK13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tit/DattaMHB13,
author = {Nilanjana Datta and
Mil{\'{a}}n Mosonyi and
Min{-}Hsiu Hsieh and
Fernando G. S. L. Brand{\~{a}}o},
title = {A Smooth Entropy Approach to Quantum Hypothesis Testing and the Classical
Capacity of Quantum Channels},
journal = {{IEEE} Trans. Inf. Theory},
volume = {59},
number = {12},
pages = {8014--8026},
year = {2013},
url = {https://doi.org/10.1109/TIT.2013.2282160},
doi = {10.1109/TIT.2013.2282160},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tit/DattaMHB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tocs/CorbettDEFFFGGHHHKKLLMMNQRRSSTWW13,
author = {James C. Corbett and
Jeffrey Dean and
Michael Epstein and
Andrew Fikes and
Christopher Frost and
J. J. Furman and
Sanjay Ghemawat and
Andrey Gubarev and
Christopher Heiser and
Peter Hochschild and
Wilson C. Hsieh and
Sebastian Kanthak and
Eugene Kogan and
Hongyi Li and
Alexander Lloyd and
Sergey Melnik and
David Mwaura and
David Nagle and
Sean Quinlan and
Rajesh Rao and
Lindsay Rolig and
Yasushi Saito and
Michal Szymaniak and
Christopher Taylor and
Ruth Wang and
Dale Woodford},
title = {Spanner: Google's Globally Distributed Database},
journal = {{ACM} Trans. Comput. Syst.},
volume = {31},
number = {3},
pages = {8},
year = {2013},
url = {https://doi.org/10.1145/2491245},
doi = {10.1145/2491245},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tocs/CorbettDEFFFGGHHHKKLLMMNQRRSSTWW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/twc/XinSMHS13,
author = {Chunsheng Xin and
Min Song and
Liangping Ma and
George Hsieh and
Chien{-}Chung Shen},
title = {An Incentivized Cooperative Architecture for Dynamic Spectrum Access
Networks},
journal = {{IEEE} Trans. Wirel. Commun.},
volume = {12},
number = {10},
pages = {5154--5161},
year = {2013},
url = {https://doi.org/10.1109/TWC.2013.090413.122052},
doi = {10.1109/TWC.2013.090413.122052},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/twc/XinSMHS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl-sighan/YangHCTSH13,
author = {Ting{-}Hao Yang and
Yu{-}Lun Hsieh and
Yu{-}Hsuan Chen and
Michael Tsang and
Cheng{-}Wei Shih and
Wen{-}Lian Hsu},
editor = {Liang{-}Chih Yu and
Yuen{-}Hsien Tseng and
Jingbo Zhu and
Fuji Ren},
title = {Sinica-IASL Chinese spelling check system at Sighan-7},
booktitle = {Proceedings of the Seventh {SIGHAN} Workshop on Chinese Language Processing,
SIGHAN@IJCNLP 2013, Nagoya, Japan, October 14-18, 2013},
pages = {93--96},
publisher = {Asian Federation of Natural Language Processing},
year = {2013},
url = {https://aclanthology.org/W13-4417/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl-sighan/YangHCTSH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl-socialnlp/HsiehCCW13,
author = {Wen{-}Tai Hsieh and
Seng{-}cho Timothy Chou and
Yu{-}Hsuan Cheng and
Chen Ming Wu},
editor = {Shou{-}de Lin and
Lun{-}Wei Ku and
Tsung{-}Ting Kuo},
title = {Predicting {TV} Audience Rating with Social Media},
booktitle = {Proceedings of the {IJCNLP} Workshop on Natural Language Processing
for Social Media, SocialNLP@IJCNLP 2013, Nagoya, Japan, October 14
- 18, 2013},
pages = {1--5},
publisher = {Asian Federation of Natural Language Processing},
year = {2013},
url = {https://aclanthology.org/W13-4201/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl-socialnlp/HsiehCCW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asap/TangHCNBHH13,
author = {Li Tang and
Xiaobo Sharon Hu and
Danny Z. Chen and
Michael T. Niemier and
Richard F. Barrett and
Simon D. Hammond and
Genie Hsieh},
title = {{GPU} acceleration of Data Assembly in Finite Element Methods and
its energy implications},
booktitle = {24th International Conference on Application-Specific Systems, Architectures
and Processors, {ASAP} 2013, Washington, DC, USA, June 5-7, 2013},
pages = {321--328},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/ASAP.2013.6567597},
doi = {10.1109/ASAP.2013.6567597},
timestamp = {Sun, 17 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asap/TangHCNBHH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ats/ShihHLLWC13,
author = {Chi{-}Jih Shih and
Shih{-}An Hsieh and
Yi{-}Chang Lu and
James Chien{-}Mo Li and
Tzong{-}Lin Wu and
Krishnendu Chakrabarty},
title = {Test Generation of Path Delay Faults Induced by Defects in Power {TSV}},
booktitle = {22nd Asian Test Symposium, {ATS} 2013, Yilan County, Taiwan, November
18-21, 2013},
pages = {43--48},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/ATS.2013.18},
doi = {10.1109/ATS.2013.18},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ats/ShihHLLWC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/blackseecom/WangSHYH13,
author = {Sen{-}Hung Wang and
Hsuan{-}Jung Su and
Hung{-}Yun Hsieh and
Shu{-}Ping Yeh and
Minnie Ho},
title = {Random access design for clustered wireless machine to machine networks},
booktitle = {First International Black Sea Conference on Communications and Networking,
BlackSeaCom 2013, Batumi, Georgia, July 3-5, 2013},
pages = {107--111},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/BlackSeaCom.2013.6623391},
doi = {10.1109/BLACKSEACOM.2013.6623391},
timestamp = {Tue, 09 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/blackseecom/WangSHYH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/SawadaSCHM13,
author = {Dan Sawada and
Anirudh Sharma and
Sujoy Kumar Chowdhury and
Christine Hsieh and
Andrea Miller},
editor = {Wendy E. Mackay and
Stephen A. Brewster and
Susanne B{\o}dker},
title = {Wave alchemy: perception and reminiscence of expressive moments through
waves},
booktitle = {2013 {ACM} {SIGCHI} Conference on Human Factors in Computing Systems,
{CHI} '13, Paris, France, April 27 - May 2, 2013, Extended Abstracts},
pages = {1611--1616},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2468356.2468644},
doi = {10.1145/2468356.2468644},
timestamp = {Fri, 12 Mar 2021 15:27:48 +0100},
biburl = {https://dblp.org/rec/conf/chi/SawadaSCHM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/HongLLHC13,
author = {Jia{-}Hua Hong and
Shuenn{-}Yuh Lee and
Ming{-}Chun Liang and
Cheng{-}Han Hsieh and
Shih{-}Yu Chang Chien},
title = {A wireless {ECG} acquisition and classification system for body sensor
networks},
booktitle = {35th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2013, Osaka, Japan, July 3-7,
2013},
pages = {5183--5186},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/EMBC.2013.6610716},
doi = {10.1109/EMBC.2013.6610716},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/embc/HongLLHC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fira/LiHHCLW13,
author = {Shih{-}An Li and
Ming{-}Hua Hsieh and
Cheng{-}Yao Ho and
Kung{-}Han Chen and
Ciao{-}Yun Lin and
Ching{-}Chang Wong},
editor = {Khairuddin Omar and
Mohd Jan Nordin and
Prahlad Vadakkepat and
Anton Satria Prabuwono and
Siti Norul Huda Sheikh Abdullah and
Jacky Baltes and
Shamsudin H. M. Amin and
Wan Zuha Wan Hassan and
Mohammad Faidzul Nasrudin},
title = {Task Allocation Design for Autonomous Soccer Robot},
booktitle = {Intelligent Robotics Systems: Inspiring the {NEXT} - 16th {FIRA} RoboWorld
Congress, {FIRA} 2013, Kuala Lumpur, Malaysia, August 24-29, 2013.
Proceedings},
series = {Communications in Computer and Information Science},
volume = {376},
pages = {297--308},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-40409-2\_26},
doi = {10.1007/978-3-642-40409-2\_26},
timestamp = {Sat, 09 Apr 2022 12:46:24 +0200},
biburl = {https://dblp.org/rec/conf/fira/LiHHCLW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/HsiehH13,
author = {Min{-}Chih Hsieh and
Sheue{-}Ling Hwang},
editor = {Masaaki Kurosu},
title = {The Effect of Information Quantity on Cbp Interface in the Advanced
Nuclear Power Plant},
booktitle = {Human-Computer Interaction. Users and Contexts of Use - 15th International
Conference, {HCI} International 2013, Las Vegas, NV, USA, July 21-26,
2013, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {8006},
pages = {166--173},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-39265-8\_18},
doi = {10.1007/978-3-642-39265-8\_18},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/hci/HsiehH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icait/HsiehHCHCTHS13,
author = {Wen{-}Hsuan Hsieh and
Yi{-}Chung Huang and
Jian{-}Li Chen and
Wen{-}Chi Hung and
Wood{-}Hi Cheng and
Ying{-}Chien Tsai and
Yi{-}Cheng Hsu and
Maw{-}Tyan Sheen},
title = {Direct near-field phase measurements of lensed fiber employing a single-mode
fiber interferometer},
booktitle = {6th {IEEE} International Conference on Advanced Infocomm Technology,
{ICAIT} 2013, Hsinchu, Taiwan, July 6-9, 2013},
pages = {93--94},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICAIT.2013.6621513},
doi = {10.1109/ICAIT.2013.6621513},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icait/HsiehHCHCTHS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnlp/BaiHCC13,
author = {Ming{-}Hong Bai and
Yu{-}Ming Hsieh and
Keh{-}Jiann Chen and
Jason S. Chang},
title = {Translating Chinese Unknown Words by Automatically Acquired Templates},
booktitle = {Sixth International Joint Conference on Natural Language Processing,
{IJCNLP} 2013, Nagoya, Japan, October 14-18, 2013},
pages = {839--843},
publisher = {Asian Federation of Natural Language Processing / {ACL}},
year = {2013},
url = {https://aclanthology.org/I13-1103/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnlp/BaiHCC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/HsiehGBN13,
author = {Fang{-}Ying Hsieh and
Louis Goldstein and
Dani Byrd and
Shrikanth S. Narayanan},
editor = {Fr{\'{e}}d{\'{e}}ric Bimbot and
Christophe Cerisara and
C{\'{e}}cile Fougeron and
Guillaume Gravier and
Lori Lamel and
Fran{\c{c}}ois Pellegrino and
Pascal Perrier},
title = {Truncation of pharyngeal gesture in English diphthong [a{\unicode{618}}]},
booktitle = {14th Annual Conference of the International Speech Communication Association,
{INTERSPEECH} 2013, Lyon, France, August 25-29, 2013},
pages = {968--972},
publisher = {{ISCA}},
year = {2013},
url = {https://doi.org/10.21437/Interspeech.2013-170},
doi = {10.21437/INTERSPEECH.2013-170},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/HsiehGBN13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/ChengHHHC13,
author = {Wei{-}Sheng Cheng and
Min{-}Han Hsieh and
Shuo{-}Hong Hung and
Szu{-}Yao Hung and
Charlie Chung{-}Ping Chen},
title = {A 10-bit current-steering {DAC} for HomePlug {AV2} powerline communication
system in 90nm {CMOS}},
booktitle = {2013 {IEEE} International Symposium on Circuits and Systems (ISCAS2013),
Beijing, China, May 19-23, 2013},
pages = {2034--2037},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ISCAS.2013.6572271},
doi = {10.1109/ISCAS.2013.6572271},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/ChengHHHC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/LiangHL13,
author = {Ming{-}Chun Liang and
Cheng{-}Han Hsieh and
Shuenn{-}Yuh Lee},
title = {A 1.5-bit/stage pipeline {ADC} with FFT-based calibration method},
booktitle = {2013 {IEEE} International Symposium on Circuits and Systems (ISCAS2013),
Beijing, China, May 19-23, 2013},
pages = {2042--2045},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ISCAS.2013.6572273},
doi = {10.1109/ISCAS.2013.6572273},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/LiangHL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/LiuHLHC13,
author = {Pang{-}Kai Liu and
Szu{-}Yao Hung and
Chang{-}Yi Liu and
Min{-}Han Hsieh and
Charlie Chung{-}Ping Chen},
title = {A 52 dBc {MTPR} line driver for powerline communication HomePlug {AV}
standard in 0.18-{\(\mu\)}m {CMOS} technology},
booktitle = {2013 {IEEE} International Symposium on Circuits and Systems (ISCAS2013),
Beijing, China, May 19-23, 2013},
pages = {1404--1407},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ISCAS.2013.6572118},
doi = {10.1109/ISCAS.2013.6572118},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/LiuHLHC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/LiuHKSMCTF13,
author = {Yong Liu and
Ping{-}Hsuan Hsieh and
Seongwon Kim and
Jae{-}sun Seo and
Robert K. Montoye and
Leland Chang and
Jos{\'{e}} A. Tierno and
Daniel J. Friedman},
title = {A 0.1pJ/b 5-to-10Gb/s charge-recycling stacked low-power {I/O} for
on-chip signaling in 45nm {CMOS} {SOI}},
booktitle = {2013 {IEEE} International Solid-State Circuits Conference - Digest
of Technical Papers, {ISSCC} 2013, San Francisco, CA, USA, February
17-21, 2013},
pages = {400--401},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ISSCC.2013.6487787},
doi = {10.1109/ISSCC.2013.6487787},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/LiuHKSMCTF13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mmvr/NiskyPHO13,
author = {Ilana Nisky and
Sangram Patil and
Michael H. Hsieh and
Allison M. Okamura},
editor = {James D. Westwood and
Susan W. Westwood and
Li Fell{\"{a}}nder{-}Tsai and
Randy S. Haluck and
Richard A. Robb and
Steven Senger and
Kirby G. Vosburgh},
title = {Kinematic Analysis of Motor Performance in Robot-Assisted Surgery:
{A} Preliminary Study},
booktitle = {Medicine Meets Virtual Reality 20 - NextMed, {MMVR} 2013, San Diego,
California, USA, February 20-23, 2013},
series = {Studies in Health Technology and Informatics},
volume = {184},
pages = {302--308},
publisher = {{IOS} Press},
year = {2013},
url = {https://doi.org/10.3233/978-1-61499-209-7-302},
doi = {10.3233/978-1-61499-209-7-302},
timestamp = {Mon, 16 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mmvr/NiskyPHO13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mobisys/LeuSCHCM13,
author = {Jenq{-}Shiou Leu and
Kuan{-}Wu Su and
Tien{-}Yu Chu and
Chen{-}Hsin Hsieh and
Yu{-}Shan Athena Chen and
Jui{-}Ping Ma},
editor = {Hao{-}Hua Chu and
Polly Huang and
Romit Roy Choudhury and
Feng Zhao},
title = {Pointer wizard: a remote interaction user interface},
booktitle = {The 11th Annual International Conference on Mobile Systems, Applications,
and Services, MobiSys'13, Taipei, Taiwan, June 25-28, 2013},
pages = {477--478},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2462456.2465734},
doi = {10.1145/2462456.2465734},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mobisys/LeuSCHCM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/HsiehSDRP13,
author = {Cho{-}Jui Hsieh and
M{\'{a}}ty{\'{a}}s A. Sustik and
Inderjit S. Dhillon and
Pradeep Ravikumar and
Russell A. Poldrack},
editor = {Christopher J. C. Burges and
L{\'{e}}on Bottou and
Zoubin Ghahramani and
Kilian Q. Weinberger},
title = {{BIG} {\&} {QUIC:} Sparse Inverse Covariance Estimation for a
Million Variables},
booktitle = {Advances in Neural Information Processing Systems 26: 27th Annual
Conference on Neural Information Processing Systems 2013. Proceedings
of a meeting held December 5-8, 2013, Lake Tahoe, Nevada, United States},
pages = {3165--3173},
year = {2013},
url = {https://proceedings.neurips.cc/paper/2013/hash/1abb1e1ea5f481b589da52303b091cbb-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/HsiehSDRP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sitis/HsiehSWCLZCC13,
author = {Yi{-}Zeng Hsieh and
Mu{-}Chun Su and
Cheng{-}Tsung Wu and
Chien{-}Hsing Chou and
Ching{-}Hu Lu and
Yu{-}Xiang Zhao and
Ya{-}Yun Cheng and
Yung{-}Long Chu},
editor = {Kokou Y{\'{e}}tongnon and
Albert Dipanda and
Richard Chbeir},
title = {To Develop the Virtual Physics Laboratory by Integrating Kinect with
Gesture Classification Algorithm},
booktitle = {Ninth International Conference on Signal-Image Technology {\&}
Internet-Based Systems, {SITIS} 2013, Kyoto, Japan, December 2-5,
2013},
pages = {1017--1019},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/SITIS.2013.164},
doi = {10.1109/SITIS.2013.164},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sitis/HsiehSWCLZCC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vtc/FangCLSHH13,
author = {Shih{-}Hao Fang and
Ju{-}Ya Chen and
Jing{-}Shiun Lin and
Ming{-}Der Shieh and
Dung{-}Rung Hsieh and
Jen{-}Yuan Hsu},
title = {Subspace-Based Blind Channel Estimation for {MIMO-OFDM} Systems with
Repetition Index},
booktitle = {Proceedings of the 78th {IEEE} Vehicular Technology Conference, {VTC}
Fall 2013, Las Vegas, NV, USA, September 2-5, 2013},
pages = {1--5},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/VTCFall.2013.6692426},
doi = {10.1109/VTCFALL.2013.6692426},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/vtc/FangCLSHH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/HsiehTAHS13,
author = {Cho{-}Jui Hsieh and
Mitul Tiwari and
Deepak Agarwal and
Xinyi (Lisa) Huang and
Sam Shah},
editor = {Daniel Schwabe and
Virg{\'{\i}}lio A. F. Almeida and
Hartmut Glaser and
Ricardo Baeza{-}Yates and
Sue B. Moon},
title = {Organizational overlap on social networks and its applications},
booktitle = {22nd International World Wide Web Conference, {WWW} '13, Rio de Janeiro,
Brazil, May 13-17, 2013},
pages = {571--582},
publisher = {International World Wide Web Conferences Steering Committee / {ACM}},
year = {2013},
url = {https://doi.org/10.1145/2488388.2488439},
doi = {10.1145/2488388.2488439},
timestamp = {Sun, 22 Sep 2019 18:15:38 +0200},
biburl = {https://dblp.org/rec/conf/www/HsiehTAHS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/dars/2010,
editor = {Alcherio Martinoli and
Francesco Mondada and
Nikolaus Correll and
Gr{\'{e}}gory Mermoud and
Magnus Egerstedt and
M. Ani Hsieh and
Lynne E. Parker and
Kasper St{\o}y},
title = {Distributed Autonomous Robotic Systems - The 10th International Symposium,
{DARS} 2010, Lausanne, Switzerland, November 1-3, 2010},
series = {Springer Tracts in Advanced Robotics},
volume = {83},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-32723-0},
doi = {10.1007/978-3-642-32723-0},
isbn = {978-3-642-32722-3},
timestamp = {Tue, 23 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dars/2010.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/HsiehSDR13,
author = {Cho{-}Jui Hsieh and
M{\'{a}}ty{\'{a}}s A. Sustik and
Inderjit S. Dhillon and
Pradeep Ravikumar},
title = {Sparse Inverse Covariance Matrix Estimation Using Quadratic Approximation},
journal = {CoRR},
volume = {abs/1306.3212},
year = {2013},
url = {http://arxiv.org/abs/1306.3212},
eprinttype = {arXiv},
eprint = {1306.3212},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/HsiehSDR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chb/HsiehCM12,
author = {Yu{-}Chen Hsieh and
Kuo{-}Hsiang Chen and
Min{-}Yuan Ma},
title = {Retain viewer's attention on banner ad by manipulating information
type of the content},
journal = {Comput. Hum. Behav.},
volume = {28},
number = {5},
pages = {1692--1699},
year = {2012},
url = {https://doi.org/10.1016/j.chb.2012.04.008},
doi = {10.1016/J.CHB.2012.04.008},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/chb/HsiehCM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cj/HsiehRTSR12,
author = {Ming{-}yu Hsieh and
Rolf Riesen and
Kevin Thompson and
William J. Song and
Arun Rodrigues},
title = {{SST:} {A} Scalable Parallel Framework for Architecture-Level Performance,
Power, Area and Thermal Simulation},
journal = {Comput. J.},
volume = {55},
number = {2},
pages = {181--191},
year = {2012},
url = {https://doi.org/10.1093/comjnl/bxr069},
doi = {10.1093/COMJNL/BXR069},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cj/HsiehRTSR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/KaraHHHMRWDRCBMBMWHGK12,
author = {Emily L. Kara and
Paul C. Hanson and
David P. Hamilton and
Matthew R. Hipsey and
Katherine D. McMahon and
Jordan S. Read and
Luke A. Winslow and
John Dedrick and
Kevin Rose and
Cayelan C. Carey and
Stefan Bertilsson and
David da Motta Marques and
Lucas Beversdorf and
Todd Miller and
Chin H. Wu and
Yi{-}Fang Hsieh and
Evelyn Gaiser and
Tim Kratz},
title = {Time-scale dependence in numerical simulations: Assessment of physical,
chemical, and biological predictions in a stratified lake at temporal
scales of hours to months},
journal = {Environ. Model. Softw.},
volume = {35},
pages = {104--121},
year = {2012},
url = {https://doi.org/10.1016/j.envsoft.2012.02.014},
doi = {10.1016/J.ENVSOFT.2012.02.014},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/envsoft/KaraHHHMRWDRCBMBMWHGK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ets/HsiehWSL12,
author = {Tung{-}Cheng Hsieh and
Tzone{-}I Wang and
Chien{-}Yuan Su and
Ming{-}Che Lee},
title = {A Fuzzy Logic-based Personalized Learning System for Supporting Adaptive
English Learning},
journal = {J. Educ. Technol. Soc.},
volume = {15},
number = {1},
pages = {273--288},
year = {2012},
url = {http://www.ifets.info/download\_pdf.php?j\_id=54\&a\_id=1214},
timestamp = {Mon, 16 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ets/HsiehWSL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdsn/SuHLH12,
author = {Tung{-}Shih Su and
Mei{-}Wen Huang and
Wei{-}Shuo Li and
Wen{-}Shyong Hsieh},
title = {Aggregation Scheme with Secure Hierarchical Clustering for Wireless
Sensor Networks},
journal = {Int. J. Distributed Sens. Networks},
volume = {8},
year = {2012},
url = {https://doi.org/10.1155/2012/162347},
doi = {10.1155/2012/162347},
timestamp = {Sun, 21 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijdsn/SuHLH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijebm/HungYH12,
author = {Ming{-}Chien Hung and
Shih{-}Ting Yang and
Ting{-}Chu Hsieh},
title = {An Examination of the Determinants of Mobile Shopping Continuance},
journal = {Int. J. Electron. Bus. Manag.},
volume = {10},
number = {1},
pages = {29--37},
year = {2012},
url = {http://ijebm.ie.nthu.edu.tw/IJEBM\_Web/IJEBM\_static/Paper-V10\_N1/A04.pdf},
timestamp = {Mon, 28 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijebm/HungYH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmlo/WongCCHL12,
author = {Lung{-}Hsiang Wong and
Ching{-}Sing Chai and
Chee{-}Kuen Chin and
Yu{-}Fen Hsieh and
May Liu},
title = {Towards a seamless language learning framework mediated by the ubiquitous
technology},
journal = {Int. J. Mob. Learn. Organisation},
volume = {6},
number = {2},
pages = {156--171},
year = {2012},
url = {https://doi.org/10.1504/IJMLO.2012.047599},
doi = {10.1504/IJMLO.2012.047599},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmlo/WongCCHL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijnm/MaCKHH12,
author = {Yi{-}Wei Ma and
Jiann{-}Liang Chen and
Sy{-}Yen Kuo and
Wen{-}Kuei Hsieh and
Yueh{-}Min Huang},
title = {An efficient code gateway for {RFID} seamless applications},
journal = {Int. J. Netw. Manag.},
volume = {22},
number = {2},
pages = {150--161},
year = {2012},
url = {https://doi.org/10.1002/nem.797},
doi = {10.1002/NEM.797},
timestamp = {Thu, 21 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijnm/MaCKHH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jam/Chang-JianCH12,
author = {Cai{-}Wan Chang{-}Jian and
Shiuh Ming Chang and
Hsieh{-}Chung Hsu},
title = {Couple-Stress Fluid Improves Dynamic Response of Gear-Pair System
Supported by Journal Bearings},
journal = {J. Appl. Math.},
volume = {2012},
pages = {527878:1--527878:20},
year = {2012},
url = {https://doi.org/10.1155/2012/527878},
doi = {10.1155/2012/527878},
timestamp = {Thu, 16 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jam/Chang-JianCH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcphy/SuSKWHT12,
author = {Cheng{-}Chin Su and
Matthew R. Smith and
Fang{-}An Kuo and
Jong{-}Shinn Wu and
Chih{-}Wei Hsieh and
Kun{-}Chang Tseng},
title = {Large-scale simulations on multiple Graphics Processing Units (GPUs)
for the direct simulation Monte Carlo method},
journal = {J. Comput. Phys.},
volume = {231},
number = {23},
pages = {7932--7958},
year = {2012},
url = {https://doi.org/10.1016/j.jcp.2012.07.038},
doi = {10.1016/J.JCP.2012.07.038},
timestamp = {Sat, 06 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcphy/SuSKWHT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/HsiehL12,
author = {M. Ani Hsieh and
Simon Lacroix},
title = {Editorial: For the {JFR} special issue on "Multiple collaborative
field robots"},
journal = {J. Field Robotics},
volume = {29},
number = {5},
pages = {687--688},
year = {2012},
url = {https://doi.org/10.1002/rob.21438},
doi = {10.1002/ROB.21438},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfr/HsiehL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/BulzacchelliMBSHHHRFGPMSKAKCRSGCBBKTF12,
author = {John F. Bulzacchelli and
Christian Menolfi and
Troy J. Beukema and
Daniel W. Storaska and
Juergen Hertle and
David Hanson and
Ping{-}Hsuan Hsieh and
Sergey V. Rylov and
Daniel Furrer and
Daniele Gardellini and
Andrea Prati and
Thomas Morf and
Vivek Sharma and
Ram Kelkar and
Herschel A. Ainspan and
William R. Kelly and
L. R. Chieco and
Glenn Ritter and
J. A. Sorice and
Jon Garlett and
Robert Callan and
Matthias Braendli and
Peter Buchmann and
Marcel A. Kossel and
Thomas Toifl and
Daniel J. Friedman},
title = {A 28-Gb/s 4-Tap FFE/15-Tap {DFE} Serial Link Transceiver in 32-nm
{SOI} {CMOS} Technology},
journal = {{IEEE} J. Solid State Circuits},
volume = {47},
number = {12},
pages = {3232--3248},
year = {2012},
url = {https://doi.org/10.1109/JSSC.2012.2216414},
doi = {10.1109/JSSC.2012.2216414},
timestamp = {Thu, 11 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/BulzacchelliMBSHHHRFGPMSKAKCRSGCBBKTF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/SatriaHHCL12,
author = {Muhammad T. Satria and
Bormin Huang and
Tung{-}Ju Hsieh and
Yang{-}Lang Chang and
Wen{-}Yew Liang},
title = {{GPU} Acceleration of Tsunami Propagation Model},
journal = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
volume = {5},
number = {3},
pages = {1014--1023},
year = {2012},
url = {https://doi.org/10.1109/JSTARS.2012.2199468},
doi = {10.1109/JSTARS.2012.2199468},
timestamp = {Tue, 31 Mar 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/staeors/SatriaHHCL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/WangCLTCHLLS12,
author = {Chunyang Wang and
Ming{-}Lung Chuang and
Shinn{-}Jye Liang and
Jui{-}Che Tsai and
Ching{-}Cheng Chuang and
Yao{-}Sheng Hsieh and
Chih{-}Wei Lu and
Po{-}Lei Lee and
Chia{-}Wei Sun},
title = {Diffuse Optical Multipatch Technique for Tissue Oxygenation Monitoring:
Clinical Study in Intensive Care Unit},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {59},
number = {1},
pages = {87--94},
year = {2012},
url = {https://doi.org/10.1109/TBME.2011.2147315},
doi = {10.1109/TBME.2011.2147315},
timestamp = {Wed, 04 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tbe/WangCLTCHLLS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tis/HsiehKHK12,
author = {J. J. Po{-}An Hsieh and
Mark Keil and
Jonny Holmstr{\"{o}}m and
Lynette Kvasny},
title = {The Bumpy Road to Universal Access: An Actor-Network Analysis of a
{U.S.} Municipal Broadband Internet Initiative},
journal = {Inf. Soc.},
volume = {28},
number = {4},
pages = {264--283},
year = {2012},
url = {https://doi.org/10.1080/01972243.2012.689271},
doi = {10.1080/01972243.2012.689271},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tis/HsiehKHK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/HsiehFHSC12,
author = {Chien{-}Yu Hsieh and
Ming{-}Long Fan and
Vita Pi{-}Ho Hu and
Pin Su and
Ching{-}Te Chuang},
title = {Independently-Controlled-Gate FinFET Schmitt Trigger Sub-Threshold
SRAMs},
journal = {{IEEE} Trans. Very Large Scale Integr. Syst.},
volume = {20},
number = {7},
pages = {1201--1210},
year = {2012},
url = {https://doi.org/10.1109/TVLSI.2011.2156435},
doi = {10.1109/TVLSI.2011.2156435},
timestamp = {Wed, 11 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvlsi/HsiehFHSC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl-sighan/HsiehBCC12,
author = {Yu{-}Ming Hsieh and
Ming{-}Hong Bai and
Jason S. Chang and
Keh{-}Jiann Chen},
title = {Improving {PCFG} Chinese Parsing with Context-Dependent Probability
Re-estimation},
booktitle = {Proceedings of the Second {CIPS-SIGHAN} Joint Conference on Chinese
Language Processing, Tianjin, China, December 20-21, 2012},
pages = {216--221},
publisher = {Association for Computational Linguistics},
year = {2012},
url = {https://aclanthology.org/W12-6338/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl-sighan/HsiehBCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/BaiHCC12,
author = {Ming{-}Hong Bai and
Yu{-}Ming Hsieh and
Keh{-}Jiann Chen and
Jason S. Chang},
title = {{DOMCAT:} {A} Bilingual Concordancer for Domain-Specific Computer
Assisted Translation},
booktitle = {The 50th Annual Meeting of the Association for Computational Linguistics,
Proceedings of the System Demonstrations, July 10, 2012, Jeju Island,
Korea},
pages = {55--60},
publisher = {The Association for Computer Linguistics},
year = {2012},
url = {https://aclanthology.org/P12-3010/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/BaiHCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ChenHHKC12,
author = {Mei{-}hua Chen and
Shih{-}Ting Huang and
Hung{-}ting Hsieh and
Ting{-}hui Kao and
Jason S. Chang},
title = {{FLOW:} {A} First-Language-Oriented Writing Assistant System},
booktitle = {The 50th Annual Meeting of the Association for Computational Linguistics,
Proceedings of the System Demonstrations, July 10, 2012, Jeju Island,
Korea},
pages = {157--162},
publisher = {The Association for Computer Linguistics},
year = {2012},
url = {https://aclanthology.org/P12-3027/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ChenHHKC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/HsiehWKC12,
author = {Wen{-}Tai Hsieh and
Chen Ming Wu and
Tsun Ku and
Seng{-}cho Timothy Chou},
title = {Social Event Radar: {A} Bilingual Context Mining and Sentiment Analysis
Summarization System},
booktitle = {The 50th Annual Meeting of the Association for Computational Linguistics,
Proceedings of the System Demonstrations, July 10, 2012, Jeju Island,
Korea},
pages = {163--168},
publisher = {The Association for Computer Linguistics},
year = {2012},
url = {https://aclanthology.org/P12-3028/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/HsiehWKC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apccas/ChenLHYHCWHHTMC12,
author = {Yung{-}Chan Chen and
Yu{-}Po Lin and
Tsui{-}Ling Hsieh and
Chun{-}Yi Yeh and
Pin{-}Yang Huang and
Hung{-}Chih Chiu and
Zong{-}Ye Wang and
Wen{-}Yang Hsu and
Po{-}Chiun Huang and
Kea{-}Tiong Tang and
Hsi{-}Pin Ma and
Hsin Chen},
title = {An implantable microsystem for studying the Parkinson's Disease},
booktitle = {{IEEE} Asia Pacific Conference on Circuits and Systems, {APCCAS} 2012,
Kaohsiung, Taiwan, December 2-5, 2012},
pages = {92--95},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/APCCAS.2012.6418979},
doi = {10.1109/APCCAS.2012.6418979},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/apccas/ChenLHYHCWHHTMC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apccas/HuangLHLH12,
author = {Chen{-}Yueh Huang and
Shuenn{-}Yuh Lee and
Jia{-}Hua Hong and
Ming{-}Chun Liang and
Cheng{-}Han Hsieh},
title = {Burst-pulse control of microstimulator for bladder controller},
booktitle = {{IEEE} Asia Pacific Conference on Circuits and Systems, {APCCAS} 2012,
Kaohsiung, Taiwan, December 2-5, 2012},
pages = {84--87},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/APCCAS.2012.6418977},
doi = {10.1109/APCCAS.2012.6418977},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/apccas/HuangLHLH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/WuNTHJRCC12,
author = {Hao Wu and
Lan Nan and
Sai{-}Wang Tam and
Hsieh{-}Hung Hsieh and
Chewnpu Jou and
Glenn Reinman and
Jason Cong and
Mau{-}Chung Frank Chang},
title = {A 60GHz on-chip RF-Interconnect with {\(\lambda\)}/4 coupler for 5Gbps
bi-directional communication and multi-drop arbitration},
booktitle = {Proceedings of the {IEEE} 2012 Custom Integrated Circuits Conference,
{CICC} 2012, San Jose, CA, USA, September 9-12, 2012},
pages = {1--4},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/CICC.2012.6330666},
doi = {10.1109/CICC.2012.6330666},
timestamp = {Thu, 03 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cicc/WuNTHJRCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eacl/HuangYCHKC12,
author = {Chung{-}Chi Huang and
Ping{-}Che Yang and
Mei{-}hua Chen and
Hung{-}ting Hsieh and
Ting{-}hui Kao and
Jason S. Chang},
editor = {Walter Daelemans and
Mirella Lapata and
Llu{\'{\i}}s M{\`{a}}rquez},
title = {TransAhead: {A} Writing Assistant for {CAT} and {CALL}},
booktitle = {{EACL} 2012, 13th Conference of the European Chapter of the Association
for Computational Linguistics, Avignon, France, April 23-27, 2012},
pages = {16--19},
publisher = {The Association for Computer Linguistics},
year = {2012},
url = {https://aclanthology.org/E12-2004/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eacl/HuangYCHKC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecis/ShinWH12,
author = {Shin{-}Shing Shin and
Jen{-}Her Wu and
Ming{-}Che Hsieh},
title = {A MDA-Based Development Approach for 3-tiers Applications},
booktitle = {20th European Conference on Information Systems, {ECIS} 2012, Barcelona,
Spain, June 10-13, 2012},
pages = {51},
year = {2012},
url = {http://aisel.aisnet.org/ecis2012/51},
timestamp = {Mon, 05 Dec 2016 15:14:00 +0100},
biburl = {https://dblp.org/rec/conf/ecis/ShinWH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12,
author = {Socrates D. Vamvakos and
Bendik Kleveland and
Dipak K. Sikdar and
B. K. Ahuja and
Haidang Lin and
Jayaprakash Balachandran and
Wignes Balakrishnan and
Aldo Bottelli and
Jawji Chen and
Xiaole Chen and
Jae Choi and
Jeong Choi and
Rajesh Chopra and
Sanjay Dabral and
Kalyan Dasari and
Ronald B. David and
Shaishav Desai and
Claude R. Gauthier and
Mahmudul Hassan and
Kuo{-}Chiang Hsieh and
Ramosan Canagasaby and
Jeff Kumala and
E. P. Kwon and
Ben Lee and
Ming Liu and
Gurupada Mandal and
Sundari Mitra and
Byeong Cheol Na and
Siddharth Panwar and
Jay Patel and
Chethan Rao and
Vithal Rao and
Richard Rouse and
Ritesh Saraf and
Subramanian Seshadri and
Jae{-}K. Sim and
Clement Szeto and
Alvin Wang and
Jason Yeung},
title = {A 576 Mb {DRAM} with 16-channel 10.3125Gbps serial {I/O} and 14.5
ns latency},
booktitle = {Proceedings of the 38th European Solid-State Circuit conference, {ESSCIRC}
2012, Bordeaux, France, September 17-21, 2012},
pages = {458--461},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ESSCIRC.2012.6341354},
doi = {10.1109/ESSCIRC.2012.6341354},
timestamp = {Thu, 26 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esscirc/VamvakosKSALBBBCCCCCDDDDGHHCKKLLMMNPPRRRSSSSWY12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fskd/ChiuTWCSK12,
author = {Sheng{-}Hsiung Chiu and
Meng{-}Hsiun Tsai and
Hsieh{-}Chung Wu and
Wei{-}Chun Chen and
Utpala Shrestha and
Sherwin Kuo},
title = {Application of Fuzzy c-Means and Self-organizing maps for genes clustering
in mouse brain microarray data analysis},
booktitle = {9th International Conference on Fuzzy Systems and Knowledge Discovery,
{FSKD} 2012, 29-31 May 2012, Chongqing, China},
pages = {1104--1108},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/FSKD.2012.6234233},
doi = {10.1109/FSKD.2012.6234233},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/fskd/ChiuTWCSK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fskd/SuWH12,
author = {Chin{-}Hung Su and
Mohd Helmy Abd Wahab and
Tsai{-}Ming Hsieh},
title = {Image Retrieval based on color and texture features},
booktitle = {9th International Conference on Fuzzy Systems and Knowledge Discovery,
{FSKD} 2012, 29-31 May 2012, Chongqing, China},
pages = {1816--1819},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/FSKD.2012.6234300},
doi = {10.1109/FSKD.2012.6234300},
timestamp = {Fri, 02 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fskd/SuWH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hisb/HsiehDCLK12,
author = {Alexander Hsieh and
Son Doan and
Michael Conway and
Ko{-}Wei Lin and
Hyeoneui Kim},
title = {Demographics Identification: Variable Extraction Resource {(DIVER)}},
booktitle = {2012 {IEEE} Second International Conference on Healthcare Informatics,
Imaging and Systems Biology, {HISB} 2012, La Jolla, CA, USA, September
27-28, 2012},
pages = {40--49},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/HISB.2012.17},
doi = {10.1109/HISB.2012.17},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hisb/HsiehDCLK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/HsiehFMS12,
author = {M. Ani Hsieh and
Eric Forgoston and
T. William Mather and
Ira B. Schwartz},
title = {Robotic manifold tracking of coherent structures in flows},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2012, 14-18 May, 2012, St. Paul, Minnesota, {USA}},
pages = {4242--4247},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICRA.2012.6224769},
doi = {10.1109/ICRA.2012.6224769},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/icra/HsiehFMS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isie/HouLLH12,
author = {Chung{-}Chuan Hou and
Shu{-}Wei Lin and
Yung{-}Hsien Lien and
Min{-}Ju Hsieh},
title = {An {AC/DC} power system with an auxiliary three-level converter under
voltage sags},
booktitle = {21st {IEEE} International Symposium on Industrial Electronics, {ISIE}
2012, Hangzhou, China, 28-31 May, 2012},
pages = {1968--1972},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISIE.2012.6237394},
doi = {10.1109/ISIE.2012.6237394},
timestamp = {Mon, 09 Aug 2021 14:54:04 +0200},
biburl = {https://dblp.org/rec/conf/isie/HouLLH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isocc/HsiehLH12,
author = {Chi{-}Hsuan Hsieh and
Ming{-}Yong Lee and
Yuan{-}Hao Huang},
title = {A 516Mb/s 0.2nJ/bit/iter variable-block-size turbo decoder for 3GPP
{LTE-A} system},
booktitle = {International SoC Design Conference, {ISOCC} 2012, Jeju Island, South
Korea, November 4-7, 2012},
pages = {343--346},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISOCC.2012.6407111},
doi = {10.1109/ISOCC.2012.6407111},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isocc/HsiehLH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispacs/HsiehWTSL12,
author = {Meng{-}Yen Hsieh and
Tin{-}Yu Wu and
Yin{-}Te Tsai and
Chi{-}Hua Shih and
Kuan{-}Ching Li},
title = {Interactive design using non-touch technologies for group trip},
booktitle = {International Symposium on Intelligent Signal Processing and Communications
Systems, {ISPACS} 2012, Tamsui, New Taipei City, Taiwan, November
4-7, 2012},
pages = {216--221},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISPACS.2012.6473483},
doi = {10.1109/ISPACS.2012.6473483},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/ispacs/HsiehWTSL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispacs/LiLWCLYHW12,
author = {Shih{-}An Li and
Yi{-}Chun Lin and
Chung{-}Wei Weng and
Yi{-}Hong Chen and
Chia{-}Hung Lo and
Min{-}Hao Yang and
Ming{-}Hua Hsieh and
Ching{-}Chang Wong},
title = {Circle object recognition based on monocular vision for home security
robot},
booktitle = {International Symposium on Intelligent Signal Processing and Communications
Systems, {ISPACS} 2012, Tamsui, New Taipei City, Taiwan, November
4-7, 2012},
pages = {258--261},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISPACS.2012.6473491},
doi = {10.1109/ISPACS.2012.6473491},
timestamp = {Tue, 23 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ispacs/LiLWCLYHW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispacs/LiWCLYLHW12,
author = {Shih{-}An Li and
Chung{-}Wei Weng and
Yi{-}Hong Chen and
Chia{-}Hung Lo and
Min{-}Hao Yang and
Yi{-}Chun Lin and
Ming{-}Hua Hsieh and
Ching{-}Chang Wong},
title = {Servo motor controller design for robotic manipulator},
booktitle = {International Symposium on Intelligent Signal Processing and Communications
Systems, {ISPACS} 2012, Tamsui, New Taipei City, Taiwan, November
4-7, 2012},
pages = {254--257},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISPACS.2012.6473490},
doi = {10.1109/ISPACS.2012.6473490},
timestamp = {Tue, 23 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ispacs/LiWCLYLHW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispacs/SuHHLC12,
author = {Mu{-}Chun Su and
Ting{-}Huan Hsio and
Yi{-}Zeng Hsieh and
Shih{-}Chieh Lin and
Chien{-}Hsing Chou},
title = {A neural-network-based sketch recognition system},
booktitle = {International Symposium on Intelligent Signal Processing and Communications
Systems, {ISPACS} 2012, Tamsui, New Taipei City, Taiwan, November
4-7, 2012},
pages = {420--423},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISPACS.2012.6473523},
doi = {10.1109/ISPACS.2012.6473523},
timestamp = {Tue, 23 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ispacs/SuHHLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/BulzacchelliBSHRFGPMHHMSKAKRGCTF12,
author = {John F. Bulzacchelli and
Troy J. Beukema and
Daniel W. Storaska and
Ping{-}Hsuan Hsieh and
Sergey V. Rylov and
Daniel Furrer and
Daniele Gardellini and
Andrea Prati and
Christian Menolfi and
David Hanson and
Juergen Hertle and
Thomas Morf and
Vivek Sharma and
Ram Kelkar and
Herschel A. Ainspan and
William R. Kelly and
Glenn Ritter and
Jon Garlett and
Robert Callan and
Thomas Toifl and
Daniel J. Friedman},
title = {A 28Gb/s 4-tap FFE/15-tap {DFE} serial link transceiver in 32nm {SOI}
{CMOS} technology},
booktitle = {2012 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2012, San Francisco, CA, USA, February 19-23, 2012},
pages = {324--326},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISSCC.2012.6177031},
doi = {10.1109/ISSCC.2012.6177031},
timestamp = {Fri, 12 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/BulzacchelliBSHRFGPMHHMSKAKRGCTF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/HsiehCLC12,
author = {Min{-}Han Hsieh and
Liang{-}Hsin Chen and
Shen{-}Iuan Liu and
Charlie Chung{-}Ping Chen},
title = {A 6.7MHz-to-1.24GHz 0.0318mm\({}^{\mbox{2}}\) fast-locking all-digital
{DLL} in 90nm {CMOS}},
booktitle = {2012 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2012, San Francisco, CA, USA, February 19-23, 2012},
pages = {244--246},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISSCC.2012.6176994},
doi = {10.1109/ISSCC.2012.6176994},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/HsiehCLC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/KimBTJHRCC12,
author = {Yanghyo Kim and
Gyungsu Byun and
Adrian Tang and
Chewnpu Jou and
Hsieh{-}Hung Hsieh and
Glenn Reinman and
Jason Cong and
Mau{-}Chung Frank Chang},
title = {An 8Gb/s/pin 4pJ/b/pin Single-T-Line dual (base+RF) band simultaneous
bidirectional mobile memory {I/O} interface with inter-channel interference
suppression},
booktitle = {2012 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2012, San Francisco, CA, USA, February 19-23, 2012},
pages = {50--52},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ISSCC.2012.6176874},
doi = {10.1109/ISSCC.2012.6176874},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/KimBTJHRCC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mlslp/DhillonHSR12,
author = {Inderjit S. Dhillon and
Cho{-}Jui Hsieh and
M{\'{a}}ty{\'{a}}s A. Sustik and
Pradeep Ravikumar},
title = {Sparse inverse covariance matrix estimation using quadratic approximation},
booktitle = {2012 Symposium on Machine Learning in Speech and Language Processing,
{MLSLP} 2012, Portland, Oregon, USA, September 14, 2012},
publisher = {{ISCA}},
year = {2012},
url = {https://www.isca-archive.org/mlslp\_2012/dhillon12\_mlslp.html},
timestamp = {Thu, 01 Aug 2024 15:37:24 +0200},
biburl = {https://dblp.org/rec/conf/mlslp/DhillonHSR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mwscas/VamvakosGRCCDDH12,
author = {Socrates D. Vamvakos and
Claude R. Gauthier and
Chethan Rao and
Karthisha Ramoshan Canagasaby and
Prashant Choudhary and
Sanjay Dabral and
Shaishav Desai and
Mahmudul Hassan and
Kuo{-}Chiang Hsieh and
Bendik Kleveland and
Gurupada Mandal and
Richard Rouse and
Ritesh Saraf and
Alvin Wang and
Jason Yeung and
Khaldoon Abugharbieh and
Ying Cao},
title = {A 2.488-11.2 Gb/s multi-protocol SerDes in 40nm low-leakage {CMOS}
for {FPGA} applications},
booktitle = {55th {IEEE} International Midwest Symposium on Circuits and Systems,
{MWSCAS} 2012, Boise, ID, USA, August 5-8, 2012},
pages = {5--8},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/MWSCAS.2012.6291943},
doi = {10.1109/MWSCAS.2012.6291943},
timestamp = {Mon, 09 Aug 2021 14:54:01 +0200},
biburl = {https://dblp.org/rec/conf/mwscas/VamvakosGRCCDDH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/osdi/CorbettDEFFFGGHHHKKLLMMNQRRSSTWW12,
author = {James C. Corbett and
Jeffrey Dean and
Michael Epstein and
Andrew Fikes and
Christopher Frost and
J. J. Furman and
Sanjay Ghemawat and
Andrey Gubarev and
Christopher Heiser and
Peter Hochschild and
Wilson C. Hsieh and
Sebastian Kanthak and
Eugene Kogan and
Hongyi Li and
Alexander Lloyd and
Sergey Melnik and
David Mwaura and
David Nagle and
Sean Quinlan and
Rajesh Rao and
Lindsay Rolig and
Yasushi Saito and
Michal Szymaniak and
Christopher Taylor and
Ruth Wang and
Dale Woodford},
editor = {Chandu Thekkath and
Amin Vahdat},
title = {Spanner: Google's Globally-Distributed Database},
booktitle = {10th {USENIX} Symposium on Operating Systems Design and Implementation,
{OSDI} 2012, Hollywood, CA, USA, October 8-10, 2012},
pages = {251--264},
publisher = {{USENIX} Association},
year = {2012},
url = {https://www.usenix.org/conference/osdi12/technical-sessions/presentation/corbett},
timestamp = {Tue, 02 Feb 2021 08:05:55 +0100},
biburl = {https://dblp.org/rec/conf/osdi/CorbettDEFFFGGHHHKKLLMMNQRRSSTWW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/paclic/HsiehCS12,
author = {Shu{-}Kai Hsieh and
Yu{-}Yun Chang and
Meng{-}Xian Shih},
title = {Chinese Sentiments on the Clouds: {A} Preliminary Experiment on Corpus
Processing and Exploration on Cloud Service},
booktitle = {Proceedings of the 26th Pacific Asia Conference on Language, Information
and Computation, {PACLIC} 26, Bali, Indonesia, December 16-18, 2012},
pages = {491--497},
publisher = {{PACLIC} 26 Organizing Committee and {PACLIC} Steering Committee /
{ACL} / Faculty of Computer Science, Universitas Indonesia},
year = {2012},
url = {https://aclanthology.org/Y12-1053/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/paclic/HsiehCS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ph/RamanathanAFGHJKLOSTE12,
author = {Nithya Ramanathan and
Faisal Alquaddoomi and
Hossein Falaki and
Dony George and
Cheng{-}Kang Hsieh and
John Jenkins and
Cameron Ketcham and
Brent Longstaff and
Jeroen Ooms and
Joshua Selsky and
Hongsuda Tangmunarunkit and
Deborah Estrin},
title = {ohmage: An open mobile system for activity and experience sampling},
booktitle = {6th International Conference on Pervasive Computing Technologies for
Healthcare, PervasiveHealth 2012 and Workshops, San Diego, CA, USA,
May 21-24, 2012},
pages = {203--204},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.4108/icst.pervasivehealth.2012.248705},
doi = {10.4108/ICST.PERVASIVEHEALTH.2012.248705},
timestamp = {Wed, 11 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ph/RamanathanAFGHJKLOSTE12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/EssenHAG12,
author = {Brian Van Essen and
Henry Hsieh and
Sasha Ames and
Maya B. Gokhale},
title = {{DI-MMAP:} {A} High Performance Memory-Map Runtime for Data-Intensive
Applications},
booktitle = {2012 {SC} Companion: High Performance Computing, Networking Storage
and Analysis, Salt Lake City, UT, USA, November 10-16, 2012},
pages = {731--735},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/SC.Companion.2012.99},
doi = {10.1109/SC.COMPANION.2012.99},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/EssenHAG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uic/HsiehSLJ12,
author = {Shang{-}Lin Hsieh and
Ming Hsiung Su and
Lu Feng Liu and
Wey{-}Wen Jiang},
editor = {Bernady O. Apduhan and
Ching{-}Hsien Hsu and
Tadashi Dohi and
Kenji Ishida and
Laurence Tianruo Yang and
Jianhua Ma},
title = {A Finite State Machine-Based Fall Detection Mechanism on Smartphones},
booktitle = {9th International Conference on Ubiquitous Intelligence and Computing
and 9th International Conference on Autonomic and Trusted Computing,
{UIC/ATC} 2012, Fukuoka, Japan, September 4-7, 2012},
pages = {735--739},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/UIC-ATC.2012.153},
doi = {10.1109/UIC-ATC.2012.153},
timestamp = {Thu, 01 Feb 2024 20:40:31 +0100},
biburl = {https://dblp.org/rec/conf/uic/HsiehSLJ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/LiHLS12,
author = {Cheng{-}Te Li and
Hsun{-}Ping Hsieh and
Shou{-}De Lin and
Man{-}Kwan Shan},
editor = {Alain Mille and
Fabien Gandon and
Jacques Misselis and
Michael Rabinovich and
Steffen Staab},
title = {Finding influential seed successors in social networks},
booktitle = {Proceedings of the 21st World Wide Web Conference, {WWW} 2012, Lyon,
France, April 16-20, 2012 (Companion Volume)},
pages = {557--558},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2187980.2188125},
doi = {10.1145/2187980.2188125},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/www/LiHLS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ahswn/LiuLHTS11,
author = {Ning{-}Han Liu and
Cheng{-}Yi Li and
Shu{-}Ju Hsieh and
Cheng{-}Fa Tsai and
Min{-}Hua Shao},
title = {Long-term Audio Observation by Wireless Sensor Networks with Filtering
Strategies},
journal = {Ad Hoc Sens. Wirel. Networks},
volume = {12},
number = {1-2},
pages = {151--167},
year = {2011},
url = {http://www.oldcitypublishing.com/journals/ahswn-home/ahswn-issue-contents/ahswn-volume-12-number-1-2-2011/ahswn-12-1-2-p-151-167/},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ahswn/LiuLHTS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/SuLWHL11,
author = {Mu{-}Chun Su and
Shih{-}Chang Lai and
Pa{-}Chun Wang and
Yi{-}Zeng Hsieh and
Shih{-}Chieh Lin},
title = {A SOMO-based approach to the operating room scheduling problem},
journal = {Expert Syst. Appl.},
volume = {38},
number = {12},
pages = {15447--15454},
year = {2011},
url = {https://doi.org/10.1016/j.eswa.2011.06.016},
doi = {10.1016/J.ESWA.2011.06.016},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eswa/SuLWHL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/JangCCHHH11,
author = {Sheng{-}Lyang Jang and
Chia{-}Wei Chang and
Yu{-}Sheng Chen and
Jhin{-}Fang Huang and
Jau{-}Wei Hsieh and
Chong{-}Wei Huang},
title = {A 0.18 {\(\mathrm{\mu}\)}m {CMOS} Wide-Band Injection-Locked Frequency
Divider Using Push-Push Oscillator},
journal = {{IEICE} Trans. Electron.},
volume = {94-C},
number = {8},
pages = {1332--1335},
year = {2011},
url = {https://doi.org/10.1587/transele.E94.C.1332},
doi = {10.1587/TRANSELE.E94.C.1332},
timestamp = {Sat, 11 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieicet/JangCCHHH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbra/ChiuHT11,
author = {Sung{-}Kay Chiu and
Ming{-}Hua Hsieh and
Chi{-}Meng Tzeng},
title = {Unique marker finder algorithm generates molecular diagnostic markers},
journal = {Int. J. Bioinform. Res. Appl.},
volume = {7},
number = {1},
pages = {24--42},
year = {2011},
url = {https://doi.org/10.1504/IJBRA.2011.039168},
doi = {10.1504/IJBRA.2011.039168},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbra/ChiuHT11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/paapp/ChenTSCHW11,
author = {Chi{-}Tung Chen and
Sirin Tekinay and
Cem U. Saraydar and
Hsing{-}Chung Chen and
Ming{-}Yuan Hsieh and
Jyu{-}Wei Wang},
title = {Flexible architecture of relay-based wireless network for network
lifetime extension with hop-count constraint},
journal = {Int. J. Parallel Emergent Distributed Syst.},
volume = {26},
number = {2},
pages = {121--148},
year = {2011},
url = {https://doi.org/10.1080/17445761003691882},
doi = {10.1080/17445761003691882},
timestamp = {Fri, 06 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/paapp/ChenTSCHW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/HuangLHTWLWCYF11,
author = {Chien{-}Hsin Huang and
Chien{-}Hsing Lee and
Tsung{-}Min Hsieh and
Li{-}Chi Tsao and
Shaoyi Wu and
Jhyy{-}Cheng Liou and
Mingyi Wang and
Li{-}Che Chen and
Ming{-}Chuen Yip and
Weileun Fang},
title = {Implementation of the {CMOS} {MEMS} Condenser Microphone with Corrugated
Metal Diaphragm and Silicon Back-Plate},
journal = {Sensors},
volume = {11},
number = {6},
pages = {6257--6269},
year = {2011},
url = {https://doi.org/10.3390/s110606257},
doi = {10.3390/S110606257},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sensors/HuangLHTWLWCYF11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamam/McCueHMN11,
author = {Scott W. McCue and
Mike H.{-}N. Hsieh and
Timothy J. Moroney and
Mark I. Nelson},
title = {Asymptotic and Numerical Results for a Model of Solvent-Dependent
Drug Diffusion through Polymeric Spheres},
journal = {{SIAM} J. Appl. Math.},
volume = {71},
number = {6},
pages = {2287--2311},
year = {2011},
url = {https://doi.org/10.1137/110821688},
doi = {10.1137/110821688},
timestamp = {Wed, 20 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamam/McCueHMN11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmetrics/HsiehRRTS11,
author = {Ming{-}yu Hsieh and
Arun Rodrigues and
Rolf Riesen and
Kevin Thompson and
William J. Song},
title = {A framework for architecture-level power, area, and thermal simulation
and its application to network-on-chip design exploration},
journal = {{SIGMETRICS} Perform. Evaluation Rev.},
volume = {38},
number = {4},
pages = {63--68},
year = {2011},
url = {https://doi.org/10.1145/1964218.1964229},
doi = {10.1145/1964218.1964229},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigmetrics/HsiehRRTS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/LeeSLCHYLLF11,
author = {Shuenn{-}Yuh Lee and
Mario YuCheng Su and
Ming{-}Chun Liang and
You{-}Yin Chen and
Cheng{-}Han Hsieh and
Chung{-}Min Yang and
Hsin{-}Yi Lai and
Jou{-}Wei Lin and
Qiang Fang},
title = {A Programmable Implantable Microstimulator SoC With Wireless Telemetry:
Application in Closed-Loop Endocardial Stimulation for Cardiac Pacemaker},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {5},
number = {6},
pages = {511--522},
year = {2011},
url = {https://doi.org/10.1109/TBCAS.2011.2177661},
doi = {10.1109/TBCAS.2011.2177661},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbcas/LeeSLCHYLLF11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/TangCCHS11,
author = {Kea{-}Tiong Tang and
Shih{-}Wen Chiu and
Meng{-}Fan Chang and
Chih{-}Cheng Hsieh and
Jyuo{-}Min Shyu},
title = {A Low-Power Electronic Nose Signal-Processing Chip for a Portable
Artificial Olfaction System},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {5},
number = {4},
pages = {380--390},
year = {2011},
url = {https://doi.org/10.1109/TBCAS.2011.2116786},
doi = {10.1109/TBCAS.2011.2116786},
timestamp = {Thu, 24 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbcas/TangCCHS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/DorrellHPESG11,
author = {David George Dorrell and
Min{-}Fu Hsieh and
Mircea Popescu and
Lyndon Evans and
David A. Staton and
Vic Grout},
title = {A Review of the Design Issues and Techniques for Radial-Flux Brushless
Surface and Internal Rare-Earth Permanent-Magnet Motors},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {58},
number = {9},
pages = {3741--3757},
year = {2011},
url = {https://doi.org/10.1109/TIE.2010.2089940},
doi = {10.1109/TIE.2010.2089940},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/DorrellHPESG11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tr/YehSHCL11,
author = {Wei{-}Chang Yeh and
J. C. P. Su and
Tsung{-}Jung Hsieh and
Mingchang Chih and
Sin{-}Long Liu},
title = {Approximate Reliability Function Based on Wavelet Latin Hypercube
Sampling and Bee Recurrent Neural Network},
journal = {{IEEE} Trans. Reliab.},
volume = {60},
number = {2},
pages = {404--414},
year = {2011},
url = {https://doi.org/10.1109/TR.2011.2134190},
doi = {10.1109/TR.2011.2134190},
timestamp = {Fri, 28 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tr/YehSHCL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acsc/HsiehHT11,
author = {Chaur{-}Heh Hsieh and
Ping Sheng Huang and
Ming{-}Da Tang},
editor = {Mark Reynolds},
title = {The Recognition of Human Action Using Silhouette Histogram},
booktitle = {Thirty-Fourth Australasian Computer Science Conference, {ACSC} 2011,
Perth, Australia, January 2011},
series = {{CRPIT}},
volume = {113},
pages = {11--16},
publisher = {Australian Computer Society},
year = {2011},
url = {http://crpit.scem.westernsydney.edu.au/abstracts/CRPITV113Hsieh.html},
timestamp = {Fri, 02 Jul 2021 14:00:51 +0200},
biburl = {https://dblp.org/rec/conf/acsc/HsiehHT11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asist/AytacKNRPH11,
author = {Selenay Aytac and
Margaret E. I. Kipp and
Diane Neal and
Victoria L. Rubin and
Cristina Pattuelli and
Ingrid Hsieh{-}Yee},
title = {Emerging trends in knowledge organization and information organization
course curriculum},
booktitle = {Bridging the Gulf: Communication and Information in Society, Technology,
and Work - Proceedings of the 74th ASIS{\&}T Annual Meeting, {ASIST}
2011, New Orleans, LA, USA, October 9-12, 2011},
series = {Proc. Assoc. Inf. Sci. Technol.},
volume = {48},
number = {1},
pages = {1--4},
publisher = {Wiley},
year = {2011},
url = {https://doi.org/10.1002/meet.2011.14504801079},
doi = {10.1002/MEET.2011.14504801079},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asist/AytacKNRPH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/LeeFCCLCCSHL11,
author = {Yu{-}Huei Lee and
Ming{-}Yan Fan and
Wei{-}Chung Chen and
Ke{-}Horng Chen and
Sheng{-}Fa Liu and
Pao{-}Hsien Chiu and
Sandy Chen and
Chun{-}Yu Shen and
Ming{-}Ta Hsieh and
Huai{-}An Li},
editor = {Rakesh Patel and
Tom Andre and
Aurangzeb Khan},
title = {A near-zero cross-regulation single-inductor bipolar-output {(SIBO)}
converter with an active-energy-correlation control for driving cholesteric-LCD},
booktitle = {2011 {IEEE} Custom Integrated Circuits Conference, {CICC} 2011, San
Jose, CA, USA, Sept. 19-21, 2011},
pages = {1--4},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/CICC.2011.6055341},
doi = {10.1109/CICC.2011.6055341},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cicc/LeeFCCLCCSHL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cscl/LinnSCHSMCCXZSM11,
author = {Marcia C. Linn and
Ji Shen and
Hsin{-}Yi Chang and
Fang{-}Pei Hsieh and
Beat Schwendimann and
Camillia Matuk and
Jennifer King Chen and
Jennifer L. Chiu and
Charles Xie and
Baohui Zhang and
Daner Sun and
Karel Mous and
Quee Boon Koh and
Bahadia Namdar and
Rutchelle Enriquez and
Jing Lei and
Heng Luo and
Sunghye Lee and
Hsin{-}Kai Wu},
title = {Collaboration as Scaffolding: Learning Together with Dynamic, Interactive
Scientific Visualizations and Computer Models},
booktitle = {Proceedings of the 9th International Conference on Computer Supported
Collaborative Learning, {CSCL} 2011, Hong Kong, July 4-8, 2011},
publisher = {International Society of the Learning Sciences},
year = {2011},
url = {https://repository.isls.org/handle/1/2402},
timestamp = {Wed, 28 Apr 2021 17:11:51 +0200},
biburl = {https://dblp.org/rec/conf/cscl/LinnSCHSMCCXZSM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ercimdl/AkbarFSCCDGHSFCHSF11,
author = {Monika Akbar and
Weiguo Fan and
Clifford A. Shaffer and
Yinlin Chen and
Lillian N. Cassel and
Lois M. L. Delcambre and
Daniel D. Garcia and
Gregory W. Hislop and
Frank M. Shipman III and
Richard Furuta and
B. Stephen Carpenter II and
Hao{-}wei Hsieh and
Bob Siegfried and
Edward A. Fox},
editor = {Stefan Gradmann and
Francesca Borri and
Carlo Meghini and
Heiko Schuldt},
title = {Digital Library 2.0 for Educational Resources},
booktitle = {Research and Advanced Technology for Digital Libraries - International
Conference on Theory and Practice of Digital Libraries, {TPDL} 2011,
Berlin, Germany, September 26-28, 2011. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6966},
pages = {89--100},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-24469-8\_11},
doi = {10.1007/978-3-642-24469-8\_11},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ercimdl/AkbarFSCCDGHSFCHSF11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/ChenSHX11,
author = {Changlong Chen and
Min Song and
George Hsieh and
Chunsheng Xin},
title = {A {PLL} Based Approach to Building an Effective Covert Timing Channel},
booktitle = {Proceedings of the Global Communications Conference, {GLOBECOM} 2011,
5-9 December 2011, Houston, Texas, {USA}},
pages = {1--5},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/GLOCOM.2011.6134373},
doi = {10.1109/GLOCOM.2011.6134373},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/globecom/ChenSHX11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ibica/HuangLHWHCTHHSLCC11,
author = {Sheng{-}Chieh Huang and
Yung{-}Pin Lee and
Min{-}Hua Hsieh and
Hui{-}Min Wang and
Mark C. Hou and
Shih{-}Chun Chao and
Cheng{-}Lung Tseng and
Wei{-}Ta Hsiao and
Chung{-}Hung Hong and
Kai{-}Yu Shao and
Shi{-}Han Luo and
Wei{-}Chun Chiu and
Wei{-}Yu Chen},
title = {What's Happening to Our Body after Drinking Coke? The Characteristic
of the Blood Pressure Wave in Radial Artery},
booktitle = {Second International Conference on Innovations in Bio-inspired Computing
and Applications, {IBICA} 2011, Shenzhen, China, 16-18 December, 2011},
pages = {41--44},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/IBICA.2011.15},
doi = {10.1109/IBICA.2011.15},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ibica/HuangLHWHCTHHSLCC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icinco/GonzalezHMHHISB11,
author = {Maximillian Gonzalez and
Xinheng Huang and
David S. Hermina Martinez and
Chung H. Hsieh and
Yuan R. Huang and
Benjamin Irvine and
Martin B. Short and
Andrea L. Bertozzi},
editor = {Jean{-}Louis Ferrier and
Alain Bernard and
Oleg Yu. Gusikhin and
Kurosh Madani},
title = {A Third Generation Micro-vehicle Testbed for Cooperative Control and
Sensing Strategies},
booktitle = {{ICINCO} 2011 - Proceedings of the 8th International Conference on
Informatics in Control, Automation and Robotics, Volume 2, Noordwijkerhout,
The Netherlands, 28 - 31 July, 2011},
pages = {14--20},
publisher = {SciTePress},
year = {2011},
timestamp = {Tue, 03 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icinco/GonzalezHMHHISB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmcs/SuHMT11,
author = {Ja{-}Hwung Su and
Ming{-}Hua Hsieh and
Tao Mei and
Vincent S. Tseng},
title = {Photosense: Make sense of your photos with enriched harmonic music
via emotion association},
booktitle = {Proceedings of the 2011 {IEEE} International Conference on Multimedia
and Expo, {ICME} 2011, 11-15 July, 2011, Barcelona, Catalonia, Spain},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ICME.2011.6011994},
doi = {10.1109/ICME.2011.6011994},
timestamp = {Tue, 06 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmcs/SuHMT11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/WangHWLCLC11,
author = {Yu{-}Shun Wang and
Min{-}Han Hsieh and
Yi{-}Chi Wu and
Chia{-}Ming Liu and
Hsien{-}Chen Chiu and
Bing{-}Feng Lin and
Charlie Chung{-}Ping Chen},
title = {A 12 Gb/s chip-to-chip {AC} coupled transceiver},
booktitle = {International Symposium on Circuits and Systems {(ISCAS} 2011), May
15-19 2011, Rio de Janeiro, Brazil},
pages = {1692--1695},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ISCAS.2011.5937907},
doi = {10.1109/ISCAS.2011.5937907},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/WangHWLCLC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/YangHHLWFDCC11,
author = {Yao{-}Yi Yang and
Chun{-}Yu Hsieh and
Tzu{-}Chi Huang and
Yu{-}Huei Lee and
Shih{-}Wei Wang and
Ming{-}Yan Fan and
Ming{-}Jhe Du and
Shih{-}Hsien Cheng and
Ke{-}Horng Chen},
title = {A 80V output voltage boost converter with low voltage ripple for Avalanche
Photodiode(APD)},
booktitle = {International Symposium on Circuits and Systems {(ISCAS} 2011), May
15-19 2011, Rio de Janeiro, Brazil},
pages = {757--760},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ISCAS.2011.5937676},
doi = {10.1109/ISCAS.2011.5937676},
timestamp = {Mon, 16 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/YangHHLWFDCC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/ByunKKTHWJCRC11,
author = {Gyungsu Byun and
Yanghyo Kim and
Jongsun Kim and
Sai{-}Wang Tam and
Hsieh{-}Hung Hsieh and
P.{-}Y. Wu and
Chewnpu Jou and
Jason Cong and
Glenn Reinman and
Mau{-}Chung Frank Chang},
title = {An 8.4Gb/s 2.5pJ/b mobile memory {I/O} interface using simultaneous
bidirectional Dual (Base+RF) band signaling},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2011,
Digest of Technical Papers, San Francisco, CA, USA, 20-24 February,
2011},
pages = {488--490},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ISSCC.2011.5746409},
doi = {10.1109/ISSCC.2011.5746409},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/ByunKKTHWJCRC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/LeeSLHHYCLLF11,
author = {Shuenn{-}Yuh Lee and
Yu{-}Cheng Su and
Ming{-}Chun Liang and
Jia{-}Hua Hong and
Cheng{-}Han Hsieh and
Chung{-}Min Yang and
You{-}Yin Chen and
Hsin{-}Yi Lai and
Jou{-}Wei Lin and
Qiang Fang},
title = {A programmable implantable micro-stimulator SoC with wireless telemetry:
Application in closed-loop endocardial stimulation for cardiac pacemaker},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2011,
Digest of Technical Papers, San Francisco, CA, USA, 20-24 February,
2011},
pages = {44--45},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ISSCC.2011.5746212},
doi = {10.1109/ISSCC.2011.5746212},
timestamp = {Sun, 04 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/LeeSLHHYCLLF11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/msn/WangSHX11,
author = {Jun Wang and
Min Song and
George Hsieh and
Chunsheng Xin},
editor = {Junliang Chen and
Huadong Ma and
Ivan Stojmenovic},
title = {Minimum Cost Broadcast in Multi-radio Multi-channel Wireless Mesh
Networks},
booktitle = {Seventh International Conference on Mobile Ad-hoc and Sensor Networks,
{MSN} 2011, Beijing, China, December 16-18, 2011},
pages = {238--247},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/MSN.2011.46},
doi = {10.1109/MSN.2011.46},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/msn/WangSHX11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/LeeLHTLLCCJ11,
author = {Chi{-}Yuan Lee and
Shuo{-}Jen Lee and
Chien{-}Te Hsieh and
Ming{-}Shao Tang and
Jia{-}Yi Lin and
Yi{-}Man Lo and
Pei{-}Chi Chen and
Dar{-}Yuan Chang and
Ruey{-}Shin Juang},
title = {In situ monitoring of voltage and temperature in lithium batteries},
booktitle = {6th {IEEE} International Conference on Nano/Micro Engineered and Molecular
Systems, {NEMS} 2011, Kaohsiung, Taiwan, February 20-23, 2011},
pages = {237--240},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/NEMS.2011.6017338},
doi = {10.1109/NEMS.2011.6017338},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/nems/LeeLHTLLCCJ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/HsiehSDR11,
author = {Cho{-}Jui Hsieh and
M{\'{a}}ty{\'{a}}s A. Sustik and
Inderjit S. Dhillon and
Pradeep Ravikumar},
editor = {John Shawe{-}Taylor and
Richard S. Zemel and
Peter L. Bartlett and
Fernando C. N. Pereira and
Kilian Q. Weinberger},
title = {Sparse Inverse Covariance Matrix Estimation Using Quadratic Approximation},
booktitle = {Advances in Neural Information Processing Systems 24: 25th Annual
Conference on Neural Information Processing Systems 2011. Proceedings
of a meeting held 12-14 December 2011, Granada, Spain},
pages = {2330--2338},
year = {2011},
url = {https://proceedings.neurips.cc/paper/2011/hash/2ba8698b79439589fdd2b0f7218d8b07-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/HsiehSDR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/LiCHMKBRJ11,
author = {Sheng Li and
Ke Chen and
Ming{-}yu Hsieh and
Naveen Muralimanohar and
Chad D. Kersey and
Jay B. Brockman and
Arun F. Rodrigues and
Norman P. Jouppi},
editor = {Scott A. Lathrop and
Jim Costa and
William Kramer},
title = {System implications of memory reliability in exascale computing},
booktitle = {Conference on High Performance Computing Networking, Storage and Analysis,
{SC} 2011, Seattle, WA, USA, November 12-18, 2011},
pages = {46:1--46:12},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2063384.2063445},
doi = {10.1145/2063384.2063445},
timestamp = {Thu, 05 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/LiCHMKBRJ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aei/TsaiKH10,
author = {Meng{-}Han Tsai and
Shih{-}Chung Kang and
Shang{-}Hsien Hsieh},
title = {A three-stage framework for introducing a 4D tool in large consulting
firms},
journal = {Adv. Eng. Informatics},
volume = {24},
number = {4},
pages = {476--489},
year = {2010},
url = {https://doi.org/10.1016/j.aei.2010.04.002},
doi = {10.1016/J.AEI.2010.04.002},
timestamp = {Tue, 23 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aei/TsaiKH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcsb/HsiehYREW10,
author = {Ming{-}yu Hsieh and
Shujie Yang and
Mary Raymond{-}Stinz and
Jeremy S. Edwards and
Bridget S. Wilson},
title = {Spatio-temporal modeling of signaling protein recruitment to {EGFR}},
journal = {{BMC} Syst. Biol.},
volume = {4},
pages = {57},
year = {2010},
url = {https://doi.org/10.1186/1752-0509-4-57},
doi = {10.1186/1752-0509-4-57},
timestamp = {Tue, 05 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcsb/HsiehYREW10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/candie/ChungH10,
author = {Shu{-}Hsing Chung and
Ming{-}Hsiu Hsieh},
title = {Interim equipment shutdown planning for a wafer fab during economic
downturns},
journal = {Comput. Ind. Eng.},
volume = {59},
number = {4},
pages = {819--829},
year = {2010},
url = {https://doi.org/10.1016/j.cie.2010.08.009},
doi = {10.1016/J.CIE.2010.08.009},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/candie/ChungH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cin/McAsseyHS10,
author = {Michael P. McAssey and
Fushing Hsieh and
Anne C. Smith},
title = {Coupling among Electroencephalogram Gamma Signals on a Short Time
Scale},
journal = {Comput. Intell. Neurosci.},
volume = {2010},
pages = {946089:1--946089:12},
year = {2010},
url = {https://doi.org/10.1155/2010/946089},
doi = {10.1155/2010/946089},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cin/McAsseyHS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cphysics/SmithKHYWF10,
author = {Matthew R. Smith and
Fang{-}An Kuo and
Chih{-}Wei Hsieh and
Jen{-}Perng Yu and
Jong{-}Shinn Wu and
Alex Ferguson},
title = {Rapid optimization of blast wave mitigation strategies using Quiet
Direct Simulation and Genetic Algorithm},
journal = {Comput. Phys. Commun.},
volume = {181},
number = {6},
pages = {1025--1036},
year = {2010},
url = {https://doi.org/10.1016/j.cpc.2010.02.009},
doi = {10.1016/J.CPC.2010.02.009},
timestamp = {Thu, 07 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cphysics/SmithKHYWF10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/LinHT10,
author = {Kawuu Weicheng Lin and
Ming{-}Hua Hsieh and
Vincent S. Tseng},
title = {A novel prediction-based strategy for object tracking in sensor networks
by mining seamless temporal movement patterns},
journal = {Expert Syst. Appl.},
volume = {37},
number = {4},
pages = {2799--2807},
year = {2010},
url = {https://doi.org/10.1016/j.eswa.2009.09.011},
doi = {10.1016/J.ESWA.2009.09.011},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eswa/LinHT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-com/ChengHC10,
author = {Sheng{-}Tzong Cheng and
Ming{-}Tzung Hsieh and
Bo{-}Fu Chen},
title = {Fairness-based scheduling algorithm for time division duplex mode
{IEEE} 802.16 broadband wireless access systems},
journal = {{IET} Commun.},
volume = {4},
number = {9},
pages = {1065--1072},
year = {2010},
url = {https://doi.org/10.1049/iet-com.2009.0083},
doi = {10.1049/IET-COM.2009.0083},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iet-com/ChengHC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijebm/LinHL10,
author = {Jwu{-}Rong Lin and
Chen{-}Jui Huang and
Hsieh{-}Lung Liu},
title = {A Matching Approach to M{\&}A, R{\&}D, and Patents: Evidence
from Taiwan's Listed Companies},
journal = {Int. J. Electron. Bus. Manag.},
volume = {8},
number = {4},
pages = {282--291},
year = {2010},
url = {http://ijebm.ie.nthu.edu.tw/IJEBM\_Web/IJEBM\_static/Paper-V8\_N4/A04.pdf},
timestamp = {Mon, 28 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijebm/LinHL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijinfoman/SeahHW10,
author = {Melody Seah and
Ming{-}Huei Hsieh and
Pu{-}Dong Weng},
title = {A case analysis of Savecom: The role of indigenous leadership in implementing
a business intelligence system},
journal = {Int. J. Inf. Manag.},
volume = {30},
number = {4},
pages = {368--373},
year = {2010},
url = {https://doi.org/10.1016/j.ijinfomgt.2010.04.002},
doi = {10.1016/J.IJINFOMGT.2010.04.002},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijinfoman/SeahHW10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jaciii/SuWHWHLH10,
author = {Mu{-}Chun Su and
Shao{-}Jui Wang and
Chen{-}Ko Huang and
Pa{-}Chun Wang and
Fu{-}Hau Hsu and
Shih{-}Chieh Lin and
Yi{-}Zeng Hsieh},
title = {A Signal-Representation-Based Parser to Extract Text-Based Information
from the Web},
journal = {J. Adv. Comput. Intell. Intell. Informatics},
volume = {14},
number = {5},
pages = {531--539},
year = {2010},
url = {https://doi.org/10.20965/jaciii.2010.p0531},
doi = {10.20965/JACIII.2010.P0531},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jaciii/SuWHWHLH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/VisweswaranAHWYC10,
author = {Shyam Visweswaran and
Derek C. Angus and
Margaret Hsieh and
Lisa A. Weissfeld and
Donald Yealy and
Gregory F. Cooper},
title = {Learning patient-specific predictive models from clinical data},
journal = {J. Biomed. Informatics},
volume = {43},
number = {5},
pages = {669--685},
year = {2010},
url = {https://doi.org/10.1016/j.jbi.2010.04.009},
doi = {10.1016/J.JBI.2010.04.009},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/VisweswaranAHWYC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/PayneCSHK10,
author = {Robert Payne and
Marco Corsi and
David Smith and
Tien{-}Ling Hsieh and
Scott Kaylor},
title = {A 16-Bit 100 to 160 MS/s SiGe BiCMOS Pipelined {ADC} With 100 dBFS
{SFDR}},
journal = {{IEEE} J. Solid State Circuits},
volume = {45},
number = {12},
pages = {2613--2622},
year = {2010},
url = {https://doi.org/10.1109/JSSC.2010.2074650},
doi = {10.1109/JSSC.2010.2074650},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/PayneCSHK10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/HayashiHS10,
author = {Yoichi Hayashi and
Ming{-}Huei Hsieh and
Rudy Setiono},
title = {Understanding consumer heterogeneity: {A} business intelligence application
of neural networks},
journal = {Knowl. Based Syst.},
volume = {23},
number = {8},
pages = {856--863},
year = {2010},
url = {https://doi.org/10.1016/j.knosys.2010.05.010},
doi = {10.1016/J.KNOSYS.2010.05.010},
timestamp = {Tue, 25 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/kbs/HayashiHS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/KuoLLYCHLL10,
author = {Shou{-}Yi Kuo and
Kou{-}Chen Liu and
Fang{-}I Lai and
Jui{-}Fu Yang and
Wei{-}Chun Chen and
Ming{-}Yang Hsieh and
Hsin{-}I Lin and
Woei{-}Tyng Lin},
title = {Effects of {RF} power on the structural, optical and electrical properties
of Al-doped zinc oxide films},
journal = {Microelectron. Reliab.},
volume = {50},
number = {5},
pages = {730--733},
year = {2010},
url = {https://doi.org/10.1016/j.microrel.2010.01.042},
doi = {10.1016/J.MICROREL.2010.01.042},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mr/KuoLLYCHLL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/WangLHHCYL10,
author = {Mu{-}Chun Wang and
Chuan{-}Hsi Liu and
Kuo{-}Shu Huang and
Zhen{-}Ying Hsieh and
Shuang{-}Yuan Chen and
Hsin{-}Chia Yang and
Chii{-}Ruey Lin},
title = {Promoting of charged-device model/electrostatic discharge immunity
in the dicing saw process},
journal = {Microelectron. Reliab.},
volume = {50},
number = {6},
pages = {839--846},
year = {2010},
url = {https://doi.org/10.1016/j.microrel.2010.02.018},
doi = {10.1016/J.MICROREL.2010.02.018},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mr/WangLHHCYL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ncn/ShihHW10,
author = {Yi{-}Chang Shih and
Min{-}Hsiu Hsieh and
Hung{-}Yu Wei},
title = {Multicasting homogeneous and heterogeneous quantum states in quantum
networks},
journal = {Nano Commun. Networks},
volume = {1},
number = {4},
pages = {273--282},
year = {2010},
url = {https://doi.org/10.1016/j.nancom.2010.10.003},
doi = {10.1016/J.NANCOM.2010.10.003},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ncn/ShihHW10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/orgsci/HsiehLNL10,
author = {Chihmao Hsieh and
S{\'{e}}rgio Giovanetti Lazzarini and
Jackson A. Nickerson and
Marcio Laurini},
title = {Does Ownership Affect the Variability of the Production Process? Evidence
from International Courier Services},
journal = {Organ. Sci.},
volume = {21},
number = {4},
pages = {892--912},
year = {2010},
url = {https://doi.org/10.1287/orsc.1090.0482},
doi = {10.1287/ORSC.1090.0482},
timestamp = {Thu, 16 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/orgsci/HsiehLNL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/ChenSLKDHKCCMVKSB10,
author = {Rong Chen and
Tara K. Sigdel and
Li Li and
Neeraja Kambham and
Joel Dudley and
Szu{-}chuan Hsieh and
R. Bryan Klassen and
Amery Chen and
Tuyen Caohuu and
Alexander A. Morgan and
Hannah A. Valantine and
Kiran K. Khush and
Minnie M. Sarwal and
Atul J. Butte},
title = {Differentially Expressed {RNA} from Public Microarray Data Identifies
Serum Protein Biomarkers for Cross-Organ Transplant Rejection and
Other Conditions},
journal = {PLoS Comput. Biol.},
volume = {6},
number = {9},
year = {2010},
url = {https://doi.org/10.1371/journal.pcbi.1000940},
doi = {10.1371/JOURNAL.PCBI.1000940},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/ChenSLKDHKCCMVKSB10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apccas/ChangWHLLH10,
author = {Ming{-}Hung Chang and
Jung{-}Yi Wu and
Wei{-}Chih Hsieh and
Shang{-}Yuan Lin and
You{-}Wei Liang and
Wei Hwang},
title = {High efficiency power management system for solar energy harvesting
applications},
booktitle = {{IEEE} Asia Pacific Conference on Circuits and Systems, {APCCAS} 2010,
Kuala Lumpur, Malaysia, December 6-9, 2010},
pages = {879--882},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/APCCAS.2010.5774960},
doi = {10.1109/APCCAS.2010.5774960},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/apccas/ChangWHLLH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibm/HungLCCHTL10,
author = {Che{-}Lun Hung and
Chun{-}Yuan Lin and
Shih{-}Cheng Chang and
Yeh{-}Ching Chung and
Shu Ju Hsieh and
Chuan Yi Tang and
Yaw{-}Ling Lin},
title = {{CORAL-M:} Heuristic coding region alignment method for multiple genome
sequences},
booktitle = {2010 {IEEE} International Conference on Bioinformatics and Biomedicine
Workshops, {BIBMW} 2010, Hong Kong, December 18, 2010},
pages = {223--228},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/BIBMW.2010.5703803},
doi = {10.1109/BIBMW.2010.5703803},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bibm/HungLCCHTL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/HsiehHJKCYTWLT10,
author = {Hsieh{-}Hung Hsieh and
Fu{-}Lung Hsueh and
Chewnpu Jou and
Fred Kuo and
Sean Chen and
Tzu{-}Jin Yeh and
Kevin Kai{-}Wen Tan and
Po{-}Yi Wu and
Yu{-}Ling Lin and
Ming{-}Hsien Tsai},
editor = {Jacqueline Snyder and
Rakesh Patel and
Tom Andre},
title = {A V-band divide-by-three differential direct injection-locked frequency
divider in 65-nm {CMOS}},
booktitle = {{IEEE} Custom Integrated Circuits Conference, {CICC} 2010, San Jose,
California, USA, 19-22 September, 2010, Proceedings},
pages = {1--4},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/CICC.2010.5617391},
doi = {10.1109/CICC.2010.5617391},
timestamp = {Tue, 20 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cicc/HsiehHJKCYTWLT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gensips/HsiehS10,
author = {Mu{-}Fen Hsieh and
Sing{-}Hoi Sze},
title = {Graphlet alignment in protein interaction networks},
booktitle = {2010 {IEEE} International Workshop on Genomic Signal Processing and
Statistics, GENSiPS 2010, Cold Spring Harbor, NY, USA, November 10-12,
2010},
pages = {1--4},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/GENSIPS.2010.5719676},
doi = {10.1109/GENSIPS.2010.5719676},
timestamp = {Wed, 16 Oct 2019 14:14:54 +0200},
biburl = {https://dblp.org/rec/conf/gensips/HsiehS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/XinSMHS10,
author = {Chunsheng Xin and
Min Song and
Liangping Ma and
George Hsieh and
Chien{-}Chung Shen},
title = {On Random Dynamic Spectrum Access for Cognitive Radio Networks},
booktitle = {Proceedings of the Global Communications Conference, 2010. {GLOBECOM}
2010, 6-10 December 2010, Miami, Florida, {USA}},
pages = {1--5},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/GLOCOM.2010.5683983},
doi = {10.1109/GLOCOM.2010.5683983},
timestamp = {Thu, 20 Jul 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/globecom/XinSMHS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ht/HsiehPJNS10,
author = {Hao{-}wei Hsieh and
Katherine Pauls and
Amber Jansen and
Gautam Nimmagadda and
Frank M. Shipman III},
editor = {Mark H. Chignell and
Elaine G. Toms},
title = {Assisting two-way mapping generation in hypermedia workspace},
booktitle = {HT'10, Proceedings of the 21st {ACM} Conference on Hypertext and Hypermedia,
Toronto, Ontario, Canada, June 13-16, 2010},
pages = {99--108},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1810617.1810636},
doi = {10.1145/1810617.1810636},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ht/HsiehPJNS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/LinFHMCH10,
author = {Jui{-}Chieh Lin and
Ming{-}Jung Fan{-}Chiang and
Minja Hsieh and
Song{-}Yen Mao and
Sao{-}Jie Chen and
Yu Hen Hu},
title = {Cycle efficient scrambler implementation for software defined radio},
booktitle = {Proceedings of the {IEEE} International Conference on Acoustics, Speech,
and Signal Processing, {ICASSP} 2010, 14-19 March 2010, Sheraton Dallas
Hotel, Dallas, Texas, {USA}},
pages = {1586--1589},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ICASSP.2010.5495532},
doi = {10.1109/ICASSP.2010.5495532},
timestamp = {Sun, 04 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icassp/LinFHMCH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/ChenCHH10,
author = {Shi{-}Wen Chen and
Ming{-}Hung Chang and
Wei{-}Chih Hsieh and
Wei Hwang},
title = {Fully on-chip temperature, process, and voltage sensors},
booktitle = {International Symposium on Circuits and Systems {(ISCAS} 2010), May
30 - June 2, 2010, Paris, France},
pages = {897--900},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ISCAS.2010.5537410},
doi = {10.1109/ISCAS.2010.5537410},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/ChenCHH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/HsiehCCCY10,
author = {Jun{-}Wei Hsieh and
Sin{-}Yu Chen and
Chi{-}Hung Chuang and
Miao{-}Fen Chueh and
Shiaw{-}Shian Yu},
title = {Occluded human body segmentation and its application to behavior analysis},
booktitle = {International Symposium on Circuits and Systems {(ISCAS} 2010), May
30 - June 2, 2010, Paris, France},
pages = {3433--3436},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ISCAS.2010.5537851},
doi = {10.1109/ISCAS.2010.5537851},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/HsiehCCCY10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/LinHFMYCH10,
author = {Jui{-}Chieh Lin and
Minja Hsieh and
Ming{-}Jung Fan{-}Chiang and
Song{-}Yen Mao and
Chu Yu and
Sao{-}Jie Chen and
Yu Hen Hu},
title = {Perfect shuffling for cycle efficient puncturer and interleaver for
software defined radio},
booktitle = {International Symposium on Circuits and Systems {(ISCAS} 2010), May
30 - June 2, 2010, Paris, France},
pages = {3965--3968},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ISCAS.2010.5537661},
doi = {10.1109/ISCAS.2010.5537661},
timestamp = {Sun, 04 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/LinHFMYCH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/PayneCSKH10,
author = {Robert Payne and
Marco Corsi and
David Smith and
Scott Kaylor and
Daniel Hsieh},
title = {A 16b 100-to-160MS/s SiGe BiCMOS pipelined {ADC} with 100dBFS {SFDR}},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2010,
Digest of Technical Papers, San Francisco, CA, USA, 7-11 February,
2010},
pages = {294--295},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ISSCC.2010.5433928},
doi = {10.1109/ISSCC.2010.5433928},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/PayneCSKH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jcdl/BaeKMMZSHM10,
author = {Soonil Bae and
DoHyoung Kim and
Konstantinos A. Meintanis and
J. Michael Moore and
Anna Zacchi and
Frank M. Shipman III and
Hao{-}wei Hsieh and
Catherine C. Marshall},
editor = {Jane Hunter and
Carl Lagoze and
C. Lee Giles and
Yuan{-}Fang Li},
title = {Supporting document triage via annotation-based multi-application
visualizations},
booktitle = {Proceedings of the 2010 Joint International Conference on Digital
Libraries, {JCDL} 2010, Gold Coast, Queensland, Australia, June 21-25,
2010},
pages = {177--186},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1816123.1816150},
doi = {10.1145/1816123.1816150},
timestamp = {Tue, 27 Jul 2021 17:37:28 +0200},
biburl = {https://dblp.org/rec/conf/jcdl/BaeKMMZSHM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mmm/HsiehTHCKYLWCLLCWLL10,
author = {Chun{-}Ko Hsieh and
Xin Tong and
Yi{-}Ping Hung and
Chia{-}Ping Chen and
Ju{-}Chun Ko and
Meng{-}Chieh Yu and
Han{-}Hung Lin and
Szu{-}Wei Wu and
Yi{-}Yu Chung and
Liang{-}Chun Lin and
Ming{-}Sui Lee and
Chu{-}Song Chen and
Jiaping Wang and
Quo{-}Ping Lin and
I{-}Ling Liu},
editor = {Susanne Boll and
Qi Tian and
Lei Zhang and
Zili Zhang and
Yi{-}Ping Phoebe Chen},
title = {Transformational Breathing between Present and Past: Virtual Exhibition
System of the Mao-Kung Ting},
booktitle = {Advances in Multimedia Modeling, 16th International Multimedia Modeling
Conference, {MMM} 2010, Chongqing, China, January 6-8, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5916},
pages = {707--712},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-11301-7\_73},
doi = {10.1007/978-3-642-11301-7\_73},
timestamp = {Mon, 19 Aug 2024 08:37:55 +0200},
biburl = {https://dblp.org/rec/conf/mmm/HsiehTHCKYLWCLLCWLL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mobicom/Xin0MHS10,
author = {Chunsheng Xin and
Min Song and
Liangping Ma and
George Hsieh and
Chien{-}Chung Shen},
editor = {Ranveer Chandra and
Sachin Katti and
Thomas Moscibroda},
title = {Network coding relayed dynamic spectrum access},
booktitle = {Proceedings of the 2010 {ACM} Workshop on Cognitive Radio Networks,
CoRoNet@MOBICOM 2010, Chicago, Illinois, USA, September 20, 2010},
pages = {31--36},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1859955.1859963},
doi = {10.1145/1859955.1859963},
timestamp = {Tue, 06 Nov 2018 16:58:59 +0100},
biburl = {https://dblp.org/rec/conf/mobicom/Xin0MHS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nsdi/HsiehGL10,
author = {Jonathan M. Hsieh and
Steven D. Gribble and
Henry M. Levy},
title = {The Architecture and Implementation of an Extensible Web Crawler},
booktitle = {Proceedings of the 7th {USENIX} Symposium on Networked Systems Design
and Implementation, {NSDI} 2010, April 28-30, 2010, San Jose, CA,
{USA}},
pages = {329--344},
publisher = {{USENIX} Association},
year = {2010},
url = {http://www.usenix.org/events/nsdi10/tech/full\_papers/hsieh.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nsdi/HsiehGL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/paclic/GaillardCMHN10,
author = {Beno{\^{\i}}t Gaillard and
Yannick Chudy and
Pierre Magistry and
Shu{-}Kai Hsieh and
Emmanuel Navarro},
editor = {Ryo Otoguro and
Kiyoshi Ishikawa and
Hiroshi Umemoto and
Kei Yoshimoto and
Yasunari Harada},
title = {Graph Representation of Synonymy and Translation Resources for Crosslinguistic
Modelisation of Meaning},
booktitle = {Proceedings of the 24th Pacific Asia Conference on Language, Information
and Computation, {PACLIC} 24, Tohoku University, Japan, 4-7 November
2010},
pages = {819--830},
publisher = {Institute for Digital Enhancement of Cognitive Development, Waseda
University},
year = {2010},
url = {https://aclanthology.org/Y10-1094/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/paclic/GaillardCMHN10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rocling/ChenLSHHH10,
author = {Mei{-}Yu Chen and
Hsin{-}Ni Lin and
Chang{-}An Shih and
Yen{-}Ching Hsu and
Pei{-}Yu Hsu and
Shu{-}Kai Hsieh},
title = {Classifying mood in plurks},
booktitle = {Proceedings of the 22th Conference on Computational Linguistics and
Speech Processing, {ROCLING} 2010, Nantou, Taiwan, September 1-2,
2010},
publisher = {Association for Computational Linguistics and Chinese Language Processing
(ACLCLP), Taiwan},
year = {2010},
url = {https://aclanthology.org/O10-1012/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/rocling/ChenLSHHH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semeval/AgirreLFHTMVS10,
author = {Eneko Agirre and
Oier Lopez de Lacalle and
Christiane Fellbaum and
Shu{-}Kai Hsieh and
Maurizio Tesconi and
Monica Monachini and
Piek Vossen and
Roxanne Segers},
editor = {Katrin Erk and
Carlo Strapparava},
title = {SemEval-2010 Task 17: All-Words Word Sense Disambiguation on a Specific
Domain},
booktitle = {Proceedings of the 5th International Workshop on Semantic Evaluation,
SemEval@ACL 2010, Uppsala University, Uppsala, Sweden, July 15-16,
2010},
pages = {75--80},
publisher = {The Association for Computer Linguistics},
year = {2010},
url = {https://aclanthology.org/S10-1013/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/semeval/AgirreLFHTMVS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semeval/SoroaALBVMLH10,
author = {Aitor Soroa and
Eneko Agirre and
Oier Lopez de Lacalle and
Wauter Bosma and
Piek Vossen and
Monica Monachini and
Jessie Lo and
Shu{-}Kai Hsieh},
editor = {Katrin Erk and
Carlo Strapparava},
title = {Kyoto: An Integrated System for Specific Domain {WSD}},
booktitle = {Proceedings of the 5th International Workshop on Semantic Evaluation,
SemEval@ACL 2010, Uppsala University, Uppsala, Sweden, July 15-16,
2010},
pages = {417--420},
publisher = {The Association for Computer Linguistics},
year = {2010},
url = {https://aclanthology.org/S10-1093/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/semeval/SoroaALBVMLH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnis/ChenSH10,
author = {Changlong Chen and
Min Song and
George Hsieh},
title = {Intrusion detection of sinkhole attacks in large-scale wireless sensor
networks},
booktitle = {Proceedings of the {IEEE} International Conference on Wireless Communications,
Networking and Information Security, {WCNIS} 2010, 25-27 June 2010,
Beijing, China},
pages = {711--716},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/WCINS.2010.5541872},
doi = {10.1109/WCINS.2010.5541872},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/wcnis/ChenSH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/BickelMHBLB09,
author = {David R. Bickel and
Zahra Montazeri and
Pei{-}Chun Hsieh and
Mary Beatty and
Shai J. Lawit and
Nicholas J. Bate},
title = {Gene network reconstruction from transcriptional dynamics under kinetic
model uncertainty: a case for the second derivative},
journal = {Bioinform.},
volume = {25},
number = {6},
pages = {772--779},
year = {2009},
url = {https://doi.org/10.1093/bioinformatics/btp028},
doi = {10.1093/BIOINFORMATICS/BTP028},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/BickelMHBLB09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/LiuCCTLPCKHLJLCH09,
author = {Li{-}Yu Daisy Liu and
Chien{-}Yu Chen and
Mei{-}Ju May Chen and
Ming{-}Shian Tsai and
Cho{-}Han S. Lee and
Tzu L. Phang and
Li{-}Yun Chang and
Wen{-}Hung Kuo and
Hsiao{-}Lin Hwa and
Huang{-}Chun Lien and
Shih{-}Ming Jung and
Yi{-}Shing Lin and
King{-}Jen Chang and
Fon{-}Jou Hsieh},
title = {Statistical identification of gene association by {CID} in application
of constructing {ER} regulatory network},
journal = {{BMC} Bioinform.},
volume = {10},
year = {2009},
url = {https://doi.org/10.1186/1471-2105-10-85},
doi = {10.1186/1471-2105-10-85},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/LiuCCTLPCKHLJLCH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csda/HsiehLS09,
author = {S. H. Hsieh and
S. M. Lee and
P. S. Shen},
title = {Semiparametric analysis of randomized response data with missing covariates
in logistic regression},
journal = {Comput. Stat. Data Anal.},
volume = {53},
number = {7},
pages = {2673--2692},
year = {2009},
url = {https://doi.org/10.1016/j.csda.2009.01.011},
doi = {10.1016/J.CSDA.2009.01.011},
timestamp = {Tue, 23 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csda/HsiehLS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jirs/DerenickSH09,
author = {Jason C. Derenick and
John R. Spletzer and
M. Ani Hsieh},
title = {An Optimal Approach to Collaborative Target Tracking with Performance
Guarantees},
journal = {J. Intell. Robotic Syst.},
volume = {56},
number = {1-2},
pages = {47--67},
year = {2009},
url = {https://doi.org/10.1007/s10846-008-9302-x},
doi = {10.1007/S10846-008-9302-X},
timestamp = {Tue, 07 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jirs/DerenickSH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jise/ChengH09a,
author = {Sheng{-}Tzong Cheng and
Ming{-}Tzung Hsieh},
title = {Modeling and Analysis of Code-based Call Admission Control for QoS
Management in {W-CDMA} Systems},
journal = {J. Inf. Sci. Eng.},
volume = {25},
number = {3},
pages = {717--731},
year = {2009},
url = {http://www.iis.sinica.edu.tw/page/jise/2009/200905\_04.html},
timestamp = {Fri, 16 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jise/ChengH09a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jodi/HsiehS09,
author = {Hao{-}wei Hsieh and
Frank M. Shipman III},
title = {Supporting Visual Problem Solving in Spatial Hypertext},
journal = {J. Digit. Inf.},
volume = {10},
number = {3},
year = {2009},
url = {https://journals.tdl.org/jodi/index.php/jodi/article/view/173},
timestamp = {Tue, 24 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jodi/HsiehS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jors/HayashiHS09,
author = {Yoichi Hayashi and
Ming{-}Huei Hsieh and
Rudy Setiono},
title = {Predicting consumer preference for fast-food franchises: a data mining
approach},
journal = {J. Oper. Res. Soc.},
volume = {60},
number = {9},
pages = {1221--1229},
year = {2009},
url = {https://doi.org/10.1057/palgrave.jors.2602646},
doi = {10.1057/PALGRAVE.JORS.2602646},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jors/HayashiHS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/HuangHCHP09,
author = {Y. M. Huang and
M. Y. Hsieh and
H. C. Chao and
S. H. Hung and
J. H. Park},
title = {Pervasive, secure access to a hierarchical sensor-based healthcare
monitoring architecture in wireless heterogeneous networks},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {27},
number = {4},
pages = {400--411},
year = {2009},
url = {https://doi.org/10.1109/JSAC.2009.090505},
doi = {10.1109/JSAC.2009.090505},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/HuangHCHP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lre/SoriaMBCHHMT09,
author = {Claudia Soria and
Monica Monachini and
Francesca Bertagna and
Nicoletta Calzolari and
Chu{-}Ren Huang and
Shu{-}Kai Hsieh and
Andrea Marchetti and
Maurizio Tesconi},
title = {Exploring interoperability of language resources: the case of cross-lingual
semi-automatic enrichment of wordnets},
journal = {Lang. Resour. Evaluation},
volume = {43},
number = {1},
pages = {87--96},
year = {2009},
url = {https://doi.org/10.1007/s10579-009-9082-3},
doi = {10.1007/S10579-009-9082-3},
timestamp = {Thu, 05 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/lre/SoriaMBCHHMT09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mr/HsiehWCSLCH09,
author = {Zhen{-}Ying Hsieh and
Mu{-}Chun Wang and
Chih Chen and
Jia{-}Min Shieh and
Yu{-}Ting Lin and
Shuang{-}Yuan Chen and
Heng{-}Sheng Huang},
title = {Trend transformation of drain-current degradation under drain-avalanche
hot-carrier stress for {CLC} n-TFTs},
journal = {Microelectron. Reliab.},
volume = {49},
number = {8},
pages = {892--896},
year = {2009},
url = {https://doi.org/10.1016/j.microrel.2009.05.011},
doi = {10.1016/J.MICROREL.2009.05.011},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mr/HsiehWCSLCH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/LinWHH09,
author = {Chang{-}Hua Lin and
Chien{-}Ming Wang and
Min{-}Hsuan Hung and
Shang{-}Po Hsieh},
title = {Reducing the Parasitic Capacitance Effect in {LCD} Panel for Backlight
Module Based on Primary-Side Control and {DPLL} Technique},
journal = {{IEEE} Trans. Ind. Electron.},
volume = {56},
number = {8},
pages = {2918--2922},
year = {2009},
url = {https://doi.org/10.1109/TIE.2009.2014905},
doi = {10.1109/TIE.2009.2014905},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tie/LinWHH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/trob/BermanHHK09,
author = {Spring Berman and
{\'{A}}d{\'{a}}m M. Hal{\'{a}}sz and
M. Ani Hsieh and
Vijay Kumar},
title = {Optimized Stochastic Policies for Task Allocation in Swarms of Robots},
journal = {{IEEE} Trans. Robotics},
volume = {25},
number = {4},
pages = {927--937},
year = {2009},
url = {https://doi.org/10.1109/TRO.2009.2024997},
doi = {10.1109/TRO.2009.2024997},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/trob/BermanHHK09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wicomm/SheuHD09,
author = {Jang{-}Ping Sheu and
Kun{-}Ying Hsieh and
Ming{-}Lung Ding},
title = {Routing with hexagonal virtual coordinates in wireless sensor networks},
journal = {Wirel. Commun. Mob. Comput.},
volume = {9},
number = {9},
pages = {1206--1219},
year = {2009},
url = {https://doi.org/10.1002/wcm.685},
doi = {10.1002/WCM.685},
timestamp = {Thu, 06 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/wicomm/SheuHD09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl-alr/TokunagaKCMSSCX09,
author = {Takenobu Tokunaga and
Dain Kaplan and
Nicoletta Calzolari and
Monica Monachini and
Claudia Soria and
Virach Sornlertlamvanich and
Thatsanee Charoenporn and
Yingju Xia and
Chu{-}Ren Huang and
Shu{-}Kai Hsieh and
Kiyoaki Shirai},
editor = {Hammam Riza and
Virach Sornlertlamvanich},
title = {Query Expansion using LMF-Compliant Lexical Resources},
booktitle = {Proceedings of the 7th Workshop on Asian Language Resources, ALR7@IJCNLP
2009, Singapore, August 6-7, 2009},
pages = {145--152},
publisher = {Association for Computational Linguistics},
year = {2009},
url = {https://aclanthology.org/W09-3421/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl-alr/TokunagaKCMSSCX09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl-pwnlp/NavarroSGPHKMH09,
author = {Emmanuel Navarro and
Franck Sajous and
Bruno Gaume and
Laurent Pr{\'{e}}vot and
Shu{-}Kai Hsieh and
Ivy Kuo and
Pierre Magistry and
Chu{-}Ren Huang},
editor = {Iryna Gurevych and
Torsten Zesch},
title = {Wiktionary for Natural Language Processing: Methodology and Limitations},
booktitle = {Proceedings of the 1st 2009 Workshop on The People's Web Meets {NLP:}
Collaboratively Constructed Semantic Resources@IJCNLP 2009, Suntec,
Singapore, August 7, 2009},
pages = {19--27},
publisher = {Association for Computational Linguistics},
year = {2009},
url = {https://aclanthology.org/W09-3303/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl-pwnlp/NavarroSGPHKMH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asist/Hsieh-YeeCJAMH09,
author = {Ingrid Hsieh{-}Yee and
Heting Chu and
Joseph Janes and
Eileen G. Abels and
William E. Moen and
Samantha Hastings},
title = {Diversity and commonality of information science education in a pluralistic
world},
booktitle = {Thriving on Diversity: Information Opportunities in a Pluralistic
World - Proceedings of the 72nd ASIS{\&}T Annual Meeting, {ASIST}
2009, Vancouver, BC, Canada, November 6-11, 2009},
series = {Proc. Assoc. Inf. Sci. Technol.},
volume = {46},
number = {1},
pages = {1--4},
publisher = {Wiley},
year = {2009},
url = {https://doi.org/10.1002/meet.2009.1450460139},
doi = {10.1002/MEET.2009.1450460139},
timestamp = {Fri, 21 Jan 2022 13:55:35 +0100},
biburl = {https://dblp.org/rec/conf/asist/Hsieh-YeeCJAMH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asist/Hsieh-YeeMCCKWK09,
author = {Ingrid Hsieh{-}Yee and
Elaine M{\'{e}}nard and
(Sophy) Shu{-}Jiun Chen and
Ya{-}Ning (Arthur) Chen and
Martin Kalfatovic and
Kathy Wisser and
Jeonghyun Kim},
title = {Information organization in libraries, archives and museums: Converging
practices and collaboration opportunities},
booktitle = {Thriving on Diversity: Information Opportunities in a Pluralistic
World - Proceedings of the 72nd ASIS{\&}T Annual Meeting, {ASIST}
2009, Vancouver, BC, Canada, November 6-11, 2009},
series = {Proc. Assoc. Inf. Sci. Technol.},
volume = {46},
number = {1},
pages = {1--5},
publisher = {Wiley},
year = {2009},
url = {https://doi.org/10.1002/meet.2009.1450460136},
doi = {10.1002/MEET.2009.1450460136},
timestamp = {Wed, 14 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asist/Hsieh-YeeMCCKWK09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edutainment/SuCTYCJHHL09,
author = {Mu{-}Chun Su and
Gwo{-}Dong Chen and
Yi{-}Shan Tsai and
Ren{-}Hao Yao and
Chung{-}Kuang Chou and
Yohannes Budiono Jinawi and
De{-}Yuan Huang and
Yi{-}Zeng Hsieh and
Shih{-}Chieh Lin},
editor = {Maiga Chang and
Rita Kuo and
Kinshuk and
Gwo{-}Dong Chen and
Michitaka Hirose},
title = {Design of an Interactive Table for Mixed-Reality Learning Environments},
booktitle = {Learning by Playing. Game-based Education System Design and Development,
4th International Conference on E-Learning and Games, Edutainment
2009, Banff, Canada, August 9-11, 2009. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5670},
pages = {489--494},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-03364-3\_59},
doi = {10.1007/978-3-642-03364-3\_59},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/edutainment/SuCTYCJHHL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/LeeWYZCHHTKCCHL09,
author = {Yu{-}Huei Lee and
Shih{-}Jung Wang and
Yao{-}Yi Yang and
Kuo{-}Lin Zheng and
Po{-}Fung Chen and
Chun{-}Yu Hsieh and
Ming{-}Hsin Huang and
Yu{-}Nong Tsai and
Yu{-}Zhou Ke and
Ke{-}Horng Chen and
Yi{-}Kuang Chen and
Chen{-}Chih Huang and
Ying{-}Hsi Lin},
title = {A high efficiency and compact size 65nm power management module with
1.2v low-voltage {PWM} controller for {UWB} system application},
booktitle = {35th European Solid-State Circuits Conference, {ESSCIRC} 2009, Athens,
Greece, 14-18 September 2009},
pages = {272--275},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/ESSCIRC.2009.5326007},
doi = {10.1109/ESSCIRC.2009.5326007},
timestamp = {Mon, 09 Aug 2021 14:54:02 +0200},
biburl = {https://dblp.org/rec/conf/esscirc/LeeWYZCHHTKCCHL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/LinHYTS09,
author = {Chiuhsiang Joe Lin and
Min{-}Chih Hsieh and
Hui{-}Chi Yu and
Ping{-}Jung Tsai and
Wei{-}Jung Shiang},
editor = {Julie A. Jacko},
title = {Comparing the Usability of the Icons and Functions between {IE6.0}
and {IE7.0}},
booktitle = {Human-Computer Interaction. New Trends, 13th International Conference,
{HCI} International 2009, San Diego, CA, USA, July 19-24, 2009, Proceedings,
Part {I}},
series = {Lecture Notes in Computer Science},
volume = {5610},
pages = {465--473},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-02574-7\_52},
doi = {10.1007/978-3-642-02574-7\_52},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/hci/LinHYTS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/his/HsiehHLL09,
author = {Ming{-}Che Hsieh and
Wei{-}Sheng Hung and
Shu{-}Wen Lin and
Chin{-}Hsing Luo},
editor = {Ge Yu and
Mario K{\"{o}}ppen and
Shyi{-}Ming Chen and
Xiamu Niu},
title = {Designing an Assistive Dialog Agent for a Case of Spinal Cord Injury},
booktitle = {9th International Conference on Hybrid Intelligent Systems {(HIS}
2009), August 12-14, 2009, Shenyang, China},
pages = {67--72},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/HIS.2009.21},
doi = {10.1109/HIS.2009.21},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/his/HsiehHLL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/his/LinSHWH09,
author = {Sheng{-}Shi Lin and
Shin{-}Shing Shin and
Ming{-}Che Hsieh and
Jen{-}Her Wu and
Wei{-}Sheng Hung},
editor = {Ge Yu and
Mario K{\"{o}}ppen and
Shyi{-}Ming Chen and
Xiamu Niu},
title = {MDA-Based {UI} Modeling and Transformation of Spoken Dialog Systems},
booktitle = {9th International Conference on Hybrid Intelligent Systems {(HIS}
2009), August 12-14, 2009, Shenyang, China},
pages = {47--51},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/HIS.2009.17},
doi = {10.1109/HIS.2009.17},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/his/LinSHWH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ica3pp/FangCCLHSH09,
author = {Jyh{-}Perng Fang and
Yang{-}Lang Chang and
Chih{-}Chia Chen and
Wen{-}Yew Liang and
Tung{-}Ju Hsieh and
Muhammad T. Satria and
Chin{-}Chuan Han},
editor = {Arrems Hua and
Shih{-}Liang Chang},
title = {A Parallel Simulated Annealing Approach for Floorplanning in {VLSI}},
booktitle = {Algorithms and Architectures for Parallel Processing, 9th International
Conference, {ICA3PP} 2009, Taipei, Taiwan, June 8-11, 2009. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5574},
pages = {291--302},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-03095-6\_29},
doi = {10.1007/978-3-642-03095-6\_29},
timestamp = {Tue, 14 May 2019 10:00:51 +0200},
biburl = {https://dblp.org/rec/conf/ica3pp/FangCCLHSH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ica3pp/LiangHSCFCH09,
author = {Wen{-}Yew Liang and
Tung{-}Ju Hsieh and
Muhammad T. Satria and
Yang{-}Lang Chang and
Jyh{-}Perng Fang and
Chih{-}Chia Chen and
Chin{-}Chuan Han},
editor = {Arrems Hua and
Shih{-}Liang Chang},
title = {A GPU-Based Simulation of Tsunami Propagation and Inundation},
booktitle = {Algorithms and Architectures for Parallel Processing, 9th International
Conference, {ICA3PP} 2009, Taipei, Taiwan, June 8-11, 2009. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5574},
pages = {593--603},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-03095-6\_56},
doi = {10.1007/978-3-642-03095-6\_56},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ica3pp/LiangHSCFCH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/HsiehHCSM09,
author = {M. Ani Hsieh and
{\'{A}}d{\'{a}}m M. Hal{\'{a}}sz and
Ekin Dogus Cubuk and
Samuel S. Schoenholz and
Alcherio Martinoli},
title = {Specialization as an optimal strategy under varying external conditions},
booktitle = {2009 {IEEE} International Conference on Robotics and Automation, {ICRA}
2009, Kobe, Japan, May 12-17, 2009},
pages = {1941--1946},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/ROBOT.2009.5152798},
doi = {10.1109/ROBOT.2009.5152798},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icra/HsiehHCSM09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iih-msp/LinHT09,
author = {Kawuu Weicheng Lin and
Ming{-}Hua Hsieh and
Vincent S. Tseng},
editor = {Jeng{-}Shyang Pan and
Yen{-}Wei Chen and
Lakhmi C. Jain},
title = {Mining Temporal Region-Based Service Patterns for Cooperative Caching
in Wireless Multimedia Sensor Networks},
booktitle = {Fifth International Conference on Intelligent Information Hiding and
Multimedia Signal Processing {(IIH-MSP} 2009), Kyoto, Japan, 12-14
September, 2009, Proceedings},
pages = {1240--1244},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/IIH-MSP.2009.179},
doi = {10.1109/IIH-MSP.2009.179},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iih-msp/LinHT09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/LiHW09,
author = {Katherine Shu{-}Min Li and
Ming{-}Hua Hsieh and
Sying{-}Jyan Wang},
title = {Level Converting Scan Flip-flops},
booktitle = {International Symposium on Circuits and Systems {(ISCAS} 2009), 24-17
May 2009, Taipei, Taiwan},
pages = {2505--2508},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/ISCAS.2009.5118310},
doi = {10.1109/ISCAS.2009.5118310},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iscas/LiHW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isqed/LakshminarayananJNKSTWHLLMFHLYTL09,
author = {S. Lakshminarayanan and
J. Joung and
Giri Narasimhan and
Ravi Kapre and
M. Slanina and
J. Tung and
Morgan Whately and
C.{-}L. Hou and
W.{-}J. Liao and
S.{-}C. Lin and
P.{-}G. Ma and
C.{-}W. Fan and
M.{-}C. Hsieh and
F.{-}C. Liu and
K.{-}L. Yeh and
W.{-}C. Tseng and
S. W. Lu},
title = {Standby power reduction and {SRAM} cell optimization for 65nm technology},
booktitle = {10th International Symposium on Quality of Electronic Design {(ISQED}
2009), 16-18 March 2009, San Jose, CA, {USA}},
pages = {471--475},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ISQED.2009.4810340},
doi = {10.1109/ISQED.2009.4810340},
timestamp = {Tue, 22 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isqed/LakshminarayananJNKSTWHLLMFHLYTL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/SowlatiACOSVRKDCVTSFSACMDHGSBRCSHKLPPZTARDWDWRPV09,
author = {Tirdad Sowlati and
Bipul Agarwal and
J. Cho and
Thomas Obkircher and
Mohamed El Said and
John Vasa and
Bala Ramachandran and
Masoud Kahrizi and
Elias Dagher and
Wei{-}Hong Chen and
Martin Vadkerti and
Georgi Taskov and
Utku Seckin and
Hamid Firouzkouhi and
Behzad Saeidi and
Hasan Akyol and
Yunyoung Choi and
Amir Mahjoob and
Sandeep D'Souza and
Chieh{-}Yu Hsieh and
David Guss and
Dan Shum and
Dean A. Badillo and
Imtiyaz Ron and
Doris Ching and
Feng Shi and
Yong He and
Jaleh Komaili and
Aravind Loke and
Rajasekhar Pullela and
Engin Pehlivanoglu and
Hossein Zarei and
Shahrzad Tadjpour and
Darioush Agahi and
Dmitriy Rozenblit and
William Domino and
Gregory Williams and
Nader Damavandi and
Stephane Wloczysiak and
Suhanthan Rajendra and
Aaron Paff and
Tom Valencia},
title = {Single-chip multiband {WCDMA/HSDPA/HSUPA/EGPRS} transceiver with diversity
receiver and 3G DigRF interface without {SAW} filters in transmitter
/ 3G receiver paths},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2009,
Digest of Technical Papers, San Francisco, CA, USA, 8-12 February,
2009},
pages = {116--117},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/ISSCC.2009.4977335},
doi = {10.1109/ISSCC.2009.4977335},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/SowlatiACOSVRKDCVTSFSACMDHGSBRCSHKLPPZTARDWDWRPV09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc/HsiehBAGL09,
author = {Tong{-}Yu Hsieh and
Melvin A. Breuer and
Murali Annavaram and
Sandeep K. Gupta and
Kuen{-}Jong Lee},
editor = {Gordon W. Roberts and
Bill Eklow},
title = {Tolerance of performance degrading faults for effective yield improvement},
booktitle = {2009 {IEEE} International Test Conference, {ITC} 2009, Austin, TX,
USA, November 1-6, 2009},
pages = {1--10},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/TEST.2009.5355594},
doi = {10.1109/TEST.2009.5355594},
timestamp = {Thu, 21 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/itc/HsiehBAGL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nems/HsuYLHYC09,
author = {Shou{-}Ping Hsu and
Kao{-}Feng Yarn and
Win{-}Jet Luo and
I{-}Ting Hsieh and
Hong{-}Jun Ye and
Meng{-}Hua Chung},
title = {Microfluidic mixing with electrokinetic instability in a double T-shaped
microchannel},
booktitle = {4th {IEEE} International Conference on Nano/Micro Engineered and Molecular
Systems, {IEEE-NEMS} 2009, Shenzhen, China, January 5-8, 2009},
pages = {787--792},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/NEMS.2009.5068696},
doi = {10.1109/NEMS.2009.5068696},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nems/HsuYLHYC09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sede/HsiehSH09,
author = {Ching{-}Tang Hsieh and
Meng{-}Shian Shih and
Min{-}Nan Hsiao},
title = {{PSO} accelerated 3D face angle searching system for face recognition},
booktitle = {18th International Conference on Software Engineering and Data Engineering
(SEDE-2009), June 22-24, 2009, Imperial Palace Hotel Las Vegas, Las
Vegas, Nevada, USA, Proceedings},
pages = {295},
publisher = {{ISCA}},
year = {2009},
timestamp = {Mon, 06 Jul 2009 10:37:45 +0200},
biburl = {https://dblp.org/rec/conf/sede/HsiehSH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/socc/LinHFYCH09,
author = {Jui{-}Chieh Lin and
Minja Hsieh and
Ming{-}Jung Fan{-}Chiang and
Chu Yu and
Sao{-}Jie Chen and
Yu Hen Hu},
title = {An instruction set architecture independent design method for embedded
OFDM-based software defined transmitter},
booktitle = {Annual {IEEE} International SoC Conference, SoCC 2009, September 9-11,
2009, Belfast, Northern Ireland, UK, Proceedings},
pages = {207--210},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/SOCCON.2009.5398058},
doi = {10.1109/SOCCON.2009.5398058},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/socc/LinHFYCH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/BaileyBBBBCCDMPFGGKLMNPRSUHY09,
author = {Daniel V. Bailey and
Lejla Batina and
Daniel J. Bernstein and
Peter Birkner and
Joppe W. Bos and
Hsieh{-}Chung Chen and
Chen{-}Mou Cheng and
Gauthier Van Damme and
Giacomo de Meulenaer and
Luis J. Dominguez Perez and
Junfeng Fan and
Tim G{\"{u}}neysu and
Frank K. G{\"{u}}rkaynak and
Thorsten Kleinjung and
Tanja Lange and
Nele Mentens and
Ruben Niederhagen and
Christof Paar and
Francesco Regazzoni and
Peter Schwabe and
Leif Uhsadel and
Anthony Van Herrewege and
Bo{-}Yin Yang},
title = {Breaking {ECC2K-130}},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {541},
year = {2009},
url = {http://eprint.iacr.org/2009/541},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/BaileyBBBBCCDMPFGGKLMNPRSUHY09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/amc/HsiehC08,
author = {Sun{-}Yuan Hsieh and
Ming{-}Yu Chen},
title = {A DNA-based solution to the graph isomorphism problem using Adleman-Lipton
model with stickers},
journal = {Appl. Math. Comput.},
volume = {197},
number = {2},
pages = {672--686},
year = {2008},
url = {https://doi.org/10.1016/j.amc.2007.08.005},
doi = {10.1016/J.AMC.2007.08.005},
timestamp = {Fri, 17 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/amc/HsiehC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/candie/ChungH08,
author = {Shu{-}Hsing Chung and
Ming{-}Hsiu Hsieh},
title = {Long-term tool elimination planning for a wafer fab},
journal = {Comput. Ind. Eng.},
volume = {54},
number = {3},
pages = {589--601},
year = {2008},
url = {https://doi.org/10.1016/j.cie.2007.09.009},
doi = {10.1016/J.CIE.2007.09.009},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/candie/ChungH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/LinCHMLC08,
author = {Chao{-}Shun Lin and
Jainn{-}Shiun Chiu and
Ming{-}Hui Hsieh and
Martin S. Mok and
Yu{-}Chuan Li and
Hung{-}Wen Chiu},
title = {Predicting hypotensive episodes during spinal anesthesia with the
application of artificial neural networks},
journal = {Comput. Methods Programs Biomed.},
volume = {92},
number = {2},
pages = {193--197},
year = {2008},
url = {https://doi.org/10.1016/j.cmpb.2008.06.013},
doi = {10.1016/J.CMPB.2008.06.013},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cmpb/LinCHMLC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cogsci/ChangiziHNKS08,
author = {Mark A. Changizi and
Andrew Hsieh and
Romi Nijhawan and
Ryota Kanai and
Shinsuke Shimojo},
title = {Perceiving the Present and a Systematization of Illusions},
journal = {Cogn. Sci.},
volume = {32},
number = {3},
pages = {459--503},
year = {2008},
url = {https://doi.org/10.1080/03640210802035191},
doi = {10.1080/03640210802035191},
timestamp = {Thu, 04 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cogsci/ChangiziHNKS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/gandc/PanHLL08,
author = {Shih{-}Yu Pan and
Bieng{-}Zih Hsieh and
Ming{-}Tar Lu and
Zsay{-}Shing Lin},
title = {Identification of stratigraphic formation interfaces using wavelet
and Fourier transforms},
journal = {Comput. Geosci.},
volume = {34},
number = {1},
pages = {77--92},
year = {2008},
url = {https://doi.org/10.1016/j.cageo.2007.01.002},
doi = {10.1016/J.CAGEO.2007.01.002},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/gandc/PanHLL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijebm/WuLCN08,
author = {Shih{-}Hao Wu and
Yingshing Lin and
Jenn{-}Maw Cheng and
Mei{-}hsieh N},
title = {The Empirical Study of Relationship Marketing in Maritime Transportation
Service},
journal = {Int. J. Electron. Bus. Manag.},
volume = {6},
number = {2},
pages = {70--79},
year = {2008},
url = {http://ijebm.ie.nthu.edu.tw/IJEBM\_Web/IJEBM\_static/Paper-V6\_N2/A02.pdf},
timestamp = {Mon, 28 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijebm/WuLCN08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/NiddamCLYH08,
author = {David M. Niddam and
Rai{-}Chi Chan and
Si{-}Huei Lee and
Tzu{-}Chen Yeh and
Jen{-}Chuen Hsieh},
title = {Central representation of hyperalgesia from myofascial trigger point},
journal = {NeuroImage},
volume = {39},
number = {3},
pages = {1299--1306},
year = {2008},
url = {https://doi.org/10.1016/j.neuroimage.2007.09.051},
doi = {10.1016/J.NEUROIMAGE.2007.09.051},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/NiddamCLYH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmod/CafarellaCFHHLMM08,
author = {Michael J. Cafarella and
Edward Y. Chang and
Andrew Fikes and
Alon Y. Halevy and
Wilson C. Hsieh and
Alberto Lerner and
Jayant Madhavan and
S. Muthukrishnan},
title = {Data management projects at Google},
journal = {{SIGMOD} Rec.},
volume = {37},
number = {1},
pages = {34--38},
year = {2008},
url = {https://doi.org/10.1145/1374780.1374789},
doi = {10.1145/1374780.1374789},
timestamp = {Wed, 12 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigmod/CafarellaCFHHLMM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/swarm/HsiehHBK08,
author = {M. Ani Hsieh and
{\'{A}}d{\'{a}}m M. Hal{\'{a}}sz and
Spring Berman and
Vijay Kumar},
title = {Biologically inspired redistribution of a swarm of robots among multiple
sites},
journal = {Swarm Intell.},
volume = {2},
number = {2-4},
pages = {121--141},
year = {2008},
url = {https://doi.org/10.1007/s11721-008-0019-z},
doi = {10.1007/S11721-008-0019-Z},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/swarm/HsiehHBK08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tocs/ChangDGHWBCFG08,
author = {Fay Chang and
Jeffrey Dean and
Sanjay Ghemawat and
Wilson C. Hsieh and
Deborah A. Wallach and
Michael Burrows and
Tushar Chandra and
Andrew Fikes and
Robert E. Gruber},
title = {Bigtable: {A} Distributed Storage System for Structured Data},
journal = {{ACM} Trans. Comput. Syst.},
volume = {26},
number = {2},
pages = {4:1--4:26},
year = {2008},
url = {https://doi.org/10.1145/1365815.1365816},
doi = {10.1145/1365815.1365816},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tocs/ChangDGHWBCFG08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/vldb/HsiehTCY08,
author = {Ming{-}Jyh Hsieh and
Wei{-}Guang Teng and
Ming{-}Syan Chen and
Philip S. Yu},
title = {{DAWN:} an efficient framework of {DCT} for data with error estimation},
journal = {{VLDB} J.},
volume = {17},
number = {4},
pages = {683--702},
year = {2008},
url = {https://doi.org/10.1007/s00778-006-0032-z},
doi = {10.1007/S00778-006-0032-Z},
timestamp = {Fri, 09 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/vldb/HsiehTCY08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apscc/HsiehKY08,
author = {Ming{-}Chih Hsieh and
Yung{-}Wei Kao and
Shyan{-}Ming Yuan},
title = {Web 2.0 Toolbar: Providing Web 2.0 Services for Existence Web Pages},
booktitle = {Proceedings of the 3rd {IEEE} Asia-Pacific Services Computing Conference,
{APSCC} 2008, Yilan, Taiwan, 9-12 December 2008},
pages = {507--512},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/APSCC.2008.137},
doi = {10.1109/APSCC.2008.137},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/apscc/HsiehKY08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asist/BaeHKMMMZS08,
author = {Soonil Bae and
Hao{-}wei Hsieh and
DoHyoung Kim and
Catherine C. Marshall and
Konstantinos A. Meintanis and
J. Michael Moore and
Anna Zacchi and
Frank M. Shipman III},
title = {Supporting document triage via annotation-based visualizations},
booktitle = {People Transforming Information - Information Transforming People
- Proceedings of the 71st ASIS{\&}T Annual Meeting, {ASIST} 2008,
Columbus, OH, USA, October 24-29, 2008},
series = {Proc. Assoc. Inf. Sci. Technol.},
volume = {45},
number = {1},
pages = {1--16},
publisher = {Wiley},
year = {2008},
url = {https://doi.org/10.1002/meet.2008.1450450241},
doi = {10.1002/MEET.2008.1450450241},
timestamp = {Fri, 21 Jan 2022 13:55:35 +0100},
biburl = {https://dblp.org/rec/conf/asist/BaeHKMMMZS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asist/ChoiHRSGI08,
author = {Youngok Choi and
Ingrid Hsieh{-}Yee and
Edie Rasmussen and
Martha M. Smith and
Jane Greenberg and
Hemalata Iyer},
title = {Retrieving and using visual resources: Challenges and opportunities
for research and education},
booktitle = {People Transforming Information - Information Transforming People
- Proceedings of the 71st ASIS{\&}T Annual Meeting, {ASIST} 2008,
Columbus, OH, USA, October 24-29, 2008},
series = {Proc. Assoc. Inf. Sci. Technol.},
volume = {45},
number = {1},
pages = {1--4},
publisher = {Wiley},
year = {2008},
url = {https://doi.org/10.1002/meet.2008.1450450150},
doi = {10.1002/MEET.2008.1450450150},
timestamp = {Wed, 24 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asist/ChoiHRSGI08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ats/HsiehLLK08,
author = {Ming{-}Ting Hsieh and
Shun{-}Yen Lu and
Jing{-}Jia Liou and
Augusli Kifli},
title = {High Quality Pattern Generation for Delay Defects with Functional
Sensitized Paths},
booktitle = {17th {IEEE} Asian Test Symposium, {ATS} 2008, Sapporo, Japan, November
24-27, 2008},
pages = {131--136},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ATS.2008.41},
doi = {10.1109/ATS.2008.41},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ats/HsiehLLK08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/BermanHHK08,
author = {Spring Berman and
{\'{A}}d{\'{a}}m M. Hal{\'{a}}sz and
M. Ani Hsieh and
Vijay Kumar},
title = {Navigation-based optimization of stochastic strategies for allocating
a robot swarm among multiple sites},
booktitle = {Proceedings of the 47th {IEEE} Conference on Decision and Control,
{CDC} 2008, December 9-11, 2008, Canc{\'{u}}n, Mexico},
pages = {4376--4381},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/CDC.2008.4739482},
doi = {10.1109/CDC.2008.4739482},
timestamp = {Fri, 04 Mar 2022 13:27:23 +0100},
biburl = {https://dblp.org/rec/conf/cdc/BermanHHK08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/AzcarragaHS08,
author = {Arnulfo P. Azcarraga and
Ming{-}Huei Hsieh and
Rudy Setiono},
title = {Market research applications of artificial neural networks},
booktitle = {Proceedings of the {IEEE} Congress on Evolutionary Computation, {CEC}
2008, June 1-6, 2008, Hong Kong, China},
pages = {357--363},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/CEC.2008.4630822},
doi = {10.1109/CEC.2008.4630822},
timestamp = {Thu, 16 Dec 2021 14:01:33 +0100},
biburl = {https://dblp.org/rec/conf/cec/AzcarragaHS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/digitel/SuHLHC08,
author = {Mu{-}Chun Su and
De{-}Yuan Huang and
Shih{-}Chieh Lin and
Yi{-}Zeng Hsieh and
Gwo{-}Dong Chen},
editor = {Michael Eisenberg and
Kinshuk and
Maiga Chang and
Rory McGreal},
title = {Application of a Learning-Companion Robot in Learning Environments},
booktitle = {The 2nd {IEEE} International Conference on Digital Game and Intelligent
Toy Enhanced Learning, {DIGITEL} 2008, November 17-19, 2008, Banff,
Canada},
pages = {203--204},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/DIGITEL.2008.32},
doi = {10.1109/DIGITEL.2008.32},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/digitel/SuHLHC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iadis/ChengYHWHC08,
author = {Wen Po Cheng and
Ruey Fang Yu and
Ying Ju Hsieh and
Shu Yi Wu and
Yu Wei Huang and
Sin Ming Chen},
editor = {Ajith Abraham},
title = {Prove the Relationship between Particle Size, Turbidity Fluctuations
by Image Analysis},
booktitle = {{IADIS} European Conference on Data Mining 2008, Amsterdam, The Netherlands,
July 24-26, 2008. Proceedings},
pages = {170--172},
publisher = {{IADIS}},
year = {2008},
timestamp = {Thu, 29 Sep 2011 17:31:31 +0200},
biburl = {https://dblp.org/rec/conf/iadis/ChengYHWHC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icves/OzgunerRBHYT08,
author = {{\"{U}}mit {\"{O}}zg{\"{u}}ner and
Keith A. Redmill and
Scott Biddlestone and
Ming Feng Hsieh and
Ahmet Yazici and
Charles K. Toth},
title = {Simulation and testing environments for the {DARPA} Urban Challenge},
booktitle = {{IEEE} International Conference on Vehicular Electronics and Safety,
{ICVES} 2008, Columbus, OH, USA, 22-24 September, 2008},
pages = {222--226},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/ICVES.2008.4640881},
doi = {10.1109/ICVES.2008.4640881},
timestamp = {Mon, 09 Aug 2021 14:54:01 +0200},
biburl = {https://dblp.org/rec/conf/icves/OzgunerRBHYT08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipps/ChenHL08,
author = {Da{-}Ren Chen and
Shu{-}Ming Hsieh and
Ming{-}Fong Lai},
title = {Efficient algorithms for periodic real-time tasks to optimal discrete
voltage schedules},
booktitle = {22nd {IEEE} International Symposium on Parallel and Distributed Processing,
{IPDPS} 2008, Miami, Florida USA, April 14-18, 2008},
pages = {1--8},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/IPDPS.2008.4536543},
doi = {10.1109/IPDPS.2008.4536543},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ipps/ChenHL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/SrinivasaFGHGLK08,
author = {Gowri Srinivasa and
Matthew C. Fickus and
Manuel N. Gonzalez{-}Rivero and
Sarah Yichia Hsieh and
Yusong Guo and
Adam D. Linstedt and
Jelena Kovacevic},
title = {Active mask segmentation for the cell-volume computation and Golgi-body
segmentation of hela cell images},
booktitle = {Proceedings of the 2008 {IEEE} International Symposium on Biomedical
Imaging: From Nano to Macro, Paris, France, May 14-17, 2008},
pages = {348--351},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/ISBI.2008.4541004},
doi = {10.1109/ISBI.2008.4541004},
timestamp = {Wed, 04 Oct 2023 17:01:25 +0200},
biburl = {https://dblp.org/rec/conf/isbi/SrinivasaFGHGLK08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isda/HsiehHSLH08,
author = {Ming{-}Che Hsieh and
Wei{-}Sheng Hung and
Shin{-}Shing Shin and
Shu{-}Wen Lin and
Tsan{-}Hsun Huang},
editor = {Jeng{-}Shyang Pan and
Ajith Abraham and
Chin{-}Chen Chang},
title = {Spoken Dialogue Agent Interface Requirements Modeling Based on {PASSI}
Methodology},
booktitle = {Eighth International Conference on Intelligent Systems Design and
Applications, {ISDA} 2008, 26-28 November 2008, Kaohsiung, Taiwan,
3 Volumes},
pages = {339--342},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ISDA.2008.342},
doi = {10.1109/ISDA.2008.342},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isda/HsiehHSLH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isda/TsengHL08,
author = {Vincent S. Tseng and
Ming{-}Hua Hsieh and
Kawuu Weicheng Lin},
editor = {Jeng{-}Shyang Pan and
Ajith Abraham and
Chin{-}Chen Chang},
title = {Mining Region-Based Movement Patterns for Energy-Efficient Object
Tracking in Sensor Networks},
booktitle = {Eighth International Conference on Intelligent Systems Design and
Applications, {ISDA} 2008, 26-28 November 2008, Kaohsiung, Taiwan,
3 Volumes},
pages = {188--196},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ISDA.2008.124},
doi = {10.1109/ISDA.2008.124},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isda/TsengHL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/RomanovskyKAONHWWWCH08,
author = {Sergey Romanovsky and
Atul Katoch and
Arun Achyuthan and
C. O'Connell and
Sreedhar Natarajan and
C. Huang and
Chuan{-}Yu Wu and
Min{-}Jer Wang and
C. J. Wang and
P. Chen and
R. Hsieh},
title = {A 500MHz Random-Access Embedded 1Mb {DRAM} Macro in Bulk {CMOS}},
booktitle = {2008 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2008, Digest of Technical Papers, San Francisco, CA, USA, February
3-7, 2008},
pages = {270--271},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/ISSCC.2008.4523161},
doi = {10.1109/ISSCC.2008.4523161},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/RomanovskyKAONHWWWCH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/ChungPXAHH08,
author = {Siaw{-}Fong Chung and
Laurent Pr{\'{e}}vot and
Mingwei Xu and
Kathleen Ahrens and
Shu{-}Kai Hsieh and
Chu{-}Ren Huang},
title = {Extracting Concrete Senses of Lexicon through Measurement of Conceptual
Similarity in Ontologies},
booktitle = {Proceedings of the International Conference on Language Resources
and Evaluation, {LREC} 2008, 26 May - 1 June 2008, Marrakech, Morocco},
publisher = {European Language Resources Association},
year = {2008},
url = {http://www.lrec-conf.org/proceedings/lrec2008/summaries/501.html},
timestamp = {Mon, 19 Aug 2019 15:22:28 +0200},
biburl = {https://dblp.org/rec/conf/lrec/ChungPXAHH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/TokunagaKHHCMSSSCX08,
author = {Takenobu Tokunaga and
Dain Kaplan and
Chu{-}Ren Huang and
Shu{-}Kai Hsieh and
Nicoletta Calzolari and
Monica Monachini and
Claudia Soria and
Kiyoaki Shirai and
Virach Sornlertlamvanich and
Thatsanee Charoenporn and
Yingju Xia},
title = {Adapting International Standard for Asian Language Technologies},
booktitle = {Proceedings of the International Conference on Language Resources
and Evaluation, {LREC} 2008, 26 May - 1 June 2008, Marrakech, Morocco},
publisher = {European Language Resources Association},
year = {2008},
url = {http://www.lrec-conf.org/proceedings/lrec2008/summaries/422.html},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/TokunagaKHHCMSSSCX08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/VossenACFHHIKMMNRRTV08,
author = {Piek Vossen and
Eneko Agirre and
Nicoletta Calzolari and
Christiane Fellbaum and
Shu{-}Kai Hsieh and
Chu{-}Ren Huang and
Hitoshi Isahara and
Kyoko Kanzaki and
Andrea Marchetti and
Monica Monachini and
Federico Neri and
Remo Raffaelli and
German Rigau and
Maurizio Tesconi and
Joop VanGent},
title = {{KYOTO:} a System for Mining, Structuring and Distributing Knowledge
across Languages and Cultures},
booktitle = {Proceedings of the International Conference on Language Resources
and Evaluation, {LREC} 2008, 26 May - 1 June 2008, Marrakech, Morocco},
publisher = {European Language Resources Association},
year = {2008},
url = {http://www.lrec-conf.org/proceedings/lrec2008/summaries/373.html},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/VossenACFHHIKMMNRRTV08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miip/HsiaoCLHCLZ08,
author = {Hsi{-}Yue Hsiao and
Hua{-}mei Chen and
Ting{-}Hung Lin and
Chih{-}Yao Hsieh and
Mei{-}Yi Chu and
Guojun Liao and
Hualiang Zhong},
editor = {Joseph M. Reinhardt and
Josien P. W. Pluim},
title = {A new parametric nonrigid image registration method based on Helmholtz's
theorem},
booktitle = {Medical Imaging 2008: Image Processing, San Diego, California, United
States, 16-21 February 2008},
series = {{SPIE} Proceedings},
volume = {6914},
pages = {69142W},
publisher = {{SPIE}},
year = {2008},
url = {https://doi.org/10.1117/12.770473},
doi = {10.1117/12.770473},
timestamp = {Wed, 25 Apr 2018 08:17:27 +0200},
biburl = {https://dblp.org/rec/conf/miip/HsiaoCLHCLZ08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pdcat/ChenHL08,
author = {Da{-}Ren Chen and
Shu{-}Ming Hsieh and
Ming{-}Fong Lai},
title = {Efficient Algorithms for Jitterless Real-Time Tasks to {DVS} Schedules},
booktitle = {Ninth International Conference on Parallel and Distributed Computing,
Applications and Technologies, {PDCAT} 2008, Dunedin, Otago, New Zealand,
1-4 December 2008},
pages = {319--322},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/PDCAT.2008.15},
doi = {10.1109/PDCAT.2008.15},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/pdcat/ChenHL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pimrc/ChiouHC08,
author = {Sheng{-}Lun Chiou and
Kuo{-}Wang Hsieh and
Ming{-}Xian Chang},
title = {{CSI} reduction of {MIMO-OFDM} systems by parameterization},
booktitle = {Proceedings of the {IEEE} 19th International Symposium on Personal,
Indoor and Mobile Radio Communications, {PIMRC} 2008, 15-18 September
2008, Cannes, French Riviera, France},
pages = {1--5},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/PIMRC.2008.4699548},
doi = {10.1109/PIMRC.2008.4699548},
timestamp = {Thu, 25 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pimrc/ChiouHC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sitis/HsiehTS08,
author = {Chen{-}Chiung Hsieh and
Ming{-}Ren Tsai and
Mu{-}Chun Su},
editor = {Richard Chbeir and
Albert Dipanda and
Kokou Y{\'{e}}tongnon},
title = {A Fingertip Extraction Method and Its Application to Handwritten Alphanumeric
Characters Recognition},
booktitle = {4th {IEEE} International Conference on Signal Image Technology and
Internet Based Systems, {SITIS} 2008, Bali, Indonesia, November 30
- December 3, 2008},
pages = {293--300},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/SITIS.2008.17},
doi = {10.1109/SITIS.2008.17},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sitis/HsiehTS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sutc/TsengLH08,
author = {Vincent S. Tseng and
Kawuu Weicheng Lin and
Ming{-}Hua Hsieh},
editor = {Mukesh Singhal and
Giovanna Di Marzo Serugendo and
Jeffrey J. P. Tsai and
Wang{-}Chien Lee and
Kay R{\"{o}}mer and
Yu{-}Chee Tseng and
Han C. W. Hsiao},
title = {Energy Efficient Object Tracking in Sensor Networks by Mining Temporal
Moving Patterns},
booktitle = {{IEEE} International Conference on Sensor Networks, Ubiquitous, and
Trustworthy Computing {(SUTC} 2008), 11-13 June 2008, Taichung, Taiwan},
pages = {170--176},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/SUTC.2008.27},
doi = {10.1109/SUTC.2008.27},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sutc/TsengLH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wowmom/ChoLCMCTSG08,
author = {Dae{-}Ki Cho and
Seung{-}Hoon Lee and
Alexander Chang and
Tammara Massey and
Chia{-}Wei Chang and
Min{-}Hsieh Tsai and
Majid Sarrafzadeh and
Mario Gerla},
title = {Opportunistic medical monitoring using bluetooth {P2P} networks},
booktitle = {9th {IEEE} International Symposium on a World of Wireless, Mobile
and Multimedia Networks, {WOWMOM} 2008, Newport Beach, CA, USA, 23-26
June, 2008},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/WOWMOM.2008.4594895},
doi = {10.1109/WOWMOM.2008.4594895},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wowmom/ChoLCMCTSG08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/springer/AzcarragaHPS08,
author = {Arnulfo P. Azcarraga and
Ming{-}Huei Hsieh and
Shan Ling Pan and
Rudy Setiono},
editor = {Oded Maimon and
Lior Rokach},
title = {Improved {SOM} Labeling Methodology for Data Mining Applications},
booktitle = {Soft Computing for Knowledge Discovery and Data Mining},
pages = {45--75},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-0-387-69935-6\_3},
doi = {10.1007/978-0-387-69935-6\_3},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/series/springer/AzcarragaHPS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/isi/2008w,
editor = {Christopher C. Yang and
Hsinchun Chen and
Michael Chau and
Kuiyu Chang and
Sheau{-}Dong Lang and
Patrick S. Chen and
Raymond Hsieh and
Daniel Zeng and
Fei{-}Yue Wang and
Kathleen M. Carley and
Wenji Mao and
Justin Zhan},
title = {Intelligence and Security Informatics, {IEEE} {ISI} 2008 International
Workshops: PAISI, PACCF, and {SOCO} 2008, Taipei, Taiwan, June 17,
2008. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5075},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-69304-8},
doi = {10.1007/978-3-540-69304-8},
isbn = {978-3-540-69136-5},
timestamp = {Mon, 15 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isi/2008w.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0802-3104,
author = {M. C. Hsieh and
D. K. Jair and
Y. K. Fang and
C. S. Lin},
title = {Design and Fabrication of the Suspended High-Q Spiral Inductors with
X-Beams},
journal = {CoRR},
volume = {abs/0802.3104},
year = {2008},
url = {http://arxiv.org/abs/0802.3104},
eprinttype = {arXiv},
eprint = {0802.3104},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-0802-3104.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dss/DayTSHLWWOH07,
author = {Min{-}Yuh Day and
Richard Tzong{-}Han Tsai and
Cheng{-}Lung Sung and
Chiu{-}Chen Hsieh and
Cheng{-}Wei Lee and
Shih{-}Hung Wu and
Kuen{-}Pin Wu and
Chorng{-}Shyong Ong and
Wen{-}Lian Hsu},
title = {Reference metadata extraction using a hierarchical knowledge representation
framework},
journal = {Decis. Support Syst.},
volume = {43},
number = {1},
pages = {152--167},
year = {2007},
url = {https://doi.org/10.1016/j.dss.2006.08.006},
doi = {10.1016/J.DSS.2006.08.006},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dss/DayTSHLWWOH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/efi/VellucciHM07,
author = {Sherry L. Vellucci and
Ingrid Hsieh{-}Yee and
William E. Moen},
title = {The Metadata Education and Research Information Commons {(MERIC):}
{A} collaborative teaching and research initiative},
journal = {Educ. Inf.},
volume = {25},
number = {3-4},
pages = {169--178},
year = {2007},
url = {http://content.iospress.com/articles/education-for-information/efi00842},
timestamp = {Thu, 16 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/efi/VellucciHM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jfr/HsiehCKCGKTEAJWSM07,
author = {M. Ani Hsieh and
Anthony Cowley and
James F. Keller and
Luiz Chaimowicz and
Ben Grocholsky and
Vijay Kumar and
Camillo J. Taylor and
Yoichiro Endo and
Ronald C. Arkin and
Boyoon Jung and
Denis F. Wolf and
Gaurav S. Sukhatme and
Douglas C. MacKenzie},
title = {Adaptive teams of autonomous aerial and ground robots for situational
awareness},
journal = {J. Field Robotics},
volume = {24},
number = {11-12},
pages = {991--1014},
year = {2007},
url = {https://doi.org/10.1002/rob.20222},
doi = {10.1002/ROB.20222},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jfr/HsiehCKCGKTEAJWSM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nn/CherkasskyHKSV07,
author = {Vladimir Cherkassky and
William Hsieh and
Vladimir M. Krasnopolsky and
Dimitri P. Solomatine and
Julio J. Vald{\'{e}}s},
title = {Computational intelligence in earth and environmental sciences},
journal = {Neural Networks},
volume = {20},
number = {4},
pages = {433},
year = {2007},
url = {https://doi.org/10.1016/j.neunet.2007.05.001},
doi = {10.1016/J.NEUNET.2007.05.001},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nn/CherkasskyHKSV07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcs/HsiehT07,
author = {Ming Yu Hsieh and
Shi{-}Chun Tsai},
title = {On the fairness and complexity of generalized k-in-a-row games},
journal = {Theor. Comput. Sci.},
volume = {385},
number = {1-3},
pages = {88--100},
year = {2007},
url = {https://doi.org/10.1016/j.tcs.2007.05.031},
doi = {10.1016/J.TCS.2007.05.031},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcs/HsiehT07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tem/PanPCH07,
author = {Shan Ling Pan and
Gary S. C. Pan and
Adela J. W. Chen and
Ming H. Hsieh},
title = {The Dynamics of Implementing and Managing Modularity of Organizational
Routines During Capability Development: Insights From a Process Model},
journal = {{IEEE} Trans. Engineering Management},
volume = {54},
number = {4},
pages = {800--813},
year = {2007},
url = {https://doi.org/10.1109/TEM.2007.906854},
doi = {10.1109/TEM.2007.906854},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tem/PanPCH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkde/HsiehCY07,
author = {Ming{-}Jyh Hsieh and
Ming{-}Syan Chen and
Philip S. Yu},
title = {Approximate Query Processing in Cube Streams},
journal = {{IEEE} Trans. Knowl. Data Eng.},
volume = {19},
number = {11},
pages = {1557--1570},
year = {2007},
url = {https://doi.org/10.1109/TKDE.2007.190622},
doi = {10.1109/TKDE.2007.190622},
timestamp = {Thu, 08 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tkde/HsiehCY07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tr/HsiehJ07,
author = {Min{-}Hsiung Hsieh and
Shuen{-}Lin Jeng},
title = {Accelerated Discrete Degradation Models for Leakage Current of Ultra-Thin
Gate Oxides},
journal = {{IEEE} Trans. Reliab.},
volume = {56},
number = {3},
pages = {369--380},
year = {2007},
url = {https://doi.org/10.1109/TR.2007.903276},
doi = {10.1109/TR.2007.903276},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tr/HsiehJ07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibe/HsiehHWYLCPJLPHKCH07,
author = {Sung{-}Huai Hsieh and
Sheau{-}Ling Hsieh and
Yung{-}Ching Weng and
Tzu{-}Hsiang Yang and
Feipei Lai and
Po{-}Hsun Cheng and
Xiao{-}Ou Ping and
Mao{-}yu Jan and
Jen{-}Chiun Lin and
Chin{-}Hung Peng and
K. H. Huang and
L. F. Ko and
Chi{-}Huang Chen and
Kai{-}Ping Hsu},
title = {Middleware based Inpatient Healthcare Information System},
booktitle = {Proceedings of the 7th {IEEE} International Conference on Bioinformatics
and Bioengineering, {BIBE} 2007, October 14-17, 2007, Harvard Medical
School, Boston, MA, {USA}},
pages = {1230--1234},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/BIBE.2007.4375721},
doi = {10.1109/BIBE.2007.4375721},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bibe/HsiehHWYLCPJLPHKCH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecis/WuSCCH07,
author = {Jen{-}Her Wu and
Shin{-}Shing Shin and
Juei{-}Lung Chien and
William S. Chao and
Ming{-}Che Hsieh},
editor = {Hubert {\"{O}}sterle and
Joachim Schelp and
Robert Winter},
title = {An Extended {MDA} Method for User Interface Modeling and Transformation},
booktitle = {Proceedings of the Fifteenth European Conference on Information Systems,
{ECIS} 2007, St. Gallen, Switzerland, 2007},
pages = {1632--1642},
publisher = {University of St. Gallen},
year = {2007},
url = {http://aisel.aisnet.org/ecis2007/170},
timestamp = {Wed, 24 Jul 2019 16:44:05 +0200},
biburl = {https://dblp.org/rec/conf/ecis/WuSCCH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/LinSCCHH07,
author = {Rungtai Lin and
Ming{-}Xian Sun and
Ya{-}Ping Chang and
Yu{-}Ching Chan and
Yi{-}Chen Hsieh and
Yuan{-}Ching Huang},
editor = {Nuray M. Aykin},
title = {Designing "Culture" into Modern Product: {A} Case Study of Cultural
Product Design},
booktitle = {Usability and Internationalization. {HCI} and Culture, Second International
Conference on Usability and Internationalization, {UI-HCII} 2007,
Held as Part of {HCI} International 2007, Beijing, China, July 22-27,
2007, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {4559},
pages = {146--153},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-73287-7\_19},
doi = {10.1007/978-3-540-73287-7\_19},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hci/LinSCCHH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icadl/ChenHTW07,
author = {Szu{-}Pei Chen and
Jieh Hsiang and
Hsieh{-}Chang Tu and
Micha Wu},
editor = {Dion Hoe{-}Lian Goh and
Tru Hoang Cao and
Ingeborg S{\o}lvberg and
Edie M. Rasmussen},
title = {On Building a Full-Text Digital Library of Historical Documents},
booktitle = {Asian Digital Libraries. Looking Back 10 Years and Forging New Frontiers,
10th International Conference on Asian Digital Libraries, {ICADL}
2007, Hanoi, Vietnam, December 10-13, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4822},
pages = {49--60},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-77094-7\_11},
doi = {10.1007/978-3-540-77094-7\_11},
timestamp = {Tue, 14 May 2019 10:00:52 +0200},
biburl = {https://dblp.org/rec/conf/icadl/ChenHTW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/HsiehCWC07,
author = {Sheng{-}Wen Hsieh and
Nian{-}Shing Chen and
Min{-}Ping Wu and
Ying{-}Hsiu Chen},
editor = {J. Michael Spector and
Demetrios G. Sampson and
Toshio Okamoto and
Kinshuk and
Stefano A. Cerri and
Maomi Ueno and
Akihiro Kashihara},
title = {A Study of Using Analytic Hierarchy Process to Explore Critical Success
Factors of the {K12} Digital School},
booktitle = {Proceedings of the 7th {IEEE} International Conference on Advanced
Learning Technologies, {ICALT} 2007, Niigata, Japan, July 18-20, 2007},
pages = {133--135},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/ICALT.2007.38},
doi = {10.1109/ICALT.2007.38},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icalt/HsiehCWC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/HsiehLK07,
author = {Mong{-}ying Ani Hsieh and
Savvas G. Loizou and
Vijay Kumar},
title = {Stabilization of Multiple Robots on Stable Orbits via Local Sensing},
booktitle = {2007 {IEEE} International Conference on Robotics and Automation, {ICRA}
2007, 10-14 April 2007, Roma, Italy},
pages = {2312--2317},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/ROBOT.2007.363664},
doi = {10.1109/ROBOT.2007.363664},
timestamp = {Mon, 22 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/HsiehLK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/DerenickSH07,
author = {Jason C. Derenick and
John R. Spletzer and
M. Ani Hsieh},
title = {A graph theoretic approach to optimal target tracking for mobile robot
teams},
booktitle = {2007 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, October 29 - November 2, 2007, Sheraton Hotel and Marina,
San Diego, California, {USA}},
pages = {3422--3428},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/IROS.2007.4399574},
doi = {10.1109/IROS.2007.4399574},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/DerenickSH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/HalaszHBK07,
author = {{\'{A}}d{\'{a}}m M. Hal{\'{a}}sz and
M. Ani Hsieh and
Spring Berman and
Vijay Kumar},
title = {Dynamic redistribution of a swarm of robots among multiple sites},
booktitle = {2007 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, October 29 - November 2, 2007, Sheraton Hotel and Marina,
San Diego, California, {USA}},
pages = {2320--2325},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/IROS.2007.4399528},
doi = {10.1109/IROS.2007.4399528},
timestamp = {Mon, 22 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iros/HalaszHBK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc/LuHL07,
author = {Shun{-}Yen Lu and
Ming{-}Ting Hsieh and
Jing{-}Jia Liou},
editor = {Jill Sibert and
Janusz Rajski},
title = {An efficient SAT-based path delay fault {ATPG} with an unified sensitization
model},
booktitle = {2007 {IEEE} International Test Conference, {ITC} 2007, Santa Clara,
California, USA, October 21-26, 2007},
pages = {1--7},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/TEST.2007.4437589},
doi = {10.1109/TEST.2007.4437589},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/itc/LuHL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itc/MolyneauxZKAHH07,
author = {Robert F. Molyneaux and
Thomas A. Ziaja and
Hong Kim and
Shahryar Aryani and
Sungbae Hwang and
Alex Hsieh},
editor = {Jill Sibert and
Janusz Rajski},
title = {Design for testability features of the {SUN} microsystems niagara2
{CMP/CMT} {SPARC} chip},
booktitle = {2007 {IEEE} International Test Conference, {ITC} 2007, Santa Clara,
California, USA, October 21-26, 2007},
pages = {1--8},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/TEST.2007.4437561},
doi = {10.1109/TEST.2007.4437561},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/itc/MolyneauxZKAHH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwic/BertagnaMSCHHMT07,
author = {Francesca Bertagna and
Monica Monachini and
Claudia Soria and
Nicoletta Calzolari and
Chu{-}Ren Huang and
Shu{-}Kai Hsieh and
Andrea Marchetti and
Maurizio Tesconi},
editor = {Toru Ishida and
Susan R. Fussell and
Piek T. J. M. Vossen},
title = {Fostering Intercultural Collaboration: {A} Web Service Architecture
for Cross-Fertilization of Distributed Wordnets},
booktitle = {Intercultural Collaboration, First International Workshop, {IWIC}
2007, Kyoto, Japan, January 25-26, 2007, Invited and Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {4568},
pages = {146--158},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-74000-1\_11},
doi = {10.1007/978-3-540-74000-1\_11},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/iwic/BertagnaMSCHHMT07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mir/ChengCCWFLHPCT07,
author = {Wen{-}Huang Cheng and
Yung{-}Yu Chuang and
Bing{-}Yu Chen and
Ja{-}Ling Wu and
Shao{-}Yen Fang and
Yin{-}Tzu Lin and
Chi{-}Chang Hsieh and
Chen{-}Ming Pan and
Wei{-}Ta Chu and
Min{-}Chun Tien},
editor = {James Ze Wang and
Nozha Boujemaa and
Alberto Del Bimbo and
Jia Li},
title = {Semantic-event based analysis and segmentation of wedding ceremony
videos},
booktitle = {Proceedings of the 9th {ACM} {SIGMM} International Workshop on Multimedia
Information Retrieval, {MIR} 2007, Augsburg, Bavaria, Germany, September
24-29, 2007},
pages = {95--104},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1290082.1290098},
doi = {10.1145/1290082.1290098},
timestamp = {Fri, 21 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mir/ChengCCWFLHPCT07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/paclic/HuangH07,
author = {Hsin{-}mei May Huang and
Shelley Ching{-}Yu Hsieh},
editor = {Hee{-}Rahk Chae and
Jae{-}Woong Choe and
Jong Sup Jun and
Youngchul Jun and
Eun{-}Jung Yoo},
title = {Time-moving Metaphors and Ego-moving Metaphors: Which Is Better Comprehended
by Taiwanese?},
booktitle = {Proceedings of the 21st Pacific Asia Conference on Language, Information
and Computation, {PACLIC} 21, Seoul, Korea, November 1-3, 2007},
publisher = {The Korean Society for Language and Information / {ACL}},
year = {2007},
url = {https://aclanthology.org/Y07-1017/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/paclic/HuangH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vrst/HsiehOJYDAK07,
author = {Tung{-}Ju Hsieh and
Michael J. Olsen and
Elizabeth Johnstone and
Adam P. Young and
Neal Driscoll and
Scott A. Ashford and
Falko Kuester},
editor = {Aditi Majumder and
Larry F. Hodges and
Daniel Cohen{-}Or and
Stephen N. Spencer},
title = {VR-based visual analytics of {LIDAR} data for cliff erosion assessment},
booktitle = {Proceedings of the {ACM} Symposium on Virtual Reality Software and
Technology, {VRST} 2007, Newport Beach, California, USA, November
5-7, 2007},
pages = {249--250},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1315184.1315244},
doi = {10.1145/1315184.1315244},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vrst/HsiehOJYDAK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/SheuDH07,
author = {Jang{-}Ping Sheu and
Ming{-}Lung Ding and
Kun{-}Ying Hsieh},
title = {Routing with Hexagonal Virtual Coordinates in Wireless Sensor Networks},
booktitle = {{IEEE} Wireless Communications and Networking Conference, {WCNC} 2007,
Hong Kong, China, 11-15 March, 2007},
pages = {2929--2934},
publisher = {{IEEE}},
year = {2007},
url = {https://doi.org/10.1109/WCNC.2007.543},
doi = {10.1109/WCNC.2007.543},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/wcnc/SheuDH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wmcsa/CornwellFHPRTVBCHMRS07,
author = {Jason Cornwell and
Ian Fette and
Gary Hsieh and
Madhu K. Prabaker and
Jinghai Rao and
Karen P. Tang and
Kami Vaniea and
Lujo Bauer and
Lorrie Faith Cranor and
Jason I. Hong and
Bruce M. McLaren and
Mike Reiter and
Norman M. Sadeh},
editor = {Eyal de Lara and
Nina Bhatti},
title = {User-Controllable Security and Privacy for Pervasive Computing},
booktitle = {Eighth {IEEE} Workshop on Mobile Computing Systems and Applications,
HotMobile 2007, Tucson, Arizona, USA, March 8-9, 2007},
pages = {14--19},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/HotMobile.2007.9},
doi = {10.1109/HOTMOBILE.2007.9},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wmcsa/CornwellFHPRTVBCHMRS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/LeeYH07,
author = {Yue{-}Shi Lee and
Show{-}Jane Yen and
Min{-}Chi Hsieh},
editor = {Jie Lu and
Guangquan Zhang and
Da Ruan},
title = {An Incremental Technique for Analyzing User Behaviors in an E-Business
Environment},
booktitle = {E-Service Intelligence: Methodologies, Technologies and Applications},
series = {Studies in Computational Intelligence},
volume = {37},
pages = {347--364},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-37017-8\_16},
doi = {10.1007/978-3-540-37017-8\_16},
timestamp = {Fri, 19 Jan 2018 12:52:29 +0100},
biburl = {https://dblp.org/rec/series/sci/LeeYH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/wsc/2007,
editor = {Shane G. Henderson and
Bahar Biller and
Ming{-}Hua Hsieh and
John Shortle and
Jeffrey D. Tew and
Russell R. Barton},
title = {Proceedings of the Winter Simulation Conference, {WSC} 2007, Washington,
DC, USA, December 9-12, 2007},
publisher = {{WSC}},
year = {2007},
url = {https://ieeexplore.ieee.org/xpl/conhome/4419575/proceeding},
isbn = {1-4244-1306-0},
timestamp = {Thu, 10 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/2007.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0710-4798,
author = {Ryan Mannion and
Harry Hsieh and
Susan Cotterell and
Frank Vahid},
title = {System Synthesis for Networks of Programmable Blocks},
journal = {CoRR},
volume = {abs/0710.4798},
year = {2007},
url = {http://arxiv.org/abs/0710.4798},
eprinttype = {arXiv},
eprint = {0710.4798},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-0710-4798.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/ShihLLPCWWCSH06,
author = {Arthur Chun{-}Chieh Shih and
D. T. Lee and
Laurent Lin and
Chin{-}Lin Peng and
Shiang{-}Heng Chen and
Yu{-}Wei Wu and
Chun{-}Yi Wong and
Meng{-}Yuan Chou and
Tze{-}Chang Shiao and
Mu{-}Fen Hsieh},
title = {SinicView: {A} visualization environment for comparisons of multiple
nucleotide sequence alignment tools},
journal = {{BMC} Bioinform.},
volume = {7},
pages = {103},
year = {2006},
url = {https://doi.org/10.1186/1471-2105-7-103},
doi = {10.1186/1471-2105-7-103},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/ShihLLPCWWCSH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dam/HsiehHHK06,
author = {Sun{-}Yuan Hsieh and
Chin{-}Wen Ho and
Tsan{-}sheng Hsu and
Ming{-}Tat Ko},
title = {The Hamiltonian problem on distance-hereditary graphs},
journal = {Discret. Appl. Math.},
volume = {154},
number = {3},
pages = {508--524},
year = {2006},
url = {https://doi.org/10.1016/j.dam.2005.07.012},
doi = {10.1016/J.DAM.2005.07.012},
timestamp = {Thu, 11 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dam/HsiehHHK06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijait/HsiehWCCYYC06,
author = {Ting{-}Ya Hsieh and
Morris H. L. Wang and
Cheng{-}Wu Chen and
Chen{-}Yuan Chen and
Shang{-}En Yu and
Hsien{-}Chueh Yang and
Tsung{-}Hao Chen},
title = {A New Viewpoint of S-curve Regression Model and its Application to
Construction Management},
journal = {Int. J. Artif. Intell. Tools},
volume = {15},
number = {2},
pages = {131--142},
year = {2006},
url = {https://doi.org/10.1142/S021821300600259X},
doi = {10.1142/S021821300600259X},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijait/HsiehWCCYYC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbi/TangHNM06,
author = {Xiangyang Tang and
Jiang Hsieh and
Roy A. Nilsen and
Scott M. McOlash},
title = {Extending Three-Dimensional Weighted Cone Beam Filtered Backprojection
{(CB-FBP)} Algorithm for Image Reconstruction in Volumetric {CT} at
Low Helical Pitches},
journal = {Int. J. Biomed. Imaging},
volume = {2006},
pages = {45942:1--45942:8},
year = {2006},
url = {https://doi.org/10.1155/IJBI/2006/45942},
doi = {10.1155/IJBI/2006/45942},
timestamp = {Sun, 21 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijbi/TangHNM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/SuLH06,
author = {Mu{-}Chun Su and
Jonathan Lee and
Kuo{-}Lung Hsieh},
title = {A new ARTMAP-based neural network for incremental learning},
journal = {Neurocomputing},
volume = {69},
number = {16-18},
pages = {2284--2300},
year = {2006},
url = {https://doi.org/10.1016/j.neucom.2005.06.020},
doi = {10.1016/J.NEUCOM.2005.06.020},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijon/SuLH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/PanPH06,
author = {Shan Ling Pan and
Gary S. C. Pan and
Ming H. Hsieh},
title = {A dual-level analysis of the capability development process: {A} case
study of TT{\&}T},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {57},
number = {13},
pages = {1814--1829},
year = {2006},
url = {https://doi.org/10.1002/asi.20384},
doi = {10.1002/ASI.20384},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasis/PanPH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jors/SetionoPHA06,
author = {Rudy Setiono and
Shan L. Pan and
Ming{-}Huei Hsieh and
Arnulfo P. Azcarraga},
title = {Knowledge acquisition and revision using neural networks: an application
to a cross-national study of brand image perception},
journal = {J. Oper. Res. Soc.},
volume = {57},
number = {3},
pages = {231--240},
year = {2006},
url = {https://doi.org/10.1057/palgrave.jors.2602006},
doi = {10.1057/PALGRAVE.JORS.2602006},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jors/SetionoPHA06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/GilbertTNIPCHMC06,
author = {Laura Gilbert and
Jeff Tseng and
Rhys Newman and
Saeed Iqbal and
Ronald Pepper and
Onur Celebioglu and
Jenwei Hsieh and
Victor Mashayekhi and
Mark Cobban},
title = {Implications of virtualization on Grids for high energy physics applications},
journal = {J. Parallel Distributed Comput.},
volume = {66},
number = {7},
pages = {922--930},
year = {2006},
url = {https://doi.org/10.1016/j.jpdc.2005.12.013},
doi = {10.1016/J.JPDC.2005.12.013},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jpdc/GilbertTNIPCHMC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/HuangHCMC06,
author = {Yu{-}Wen Huang and
Bing{-}Yu Hsieh and
Shao{-}Yi Chien and
Shyh{-}Yih Ma and
Liang{-}Gee Chen},
title = {Analysis and complexity reduction of multiple reference frames motion
estimation in {H.264/AVC}},
journal = {{IEEE} Trans. Circuits Syst. Video Technol.},
volume = {16},
number = {4},
pages = {507--522},
year = {2006},
url = {https://doi.org/10.1109/TCSVT.2006.872783},
doi = {10.1109/TCSVT.2006.872783},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcsv/HuangHCMC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/vlsisp/ChienHHMC06,
author = {Shao{-}Yi Chien and
Bing{-}Yu Hsieh and
Yu{-}Wen Huang and
Shyh{-}Yih Ma and
Liang{-}Gee Chen},
title = {Hybrid Morphology Processing Unit Architecture for Moving Object Segmentation
Systems},
journal = {J. {VLSI} Signal Process.},
volume = {42},
number = {3},
pages = {241--255},
year = {2006},
url = {https://doi.org/10.1007/s11265-006-4185-1},
doi = {10.1007/S11265-006-4185-1},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/vlsisp/ChienHHMC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asist/BaeMMZHMS06,
author = {Soonil Bae and
Catherine C. Marshall and
Konstantinos A. Meintanis and
Anna Zacchi and
Hao{-}wei Hsieh and
J. Michael Moore and
Frank M. Shipman III},
title = {Patterns of reading and organizing information in document triage},
booktitle = {Information Realities: Shaping the Digital Future for All - Proceedings
of the 69th ASIS{\&}T Annual Meeting, {ASIST} 2006, Austin, TX,
USA, November 3-8, 2006},
series = {Proc. Assoc. Inf. Sci. Technol.},
volume = {43},
number = {1},
pages = {1--27},
publisher = {Wiley},
year = {2006},
url = {https://doi.org/10.1002/meet.14504301160},
doi = {10.1002/MEET.14504301160},
timestamp = {Fri, 21 Jan 2022 13:55:35 +0100},
biburl = {https://dblp.org/rec/conf/asist/BaeMMZHMS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asist/Hsieh-YeeVMMH06,
author = {Ingrid Hsieh{-}Yee and
Sherry L. Vellucci and
William E. Moen and
Francis Miksa and
Diane Hillmann},
title = {Building a digital teaching commons to enhance teaching, learning
and research: The {MERIC} experience and challenges},
booktitle = {Information Realities: Shaping the Digital Future for All - Proceedings
of the 69th ASIS{\&}T Annual Meeting, {ASIST} 2006, Austin, TX,
USA, November 3-8, 2006},
series = {Proc. Assoc. Inf. Sci. Technol.},
volume = {43},
number = {1},
pages = {1--7},
publisher = {Wiley},
year = {2006},
url = {https://doi.org/10.1002/meet.14504301101},
doi = {10.1002/MEET.14504301101},
timestamp = {Wed, 24 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/asist/Hsieh-YeeVMMH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccs/TsuH06,
author = {Shan Ming Tsu and
W. S. Hsieh},
editor = {Ferng{-}Ching Lin and
Der{-}Tsai Lee and
Bao{-}Shuh Paul Lin and
Shiuhpyng Shieh and
Sushil Jajodia},
title = {Quadtree based perceptual watermarking scheme},
booktitle = {Proceedings of the 2006 {ACM} Symposium on Information, Computer and
Communications Security, {ASIACCS} 2006, Taipei, Taiwan, March 21-24,
2006},
pages = {356},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1128817.1128871},
doi = {10.1145/1128817.1128871},
timestamp = {Tue, 10 Nov 2020 16:06:16 +0100},
biburl = {https://dblp.org/rec/conf/ccs/TsuH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/PanCHCLCLLHWLLTYMCCPHCH06,
author = {Jyh{-}Shin Pan and
Hao{-}Cheng Chen and
Bing{-}Yu Hsieh and
Hong{-}Ching Chen and
Roger Lee and
Ching{-}Ho Chu and
Yuan{-}Chin Liu and
Chuan Liu and
Lily Huang and
Chang{-}Long Wu and
Meng{-}Hsueh Lin and
Chun{-}Yiu Lin and
Shang{-}Nien Tsai and
Jenn{-}Ning Yang and
Chang{-}Po Ma and
Yung Cheng and
Shu{-}Hung Chou and
Hsiu{-}Chen Peng and
Peng{-}Chuan Huang and
Benjamin Chiu and
Alex Ho},
editor = {Ellen Sentovich},
title = {A {CMOS} SoC for 56/18/16 CD/DVD-dual/RAM applications},
booktitle = {Proceedings of the 43rd Design Automation Conference, {DAC} 2006,
San Francisco, CA, USA, July 24-28, 2006},
pages = {290--291},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1146909.1146985},
doi = {10.1145/1146909.1146985},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dac/PanCHCLCLLHWLLTYMCCPHCH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/McDirmidH06,
author = {Sean McDirmid and
Wilson C. Hsieh},
editor = {Dave Thomas},
title = {SuperGlue: Component Programming with Object-Oriented Signals},
booktitle = {{ECOOP} 2006 - Object-Oriented Programming, 20th European Conference,
Nantes, France, July 3-7, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4067},
pages = {206--229},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11785477\_15},
doi = {10.1007/11785477\_15},
timestamp = {Tue, 14 May 2019 10:00:54 +0200},
biburl = {https://dblp.org/rec/conf/ecoop/McDirmidH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/egice/HsiehL06,
author = {Shang{-}Hsien Hsieh and
Ming{-}Der Lu},
editor = {Ian F. C. Smith},
title = {Collaborative Engineering Software Development: Ontology-Based Approach},
booktitle = {Intelligent Computing in Engineering and Architecture, 13th {EG-ICE}
Workshop 2006, Ascona, Switzerland, June 25-30, 2006, Revised Selected
Papers},
series = {Lecture Notes in Computer Science},
volume = {4200},
pages = {328--342},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11888598\_31},
doi = {10.1007/11888598\_31},
timestamp = {Tue, 23 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/egice/HsiehL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/TingJHLL06,
author = {Kuo{-}Chang Ting and
Mao{-}yu Jan and
Sung{-}Huai Hsieh and
Hsiu{-}Hui Lee and
Feipei Lai},
title = {{GDCF:} Grouping {DCF} for the {MAC} layer enhancement of 802.11},
booktitle = {Proceedings of the Global Telecommunications Conference, 2006. {GLOBECOM}
'06, San Francisco, CA, USA, 27 November - 1 December 2006},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/GLOCOM.2006.815},
doi = {10.1109/GLOCOM.2006.815},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/globecom/TingJHLL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icalt/ChenHK06,
author = {Nian{-}Shing Chen and
Sheng{-}Wen Hsieh and
Kinshuk},
title = {Adaptive Language Learning Based on Learner's {STM} Ability in M-learning
Environment},
booktitle = {Proceedings of the 6th {IEEE} International Conference on Advanced
Learning Technologies, {ICALT} 2006, Kerkrade, The Netherlands, July
5-7, 2006},
pages = {1174--1175},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ICALT.2006.1652679},
doi = {10.1109/ICALT.2006.1652679},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icalt/ChenHK06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icicic/HsiehWC06,
author = {Sung{-}Yu Hsieh and
Zhao{-}Kai Wu and
Mei{-}Yung Chen},
title = {Implementation and Self-Tuning Adaptive Control Design of an Electromagnetic
Submicro-positioner},
booktitle = {First International Conference on Innovative Computing, Information
and Control {(ICICIC} 2006), 30 August - 1 September 2006, Beijing,
China},
pages = {296--299},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ICICIC.2006.462},
doi = {10.1109/ICICIC.2006.462},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icicic/HsiehWC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icicic/KuanCKH06,
author = {Yu{-}Hsin Kuan and
Shih{-}Ting Chen and
Chung Ming Kuo and
Chaur{-}Heh Hsieh},
title = {A Novel Unsupervised Salient Region Segmentation for Color Images},
booktitle = {First International Conference on Innovative Computing, Information
and Control {(ICICIC} 2006), 30 August - 1 September 2006, Beijing,
China},
pages = {96--99},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ICICIC.2006.216},
doi = {10.1109/ICICIC.2006.216},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icicic/KuanCKH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/KruchtenHMMSE06,
author = {Philippe Kruchten and
Yvonne Hsieh and
Eve MacGregor and
Deependra Moitra and
Wolfgang Strigel and
Christof Ebert},
editor = {Leon J. Osterweil and
H. Dieter Rombach and
Mary Lou Soffa},
title = {Global software development for the practitioner},
booktitle = {28th International Conference on Software Engineering {(ICSE} 2006),
Shanghai, China, May 20-28, 2006},
pages = {1032--1033},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1134285.1134489},
doi = {10.1145/1134285.1134489},
timestamp = {Mon, 26 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icse/KruchtenHMMSE06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/KruchtenHMMSE06a,
author = {Philippe Kruchten and
Yvonne Hsieh and
Eve MacGregor and
Deependra Moitra and
Wolfgang Strigel and
Christof Ebert},
editor = {Philippe Kruchten and
Deependra Moitra and
Wolfgang Strigel and
Christof Ebert},
title = {Introduction to the 1ST international workshop on global software
development for the practitioner},
booktitle = {Proceedings of the 2006 International Workshop on Global Software
Development For the Practitioner, {GSD} '06, Shanghai, China, May
23, 2006},
pages = {1--2},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1138506.1138507},
doi = {10.1145/1138506.1138507},
timestamp = {Mon, 31 Jan 2022 13:22:35 +0100},
biburl = {https://dblp.org/rec/conf/icse/KruchtenHMMSE06a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iri/TsaiDHSDH06,
author = {Richard Tzong{-}Han Tsai and
Hong{-}Jie Dai and
Hsieh{-}Chuan Hung and
Cheng{-}Lung Sung and
Min{-}Yuh Day and
Wen{-}Lian Hsu},
title = {Chinese word segmentation with minimal linguistic knowledge: An improved
conditional random fields coupled with character clustering and automatically
discovered template matching},
booktitle = {Proceedings of the 2006 {IEEE} International Conference on Information
Reuse and Integration, {IRI} - 2006: Heuristic Systems Engineering,
September 16-18, 2006, Waikoloa, Hawaii, {USA}},
pages = {274--279},
publisher = {{IEEE} Systems, Man, and Cybernetics Society},
year = {2006},
url = {https://doi.org/10.1109/IRI.2006.252425},
doi = {10.1109/IRI.2006.252425},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iri/TsaiDHSDH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/HsiehS06,
author = {Ming{-}Ta Hsieh and
Gerald E. Sobelman},
title = {Modeling and verification of high-speed wired links with Verilog-AMS},
booktitle = {International Symposium on Circuits and Systems {(ISCAS} 2006), 21-24
May 2006, Island of Kos, Greece},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/ISCAS.2006.1693032},
doi = {10.1109/ISCAS.2006.1693032},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iscas/HsiehS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/PanHCCHCTCLCLHL06,
author = {Jyh{-}Shin Pan and
Tse{-}Hsiang Hsu and
Hao{-}Cheng Chen and
Jong{-}Woei Chen and
Bing{-}Yu Hsieh and
Hong{-}Ching Chen and
Wei{-}Hsuan Tu and
Chi{-}Ming Chang and
Roger Lee and
Ching{-}Ho Chu and
Yuan{-}Chin Liu and
Chuan{-}Cheng Hsiao and
Chuan Liu and
Lily Huang and
Chia{-}Hua Chou and
Chang{-}Long Wu and
Meng{-}Hsueh Lin and
Shang{-}Ping Chen and
Brian Liu and
Heng{-}Shou Hsu and
Chun{-}Yiu Lin and
Shang{-}Nien Tsai and
Jenn{-}Ning Yang and
Sean Chien and
Kuan{-}Hua Chao and
Chang{-}Po Ma and
Yung Cheng and
Shu{-}Hung Chou and
Yih{-}Shin Weng and
Ming{-}Shiam Tsai and
Kun{-}Hung Hsieh and
Kuang{-}Jung Chang and
Jin{-}Chuan Hsu and
Hsiu{-}Chen Peng and
Alex Ho},
title = {Fully Integrated {CMOS} SoC for 56/18/16 CD/DVD-dual/RAM Applications
with On-Chip 4-LVDS Channel {WSG} and 1.5Gb/s {SATA} {PHY}},
booktitle = {2006 {IEEE} International Solid State Circuits Conference, {ISSCC}
2006, Digest of Technical Papers, an Francisco, CA, USA, February
6-9, 2006},
pages = {1022--1031},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/ISSCC.2006.1696144},
doi = {10.1109/ISSCC.2006.1696144},
timestamp = {Mon, 09 Aug 2021 14:54:04 +0200},
biburl = {https://dblp.org/rec/conf/isscc/PanHCCHCTCLCLHL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iui/BadiBMMZHSM06,
author = {Rajiv Badi and
Soonil Bae and
J. Michael Moore and
Konstantinos A. Meintanis and
Anna Zacchi and
Hao{-}wei Hsieh and
Frank M. Shipman III and
Catherine C. Marshall},
editor = {C{\'{e}}cile Paris and
Candace L. Sidner},
title = {Recognizing user interest and document value from reading and organizing
activities in document triage},
booktitle = {Proceedings of the 11th International Conference on Intelligent User
Interfaces, {IUI} 2006, Sydney, Australia, January 29 - February 1,
2006},
pages = {218--225},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1111449.1111496},
doi = {10.1145/1111449.1111496},
timestamp = {Tue, 06 Nov 2018 11:07:41 +0100},
biburl = {https://dblp.org/rec/conf/iui/BadiBMMZHSM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jcis/Meng-FenH06,
author = {Hsieh Meng{-}Fen and
Shirley J. Ho},
title = {Does Information Technology Always Help? Theory and Evidence from
Taiwan's Banking Industry},
booktitle = {Proceedings of the 2006 Joint Conference on Information Sciences,
{JCIS} 2006, Kaohsiung, Taiwan, ROC, October 8-11, 2006},
publisher = {Atlantis Press},
year = {2006},
url = {https://doi.org/10.2991/jcis.2006.147},
doi = {10.2991/JCIS.2006.147},
timestamp = {Wed, 10 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/jcis/Meng-FenH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jcis/SuHZ06,
author = {Mu{-}Chun Su and
Yi{-}Zeng Hsieh and
Yu{-}Xiang Zhao},
title = {A Simple Approach to Stereo Matching and Its Application in Developing
a Travel Aid for the Blind},
booktitle = {Proceedings of the 2006 Joint Conference on Information Sciences,
{JCIS} 2006, Kaohsiung, Taiwan, ROC, October 8-11, 2006},
publisher = {Atlantis Press},
year = {2006},
url = {https://doi.org/10.2991/jcis.2006.19},
doi = {10.2991/JCIS.2006.19},
timestamp = {Wed, 10 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/jcis/SuHZ06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jmlc/McDirmidHF06,
author = {Sean McDirmid and
Wilson C. Hsieh and
Matthew Flatt},
editor = {David E. Lightfoot and
Clemens A. Szyperski},
title = {A Framework for Modular Linking in {OO} Languages},
booktitle = {Modular Programming Languages, 7th Joint Modular Languages Conference,
{JMLC} 2006, Oxford, UK, September 13-15, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4228},
pages = {116--135},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11860990\_9},
doi = {10.1007/11860990\_9},
timestamp = {Tue, 14 May 2019 10:00:44 +0200},
biburl = {https://dblp.org/rec/conf/jmlc/McDirmidHF06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mobility/TingJHLL06,
author = {Kuo{-}Chang Ting and
Mao{-}yu Jan and
Sung{-}Huai Hsieh and
Hsiu{-}Hui Lee and
Feipei Lai},
title = {Design and analysis of grouping-based {DCF} {(GB-DCF)} scheme for
the {MAC} layer enhancement of 802.11 and 802.11e},
booktitle = {Proceedings of the 3rd international conference on Mobile technology,
applications {\&} systems, Mobility '06, Bangkok, Thailand, October
25-27, 2006},
pages = {7},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1292331.1292340},
doi = {10.1145/1292331.1292340},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mobility/TingJHLL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mswim/TingJHLL06,
author = {Kuo{-}Chang Ting and
Mao{-}yu Jan and
Sung{-}Huai Hsieh and
Hsiu{-}Hui Lee and
Feipei Lai},
editor = {Enrique Alba and
Carla{-}Fabiana Chiasserini and
Nael B. Abu{-}Ghazaleh and
Renato Lo Cigno},
title = {Design and analysis of grouping-based {DCF} {(GB-DCF)} scheme for
the {MAC} layer enhancement of 802.11 and 802.11n},
booktitle = {Proceedings of the 9th International Symposium on Modeling Analysis
and Simulation of Wireless and Mobile Systems, MSWiM 2006, Terromolinos,
Spain, October 2-6, 2006},
pages = {255--264},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1164717.1164762},
doi = {10.1145/1164717.1164762},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mswim/TingJHLL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/osdi/ChangDGHWBCFG06,
author = {Fay Chang and
Jeffrey Dean and
Sanjay Ghemawat and
Wilson C. Hsieh and
Deborah A. Wallach and
Michael Burrows and
Tushar Chandra and
Andrew Fikes and
Robert Gruber},
editor = {Brian N. Bershad and
Jeffrey C. Mogul},
title = {Bigtable: {A} Distributed Storage System for Structured Data (Awarded
Best Paper!)},
booktitle = {7th Symposium on Operating Systems Design and Implementation {(OSDI}
'06), November 6-8, Seattle, WA, {USA}},
pages = {205--218},
publisher = {{USENIX} Association},
year = {2006},
url = {http://www.usenix.org/events/osdi06/tech/chang.html},
timestamp = {Tue, 02 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/osdi/ChangDGHWBCFG06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/HsiehLKLL06,
author = {Hung{-}Yi Hsieh and
Sheng{-}Fu Liang and
Li{-}Wei Ko and
May Lin and
Chin{-}Teng Lin},
title = {Development of a Real-Time Wireless Embedded Brain Signal Acquisition/Processing
System and its Application on Driver's Drowsiness Estimation},
booktitle = {Proceedings of the {IEEE} International Conference on Systems, Man
and Cybernetics, Taipei, Taiwan, October 8-11, 2006},
pages = {4374--4379},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/ICSMC.2006.384822},
doi = {10.1109/ICSMC.2006.384822},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/smc/HsiehLKLL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/YenHWL06,
author = {Shwu{-}Huey Yen and
Ming{-}Hsien Hsieh and
Chia{-}Jen Wang and
Hwei{-}Jen Lin},
title = {A Content-Based Painting Image Retrieval System Based on AdaBoost
Algorithm},
booktitle = {Proceedings of the {IEEE} International Conference on Systems, Man
and Cybernetics, Taipei, Taiwan, October 8-11, 2006},
pages = {2407--2412},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/ICSMC.2006.385224},
doi = {10.1109/ICSMC.2006.385224},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/smc/YenHWL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/icl/SunHH05,
author = {Hung{-}Min Sun and
Bin{-}Tsan Hsieh and
Hsin{-}Jia Hwang},
title = {Secure E-mail protocols providing perfect forward secrecy},
journal = {{IEEE} Commun. Lett.},
volume = {9},
number = {1},
pages = {58--60},
year = {2005},
url = {https://doi.org/10.1109/LCOMM.2005.01004},
doi = {10.1109/LCOMM.2005.01004},
timestamp = {Thu, 20 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/icl/SunHH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/ChengTH05,
author = {Sheng{-}Tzong Cheng and
Chih{-}Hsiung Tseng and
Ming{-}Tzung Hsieh},
title = {An Integrated Location Management Scheme for Seamless Access in {B3G}
Systems},
journal = {{IEICE} Trans. Commun.},
volume = {88-B},
number = {2},
pages = {716--723},
year = {2005},
url = {https://doi.org/10.1093/ietcom/E88-B.2.716},
doi = {10.1093/IETCOM/E88-B.2.716},
timestamp = {Sat, 11 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ieicet/ChengTH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijwis/LeeYH05,
author = {Yue{-}Shi Lee and
Show{-}Jane Yen and
Min{-}Chi Hsieh},
title = {A Lattice-Based Framework for Interactively and Incrementally Mining
Web Traversal Patterns},
journal = {Int. J. Web Inf. Syst.},
volume = {1},
number = {4},
pages = {197--207},
year = {2005},
url = {https://doi.org/10.1108/17440080580000093},
doi = {10.1108/17440080580000093},
timestamp = {Wed, 20 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijwis/LeeYH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jors/SetionoPHA05,
author = {Rudy Setiono and
Shan L. Pan and
Ming{-}Huei Hsieh and
Arnulfo P. Azcarraga},
title = {Automatic knowledge extraction from survey data: learning \emph{M}-of-\emph{N}
constructs using a hybrid approach},
journal = {J. Oper. Res. Soc.},
volume = {56},
number = {1},
pages = {3--14},
year = {2005},
url = {https://doi.org/10.1057/palgrave.jors.2601807},
doi = {10.1057/PALGRAVE.JORS.2601807},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jors/SetionoPHA05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jss/SunHT05,
author = {Hung{-}Min Sun and
Bin{-}Tsan Hsieh and
Shin{-}Mu Tseng},
title = {On the security of some proxy blind signature schemes},
journal = {J. Syst. Softw.},
volume = {74},
number = {3},
pages = {297--302},
year = {2005},
url = {https://doi.org/10.1016/j.jss.2004.02.015},
doi = {10.1016/J.JSS.2004.02.015},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jss/SunHT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/paa/SuLLCH05,
author = {Mu{-}Chun Su and
Wei{-}Zhe Lu and
Jonathan Lee and
Gwo{-}Dong Chen and
Chen{-}Chiung Hsieh},
title = {The {MSFAM:} a modified fuzzy {ARTMAP} system},
journal = {Pattern Anal. Appl.},
volume = {8},
number = {1-2},
pages = {1--16},
year = {2005},
url = {https://doi.org/10.1007/s10044-004-0229-y},
doi = {10.1007/S10044-004-0229-Y},
timestamp = {Fri, 30 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/paa/SuLLCH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmc/ChengH05,
author = {Sheng{-}Tzong Cheng and
Ming{-}Tzung Hsieh},
title = {Design and Analysis of Time-Based Code Allocation Schemes in {W-CDMA}
Systems},
journal = {{IEEE} Trans. Mob. Comput.},
volume = {4},
number = {6},
pages = {604--615},
year = {2005},
url = {https://doi.org/10.1109/TMC.2005.86},
doi = {10.1109/TMC.2005.86},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmc/ChengH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/AzcarragaHPS05,
author = {Arnulfo P. Azcarraga and
Ming{-}Huei Hsieh and
Shan L. Pan and
Rudy Setiono},
title = {Extracting salient dimensions for automatic {SOM} labeling},
journal = {{IEEE} Trans. Syst. Man Cybern. Part {C}},
volume = {35},
number = {4},
pages = {595--600},
year = {2005},
url = {https://doi.org/10.1109/TSMCC.2004.843177},
doi = {10.1109/TSMCC.2004.843177},
timestamp = {Thu, 21 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsmc/AzcarragaHPS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/SetionoPHA05,
author = {Rudy Setiono and
Shan L. Pan and
Ming{-}Huei Hsieh and
Arnulfo P. Azcarraga},
title = {Separating core and noncore knowledge: an application of neural network
rule extraction to a cross-national study of brand image perception},
journal = {{IEEE} Trans. Syst. Man Cybern. Part {C}},
volume = {35},
number = {4},
pages = {465--475},
year = {2005},
url = {https://doi.org/10.1109/TSMCC.2004.843201},
doi = {10.1109/TSMCC.2004.843201},
timestamp = {Thu, 21 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tsmc/SetionoPHA05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aina/ChenCTTHT05,
author = {Jeanne Chen and
Tung{-}Shou Chen and
Tzu{-}Hsin Tsai and
Hui{-}Fang Tsai and
Mingli Hsieh and
Shih{-}Shan Tang},
title = {Using the {ACM} Technique to Refine Protein Spots in 2DGE Images},
booktitle = {19th International Conference on Advanced Information Networking and
Applications {(AINA} 2005), 28-30 March 2005, Taipei, Taiwan},
pages = {289--292},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/AINA.2005.339},
doi = {10.1109/AINA.2005.339},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aina/ChenCTTHT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aina/ChouHGS05,
author = {Shih{-}Chun Chou and
Wen{-}Tai Hsieh and
Fabien L. Gandon and
Norman M. Sadeh},
title = {Semantic Web Technologies for Context-Aware Museum Tour Guide Applications},
booktitle = {19th International Conference on Advanced Information Networking and
Applications {(AINA} 2005), 28-30 March 2005, Taipei, Taiwan},
pages = {709--714},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/AINA.2005.307},
doi = {10.1109/AINA.2005.307},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aina/ChouHGS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aina/LiCYSYWPLHT05,
author = {Kuan{-}Ching Li and
Hsun{-}Chang Chang and
Chao{-}Tung Yang and
Liria Matsumoto Sato and
Chung{-}Yuan Yang and
Yin{-}Yi Wu and
Mao{-}Yueh Pel and
Hsiang{-}Kai Liao and
Min{-}Chieh Hsieh and
Chia{-}Wen Tsai},
title = {On Construction of a Visualization Toolkit for {MPI} Parallel Programs
in Cluster Environments},
booktitle = {19th International Conference on Advanced Information Networking and
Applications {(AINA} 2005), 28-30 March 2005, Taipei, Taiwan},
pages = {211--214},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/AINA.2005.262},
doi = {10.1109/AINA.2005.262},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aina/LiCYSYWPLHT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/NguyenCTHJSMBM05,
author = {Bao Q. Nguyen and
Yao{-}Ling Chuang and
David Tung and
Chung H. Hsieh and
Zhipu Jin and
Ling Shi and
Daniel E. Marthaler and
Andrea L. Bertozzi and
Richard M. Murray},
title = {Virtual attractive-repulsive potentials for cooperative control of
second order dynamic vehicles on the Caltech {MVWT}},
booktitle = {American Control Conference, {ACC} 2005, Portland, OR, USA, 8-10 June,
2005},
pages = {1084--1089vol.2},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/ACC.2005.1470105},
doi = {10.1109/ACC.2005.1470105},
timestamp = {Tue, 06 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/amcc/NguyenCTHJSMBM05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asist/KimABCH05,
author = {Kyung{-}Sun Kim and
Robert B. Allen and
Laura M. Bartolo and
Anita Coleman and
Ingrid Hsieh{-}Yee},
title = {Progress in the design and evaluation of digital libraries: Implications
for research and education},
booktitle = {Sparking Synergies: Bringing Research and Practice Together - Proceedings
of the 68th ASIS{\&}T Annual Meeting, {ASIST} 2005, Charlotte,
North Carolina, USA, October 28 - November 2, 2005},
series = {Proc. Assoc. Inf. Sci. Technol.},
volume = {42},
number = {1},
publisher = {Wiley},
year = {2005},
url = {https://doi.org/10.1002/meet.14504201187},
doi = {10.1002/MEET.14504201187},
timestamp = {Fri, 21 Jan 2022 13:55:35 +0100},
biburl = {https://dblp.org/rec/conf/asist/KimABCH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/HsiehCY05,
author = {Ming{-}Jyh Hsieh and
Ming{-}Syan Chen and
Philip S. Yu},
editor = {Otthein Herzog and
Hans{-}J{\"{o}}rg Schek and
Norbert Fuhr and
Abdur Chowdhury and
Wilfried Teiken},
title = {Integrating {DCT} and {DWT} for approximating cube streams},
booktitle = {Proceedings of the 2005 {ACM} {CIKM} International Conference on Information
and Knowledge Management, Bremen, Germany, October 31 - November 5,
2005},
pages = {179--186},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1099554.1099588},
doi = {10.1145/1099554.1099588},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/HsiehCY05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cimca/SumodheeHSHC05,
author = {C. Sumodhee and
J. L. Hsieh and
C. T. Sun and
C. Y. Huang and
Arthur Y. M. Chen},
title = {Impact of Social Behaviors on {HIV} Epidemic: {A} Computer Simulation
View},
booktitle = {2005 International Conference on Computational Intelligence for Modelling
Control and Automation {(CIMCA} 2005), International Conference on
Intelligent Agents, Web Technologies and Internet Commerce {(IAWTIC}
2005), 28-30 November 2005, Vienna, Austria},
pages = {550--556},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/CIMCA.2005.1631526},
doi = {10.1109/CIMCA.2005.1631526},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cimca/SumodheeHSHC05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/date/MannionHCV05,
author = {Ryan Mannion and
Harry Hsieh and
Susan Cotterell and
Frank Vahid},
title = {System Synthesis for Networks of Programmable Blocks},
booktitle = {2005 Design, Automation and Test in Europe Conference and Exposition
{(DATE} 2005), 7-11 March 2005, Munich, Germany},
pages = {888--893},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/DATE.2005.289},
doi = {10.1109/DATE.2005.289},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/date/MannionHCV05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fuzzIEEE/HwangHH05,
author = {Chih{-}Lyang Hwang and
Ming{-}Ching Hsieh and
Song{-}Yu Han},
title = {A Trajectory Tracking of Piezo-Driven {X-Y} Table System Using Fuzzy
{T-S} Model-Based Variable Structure Decentralized Control},
booktitle = {{IEEE} International Conference on Fuzzy Systems, {FUZZ-IEEE} 2005,
Reno, Nevada, USA, May 22-25, 2005},
pages = {49--54},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/FUZZY.2005.1452367},
doi = {10.1109/FUZZY.2005.1452367},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/fuzzIEEE/HwangHH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ht/HsiehS05,
author = {Hao{-}wei Hsieh and
Frank M. Shipman III},
editor = {Siegfried Reich and
Manolis Tzagarakis},
title = {Activity links: supporting communication and reflection about action},
booktitle = {{HYPERTEXT} 2005, Proceedings of the 16th {ACM} Conference on Hypertext
and Hypermedia, September 6-9, 2005, Salzburg, Austria},
pages = {161--170},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1083356.1083388},
doi = {10.1145/1083356.1083388},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ht/HsiehS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccsa/LeeHY05,
author = {Yue{-}Shi Lee and
Min{-}Chi Hsieh and
Show{-}Jane Yen},
editor = {Osvaldo Gervasi and
Marina L. Gavrilova and
Vipin Kumar and
Antonio Lagan{\`{a}} and
Heow Pueh Lee and
Youngsong Mun and
David Taniar and
Chih Jeng Kenneth Tan},
title = {Efficient Approach for Interactively Mining Web Traversal Patterns},
booktitle = {Computational Science and Its Applications - {ICCSA} 2005, International
Conference, Singapore, May 9-12, 2005, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {3481},
pages = {1055--1065},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11424826\_113},
doi = {10.1007/11424826\_113},
timestamp = {Thu, 28 Apr 2022 16:17:38 +0200},
biburl = {https://dblp.org/rec/conf/iccsa/LeeHY05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icebe/YenLH05,
author = {Show{-}Jane Yen and
Yue{-}Shi Lee and
Min{-}Chi Hsieh},
editor = {Francis C. M. Lau and
Hui Lei and
Xiaofeng Meng and
Min Wang},
title = {An Efficient Incremental Algorithm for Mining Web Traversal Patterns},
booktitle = {2005 {IEEE} International Conference on e-Business Engineering {(ICEBE}
2005), 18-21 October 2005, Beijing, China},
pages = {274--281},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/ICEBE.2005.25},
doi = {10.1109/ICEBE.2005.25},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icebe/YenLH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interact/BaeBMMZHMS05,
author = {Soonil Bae and
Rajiv Badi and
Konstantinos A. Meintanis and
J. Michael Moore and
Anna Zacchi and
Hao{-}wei Hsieh and
Catherine C. Marshall and
Frank M. Shipman III},
editor = {Maria Francesca Costabile and
Fabio Patern{\`{o}}},
title = {Effects of Display Configurations on Document Triage},
booktitle = {Human-Computer Interaction - {INTERACT} 2005, {IFIP} {TC13} International
Conference, Rome, Italy, September 12-16, 2005, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3585},
pages = {130--143},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11555261\_14},
doi = {10.1007/11555261\_14},
timestamp = {Tue, 14 May 2019 10:00:46 +0200},
biburl = {https://dblp.org/rec/conf/interact/BaeBMMZHMS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-09-30 21:02 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
