Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "James Roberts"
download as .bib file
@book{DBLP:books/sp/HutsonLRCL24,
author = {James Hutson and
Jason Lively and
Bryan Robertson and
Peter Cotroneo and
Martin Lang},
title = {Creative Convergence - The {AI} Renaissance in Art and Design},
publisher = {Springer},
year = {2024},
url = {https://doi.org/10.1007/978-3-031-45127-0},
doi = {10.1007/978-3-031-45127-0},
isbn = {978-3-031-45126-3},
timestamp = {Tue, 12 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/sp/HutsonLRCL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhci/DavidR24,
author = {Meredith E. David and
James A. Roberts},
title = {For God's Sake: Integrating the Theory of Reasoned Action and Technology
Acceptance Model to Predict Smartphone Use during Church Services},
journal = {Int. J. Hum. Comput. Interact.},
volume = {40},
number = {7},
pages = {1609--1619},
year = {2024},
url = {https://doi.org/10.1080/10447318.2022.2144833},
doi = {10.1080/10447318.2022.2144833},
timestamp = {Fri, 17 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhci/DavidR24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/KellRUQFSWPM24,
author = {Gregory Kell and
Angus Roberts and
Serge Umansky and
Linglong Qian and
Davide Ferrari and
Frank Soboczenski and
Byron C. Wallace and
Nikhil Patel and
Iain James Marshall},
title = {Question answering systems for health professionals at the point of
care - a systematic review},
journal = {J. Am. Medical Informatics Assoc.},
volume = {31},
number = {4},
pages = {1009--1024},
year = {2024},
url = {https://doi.org/10.1093/jamia/ocae015},
doi = {10.1093/JAMIA/OCAE015},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/KellRUQFSWPM24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/KirkWLL24,
author = {James R. Kirk and
Robert E. Wray and
Peter Lindes and
John E. Laird},
editor = {Michael J. Wooldridge and
Jennifer G. Dy and
Sriraam Natarajan},
title = {Improving Knowledge Extraction from LLMs for Task Learning through
Agent Analysis},
booktitle = {Thirty-Eighth {AAAI} Conference on Artificial Intelligence, {AAAI}
2024, Thirty-Sixth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2024, Fourteenth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2014, February 20-27, 2024, Vancouver,
Canada},
pages = {18390--18398},
publisher = {{AAAI} Press},
year = {2024},
url = {https://doi.org/10.1609/aaai.v38i16.29799},
doi = {10.1609/AAAI.V38I16.29799},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/KirkWLL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eurocrypt/BartusekGKMRR24,
author = {James Bartusek and
Vipul Goyal and
Dakshita Khurana and
Giulio Malavolta and
Justin Raizes and
Bhaskar Roberts},
editor = {Marc Joye and
Gregor Leander},
title = {Software with Certified Deletion},
booktitle = {Advances in Cryptology - {EUROCRYPT} 2024 - 43rd Annual International
Conference on the Theory and Applications of Cryptographic Techniques,
Zurich, Switzerland, May 26-30, 2024, Proceedings, Part {IV}},
series = {Lecture Notes in Computer Science},
volume = {14654},
pages = {85--111},
publisher = {Springer},
year = {2024},
url = {https://doi.org/10.1007/978-3-031-58737-5\_4},
doi = {10.1007/978-3-031-58737-5\_4},
timestamp = {Thu, 09 May 2024 11:05:30 +0200},
biburl = {https://dblp.org/rec/conf/eurocrypt/BartusekGKMRR24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-01700,
author = {Gregory Kell and
Angus Roberts and
Serge Umansky and
Linglong Qian and
Davide Ferrari and
Frank Soboczenski and
Byron C. Wallace and
Nikhil Patel and
Iain James Marshall},
title = {Question answering systems for health professionals at the point of
care - a systematic review},
journal = {CoRR},
volume = {abs/2402.01700},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.01700},
doi = {10.48550/ARXIV.2402.01700},
eprinttype = {arXiv},
eprint = {2402.01700},
timestamp = {Fri, 09 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-01700.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-05385,
author = {Alex Ayoub and
Kaiwen Wang and
Vincent Liu and
Samuel Robertson and
James McInerney and
Dawen Liang and
Nathan Kallus and
Csaba Szepesv{\'{a}}ri},
title = {Switching the Loss Reduces the Cost in Batch Reinforcement Learning},
journal = {CoRR},
volume = {abs/2403.05385},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.05385},
doi = {10.48550/ARXIV.2403.05385},
eprinttype = {arXiv},
eprint = {2403.05385},
timestamp = {Thu, 04 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-05385.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2403-08295,
author = {Thomas Mesnard and
Cassidy Hardin and
Robert Dadashi and
Surya Bhupatiraju and
Shreya Pathak and
Laurent Sifre and
Morgane Rivi{\`{e}}re and
Mihir Sanjay Kale and
Juliette Love and
Pouya Tafti and
L{\'{e}}onard Hussenot and
Aakanksha Chowdhery and
Adam Roberts and
Aditya Barua and
Alex Botev and
Alex Castro{-}Ros and
Ambrose Slone and
Am{\'{e}}lie H{\'{e}}liou and
Andrea Tacchetti and
Anna Bulanova and
Antonia Paterson and
Beth Tsai and
Bobak Shahriari and
Charline Le Lan and
Christopher A. Choquette{-}Choo and
Cl{\'{e}}ment Crepy and
Daniel Cer and
Daphne Ippolito and
David Reid and
Elena Buchatskaya and
Eric Ni and
Eric Noland and
Geng Yan and
George Tucker and
George{-}Cristian Muraru and
Grigory Rozhdestvenskiy and
Henryk Michalewski and
Ian Tenney and
Ivan Grishchenko and
Jacob Austin and
James Keeling and
Jane Labanowski and
Jean{-}Baptiste Lespiau and
Jeff Stanway and
Jenny Brennan and
Jeremy Chen and
Johan Ferret and
Justin Chiu and
et al.},
title = {Gemma: Open Models Based on Gemini Research and Technology},
journal = {CoRR},
volume = {abs/2403.08295},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2403.08295},
doi = {10.48550/ARXIV.2403.08295},
eprinttype = {arXiv},
eprint = {2403.08295},
timestamp = {Tue, 21 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2403-08295.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2405-12147,
author = {Robert E. Wray and
James R. Kirk and
John E. Laird},
title = {Eliciting Problem Specifications via Large Language Models},
journal = {CoRR},
volume = {abs/2405.12147},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2405.12147},
doi = {10.48550/ARXIV.2405.12147},
eprinttype = {arXiv},
eprint = {2405.12147},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2405-12147.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bdr/RobertsGT23,
author = {Callum Roberts and
Adrian Gepp and
James Todd},
title = {A Big Data Framework to Address Building Sum Insured Misestimation},
journal = {Big Data Res.},
volume = {33},
pages = {100396},
year = {2023},
url = {https://doi.org/10.1016/j.bdr.2023.100396},
doi = {10.1016/J.BDR.2023.100396},
timestamp = {Sun, 24 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bdr/RobertsGT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbsn/DavidR23,
author = {Meredith E. David and
James A. Roberts},
title = {The Dual Nature of Social Media: Examining the Direction of Causal
Flow Between Fear of Missing Out and Social Media Use},
journal = {Cyberpsychology Behav. Soc. Netw.},
volume = {26},
number = {12},
pages = {881--885},
year = {2023},
url = {https://doi.org/10.1089/cyber.2023.0265},
doi = {10.1089/CYBER.2023.0265},
timestamp = {Sun, 31 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cbsn/DavidR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbsn/RobertsD23,
author = {James A. Roberts and
Meredith E. David},
title = {Instagram and TikTok Flow States and Their Association with Psychological
Well-Being},
journal = {Cyberpsychology Behav. Soc. Netw.},
volume = {26},
number = {2},
pages = {80--89},
year = {2023},
url = {https://doi.org/10.1089/cyber.2022.0117},
doi = {10.1089/CYBER.2022.0117},
timestamp = {Tue, 28 Mar 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cbsn/RobertsD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpca/GreteDMBRGGSLSSJHSR23,
author = {Philipp Grete and
Joshua C. Dolence and
Jonah M. Miller and
Joshua Brown and
Ben Ryan and
Andrew Gaspar and
Forrest Wolfgang Glines and
Sriram Swaminarayan and
Jonas Lippuner and
Clell J. Solomon and
Galen M. Shipman and
Christoph Junghans and
Daniel Holladay and
James M. Stone and
Luke F. Roberts},
title = {Parthenon - a performance portable block-structured adaptive mesh
refinement framework},
journal = {Int. J. High Perform. Comput. Appl.},
volume = {37},
number = {5},
pages = {465--486},
year = {2023},
url = {https://doi.org/10.1177/10943420221143775},
doi = {10.1177/10943420221143775},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhpca/GreteDMBRGGSLSSJHSR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/ParuiRSTLD23,
author = {Sridip Parui and
James C. Robertson and
Sandeep Somani and
Gary Tresadern and
Cong Liu and
Ken A. Dill},
title = {MELD-Bracket Ranks Binding Affinities of Diverse Sets of Ligands},
journal = {J. Chem. Inf. Model.},
volume = {63},
number = {9},
pages = {2857--2865},
year = {2023},
url = {https://doi.org/10.1021/acs.jcim.3c00243},
doi = {10.1021/ACS.JCIM.3C00243},
timestamp = {Fri, 02 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcisd/ParuiRSTLD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jmlr/ChowdheryNDBMRBCSGSSTMRBTSPRDHPBAI23,
author = {Aakanksha Chowdhery and
Sharan Narang and
Jacob Devlin and
Maarten Bosma and
Gaurav Mishra and
Adam Roberts and
Paul Barham and
Hyung Won Chung and
Charles Sutton and
Sebastian Gehrmann and
Parker Schuh and
Kensen Shi and
Sasha Tsvyashchenko and
Joshua Maynez and
Abhishek Rao and
Parker Barnes and
Yi Tay and
Noam Shazeer and
Vinodkumar Prabhakaran and
Emily Reif and
Nan Du and
Ben Hutchinson and
Reiner Pope and
James Bradbury and
Jacob Austin and
Michael Isard and
Guy Gur{-}Ari and
Pengcheng Yin and
Toju Duke and
Anselm Levskaya and
Sanjay Ghemawat and
Sunipa Dev and
Henryk Michalewski and
Xavier Garcia and
Vedant Misra and
Kevin Robinson and
Liam Fedus and
Denny Zhou and
Daphne Ippolito and
David Luan and
Hyeontaek Lim and
Barret Zoph and
Alexander Spiridonov and
Ryan Sepassi and
David Dohan and
Shivani Agrawal and
Mark Omernick and
Andrew M. Dai and
Thanumalayan Sankaranarayana Pillai and
Marie Pellat and
Aitor Lewkowycz and
Erica Moreira and
Rewon Child and
Oleksandr Polozov and
Katherine Lee and
Zongwei Zhou and
Xuezhi Wang and
Brennan Saeta and
Mark Diaz and
Orhan Firat and
Michele Catasta and
Jason Wei and
Kathy Meier{-}Hellstern and
Douglas Eck and
Jeff Dean and
Slav Petrov and
Noah Fiedel},
title = {PaLM: Scaling Language Modeling with Pathways},
journal = {J. Mach. Learn. Res.},
volume = {24},
pages = {240:1--240:113},
year = {2023},
url = {http://jmlr.org/papers/v24/22-1144.html},
timestamp = {Thu, 19 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jmlr/ChowdheryNDBMRBCSGSSTMRBTSPRDHPBAI23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jossw/NightingaleAHHECCFFLLMNR23,
author = {James W. Nightingale and
Aristeidis Amvrosiadis and
Richard G. Hayes and
Qiuhan He and
Amy Etherington and
XiaoYue Cao and
Shaun Cole and
Jonathan Frawley and
Carlos S. Frenk and
Sam Lange and
Ran Li and
Richard J. Massey and
Mattia Negrello and
Andrew Robertson},
title = {PyAutoGalaxy: Open-Source Multiwavelength Galaxy Structure {\&}
Morphology},
journal = {J. Open Source Softw.},
volume = {8},
number = {81},
pages = {4475},
year = {2023},
url = {https://doi.org/10.21105/joss.04475},
doi = {10.21105/JOSS.04475},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jossw/NightingaleAHHECCFFLLMNR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/natmi/DittmerRGBSBTWGKJLYPSTBSTPWHWLSSP23,
author = {S{\"{o}}ren Dittmer and
Michael Roberts and
Julian D. Gilbey and
Ander Biguri and
Ian Selby and
Anna Breger and
Matthew Thorpe and
Jonathan R. Weir{-}McCall and
Effrossyni Gkrania{-}Klotsas and
Anna Korhonen and
Emily R. Jefferson and
Georg Langs and
Guang Yang and
Helmut Prosch and
Jan Stanczuk and
Jing Tang and
Judith Babar and
Lorena Escudero Sanchez and
Philip Teare and
Mishal Patel and
Marcel Wassin and
Markus Holzer and
Nicholas Walton and
Pietro Li{\'{o}} and
Tolou Shadbahr and
Evis Sala and
Jacobus Preller and
James H. F. Rudd and
John A. D. Aston and
Carola{-}Bibiane Sch{\"{o}}nlieb},
title = {Navigating the development challenges in creating complex data systems},
journal = {Nat. Mac. Intell.},
volume = {5},
number = {7},
pages = {681--686},
year = {2023},
url = {https://doi.org/10.1038/s42256-023-00665-x},
doi = {10.1038/S42256-023-00665-X},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/natmi/DittmerRGBSBTWGKJLYPSTBSTPWHWLSSP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/animalci/WuNFMDELRBB023,
author = {Yifan Wu and
Colt Nichols and
Marc Foster and
Devon Martin and
James Dieffenderfer and
Masataka Enomoto and
B. Duncan X. Lascelles and
Jane Russenberger and
Gerald Brenninkmeyer and
Alper Bozkurt and
David L. Roberts},
title = {An Exploration of Machine Learning Methods for Gait Analysis of Potential
Guide Dogs},
booktitle = {The Tenth International Conference on Animal-Computer Interaction,
{ACI} 2023, Raleigh, NC, USA, December 4-8, 2023},
pages = {10:1--10:15},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3637882.3637883},
doi = {10.1145/3637882.3637883},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/animalci/WuNFMDELRBB023.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/Lloyd-RobertsJE23,
author = {Ben Lloyd{-}Roberts and
Phillip James and
Michael Edwards and
Simon Robinson and
Thomas Werner},
editor = {Albrecht Schmidt and
Kaisa V{\"{a}}{\"{a}}n{\"{a}}nen and
Tesh Goyal and
Per Ola Kristensson and
Anicia Peters},
title = {Improving Railway Safety: Human-in-the-loop Invariant Finding},
booktitle = {Extended Abstracts of the 2023 {CHI} Conference on Human Factors in
Computing Systems, {CHI} {EA} 2023, Hamburg, Germany, April 23-28,
2023},
pages = {389:1--389:8},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3544549.3573853},
doi = {10.1145/3544549.3573853},
timestamp = {Wed, 31 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/Lloyd-RobertsJE23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/Iyer0WKCLVS23,
author = {Kartik K. Iyer and
James A. Roberts and
Michaela Waak and
Ajay Kevat and
Jasneek Chawla and
Leena Lauronen and
Sampsa Vanhatalo and
Nathan J. Stevenson},
title = {Optimization of time series features to estimate brain age in children
from electroencephalography},
booktitle = {45th Annual International Conference of the {IEEE} Engineering in
Medicine {\&} Biology Society, {EMBC} 2023, Sydney, Australia,
July 24-27, 2023},
pages = {1--4},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/EMBC40787.2023.10340663},
doi = {10.1109/EMBC40787.2023.10340663},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/Iyer0WKCLVS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medinfo/ChaturvediV0R23,
author = {Jaya Chaturvedi and
Sumithra Velupillai and
Robert Stewart and
Angus Roberts},
editor = {Jen Bichel{-}Findlay and
Paula Otero and
Philip Scott and
Elaine Huesing},
title = {Identifying Mentions of Pain in Mental Health Records Text: {A} Natural
Language Processing Approach},
booktitle = {{MEDINFO} 2023 - The Future Is Accessible - Proceedings of the 19th
World Congress on Medical and Health Informatics, Sydney, NSW, Australia,
8-12 July 2023},
series = {Studies in Health Technology and Informatics},
volume = {310},
pages = {695--699},
publisher = {{IOS} Press},
year = {2023},
url = {https://doi.org/10.3233/SHTI231054},
doi = {10.3233/SHTI231054},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/medinfo/ChaturvediV0R23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/RheeCZSR23,
author = {Taehyun Rhee and
Andrew Chalmers and
Faisal Zaman and
Anna Stangnes and
Vic Roberts},
editor = {Erik Brunvand and
Cem Yuksel},
title = {Real-time Stage Modelling and Visual Effects for Live Performances},
booktitle = {{ACM} {SIGGRAPH} 2023 Real-Time Live!, {SIGGRAPH} 2023, Los Angeles,
CA, USA, August 6-10, 2023},
pages = {8:1--8:2},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3588430.3597245},
doi = {10.1145/3588430.3597245},
timestamp = {Sat, 05 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/siggraph/RheeCZSR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vrst/BellRHAM23,
author = {James Bell and
Alice Rogers and
Kristian Hansen and
Craig Anslow and
Simon McCallum},
title = {Diving Into The Twilight Zone {VR} for Marine Biology},
booktitle = {Proceedings of the 29th {ACM} Symposium on Virtual Reality Software
and Technology, {VRST} 2023, Christchurch, New Zealand, October 9-11,
2023},
pages = {50:1--50:2},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3611659.3617207},
doi = {10.1145/3611659.3617207},
timestamp = {Fri, 27 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vrst/BellRHAM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-01240,
author = {Jaya Chaturvedi and
Sumithra Velupillai and
Robert Stewart and
Angus Roberts},
title = {Identifying Mentions of Pain in Mental Health Records Text: {A} Natural
Language Processing Approach},
journal = {CoRR},
volume = {abs/2304.01240},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.01240},
doi = {10.48550/ARXIV.2304.01240},
eprinttype = {arXiv},
eprint = {2304.01240},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-01240.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-06770,
author = {James R. Kirk and
Robert E. Wray and
Peter Lindes},
title = {Improving Knowledge Extraction from LLMs for Robotic Task Learning
through Agent Analysis},
journal = {CoRR},
volume = {abs/2306.06770},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.06770},
doi = {10.48550/ARXIV.2306.06770},
eprinttype = {arXiv},
eprint = {2306.06770},
timestamp = {Fri, 16 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-06770.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-09177,
author = {Daniel Kreuter and
Samuel Tull and
Julian D. Gilbey and
Jacobus Preller and
BloodCounts Consortium and
John A. D. Aston and
James H. F. Rudd and
Suthesh Sivapalaratnam and
Carola{-}Bibiane Sch{\"{o}}nlieb and
Nicholas S. Gleadall and
Michael Roberts},
title = {Dis-AE: Multi-domain {\&} Multi-task Generalisation on Real-World
Clinical Data},
journal = {CoRR},
volume = {abs/2306.09177},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.09177},
doi = {10.48550/ARXIV.2306.09177},
eprinttype = {arXiv},
eprint = {2306.09177},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-09177.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-13579,
author = {S{\"{o}}ren Dittmer and
Michael Roberts and
Jacobus Preller and
AIX{-}COVNET Collaboration and
James H. F. Rudd and
John A. D. Aston and
Carola{-}Bibiane Sch{\"{o}}nlieb},
title = {Reinterpreting survival analysis in the universal approximator age},
journal = {CoRR},
volume = {abs/2307.13579},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2307.13579},
doi = {10.48550/ARXIV.2307.13579},
eprinttype = {arXiv},
eprint = {2307.13579},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2307-13579.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-08904,
author = {Jaya Chaturvedi and
Tao Wang and
Sumithra Velupillai and
Robert Stewart and
Angus Roberts},
title = {Development of a Knowledge Graph Embeddings Model for Pain},
journal = {CoRR},
volume = {abs/2308.08904},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2308.08904},
doi = {10.48550/ARXIV.2308.08904},
eprinttype = {arXiv},
eprint = {2308.08904},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2308-08904.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-02237,
author = {Jaya Chaturvedi and
Diana Shamsutdinova and
Felix Zimmer and
Sumithra Velupillai and
Daniel Stahl and
Robert Stewart and
Angus Roberts},
title = {Sample Size in Natural Language Processing within Healthcare Research},
journal = {CoRR},
volume = {abs/2309.02237},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2309.02237},
doi = {10.48550/ARXIV.2309.02237},
eprinttype = {arXiv},
eprint = {2309.02237},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2309-02237.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-02874,
author = {Fan Zhang and
Daniel Kreuter and
Yichen Chen and
S{\"{o}}ren Dittmer and
Samuel Tull and
Tolou Shadbahr and
BloodCounts Collaboration and
Jacobus Preller and
James H. F. Rudd and
John A. D. Aston and
Carola{-}Bibiane Sch{\"{o}}nlieb and
Nicholas S. Gleadall and
Michael Roberts},
title = {Recent Methodological Advances in Federated Learning for Healthcare},
journal = {CoRR},
volume = {abs/2310.02874},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.02874},
doi = {10.48550/ARXIV.2310.02874},
eprinttype = {arXiv},
eprint = {2310.02874},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-02874.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-06846,
author = {James R. Kirk and
Robert E. Wray and
John E. Laird},
title = {Exploiting Language Models as a Source of Knowledge for Cognitive
Agents},
journal = {CoRR},
volume = {abs/2310.06846},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.06846},
doi = {10.48550/ARXIV.2310.06846},
eprinttype = {arXiv},
eprint = {2310.06846},
timestamp = {Tue, 24 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-06846.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-16186,
author = {Howard Yanxon and
Eric J. Roberts and
Hannah Parraga and
James Weng and
Wenqian Xu and
Uta Ruett and
Alexander Hexemer and
Petrus H. Zwart and
Nicholas Schwarz},
title = {Image Segmentation using U-Net Architecture for Powder X-ray Diffraction
Images},
journal = {CoRR},
volume = {abs/2310.16186},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.16186},
doi = {10.48550/ARXIV.2310.16186},
eprinttype = {arXiv},
eprint = {2310.16186},
timestamp = {Tue, 31 Oct 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-16186.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-06477,
author = {A. Feder Cooper and
Katherine Lee and
James Grimmelmann and
Daphne Ippolito and
Christopher Callison{-}Burch and
Christopher A. Choquette{-}Choo and
Niloofar Mireshghallah and
Miles Brundage and
David Mimno and
Madiha Zahrah Choksi and
Jack M. Balkin and
Nicholas Carlini and
Christopher De Sa and
Jonathan Frankle and
Deep Ganguli and
Bryant Gipson and
Andres Guadamuz and
Swee Leng Harris and
Abigail Z. Jacobs and
Elizabeth Joh and
Gautam Kamath and
Mark Lemley and
Cass Matthews and
Christine McLeavey and
Corynne McSherry and
Milad Nasr and
Paul Ohm and
Adam Roberts and
Tom Rubin and
Pamela Samuelson and
Ludwig Schubert and
Kristen Vaccaro and
Luis Villa and
Felix Wu and
Elana Zeide},
title = {Report of the 1st Workshop on Generative {AI} and Law},
journal = {CoRR},
volume = {abs/2311.06477},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.06477},
doi = {10.48550/ARXIV.2311.06477},
eprinttype = {arXiv},
eprint = {2311.06477},
timestamp = {Wed, 15 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-06477.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-16188,
author = {Michael Roberts and
Alon Hazan and
S{\"{o}}ren Dittmer and
James H. F. Rudd and
Carola{-}Bibiane Sch{\"{o}}nlieb},
title = {The curious case of the test set {AUROC}},
journal = {CoRR},
volume = {abs/2312.16188},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.16188},
doi = {10.48550/ARXIV.2312.16188},
eprinttype = {arXiv},
eprint = {2312.16188},
timestamp = {Thu, 18 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-16188.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/BartusekGGKMRR23,
author = {James Bartusek and
Sanjam Garg and
Vipul Goyal and
Dakshita Khurana and
Giulio Malavolta and
Justin Raizes and
Bhaskar Roberts},
title = {Obfuscation and Outsourced Computation with Certified Deletion},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {265},
year = {2023},
url = {https://eprint.iacr.org/2023/265},
timestamp = {Tue, 28 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iacr/BartusekGGKMRR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhci/RobertsD22,
author = {James A. Roberts and
Meredith E. David},
title = {Me, My Smartphone, and {I:} Development of the Smartphone Orientation
Scale {(SOS)}},
journal = {Int. J. Hum. Comput. Interact.},
volume = {38},
number = {13},
pages = {1267--1275},
year = {2022},
url = {https://doi.org/10.1080/10447318.2021.1990521},
doi = {10.1080/10447318.2021.1990521},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhci/RobertsD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/WangBMPRSD22,
author = {Tao Wang and
Rebecca Bendayan and
Yamiko Msosa and
Megan Pritchard and
Angus Roberts and
Robert Stewart and
Richard J. B. Dobson},
title = {Patient-centric characterization of multimorbidity trajectories in
patients with severe mental illnesses: {A} temporal bipartite network
modeling approach},
journal = {J. Biomed. Informatics},
volume = {127},
pages = {104010},
year = {2022},
url = {https://doi.org/10.1016/j.jbi.2022.104010},
doi = {10.1016/J.JBI.2022.104010},
timestamp = {Fri, 17 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jbi/WangBMPRSD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/Wu0WFCS0PFLSHKG22,
author = {Honghan Wu and
Minhong Wang and
Jinge Wu and
Farah Francis and
Yun{-}Hsuan Chang and
Alex Shavick and
Hang Dong and
Michael Tin Chung Poon and
Natalie K. Fitzpatrick and
Adam P. Levine and
Luke T. Slater and
Alex Handy and
Andreas Karwath and
Georgios V. Gkoutos and
Claude Chelala and
Anoop D. Shah and
Robert Stewart and
Nigel Collier and
Beatrice Alex and
William Whiteley and
Cathie Sudlow and
Angus Roberts and
Richard J. B. Dobson},
title = {A survey on clinical natural language processing in the United Kingdom
from 2007 to 2022},
journal = {npj Digit. Medicine},
volume = {5},
year = {2022},
url = {https://doi.org/10.1038/s41746-022-00730-6},
doi = {10.1038/S41746-022-00730-6},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/Wu0WFCS0PFLSHKG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/BaoZWZLYLYRXJ22,
author = {Heng Bao and
Penghui Zhai and
Dusu Wen and
Weihua Zhang and
Ye Li and
Feifei Yang and
Xin Liang and
Fan Yang and
Nathan James Roberts and
Yanchun Xu and
Guangshun Jiang},
title = {Effects of Inter- and Intra-Specific Interactions on Moose Habitat
Selection Limited by Temperature},
journal = {Remote. Sens.},
volume = {14},
number = {24},
pages = {6401},
year = {2022},
url = {https://doi.org/10.3390/rs14246401},
doi = {10.3390/RS14246401},
timestamp = {Sun, 30 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/BaoZWZLYLYRXJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/CaoHLLQWRSJ22,
author = {Heqin Cao and
Yan Hua and
Xin Liang and
Zexu Long and
Jinzhe Qi and
Dusu Wen and
Nathan James Roberts and
Haijun Su and
Guangshun Jiang},
title = {Wavelet Analysis Reveals Phenology Mismatch between Leaf Phenology
of Temperate Forest Plants and the Siberian Roe Deer Molting under
Global Warming},
journal = {Remote. Sens.},
volume = {14},
number = {16},
pages = {3901},
year = {2022},
url = {https://doi.org/10.3390/rs14163901},
doi = {10.3390/RS14163901},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/CaoHLLQWRSJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/Irvine-FynnBCHB22,
author = {Tristram D. L. Irvine{-}Fynn and
Peter Bunting and
Joseph M. Cook and
Alun Hubbard and
Nicholas E. Barrand and
Edward Hanna and
Andy Hardy and
Andrew J. Hodson and
Tom O. Holt and
Matthias Huss and
James B. McQuaid and
Johan Nilsson and
Kathrin Naegeli and
Osian Roberts and
Jonathan C. Ryan and
Andrew J. Tedstone and
Martyn Tranter and
Christopher J. Williamson},
title = {Temporal Variability of Surface Reflectance Supersedes Spatial Resolution
in Defining Greenland's Bare-Ice Albedo},
journal = {Remote. Sens.},
volume = {14},
number = {1},
pages = {62},
year = {2022},
url = {https://doi.org/10.3390/rs14010062},
doi = {10.3390/RS14010062},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/Irvine-FynnBCHB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmetrics/RobertsR22,
author = {James Roberts and
Dario Rossi},
title = {Size-based scheduling vs fairness for datacenter flows: a queuing
perspective},
journal = {{SIGMETRICS} Perform. Evaluation Rev.},
volume = {50},
number = {2},
pages = {2--10},
year = {2022},
url = {https://doi.org/10.1145/3561074.3561076},
doi = {10.1145/3561074.3561076},
timestamp = {Mon, 14 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigmetrics/RobertsR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/MellorTOASHLHBR22,
author = {Stephanie Mellor and
Tim M. Tierney and
George C. O'Neill and
Nicholas Alexander and
Robert A. Seymour and
Niall Holmes and
Jos{\'{e}} David L{\'{o}}pez and
Ryan M. Hill and
Elena Boto and
Molly Rea and
Gillian Roberts and
James Leggett and
Richard Bowtell and
Matthew J. Brookes and
Eleanor A. Maguire and
Matthew C. Walker and
Gareth R. Barnes},
title = {Magnetic Field Mapping and Correction for Moving {OP-MEG}},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {69},
number = {2},
pages = {528--536},
year = {2022},
url = {https://doi.org/10.1109/TBME.2021.3100770},
doi = {10.1109/TBME.2021.3100770},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/MellorTOASHLHBR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tem/RobertsonFB22,
author = {James Robertson and
John M. Fossaceca and
Kelly W. Bennett},
title = {A Cloud-Based Computing Framework for Artificial Intelligence Innovation
in Support of Multidomain Operations},
journal = {{IEEE} Trans. Engineering Management},
volume = {69},
number = {6},
pages = {3913--3922},
year = {2022},
url = {https://doi.org/10.1109/TEM.2021.3088382},
doi = {10.1109/TEM.2021.3088382},
timestamp = {Sun, 13 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tem/RobertsonFB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/KitzhaberTBSSHR22,
author = {Joseph Kitzhaber and
Ashlyn Trapp and
James Beck and
Edoardo Serra and
Francesca Spezzano and
Eric Hayden and
Jessica Roberts},
title = {Predicting {RNA} Mutation Effects through Machine Learning of High-Throughput
Ribozyme Experiments (Student Abstract)},
booktitle = {Thirty-Sixth {AAAI} Conference on Artificial Intelligence, {AAAI}
2022, Thirty-Fourth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2022, The Twelveth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2022 Virtual Event, February 22
- March 1, 2022},
pages = {12985--12986},
publisher = {{AAAI} Press},
year = {2022},
url = {https://doi.org/10.1609/aaai.v36i11.21629},
doi = {10.1609/AAAI.V36I11.21629},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/KitzhaberTBSSHR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dev/SchienSWPRP22,
author = {Daniel Schien and
Paul Shabajee and
James Wickenden and
William Picket and
Glynn Roberts and
Chris Preist},
editor = {Engineer Bainomugisha and
Waylon Brunette and
Nicola Dell and
Amit Sharma},
title = {Demo: The {DIMPACT} Tool for Environmental Assessment of Digital Services},
booktitle = {{COMPASS} '22: {ACM} {SIGCAS/SIGCHI} Conference on Computing and Sustainable
Societies, Seattle, WA, USA, 29 June 2022 - 1 July 2022},
pages = {701--703},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3530190.3542932},
doi = {10.1145/3530190.3542932},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dev/SchienSWPRP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/FinamoreRGR22,
author = {Alessandro Finamore and
James Roberts and
Massimo Gallo and
Dario Rossi},
title = {Accelerating Deep Learning Classification with Error-controlled Approximate-key
Caching},
booktitle = {{IEEE} {INFOCOM} 2022 - {IEEE} Conference on Computer Communications,
London, United Kingdom, May 2-5, 2022},
pages = {2118--2127},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/INFOCOM48880.2022.9796677},
doi = {10.1109/INFOCOM48880.2022.9796677},
timestamp = {Sat, 25 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/infocom/FinamoreRGR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miigp/Allan0WFMWDWRSG22,
author = {Michael B. Allan and
Mohammad H. Jafari and
Nathan Van Woudenberg and
Oron Frenkel and
Darra Murphy and
Tracee Wee and
Rob D'Ortenzio and
Yong Wu and
James Roberts and
Naoya Shatani and
Ang Nan Gu and
Samira Sojoudi and
Purang Abolmaesumi},
editor = {Cristian A. Linte and
Jeffrey H. Siewerdsen},
title = {Multi-task deep learning for segmentation and landmark detection in
obstetric sonography},
booktitle = {Medical Imaging 2022: Image-Guided Procedures, Robotic Interventions,
and Modeling, San Diego, CA, USA, February 20-24, 2022 / Online, March
21-27, 2022},
series = {{SPIE} Proceedings},
volume = {12034},
publisher = {{SPIE}},
year = {2022},
url = {https://doi.org/10.1117/12.2611163},
doi = {10.1117/12.2611163},
timestamp = {Mon, 18 Mar 2024 16:25:04 +0100},
biburl = {https://dblp.org/rec/conf/miigp/Allan0WFMWDWRSG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tabletop/ChampionM22,
author = {Erik Champion and
Simon McCallum},
editor = {Craig Anslow and
Judy Kay},
title = {Game Design Prototyping Workshop: Brainstorming and Designing Collaborative
and Creative Game Prototypes with Immersive Surfaces},
booktitle = {Companion Proceedings of the 2022 Conference on Interactive Surfaces
and Spaces, {ISS} 2022, Wellington, New Zealand, November 20-23, 2022},
pages = {72--75},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3532104.3571472},
doi = {10.1145/3532104.3571472},
timestamp = {Mon, 05 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/tabletop/ChampionM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vrst/0004AMR0J22,
author = {Jiaheng Wang and
Craig Anslow and
Simon James Robertson McCallum and
Brian Robinson and
Daniel Medeiros and
Joaquim A. Jorge},
editor = {Takafumi Koike and
Naoya Koizumi and
Gerd Bruder and
Daniel Roth and
Kazuki Takashima and
Takefumi Hiraki and
Yuki Ban and
Michal Piovarci},
title = {{VR} Games for Chronic Pain Management},
booktitle = {28th {ACM} Symposium on Virtual Reality Software and Technology, {VRST}
2022, Tsukuba, Japan, 29 November 2022- 1 December 2022},
pages = {4:1--4:11},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3562939.3565624},
doi = {10.1145/3562939.3565624},
timestamp = {Thu, 07 Dec 2023 20:49:10 +0100},
biburl = {https://dblp.org/rec/conf/vrst/0004AMR0J22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-08239,
author = {Romal Thoppilan and
Daniel De Freitas and
Jamie Hall and
Noam Shazeer and
Apoorv Kulshreshtha and
Heng{-}Tze Cheng and
Alicia Jin and
Taylor Bos and
Leslie Baker and
Yu Du and
YaGuang Li and
Hongrae Lee and
Huaixiu Steven Zheng and
Amin Ghafouri and
Marcelo Menegali and
Yanping Huang and
Maxim Krikun and
Dmitry Lepikhin and
James Qin and
Dehao Chen and
Yuanzhong Xu and
Zhifeng Chen and
Adam Roberts and
Maarten Bosma and
Yanqi Zhou and
Chung{-}Ching Chang and
Igor Krivokon and
Will Rusch and
Marc Pickett and
Kathleen S. Meier{-}Hellstern and
Meredith Ringel Morris and
Tulsee Doshi and
Renelito Delos Santos and
Toju Duke and
Johnny Soraker and
Ben Zevenbergen and
Vinodkumar Prabhakaran and
Mark Diaz and
Ben Hutchinson and
Kristen Olson and
Alejandra Molina and
Erin Hoffman{-}John and
Josh Lee and
Lora Aroyo and
Ravi Rajakumar and
Alena Butryna and
Matthew Lamm and
Viktoriya Kuzmina and
Joe Fenton and
Aaron Cohen and
Rachel Bernstein and
Ray Kurzweil and
Blaise Ag{\"{u}}era y Arcas and
Claire Cui and
Marian Croak and
Ed H. Chi and
Quoc Le},
title = {LaMDA: Language Models for Dialog Applications},
journal = {CoRR},
volume = {abs/2201.08239},
year = {2022},
url = {https://arxiv.org/abs/2201.08239},
eprinttype = {arXiv},
eprint = {2201.08239},
timestamp = {Fri, 16 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2201-08239.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-12983,
author = {James Roberts and
Dario Rossi},
title = {Size-based scheduling vs fairness for datacenter flows: a queuing
perspective},
journal = {CoRR},
volume = {abs/2203.12983},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2203.12983},
doi = {10.48550/ARXIV.2203.12983},
eprinttype = {arXiv},
eprint = {2203.12983},
timestamp = {Sat, 25 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2203-12983.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-17189,
author = {Adam Roberts and
Hyung Won Chung and
Anselm Levskaya and
Gaurav Mishra and
James Bradbury and
Daniel Andor and
Sharan Narang and
Brian Lester and
Colin Gaffney and
Afroz Mohiuddin and
Curtis Hawthorne and
Aitor Lewkowycz and
Alex Salcianu and
Marc van Zee and
Jacob Austin and
Sebastian Goodman and
Livio Baldini Soares and
Haitang Hu and
Sasha Tsvyashchenko and
Aakanksha Chowdhery and
Jasmijn Bastings and
Jannis Bulian and
Xavier Garcia and
Jianmo Ni and
Andrew Chen and
Kathleen Kenealy and
Jonathan H. Clark and
Stephan Lee and
Dan Garrette and
James Lee{-}Thorp and
Colin Raffel and
Noam Shazeer and
Marvin Ritter and
Maarten Bosma and
Alexandre Passos and
Jeremy Maitin{-}Shepard and
Noah Fiedel and
Mark Omernick and
Brennan Saeta and
Ryan Sepassi and
Alexander Spiridonov and
Joshua Newlan and
Andrea Gesmundo},
title = {Scaling Up Models and Data with t5x and seqio},
journal = {CoRR},
volume = {abs/2203.17189},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2203.17189},
doi = {10.48550/ARXIV.2203.17189},
eprinttype = {arXiv},
eprint = {2203.17189},
timestamp = {Mon, 04 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2203-17189.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-02311,
author = {Aakanksha Chowdhery and
Sharan Narang and
Jacob Devlin and
Maarten Bosma and
Gaurav Mishra and
Adam Roberts and
Paul Barham and
Hyung Won Chung and
Charles Sutton and
Sebastian Gehrmann and
Parker Schuh and
Kensen Shi and
Sasha Tsvyashchenko and
Joshua Maynez and
Abhishek Rao and
Parker Barnes and
Yi Tay and
Noam Shazeer and
Vinodkumar Prabhakaran and
Emily Reif and
Nan Du and
Ben Hutchinson and
Reiner Pope and
James Bradbury and
Jacob Austin and
Michael Isard and
Guy Gur{-}Ari and
Pengcheng Yin and
Toju Duke and
Anselm Levskaya and
Sanjay Ghemawat and
Sunipa Dev and
Henryk Michalewski and
Xavier Garcia and
Vedant Misra and
Kevin Robinson and
Liam Fedus and
Denny Zhou and
Daphne Ippolito and
David Luan and
Hyeontaek Lim and
Barret Zoph and
Alexander Spiridonov and
Ryan Sepassi and
David Dohan and
Shivani Agrawal and
Mark Omernick and
Andrew M. Dai and
Thanumalayan Sankaranarayana Pillai and
Marie Pellat and
Aitor Lewkowycz and
Erica Moreira and
Rewon Child and
Oleksandr Polozov and
Katherine Lee and
Zongwei Zhou and
Xuezhi Wang and
Brennan Saeta and
Mark Diaz and
Orhan Firat and
Michele Catasta and
Jason Wei and
Kathy Meier{-}Hellstern and
Douglas Eck and
Jeff Dean and
Slav Petrov and
Noah Fiedel},
title = {PaLM: Scaling Language Modeling with Pathways},
journal = {CoRR},
volume = {abs/2204.02311},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2204.02311},
doi = {10.48550/ARXIV.2204.02311},
eprinttype = {arXiv},
eprint = {2204.02311},
timestamp = {Wed, 16 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2204-02311.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-08478,
author = {Tolou Shadbahr and
Michael Roberts and
Jan Stanczuk and
Julian D. Gilbey and
Philip Teare and
S{\"{o}}ren Dittmer and
Matthew Thorpe and
Ram{\'{o}}n Vi{\~{n}}as Torn{\'{e}} and
Evis Sala and
Pietro Li{\'{o}} and
Mishal Patel and
AIX{-}COVNET Collaboration and
James H. F. Rudd and
Tuomas Mirtti and
Antti Rannikko and
John A. D. Aston and
Jing Tang and
Carola{-}Bibiane Sch{\"{o}}nlieb},
title = {Classification of datasets with imputed missing values: does imputation
quality matter?},
journal = {CoRR},
volume = {abs/2206.08478},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.08478},
doi = {10.48550/ARXIV.2206.08478},
eprinttype = {arXiv},
eprint = {2206.08478},
timestamp = {Tue, 26 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-08478.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-09554,
author = {James R. Kirk and
Robert E. Wray and
Peter Lindes and
John E. Laird},
title = {Evaluating Diverse Knowledge Sources for Online One-shot Learning
of Novel Tasks},
journal = {CoRR},
volume = {abs/2208.09554},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2208.09554},
doi = {10.48550/ARXIV.2208.09554},
eprinttype = {arXiv},
eprint = {2208.09554},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2208-09554.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2209-07636,
author = {James R. Kirk and
Robert E. Wray and
Peter Lindes and
John E. Laird},
title = {Improving Language Model Prompting in Support of Semi-autonomous Task
Learning},
journal = {CoRR},
volume = {abs/2209.07636},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2209.07636},
doi = {10.48550/ARXIV.2209.07636},
eprinttype = {arXiv},
eprint = {2209.07636},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2209-07636.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-13191,
author = {S{\"{o}}ren Dittmer and
Michael Roberts and
Julian D. Gilbey and
Ander Biguri and
AIX{-}COVNET Collaboration and
Jacobus Preller and
James H. F. Rudd and
John A. D. Aston and
Carola{-}Bibiane Sch{\"{o}}nlieb},
title = {Navigating the challenges in creating complex data systems: a development
philosophy},
journal = {CoRR},
volume = {abs/2210.13191},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.13191},
doi = {10.48550/ARXIV.2210.13191},
eprinttype = {arXiv},
eprint = {2210.13191},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-13191.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-16859,
author = {Alexander Maloney and
Daniel A. Roberts and
James Sully},
title = {A Solvable Model of Neural Scaling Laws},
journal = {CoRR},
volume = {abs/2210.16859},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.16859},
doi = {10.48550/ARXIV.2210.16859},
eprinttype = {arXiv},
eprint = {2210.16859},
timestamp = {Wed, 02 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-16859.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-09760,
author = {Luke Metz and
James Harrison and
C. Daniel Freeman and
Amil Merchant and
Lucas Beyer and
James Bradbury and
Naman Agrawal and
Ben Poole and
Igor Mordatch and
Adam Roberts and
Jascha Sohl{-}Dickstein},
title = {VeLO: Training Versatile Learned Optimizers by Scaling Up},
journal = {CoRR},
volume = {abs/2211.09760},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.09760},
doi = {10.48550/ARXIV.2211.09760},
eprinttype = {arXiv},
eprint = {2211.09760},
timestamp = {Thu, 24 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-09760.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SafonovBBRRMP21,
author = {Vladimir L. Safonov and
Derek A. Bas and
Diana Berman and
Yuri V. Rostovtsev and
James A. Roberts and
Michael E. Mcconney and
Michael R. Page},
title = {Adaptation of Fluctuating Magnetoacoustic System to External Signals},
journal = {{IEEE} Access},
volume = {9},
pages = {80847--80853},
year = {2021},
url = {https://doi.org/10.1109/ACCESS.2021.3085301},
doi = {10.1109/ACCESS.2021.3085301},
timestamp = {Tue, 15 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/SafonovBBRRMP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/artmed/KraljevicSSRNBM21,
author = {Zeljko Kraljevic and
Thomas Searle and
Anthony Shek and
Lukasz Roguski and
Kawsar Noor and
Daniel Bean and
Aurelie Mascio and
Leilei Zhu and
Amos A. Folarin and
Angus Roberts and
Rebecca Bendayan and
Mark P. Richardson and
Robert Stewart and
Anoop D. Shah and
Wai Keong Wong and
Zina M. Ibrahim and
James T. Teo and
Richard J. B. Dobson},
title = {Multi-domain clinical natural language processing with MedCAT: The
Medical Concept Annotation Toolkit},
journal = {Artif. Intell. Medicine},
volume = {117},
pages = {102083},
year = {2021},
url = {https://doi.org/10.1016/j.artmed.2021.102083},
doi = {10.1016/J.ARTMED.2021.102083},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/artmed/KraljevicSSRNBM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bigdatasociety/StevensA21,
author = {Amy Stevens and
James Allen{-}Robertson},
title = {Encrypting human rights: The intertwining of resistant voices in the
{UK} state surveillance debate},
journal = {Big Data Soc.},
volume = {8},
number = {1},
pages = {205395172098530},
year = {2021},
url = {https://doi.org/10.1177/2053951720985304},
doi = {10.1177/2053951720985304},
timestamp = {Sun, 31 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bigdatasociety/StevensA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/WebbKRVS21,
author = {Lachlan Webb and
Minna Kauppila and
James A. Roberts and
Sampsa Vanhatalo and
Nathan J. Stevenson},
title = {Automated detection of artefacts in neonatal {EEG} with residual neural
networks},
journal = {Comput. Methods Programs Biomed.},
volume = {208},
pages = {106194},
year = {2021},
url = {https://doi.org/10.1016/j.cmpb.2021.106194},
doi = {10.1016/J.CMPB.2021.106194},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cmpb/WebbKRVS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/ZhangLGIR21,
author = {Tianzhu Zhang and
Leonardo Linguaglossa and
Paolo Giaccone and
Luigi Iannone and
James Roberts},
title = {Performance benchmarking of state-of-the-art software switches for
{NFV}},
journal = {Comput. Networks},
volume = {188},
pages = {107861},
year = {2021},
url = {https://doi.org/10.1016/j.comnet.2021.107861},
doi = {10.1016/J.COMNET.2021.107861},
timestamp = {Wed, 07 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cn/ZhangLGIR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fcomp/WhittakerDCTBRT21,
author = {Robyn Whittaker and
Rosie Dobson and
Sarah Candy and
Taria Tane and
Kelly Burrowes and
Julie Reeve and
Merryn H. Tawhai and
Denise Taylor and
Trina Robertson and
Jeffrey Garrett and
Gayl Humphrey and
Tamzin Brott and
Sabaoon Raza Khan and
Feiyu Hu and
Jim Warren},
title = {Mobile Pulmonary Rehabilitation: Feasibility of Delivery by a Mobile
Phone-Based Program},
journal = {Frontiers Comput. Sci.},
volume = {3},
pages = {546960},
year = {2021},
url = {https://doi.org/10.3389/fcomp.2021.546960},
doi = {10.3389/FCOMP.2021.546960},
timestamp = {Fri, 12 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/fcomp/WhittakerDCTBRT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fdgth/MascioSBWMPPDR21,
author = {Aurelie Mascio and
Robert Stewart and
Riley Botelle and
Marcus Williams and
Luwaiza Mirza and
Rashmi Patel and
Thomas Pollak and
Richard J. B. Dobson and
Angus Roberts},
title = {Cognitive Impairments in Schizophrenia: {A} Study in a Large Clinical
Sample Using Natural Language Processing},
journal = {Frontiers Digit. Health},
volume = {3},
pages = {711941},
year = {2021},
url = {https://doi.org/10.3389/fdgth.2021.711941},
doi = {10.3389/FDGTH.2021.711941},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fdgth/MascioSBWMPPDR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fdgth/SundstromCWRWPB21,
author = {Beth Sundstrom and
Kathleen B. Cartmell and
Ashley A. White and
Nicole Russo and
Henry Well and
Jennifer Young Pierce and
Heather M. Brandt and
James R. Roberts and
Marvella E. Ford},
title = {{HPV} Vaccination Champions: Evaluating a Technology-Mediated Intervention
for Parents},
journal = {Frontiers Digit. Health},
volume = {3},
pages = {636161},
year = {2021},
url = {https://doi.org/10.3389/fdgth.2021.636161},
doi = {10.3389/FDGTH.2021.636161},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fdgth/SundstromCWRWPB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcgs/RobertsonFVJ21,
author = {Nathan Robertson and
James M. Flegal and
Dootika Vats and
Galin L. Jones},
title = {Assessing and Visualizing Simultaneous Simulation Error},
journal = {J. Comput. Graph. Stat.},
volume = {30},
number = {2},
pages = {324--334},
year = {2021},
url = {https://doi.org/10.1080/10618600.2020.1824871},
doi = {10.1080/10618600.2020.1824871},
timestamp = {Wed, 18 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcgs/RobertsonFVJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jossw/NightingaleHKAE21,
author = {James W. Nightingale and
Richard G. Hayes and
Ashley Kelly and
Aristeidis Amvrosiadis and
Amy Etherington and
Qiuhan He and
Nan Li and
XiaoYue Cao and
Jonathan Frawley and
Shaun Cole and
Andrea Enia and
Carlos S. Frenk and
David R. Harvey and
Ran Li and
Richard J. Massey and
Mattia Negrello and
Andrew Robertson},
title = {PyAutoLens: Open-Source Strong Gravitational Lensing},
journal = {J. Open Source Softw.},
volume = {6},
number = {58},
pages = {2825},
year = {2021},
url = {https://doi.org/10.21105/joss.02825},
doi = {10.21105/JOSS.02825},
timestamp = {Fri, 04 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jossw/NightingaleHKAE21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/natmi/RobertsDTGYUAEM21,
author = {Michael Roberts and
Derek Driggs and
Matthew Thorpe and
Julian D. Gilbey and
Michael Yeung and
Stephan Ursprung and
Angelica I. Avil{\'{e}}s{-}Rivero and
Christian Etmann and
Cathal McCague and
Lucian Beer and
Jonathan R. Weir{-}McCall and
Zhongzhao Teng and
Effrossyni Gkrania{-}Klotsas and
James H. F. Rudd and
Evis Sala and
Carola{-}Bibiane Sch{\"{o}}nlieb},
title = {Common pitfalls and recommendations for using machine learning to
detect and prognosticate for {COVID-19} using chest radiographs and
{CT} scans},
journal = {Nat. Mach. Intell.},
volume = {3},
number = {3},
pages = {199--217},
year = {2021},
url = {https://doi.org/10.1038/s42256-021-00307-0},
doi = {10.1038/S42256-021-00307-0},
timestamp = {Thu, 05 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/natmi/RobertsDTGYUAEM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HuiMZAABBBBBBBB21,
author = {Steve C. N. Hui and
Mark Mikkelsen and
Helge J. Z{\"{o}}llner and
Vishwadeep Ahluwalia and
Sarael Alcauter and
Laima Baltusis and
Deborah A. Barany and
Laura R. Barlow and
Robert Becker and
Jeffrey I. Berman and
Adam Berrington and
Pallab K. Bhattacharyya and
Jakob Udby Blicher and
Wolfgang Bogner and
Mark S. Brown and
Vince D. Calhoun and
Ryan Castillo and
Kim M. Cecil and
Richard A. E. Edden and
Yeo Bi Choi and
Winnie C. W. Chu and
William T. Clarke and
Alexander R. Craven and
Koen Cuypers and
Michael Dacko and
Camilo de la Fuente{-}Sandoval and
Patricia Desmond and
Aleksandra Domagalik and
Julien Dumont and
Niall W. Duncan and
Ulrike Dydak and
Katherine Dyke and
David A. Edmondson and
Gabriele Ende and
Lars Ersland and
C. John Evans and
Alan S. R. Fermin and
Antonio Ferretti and
Ariane Fillmer and
Tao Gong and
Ian Greenhouse and
James T. Grist and
Meng Gu and
Ashley D. Harris and
Katarzyna Hat and
Stefanie Heba and
Eva Heckova and
John P. Hegarty and
Kirstin{-}Friederike Heise and
Shiori Honda and
Aaron Jacobson and
Jacobus F. A. Jansen and
Christopher W. Jenkins and
Stephen J. Johnston and
Christoph Juchem and
Alayar Kangarlu and
Adam B. Kerr and
Karl Landheer and
Thomas Lange and
Phil Lee and
Swati Rane Levendovszky and
Catherine Limperopoulos and
Feng Liu and
William Lloyd and
David J. Lythgoe and
Maro G. Machizawa and
Erin L. MacMillan and
Richard J. Maddock and
Andrei V. Manzhurtsev and
Mar{\'{\i}}a L. Martinez{-}Gudino and
Jack J. Miller and
Heline Mirzakhanian and
Marta Moreno{-}Ortega and
Paul G. Mullins and
Shinichiro Nakajima and
Jamie Near and
Ralph Noeske and
Wibeke Nordh{\o}y and
Georg Oeltzschner and
Raul Osorio{-}Duran and
Mar{\'{\i}}a Concepci{\'{o}}n Garc{\'{\i}}a Otaduy and
Erick H. Pasaye and
Ronald Peeters and
Scott J. Peltier and
Ulrich Pilatus and
Nenad Polomac and
Eric C. Porges and
Subechhya Pradhan and
James Joseph Prisciandaro and
Nicolaas A. Puts and
Caroline D. Rae and
Francisco Reyes{-}Madrigal and
Timothy P. L. Roberts and
Caroline E. Robertson and
Jens T. Rosenberg and
Diana{-}Georgiana Rotaru and
Ruth L. O'Gorman Tuura and
Muhammad G. Saleh and
Kristian Sandberg and
Ryan Sangill and
Keith Schembri and
Anouk Schrantee and
Natalia A. Semenova and
Debra Singel and
Rouslan Sitnikov and
Jolinda Smith and
Yulu Song and
Craig E. L. Stark and
Diederick Stoffers and
Stephan P. Swinnen and
Rongwen Tain and
Costin Tanase and
Sofie Tapper and
Martin Tegenthoff and
Thomas Thiel and
Marc Thioux and
Peter Truong and
Pim van Dijk and
Nolan Vella and
Rishma Vidyasagar and
Andrej Vovk and
Guangbin Wang and
Lars T. Westlye and
Timothy K. Wilbur and
William R. Willoughby and
Martin Wilson and
Hans{-}J{\"{o}}rg Wittsack and
Adam J. Woods and
Yen{-}Chien Wu and
Junqian Xu and
Maria Yanez Lopez and
David Ka Wai Yeung and
Qun Zhao and
Xiaopeng Zhou and
Gasper Zupan},
title = {Frequency drift in {MR} spectroscopy at 3T},
journal = {NeuroImage},
volume = {241},
pages = {118430},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2021.118430},
doi = {10.1016/J.NEUROIMAGE.2021.118430},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/HuiMZAABBBBBBBB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/PangGR21,
author = {James C. Pang and
Leonardo L. Gollo and
James A. Roberts},
title = {Stochastic synchronization of dynamics on the human connectome},
journal = {NeuroImage},
volume = {229},
pages = {117738},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2021.117738},
doi = {10.1016/J.NEUROIMAGE.2021.117738},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/PangGR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/TierneyLBMSEMLB21,
author = {Tim M. Tierney and
Andrew Levy and
Daniel N. Barry and
Sofie S. Meyer and
Yoshihito Shigihara and
Matt Everatt and
Stephanie Mellor and
Jos{\'{e}} David L{\'{o}}pez and
Sven Bestmann and
Niall Holmes and
Gillian Roberts and
Ryan M. Hill and
Elena Boto and
James Leggett and
Vishal Shah and
Matthew J. Brookes and
Richard Bowtell and
Eleanor A. Maguire and
Gareth R. Barnes},
title = {Mouth magnetoencephalography: {A} unique perspective on the human
hippocampus},
journal = {NeuroImage},
volume = {225},
pages = {117443},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2020.117443},
doi = {10.1016/J.NEUROIMAGE.2020.117443},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/TierneyLBMSEMLB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/animalci/HolderWMKSCDRRB21,
author = {Timothy Ricardo Nathaniel Holder and
Evan Williams and
Devon Martin and
Alice Kligerman and
Emily Summers and
Zach Cleghern and
James Dieffenderfer and
Jane Russenberger and
David L. Roberts and
Alper Bozkurt},
title = {From Ideation to Deployment: {A} Narrative Case Study of Citizen Science
Supported Wearables for Raising Guide Dogs},
booktitle = {ACI'21: Eight International Conference on Animal-Computer Interaction,
Bloomington, IN, USA, November 8 - 11, 2021},
pages = {6:1--6:13},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3493842.3493890},
doi = {10.1145/3493842.3493890},
timestamp = {Tue, 24 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/animalci/HolderWMKSCDRRB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/Greenwood-Thessman21,
author = {Erin Greenwood{-}Thessman and
Isaac Oscar Gariano and
Richard Roberts and
Stefan Marr and
Michael Homer and
James Noble},
editor = {Chris Seaton and
Olivier Fl{\"{u}}ckiger},
title = {Na{\"{\i}}ve transient cast insertion isn't (that) bad},
booktitle = {{ICOOOLPS} 2021: Proceedings of the 16th {ACM} International Workshop
on Implementation, Compilation, Optimization of {OO} Languages, Programs
and Systems, Virtual Event, Denmark, 13 July 2021},
pages = {1--9},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3464972.3472395},
doi = {10.1145/3464972.3472395},
timestamp = {Tue, 08 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ecoop/Greenwood-Thessman21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vr/Prasolova-Forland21,
author = {Ekaterina Prasolova{-}F{\o}rland and
Simon McCallum and
Jos{\'{e}} Garc{\'{\i}}a Estrada},
title = {Collaborative learning in {VR} for cross-disciplinary distributed
student teams},
booktitle = {{IEEE} Conference on Virtual Reality and 3D User Interfaces Abstracts
and Workshops, {VR} Workshops 2021, Lisbon, Portugal, March 27 - April
1, 2021},
pages = {320--325},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/VRW52623.2021.00064},
doi = {10.1109/VRW52623.2021.00064},
timestamp = {Wed, 29 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vr/Prasolova-Forland21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-00643,
author = {Michael J. Roberts and
Sisi Zhang and
Eleanor Yuan and
James Jones and
Matthias Fripp},
title = {Using Temperature Sensitivity to Estimate Shiftable Electricity Demand:
Implications for power system investments and climate change},
journal = {CoRR},
volume = {abs/2109.00643},
year = {2021},
url = {https://arxiv.org/abs/2109.00643},
eprinttype = {arXiv},
eprint = {2109.00643},
timestamp = {Mon, 20 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-00643.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-08270,
author = {Robert E. Wray III and
James R. Kirk and
John E. Laird},
title = {Language Models as a Knowledge Source for Cognitive Agents},
journal = {CoRR},
volume = {abs/2109.08270},
year = {2021},
url = {https://arxiv.org/abs/2109.08270},
eprinttype = {arXiv},
eprint = {2109.08270},
timestamp = {Wed, 22 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-08270.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-13786,
author = {Luca Pion{-}Tonachini and
Kristofer E. Bouchard and
H{\'{e}}ctor Garc{\'{\i}}a Mart{\'{\i}}n and
Sean Peisert and
W. Bradley Holtz and
Anil Aswani and
Dipankar Dwivedi and
Haruko M. Wainwright and
Ghanshyam Pilania and
Benjamin Nachman and
Babetta L. Marrone and
Nicola Falco and
Prabhat and
Daniel B. Arnold and
Alejandro Wolf{-}Yadlin and
Sarah Powers and
Sharlee Climer and
Quinn Jackson and
Ty Carlson and
Michael Sohn and
Petrus H. Zwart and
Neeraj Kumar and
Amy Justice and
Claire J. Tomlin and
Daniel A. Jacobson and
Gos Micklem and
Georgios V. Gkoutos and
Peter J. Bickel and
Jean{-}Baptiste Cazier and
Juliane M{\"{u}}ller and
Bobbie{-}Jo Webb{-}Robertson and
Rick Stevens and
Mark Anderson and
Kenneth Kreutz{-}Delgado and
Michael W. Mahoney and
James B. Brown},
title = {Learning from learning machines: a new generation of {AI} technology
to meet the needs of science},
journal = {CoRR},
volume = {abs/2111.13786},
year = {2021},
url = {https://arxiv.org/abs/2111.13786},
eprinttype = {arXiv},
eprint = {2111.13786},
timestamp = {Thu, 06 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-13786.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-02721,
author = {Kaustubh D. Dhole and
Varun Gangal and
Sebastian Gehrmann and
Aadesh Gupta and
Zhenhao Li and
Saad Mahamood and
Abinaya Mahendiran and
Simon Mille and
Ashish Srivastava and
Samson Tan and
Tongshuang Wu and
Jascha Sohl{-}Dickstein and
Jinho D. Choi and
Eduard H. Hovy and
Ondrej Dusek and
Sebastian Ruder and
Sajant Anand and
Nagender Aneja and
Rabin Banjade and
Lisa Barthe and
Hanna Behnke and
Ian Berlot{-}Attwell and
Connor Boyle and
Caroline Brun and
Marco Antonio Sobrevilla Cabezudo and
Samuel Cahyawijaya and
Emile Chapuis and
Wanxiang Che and
Mukund Choudhary and
Christian Clauss and
Pierre Colombo and
Filip Cornell and
Gautier Dagan and
Mayukh Das and
Tanay Dixit and
Thomas Dopierre and
Paul{-}Alexis Dray and
Suchitra Dubey and
Tatiana Ekeinhor and
Marco Di Giovanni and
Tanya Goyal and
Rishabh Gupta and
Louanes Hamla and
Sang Han and
Fabrice Harel{-}Canada and
Antoine Honore and
Ishan Jindal and
Przemyslaw K. Joniak and
Denis Kleyko and
Venelin Kovatchev and
Kalpesh Krishna and
Ashutosh Kumar and
Stefan Langer and
Seungjae Ryan Lee and
Corey James Levinson and
Hualou Liang and
Kaizhao Liang and
Zhexiong Liu and
Andrey Lukyanenko and
Vukosi Marivate and
Gerard de Melo and
Simon Meoni and
Maxime Meyer and
Afnan Mir and
Nafise Sadat Moosavi and
Niklas Muennighoff and
Timothy Sum Hon Mun and
Kenton Murray and
Marcin Namysl and
Maria Obedkova and
Priti Oli and
Nivranshu Pasricha and
Jan Pfister and
Richard Plant and
Vinay Prabhu and
Vasile Pais and
Libo Qin and
Shahab Raji and
Pawan Kumar Rajpoot and
Vikas Raunak and
Roy Rinberg and
Nicholas Roberts and
Juan Diego Rodriguez and
Claude Roux and
Paulo Henrique Santos Vasconcellos and
Ananya B. Sai and
Robin M. Schmidt and
Thomas Scialom and
Tshephisho Sefara and
Saqib Shamsi and
Xudong Shen and
Yiwen Shi and
Haoyue Shi and
Anna Shvets and
Nick Siegel and
Damien Sileo and
Jamie Simon and
Chandan Singh and
Roman Sitelew and
Priyank Soni and
Taylor Sorensen and
William Soto and
Aman Srivastava and
K. V. Aditya Srivatsa and
Tony Sun and
Mukund Varma T. and
A. Tabassum and
Fiona Anting Tan and
Ryan Teehan and
Mo Tiwari and
Marie Tolkiehn and
Athena Wang and
Zijian Wang and
Zijie J. Wang and
Gloria Wang and
Fuxuan Wei and
Bryan Wilie and
Genta Indra Winata and
Xinyi Wu and
Witold Wydmanski and
Tianbao Xie and
Usama Yaseen and
Michael A. Yee and
Jing Zhang and
Yue Zhang},
title = {NL-Augmenter: {A} Framework for Task-Sensitive Natural Language Augmentation},
journal = {CoRR},
volume = {abs/2112.02721},
year = {2021},
url = {https://arxiv.org/abs/2112.02721},
eprinttype = {arXiv},
eprint = {2112.02721},
timestamp = {Tue, 25 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-02721.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-06671,
author = {Alessandro Finamore and
James Roberts and
Massimo Gallo and
Dario Rossi},
title = {Accelerating Deep Learning Classification with Error-controlled Approximate-key
Caching},
journal = {CoRR},
volume = {abs/2112.06671},
year = {2021},
url = {https://arxiv.org/abs/2112.06671},
eprinttype = {arXiv},
eprint = {2112.06671},
timestamp = {Sat, 25 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-06671.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ccr/Roberts20,
author = {James W. Roberts},
title = {Comment on "Datacenter Congestion Control: Identifying what is essential
and making it practical" by Aisha Mushtaq, et al, CCR, July 2019},
journal = {Comput. Commun. Rev.},
volume = {50},
number = {2},
pages = {64},
year = {2020},
url = {https://doi.org/10.1145/3402413.3402423},
doi = {10.1145/3402413.3402423},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ccr/Roberts20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhci/RobertsD20,
author = {James A. Roberts and
Meredith E. David},
title = {The Social Media Party: Fear of Missing Out (FoMO), Social Media Intensity,
Connection, and Well-Being},
journal = {Int. J. Hum. Comput. Interact.},
volume = {36},
number = {4},
pages = {386--392},
year = {2020},
url = {https://doi.org/10.1080/10447318.2019.1646517},
doi = {10.1080/10447318.2019.1646517},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhci/RobertsD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcphy/HateleyRMY20,
author = {James C. Hateley and
Jay Roberts and
Kyle Mylonakis and
Xu Yang},
title = {Deep learning seismic substructure detection using the Frozen Gaussian
approximation},
journal = {J. Comput. Phys.},
volume = {409},
pages = {109313},
year = {2020},
url = {https://doi.org/10.1016/j.jcp.2020.109313},
doi = {10.1016/J.JCP.2020.109313},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcphy/HateleyRMY20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/AhmadiRLM20,
author = {Mahdieh Ahmadi and
James Roberts and
Emilio Leonardi and
Ali Movaghar},
title = {Cache Subsidies for an Optimal Memory for Bandwidth Tradeoff in the
Access Network},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {38},
number = {4},
pages = {736--749},
year = {2020},
url = {https://doi.org/10.1109/JSAC.2020.2971806},
doi = {10.1109/JSAC.2020.2971806},
timestamp = {Wed, 12 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/AhmadiRLM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/RheinbayNAWSTHH20,
author = {Esther Rheinbay and
Morten Muhlig Nielsen and
Federico Abascal and
Jeremiah Wala and
Ofer Shapira and
Grace Tiao and
Henrik Hornsh{\o}j and
Julian M. Hess and
Randi Istrup Juul and
Ziao Lin and
Lars Feuerbach and
Radhakrishnan Sabarinathan and
Tobias Madsen and
Jaegil Kim and
Loris Mularoni and
Shimin Shuai and
Andr{\'{e}}s Lanz{\'{o}}s and
Carl Herrmann and
Yosef E. Maruvka and
Ciyue Shen and
Samirkumar B. Amin and
Pratiti Bandopadhayay and
Johanna Bertl and
Keith A. Boroevich and
John Busanovich and
Joana Carlevaro{-}Fita and
Dimple Chakravarty and
Calvin Wing Yiu Chan and
David Craft and
Priyanka Dhingra and
Klev Diamanti and
Nuno A. Fonseca and
Abel Gonzalez{-}Perez and
Qianyun Guo and
Mark P. Hamilton and
Nicholas J. Haradhvala and
Chen Hong and
Keren Isaev and
Todd A. Johnson and
Malene Juul and
Andr{\'{e}} Kahles and
Abdullah Kahraman and
Youngwook Kim and
Jan Komorowski and
Kiran Kumar and
Sushant Kumar and
Donghoon Lee and
Kjong{-}Van Lehmann and
Yilong Li and
Eric Minwei Liu and
Lucas Lochovsky and
Keunchil Park and
Oriol Pich and
Nicola D. Roberts and
Gordon Saksena and
Steven E. Schumacher and
Nikos Sidiropoulos and
Lina Sieverling and
Nasa Sinnott{-}Armstrong and
Chip Stewart and
David Tamborero and
Jose M. C. Tubio and
Husen M. Umer and
Liis Uusk{\"{u}}la{-}Reimand and
Claes Wadelius and
Lina Wadi and
Xiaotong Yao and
Cheng{-}Zhong Zhang and
Jing Zhang and
James E. Haber and
Asger Hobolth and
Marcin Imielinski and
Manolis Kellis and
Michael S. Lawrence and
Christian von Mering and
Hidewaki Nakagawa and
Benjamin J. Raphael and
Mark A. Rubin and
Chris Sander and
Lincoln D. Stein and
Joshua M. Stuart and
Tatsuhiko Tsunoda and
David A. Wheeler and
Rory Johnson and
J{\"{u}}ri Reimand and
Mark Gerstein and
Ekta Khurana and
Peter J. Campbell and
N{\'{u}}ria L{\'{o}}pez{-}Bigas and
Gary D. Bader and
Jonathan Barenboim and
Rameen Beroukhim and
S{\o}ren Brunak and
Ken Chen and
Jung Kyoon Choi and
Jordi Deu{-}Pons and
J. Lynn Fink and
Joan Frigola and
Carlo Gambacorti Passerini and
Dale W. Garsed and
Gad Getz and
Ivo Glynne Gut and
David Haan and
Arif Ozgun Harmanci and
Mohamed Helmy and
Ermin Hodzic and
Jos{\'{e}} M. G. Izarzugaza and
Jong K. Kim and
Jan O. Korbel and
Erik Larsson and
Shantao Li and
Xiaotong Li and
Shaoke Lou and
Kathleen Marchal and
I{\~{n}}igo Martincorena and
Alexander Mart{\'{\i}}nez{-}Fundichely and
Patrick D. McGillivray and
William Meyerson and
Ferran Mui{\~{n}}os and
Marta Paczkowska and
Kiejung Park and
Jakob Skou Pedersen and
Tirso Pons and
Sergio Pulido{-}Tamayo and
Iker Reyes{-}Salazar and
Matthew A. Reyna and
Carlota Rubio{-}Perez and
S{\"{u}}leyman Cenk Sahinalp and
Leonidas Salichos and
Mark Shackleton and
Raunak Shrestha and
Alfonso Valencia and
Miguel Vazquez and
Lieven P. C. Verbeke and
Jiayin Wang and
Jonathan Warrell and
Sebastian M. Waszak and
Joachim Weischenfeldt and
Guanming Wu and
Jun Yu and
Xuanping Zhang and
Yan Zhang and
Zhongming Zhao and
Lihua Zou and
Kadir C. Akdemir and
Eva G. Alvarez and
Adrian Baez{-}Ortega and
Paul C. Boutros and
David D. L. Bowtell and
Benedikt Brors and
Kathleen H. Burns and
Kin Chan and
Isidro Cort{\'{e}}s{-}Ciriano and
Ana Dueso{-}Barroso and
Andrew J. Dunford and
Paul A. Edwards and
Xavier Estivill and
Dariush Etemadmoghadam and
Milana Frenkel{-}Morgenstern and
Dmitry A. Gordenin and
Barbara Hutter and
David T. W. Jones and
Young Seok Ju and
Marat D. Kazanov and
Leszek J. Klimczak and
Youngil Koh and
Eunjung Alice Lee and
Jake June{-}Koo Lee and
Andy G. Lynch and
Geoff MacIntyre and
Florian Markowetz and
Matthew Meyerson and
Satoru Miyano and
Fabio C. P. Navarro and
Stephan Ossowski and
Peter J. Park and
John V. Pearson and
Montserrat Puiggr{\`{o}}s and
Karsten Rippe and
Steven A. Roberts and
Bernardo Rodriguez{-}Martin and
Ralph Scully and
David Torrents and
Izar Villasante and
Nicola Waddell and
Jeremiah A. Wala and
Lixing Yang and
Sung{-}Soo Yoon and
Jorge Zamora},
title = {Analyses of non-coding somatic drivers in 2,658 cancer whole genomes},
journal = {Nat.},
volume = {578},
number = {7793},
pages = {102--111},
year = {2020},
url = {https://doi.org/10.1038/s41586-020-1965-x},
doi = {10.1038/S41586-020-1965-X},
timestamp = {Thu, 11 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/RheinbayNAWSTHH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/TurroAMGGSASFTS20,
author = {Ernest Turro and
William J. Astle and
Karyn Megy and
Stefan Gr{\"{a}}f and
Daniel Greene and
Olga Shamardina and
Hana Lango Allen and
Alba Sanchis{-}Juan and
Mattia Frontini and
Chantal Thys and
Jonathan Stephens and
Rutendo Mapeta and
Oliver S. Burren and
Kate Downes and
Matthias Haimel and
Salih Tuna and
Sri V. V. Deevi and
Timothy J. Aitman and
David L. H. Bennett and
Paul Calleja and
Keren Carss and
Mark J. Caulfield and
Patrick F. Chinnery and
Peter H. Dixon and
Daniel P. Gale and
Roger James and
Ania Koziell and
Michael A. Laffan and
Adam P. Levine and
Eamonn R. Maher and
Hugh S. Markus and
Joannella Morales and
Nicholas W. Morrell and
Andrew D. Mumford and
Elizabeth Ormondroyd and
Stuart Rankin and
Augusto Rendon and
Sylvia Richardson and
Irene Roberts and
Noemi B. A. Roy and
Moin A. Saleem and
Kenneth G. C. Smith and
Hannah Stark and
Rhea Y. Y. Tan and
Andreas C. Themistocleous and
Adrian J. Thrasher and
Hugh Watkins and
Andrew R. Webster and
Martin R. Wilkins and
Catherine Williamson and
James Whitworth and
Sean Humphray and
David R. Bentley and
Stephen Abbs and
Lara Abulhoul and
Julian Adlard and
Munaza Ahmed and
Hana Alachkar and
David J. Allsup and
Jeff Almeida{-}King and
Philip Ancliff and
Richard Antrobus and
Ruth Armstrong and
Gavin Arno and
Sofie Ashford and
Anthony Attwood and
Paul Aurora and
Christian Babbs and
Chiara Bacchelli and
Tamam Bakchoul and
Siddharth Banka and
Tadbir Bariana and
Julian Barwell and
Joana Batista and
Helen E. Baxendale and
Phil L. Beales and
Agnieszka Bierzynska and
Tina Biss and
Maria A. K. Bitner{-}Glindzicz and
Graeme C. M. Black and
Marta Bleda and
Iulia Blesneac and
Detlef Bockenhauer and
Harm Bogaard and
Christian J. Bourne and
Sara Boyce and
John R. Bradley and
Eugene Bragin and
Gerome Breen and
Paul Brennan and
Carole Brewer and
Matthew Brown and
Andrew C. Browning and
Michael J. Browning and
Rachel J. Buchan and
Matthew S. Buckland and
Teofila Bueser and
Carmen Bugarin Diz and
John Burn and
Siobhan O. Burns and
Nigel Burrows and
Carolyn Campbell and
Gerald Carr{-}White and
Ruth Casey and
Jenny Chambers and
John Chambers and
Melanie M. Y. Chan and
Calvin Cheah and
Floria Cheng and
Manali Chitre and
Martin T. Christian and
Colin Church and
Jill Clayton{-}Smith and
Maureen Cleary and
Naomi Clements Brod and
Gerry Coghlan and
Elizabeth Colby and
Trevor R. P. Cole and
Janine Collins and
Peter W. Collins and
Camilla Colombo and
Cecilia J. Compton and
Robin Condliffe and
Stuart A. Cook and
H. Terence Cook and
Nichola Cooper and
Paul A. Corris and
Abigail Furnell and
Fiona Cunningham and
Nicola S. Curry and
Antony J. Cutler and
Matthew J. Daniels and
Mehul Dattani and
Louise C. Daugherty and
John Davis and
Anthony De Soyza and
Timothy Dent and
Charu Deshpande and
Eleanor F. Dewhurst and
Sofia Douzgou and
Anna M. Drazyk and
Elizabeth Drewe and
Daniel Duarte and
Tina Dutt and
J. David M. Edgar and
Karen Edwards and
William Egner and
Melanie N. Ekani and
Perry Elliott and
Wendy N. Erber and
Marie Erwood and
Maria C. Estiu and
Dafydd Gareth Evans and
Gillian Evans and
Tamara Everington and
M{\'{e}}lanie Eyries and
Hiva Fassihi and
Remi Favier and
Jack Findhammer and
Debra Fletcher and
Frances A. Flinter and
R. Andres Floto and
Tom Fowler and
James Fox and
Amy J. Frary and
Courtney E. French and
Kathleen Freson and
Henning Gall and
Vijeya Ganesan and
Michael Gattens and
Claire Geoghegan and
Terence S. A. Gerighty and
Ali G. Gharavi and
Stefano Ghio and
Hossein{-}Ardeschir Ghofrani and
J. Simon R. Gibbs and
Kate Gibson and
Kimberly C. Gilmour and
Barbara Girerd and
Nicholas S. Gleadall and
Sarah Goddard and
David B. Goldstein and
Keith Gomez and
Pavels Gordins and
David Gosal and
Jodie Graham and
Luigi Grassi and
Lynn Greenhalgh and
Andreas Greinacher and
Paolo Gresele and
Philip Griffiths and
Sofia Grigoriadou and
Russell J. Grocock and
Detelina Grozeva and
Mark Gurnell and
Scott Hackett and
Charaka Hadinnapola and
William M. Hague and
Rosie Hague and
Matthew Hall and
Helen L. Hanson and
Eshika Haque and
Kirsty Harkness and
Andrew R. Harper and
Claire L. Harris and
Daniel Hart and
Ahamad Hassan and
Grant Hayman and
Alex Henderson and
Archana Herwadkar and
Jonathan Hoffman and
Simon Holden and
Rita Horvath and
Henry Houlden and
Arjan C. Houweling and
Luke S. G. E. Howard and
Fengyuan Hu and
Gavin Hudson and
Joseph Hughes and
Aarnoud P. Huissoon and
Marc Humbert and
Sarah Hunter and
Matthew E. Hurles and
Melita Irving and
Louise Izatt and
Sally A. Johnson and
Stephen Jolles and
Jennifer Jolley and
Dragana Josifova and
Neringa Jurkute and
Tim Karten and
Johannes Karten and
Mary A. Kasanicki and
Hanadi Kazkaz and
Rashid Kazmi and
Peter Kelleher and
Anne M. Kelly and
Wilf Kelsall and
Carly Kempster and
David G. Kiely and
Nathalie Kingston and
Robert Klima and
Nils Koelling and
Myrto Kostadima and
Gabor Kovacs and
Roman Kreuzhuber and
Taco W. Kuijpers and
Ajith Kumar and
Dinakantha Kumararatne and
Manju A. Kurian and
Fiona Lalloo and
Michele Lambert and
Allan Lawrie and
D. Mark Layton and
Nick Lench and
Claire Lentaigne and
Tracy Lester and
Rachel Linger and
Hilary Longhurst and
Lorena E. Lorenzo and
Eleni Louka and
Paul A. Lyons and
Rajiv D. Machado and
Robert V. MacKenzie Ross and
Bella Madan and
Jesmeen Maimaris and
Samantha Malka and
Sarah Mangles and
Kevin J. Marchbank and
Stephen Marks and
Hanns{-}Ulrich Marschall and
Andrew G. Marshall and
Jennifer Martin and
Mary Mathias and
Emma Matthews and
Heather Maxwell and
Paul McAlinden and
Mark I. McCarthy and
Harriet McKinney and
Aoife McMahon and
Stuart Meacham and
Adam J. Mead and
Ignacio Medina Castello and
Sarju G. Mehta and
Michel Michaelides and
Carolyn Millar and
Shehla N. Mohammed and
Shahin Moledina and
David Montani and
Anthony T. Moore and
Monika Mozere and
Keith W. Muir and
Andrea H. Nemeth and
William G. Newman and
Michael Newnham and
Sadia Noorani and
Paquita Nurden and
Jennifer O'Sullivan and
Samya Obaji and
Chris Odhams and
Steven Okoli and
Andrea Olschewski and
Horst Olschewski and
Kai Ren Ong and
S. Helen Oram and
Willem H. Ouwehand and
Claire Palles and
Sofia Papadia and
Soo{-}Mi Park and
David Parry and
Smita Patel and
Joan Paterson and
Andrew Peacock and
Simon H. Pearce and
John Peden and
Kathelijne Peerlinck and
Christopher J. Penkett and
Joanna Pepke{-}Zaba and
Romina Petersen and
Clarissa Pilkington and
Kenneth E. S. Poole and
Radhika Prathalingam and
Bethan Psaila and
Angela Pyle and
Richard Quinton and
Shamima Rahman and
Anupama Rao and
F. Lucy Raymond and
Paula J. Rayner{-}Matthews and
Christine Rees and
Tara Renton and
Christopher J. Rhodes and
Andrew S. C. Rice and
Alex Richter and
Leema Robert and
Anthony Rogers and
Sarah J. Rose and
Robert Ross{-}Russell and
Catherine Roughley and
Deborah M. Ruddy and
Omid Sadeghi{-}Alavijeh and
Nilesh J. Samani and
Crina Samarghitean and
Ravishankar B. Sargur and
Robert N. Sarkany and
Simon Satchell and
Sinisa Savic and
John A. Sayer and
Genevieve Sayer and
Laura Scelsi and
Andrew M. Schaefer and
Sol Schulman and
Richard Scott and
Marie Scully and
Claire Searle and
Werner Seeger and
Arjune Sen and
W. A. Carrock Sewell and
Denis Seyres and
Neil Shah and
Susan E. Shapiro and
Adam C. Shaw and
Patrick J. Short and
Keith Sibson and
Lucy Side and
Ilenia Simeoni and
Michael A. Simpson and
Matthew C. Sims and
Suthesh Sivapalaratnam and
Damian Smedley and
Katherine R. Smith and
Katie Snape and
Nicole Soranzo and
Florent Soubrier and
Laura Southgate and
Olivera Spasic{-}Boskovic and
Simon Staines and
Emily Staples and
Charles A. Steward and
Kathleen E. Stirrups and
Alex Stuckey and
Jay Suntharalingam and
Emilia M. Swietlik and
Petros Syrris and
R. Campbell Tait and
Kate Talks and
Katie Tate and
John M. Taylor and
Jenny C. Taylor and
James E. Thaventhiran and
Ellen Thomas and
David Thomas and
Moira J. Thomas and
Patrick Thomas and
Kate Thomson and
Glen Threadgold and
Tobias Tilly and
Marc Tischkowitz and
Catherine Titterton and
John A. Todd and
Cheng{-}Hock Toh and
Bas Tolhuis and
Ian P. Tomlinson and
Mark Toshner and
Matthew Traylor and
Carmen Treacy and
Paul Treadaway and
Richard Trembath and
Wojciech Turek and
Philip Twiss and
Tom Vale and
Chris Van Geet and
Natalie van Zuydam and
Maarten Vandekuilen and
Anthony M. Vandersteen and
Marta Vazquez{-}Lopez and
Julie von Ziegenweidt and
Anton Vonk{-}Noordegraaf and
Annette Wagner and
Quinten Waisfisz and
Suellen M. Walker and
Neil Walker and
Klaudia Walter and
James S. Ware and
Christopher Watt and
Lucy Wedderburn and
Wei Wei and
Steven B. Welch and
Julie Wessels and
Sarah K. Westbury and
John{-}Paul Westwood and
John Wharton and
Deborah Whitehorn and
Andrew O. M. Wilkie and
Brian T. Wilson and
Edwin K. S. Wong and
Nicholas W. Wood and
Yvette Wood and
Christopher Geoffrey Woods and
Emma R. Woodward and
Stephen J. Wort and
Austen Worth and
Michael Wright and
Katherine Yates and
Patrick F. K. Yong and
Timothy Young and
Ping Yu and
Patrick Yu{-}Wai{-}Man and
Eliska Zlamalova},
title = {Whole-genome sequencing of patients with rare diseases in a national
health system},
journal = {Nat.},
volume = {583},
number = {7814},
pages = {96--102},
year = {2020},
url = {https://doi.org/10.1038/s41586-020-2434-2},
doi = {10.1038/S41586-020-2434-2},
timestamp = {Fri, 22 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nature/TurroAMGGSASFTS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/PuckettSIVRB20,
author = {Alexander M. Puckett and
Mark M. Schira and
Zoey J. Isherwood and
Jonathan D. Victor and
James A. Roberts and
Michael Breakspear},
title = {Manipulating the structure of natural scenes using wavelets to study
the functional architecture of perceptual hierarchies in the brain},
journal = {NeuroImage},
volume = {221},
pages = {117173},
year = {2020},
url = {https://doi.org/10.1016/j.neuroimage.2020.117173},
doi = {10.1016/J.NEUROIMAGE.2020.117173},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/PuckettSIVRB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/IveVKYVPCR0V20,
author = {Julia Ive and
Natalia Viani and
Joyce Kam and
Lucia Yin and
Somain Verma and
Stephen Puntis and
Rudolf N. Cardinal and
Angus Roberts and
Robert Stewart and
Sumithra Velupillai},
title = {Generation and evaluation of artificial mental health records for
Natural Language Processing},
journal = {npj Digit. Medicine},
volume = {3},
year = {2020},
url = {https://doi.org/10.1038/s41746-020-0267-x},
doi = {10.1038/S41746-020-0267-X},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/IveVKYVPCR0V20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pe/AhmadiRLM20,
author = {Mahdieh Ahmadi and
James Roberts and
Emilio Leonardi and
Ali Movaghar},
title = {On the effectiveness of the {PIT} in reducing upstream demand in an
{NDN} router},
journal = {Perform. Evaluation},
volume = {138},
pages = {102081},
year = {2020},
url = {https://doi.org/10.1016/j.peva.2020.102081},
doi = {10.1016/J.PEVA.2020.102081},
timestamp = {Wed, 12 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pe/AhmadiRLM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/GoodFMMMRRSWWW20,
author = {Simon Good and
Emma Fiedler and
Chongyuan Mao and
Matthew J. Martin and
Adam Maycock and
Rebecca Reid and
Jonah Roberts{-}Jones and
Toby Searle and
Jennifer Waters and
James While and
Mark Worsfold},
title = {The Current Configuration of the Ostia System for Operational Production
of Foundation Sea Surface Temperature and Ice Concentration Analyses},
journal = {Remote. Sens.},
volume = {12},
number = {4},
pages = {720},
year = {2020},
url = {https://doi.org/10.3390/rs12040720},
doi = {10.3390/RS12040720},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/GoodFMMMRRSWWW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aina/RobertsonYGKWO20,
author = {James Robertson and
Jianhua Yang and
W. Scott Gunter and
Peter Keres and
Thomas Wingate and
Anthony Obando},
editor = {Leonard Barolli and
Flora Amato and
Francesco Moscato and
Tomoya Enokido and
Makoto Takizawa},
title = {Educational Microclimate Mesonet System Design},
booktitle = {Web, Artificial Intelligence and Network Applications - Proceedings
of the Workshops of the 34th International Conference on Advanced
Information Networking and Applications, {AINA} Workshops 2020, Caserta,
Italy, 15-17 April},
series = {Advances in Intelligent Systems and Computing},
volume = {1150},
pages = {24--33},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-44038-1\_3},
doi = {10.1007/978-3-030-44038-1\_3},
timestamp = {Thu, 04 Apr 2024 17:08:34 +0200},
biburl = {https://dblp.org/rec/conf/aina/RobertsonYGKWO20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bionlp/MascioKBDSBR20,
author = {Aurelie Mascio and
Zeljko Kraljevic and
Daniel Bean and
Richard J. B. Dobson and
Robert Stewart and
Rebecca Bendayan and
Angus Roberts},
editor = {Dina Demner{-}Fushman and
Kevin Bretonnel Cohen and
Sophia Ananiadou and
Junichi Tsujii},
title = {Comparative Analysis of Text Classification Approaches in Electronic
Health Records},
booktitle = {Proceedings of the 19th SIGBioMed Workshop on Biomedical Language
Processing, BioNLP 2020, Online, July 9, 2020},
pages = {86--94},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.bionlp-1.9},
doi = {10.18653/V1/2020.BIONLP-1.9},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bionlp/MascioKBDSBR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpec/ThalerSRRR20,
author = {Justin Thaler and
Woong Shin and
Steven Roberts and
James H. Rogers and
Todd Rosedahl},
title = {Hybrid Approach to {HPC} Cluster Telemetry and Hardware Log Analytics},
booktitle = {2020 {IEEE} High Performance Extreme Computing Conference, {HPEC}
2020, Waltham, MA, USA, September 22-24, 2020},
pages = {1--7},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/HPEC43674.2020.9286239},
doi = {10.1109/HPEC43674.2020.9286239},
timestamp = {Thu, 14 Jan 2021 08:55:23 +0100},
biburl = {https://dblp.org/rec/conf/hpec/ThalerSRRR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/BrownABCCGHLMSS20,
author = {Jonathan K. Brown and
David Abdallah and
Jim Boley and
Nicholas Collins and
Kyle Craig and
Greg Glennon and
Kuo{-}Ken Huang and
Christopher J. Lukas and
William Moore and
Richard K. Sawyer and
Yousef Shakhsheer and
Farah B. Yahya and
Alice Wang and
Nathan E. Roberts and
David D. Wentzloff and
Benton H. Calhoun},
title = {27.1 {A} 65nm Energy-Harvesting {ULP} SoC with 256kB Cortex-M0 Enabling
an 89.1{\(\mathrm{\mu}\)}W Continuous Machine Health Monitoring Wireless
Self-Powered System},
booktitle = {2020 {IEEE} International Solid- State Circuits Conference, {ISSCC}
2020, San Francisco, CA, USA, February 16-20, 2020},
pages = {420--422},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ISSCC19947.2020.9063067},
doi = {10.1109/ISSCC19947.2020.9063067},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/BrownABCCGHLMSS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/ChaturvediVSTHB20,
author = {Jaya Chaturvedi and
Natalia Viani and
Jyoti Sanyal and
Chloe Tytherleigh and
Idil Hasan and
Kate Baird and
Sumithra Velupillai and
Robert Stewart and
Angus Roberts},
editor = {Nicoletta Calzolari and
Fr{\'{e}}d{\'{e}}ric B{\'{e}}chet and
Philippe Blache and
Khalid Choukri and
Christopher Cieri and
Thierry Declerck and
Sara Goggi and
Hitoshi Isahara and
Bente Maegaard and
Joseph Mariani and
H{\'{e}}l{\`{e}}ne Mazo and
Asunci{\'{o}}n Moreno and
Jan Odijk and
Stelios Piperidis},
title = {Development of a Corpus Annotated with Medications and their Attributes
in Psychiatric Health Records},
booktitle = {Proceedings of The 12th Language Resources and Evaluation Conference,
{LREC} 2020, Marseille, France, May 11-16, 2020},
pages = {2009--2016},
publisher = {European Language Resources Association},
year = {2020},
url = {https://aclanthology.org/2020.lrec-1.247/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/ChaturvediVSTHB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vr/AnderssonBPME20,
author = {Henrik Bjelke Andersson and
Thomas B{\o}rresen and
Ekaterina Prasolova{-}F{\o}rland and
Simon McCallum and
Jos{\'{e}} Garc{\'{\i}}a Estrada},
title = {Developing An {AR} Application For Neurosurgical Training: Lessons
Learned For Medical Specialist Education},
booktitle = {2020 {IEEE} Conference on Virtual Reality and 3D User Interfaces Abstracts
and Workshops, {VR} Workshops, Atlanta, GA, USA, March 22-26, 2020},
pages = {407--412},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/VRW50115.2020.00087},
doi = {10.1109/VRW50115.2020.00087},
timestamp = {Wed, 29 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vr/AnderssonBPME20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2002-08901,
author = {Rebecca Bendayan and
Honghan Wu and
Zeljko Kraljevic and
Robert Stewart and
Tom Searle and
Jaya Chaturvedi and
Jayati Das{-}Munshi and
Zina M. Ibrahim and
Aurelie Mascio and
Angus Roberts and
Daniel Bean and
Richard J. B. Dobson},
title = {Identifying physical health comorbidities in a cohort of individuals
with severe mental illness: An application of SemEHR},
journal = {CoRR},
volume = {abs/2002.08901},
year = {2020},
url = {https://arxiv.org/abs/2002.08901},
eprinttype = {arXiv},
eprint = {2002.08901},
timestamp = {Thu, 25 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2002-08901.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2003-13489,
author = {Tianzhu Zhang and
Leonardo Linguaglossa and
Paolo Giaccone and
Luigi Iannone and
James Roberts},
title = {Performance Benchmarking of State-of-the-Art Software Switches for
{NFV}},
journal = {CoRR},
volume = {abs/2003.13489},
year = {2020},
url = {https://arxiv.org/abs/2003.13489},
eprinttype = {arXiv},
eprint = {2003.13489},
timestamp = {Wed, 01 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2003-13489.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-06624,
author = {Aurelie Mascio and
Zeljko Kraljevic and
Daniel Bean and
Richard J. B. Dobson and
Robert Stewart and
Rebecca Bendayan and
Angus Roberts},
title = {Comparative Analysis of Text Classification Approaches in Electronic
Health Records},
journal = {CoRR},
volume = {abs/2005.06624},
year = {2020},
url = {https://arxiv.org/abs/2005.06624},
eprinttype = {arXiv},
eprint = {2005.06624},
timestamp = {Thu, 25 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-06624.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-06388,
author = {Michael Roberts and
Derek Driggs and
Matthew Thorpe and
Julian D. Gilbey and
Michael Yeung and
Stephan Ursprung and
Angelica I. Avil{\'{e}}s{-}Rivero and
Christian Etmann and
Cathal McCague and
Lucian Beer and
Jonathan R. Weir{-}McCall and
Zhongzhao Teng and
James H. F. Rudd and
Evis Sala and
Carola{-}Bibiane Sch{\"{o}}nlieb},
title = {Machine learning for {COVID-19} detection and prognostication using
chest radiographs and {CT} scans: a systematic methodological review},
journal = {CoRR},
volume = {abs/2008.06388},
year = {2020},
url = {https://arxiv.org/abs/2008.06388},
eprinttype = {arXiv},
eprint = {2008.06388},
timestamp = {Fri, 14 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2008-06388.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-01165,
author = {Zeljko Kraljevic and
Thomas Searle and
Anthony Shek and
Lukasz Roguski and
Kawsar Noor and
Daniel Bean and
Aurelie Mascio and
Leilei Zhu and
Amos A. Folarin and
Angus Roberts and
Rebecca Bendayan and
Mark P. Richardson and
Robert Stewart and
Anoop D. Shah and
Wai Keong Wong and
Zina M. Ibrahim and
James T. Teo and
Richard J. B. Dobson},
title = {Multi-domain Clinical Natural Language Processing with MedCAT: the
Medical Concept Annotation Toolkit},
journal = {CoRR},
volume = {abs/2010.01165},
year = {2020},
url = {https://arxiv.org/abs/2010.01165},
eprinttype = {arXiv},
eprint = {2010.01165},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-01165.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cma/IbanezLVORH19,
author = {Daniel Ibanez and
E. Love and
Thomas E. Voth and
James R. Overfelt and
Nathan V. Roberts and
Glen Hansen},
title = {Tetrahedral mesh adaptation for Lagrangian shock hydrodynamics},
journal = {Comput. Math. Appl.},
volume = {78},
number = {2},
pages = {402--416},
year = {2019},
url = {https://doi.org/10.1016/j.camwa.2018.06.013},
doi = {10.1016/J.CAMWA.2018.06.013},
timestamp = {Fri, 25 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cma/IbanezLVORH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/JacksonRNWNA19,
author = {Elise K. Jackson and
Wade Roberts and
Benjamin Nelsen and
Gustavious P. Williams and
E. James Nelson and
Daniel P. Ames},
title = {Introductory overview: Error metrics for hydrologic modelling - {A}
review of common practices and an open source library to facilitate
use and adoption},
journal = {Environ. Model. Softw.},
volume = {119},
pages = {32--48},
year = {2019},
url = {https://doi.org/10.1016/j.envsoft.2019.05.001},
doi = {10.1016/J.ENVSOFT.2019.05.001},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/envsoft/JacksonRNWNA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/QiaoNALDWRLESM19,
author = {Xiaohui Qiao and
E. James Nelson and
Daniel P. Ames and
Zhiyu Li and
C{\'{e}}dric H. David and
Gustavious P. Williams and
Wade Roberts and
Jorge Luis S{\'{a}}nchez Lozano and
Chris Edwards and
Michael Souffront and
Mir A. Matin},
title = {A systems approach to routing global gridded runoff through local
high-resolution stream networks for flood early warning systems},
journal = {Environ. Model. Softw.},
volume = {120},
year = {2019},
url = {https://doi.org/10.1016/j.envsoft.2019.104501},
doi = {10.1016/J.ENVSOFT.2019.104501},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/envsoft/QiaoNALDWRLESM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/frai/JamesSKR19,
author = {Lachlan P. James and
Alice J. Sweeting and
Vincent G. Kelly and
Samuel Robertson},
title = {Longitudinal Analysis of Tactical Strategy in the Men's Division of
the Ultimate Fighting Championship},
journal = {Frontiers Artif. Intell.},
volume = {2},
pages = {29},
year = {2019},
url = {https://doi.org/10.3389/frai.2019.00029},
doi = {10.3389/FRAI.2019.00029},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/frai/JamesSKR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/PopescuBSGWJCPG19,
author = {Dorin{-}Mirel Popescu and
Rachel A. Botting and
Emily Stephenson and
Kile Green and
Simone Webb and
Laura Jardine and
Emily F. Calderbank and
Krzysztof Polanski and
Issac Goh and
Mirjana Efremova and
Meghan Acres and
Daniel Maunder and
Peter Vegh and
Yorick Gitton and
Jong{-}Eun Park and
Roser Vento{-}Tormo and
Zhichao Miao and
David Dixon and
Rachel Rowell and
David McDonald and
James Fletcher and
Elizabeth Poyner and
Gary Reynolds and
Michael Mather and
Corina Moldovan and
Lira Mamanova and
Frankie Greig and
Matthew D. Young and
Kerstin B. Meyer and
Steven Lisgo and
Jaume Bacardit and
Andrew Fuller and
Ben Millar and
Barbara Innes and
Susan Lindsay and
Michael J. T. Stubbington and
Monika S. Kowalczyk and
Bo Li and
Orr Ashenberg and
Marcin Tabaka and
Danielle Dionne and
Timothy L. Tickle and
Michal Slyper and
Orit Rozenblatt{-}Rosen and
Andrew Filby and
Peter Carey and
Alexandra{-}Chlo{\'{e}} Villani and
Anindita Roy and
Aviv Regev and
Alain Ch{\'{e}}dotal and
Irene Roberts and
Berthold G{\"{o}}ttgens and
Sam Behjati and
Elisa Laurenti and
Sarah A. Teichmann and
Muzlifah Haniffa},
title = {Decoding human fetal liver haematopoiesis},
journal = {Nat.},
volume = {574},
number = {7778},
pages = {365--371},
year = {2019},
url = {https://doi.org/10.1038/s41586-019-1652-y},
doi = {10.1038/S41586-019-1652-Y},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/PopescuBSGWJCPG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BarryTHBRLBBBM19,
author = {Daniel N. Barry and
Tim M. Tierney and
Niall Holmes and
Elena Boto and
Gillian Roberts and
James Leggett and
Richard Bowtell and
Matthew J. Brookes and
Gareth R. Barnes and
Eleanor A. Maguire},
title = {Imaging the human hippocampus with optically-pumped magnetoencephalography},
journal = {NeuroImage},
volume = {203},
year = {2019},
url = {https://doi.org/10.1016/j.neuroimage.2019.116192},
doi = {10.1016/J.NEUROIMAGE.2019.116192},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/BarryTHBRLBBBM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BotoSHLHRSFMTBB19,
author = {Elena Boto and
Zelekha A. Seedat and
Niall Holmes and
James Leggett and
Ryan M. Hill and
Gillian Roberts and
Vishal Shah and
T. Mark Fromhold and
Karen J. Mullinger and
Tim M. Tierney and
Gareth R. Barnes and
Richard Bowtell and
Matthew J. Brookes},
title = {Wearable neuroimaging: Combining and contrasting magnetoencephalography
and electroencephalography},
journal = {NeuroImage},
volume = {201},
year = {2019},
url = {https://doi.org/10.1016/j.neuroimage.2019.116099},
doi = {10.1016/J.NEUROIMAGE.2019.116099},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/BotoSHLHRSFMTBB19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/RobertsHABLHSRV19,
author = {Gillian Roberts and
Niall Holmes and
Nicholas Alexander and
Elena Boto and
James Leggett and
Ryan M. Hill and
Vishal Shah and
Molly Rea and
Richard Vaughan and
Eleanor A. Maguire and
Klaus Kessler and
Shaun Beebe and
T. Mark Fromhold and
Gareth R. Barnes and
Richard Bowtell and
Matthew J. Brookes},
title = {Towards {OPM-MEG} in a virtual reality environment},
journal = {NeuroImage},
volume = {199},
pages = {408--417},
year = {2019},
url = {https://doi.org/10.1016/j.neuroimage.2019.06.010},
doi = {10.1016/J.NEUROIMAGE.2019.06.010},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/RobertsHABLHSRV19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/TierneyHMLRHBLS19,
author = {Tim M. Tierney and
Niall Holmes and
Stephanie Mellor and
Jos{\'{e}} David L{\'{o}}pez and
Gillian Roberts and
Ryan M. Hill and
Elena Boto and
James Leggett and
Vishal Shah and
Matthew J. Brookes and
Richard Bowtell and
Gareth R. Barnes},
title = {Optically pumped magnetometers: From quantum origins to multi-channel
magnetoencephalography},
journal = {NeuroImage},
volume = {199},
pages = {598--608},
year = {2019},
url = {https://doi.org/10.1016/j.neuroimage.2019.05.063},
doi = {10.1016/J.NEUROIMAGE.2019.05.063},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/TierneyHMLRHBLS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmc/SthapitTRH19,
author = {Saurav Sthapit and
John Thompson and
Neil M. Robertson and
James R. Hopgood},
title = {Computational Load Balancing on the Edge in Absence of Cloud and Fog},
journal = {{IEEE} Trans. Mob. Comput.},
volume = {18},
number = {7},
pages = {1499--1512},
year = {2019},
url = {https://doi.org/10.1109/TMC.2018.2863301},
doi = {10.1109/TMC.2018.2863301},
timestamp = {Sat, 20 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmc/SthapitTRH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ahfe/AuflickSER19,
author = {Jack L. Auflick and
James K. Sprague and
Joseph T. Eganhouse and
Julius M. Roberts},
editor = {Neville A. Stanton},
title = {Forensic Analyses of Rumble Strips and Truck Conspicuity},
booktitle = {Advances in Human Factors of Transportation - Proceedings of the {AHFE}
2019 International Conference on Human Factors in Transportation,
Washington, DC, USA, July 24-28, 2019},
series = {Advances in Intelligent Systems and Computing},
volume = {964},
pages = {499--509},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-20503-4\_45},
doi = {10.1007/978-3-030-20503-4\_45},
timestamp = {Thu, 30 Sep 2021 13:54:49 +0200},
biburl = {https://dblp.org/rec/conf/ahfe/AuflickSER19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/FigueredoSPEGNT19,
author = {Grazziela P. Figueredo and
Peng Shi and
Andrew J. Parkes and
Keith Evans and
Jonathan M. Garibaldi and
Ola Negm and
Patrick James Tighe and
Herbert F. Sewell and
John Robertson},
title = {A Hybrid Evolutionary Strategy to Optimise Early-Stage Cancer Screening},
booktitle = {{IEEE} Congress on Evolutionary Computation, {CEC} 2019, Wellington,
New Zealand, June 10-13, 2019},
pages = {95--102},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/CEC.2019.8790316},
doi = {10.1109/CEC.2019.8790316},
timestamp = {Tue, 10 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cec/FigueredoSPEGNT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conext/ZhangLGGIR19,
author = {Tianzhu Zhang and
Leonardo Linguaglossa and
Massimo Gallo and
Paolo Giaccone and
Luigi Iannone and
James Roberts},
editor = {Aziz Mohaisen and
Zhi{-}Li Zhang},
title = {Comparing the performance of state-of-the-art software switches for
{NFV}},
booktitle = {Proceedings of the 15th International Conference on Emerging Networking
Experiments And Technologies, CoNEXT 2019, Orlando, FL, USA, December
09-12, 2019},
pages = {68--81},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3359989.3365415},
doi = {10.1145/3359989.3365415},
timestamp = {Mon, 09 Dec 2019 14:08:31 +0100},
biburl = {https://dblp.org/rec/conf/conext/ZhangLGGIR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/RobertsMH019,
author = {Richard Roberts and
Stefan Marr and
Michael Homer and
James Noble},
editor = {Alastair F. Donaldson},
title = {Transient Typechecks Are (Almost) Free},
booktitle = {33rd European Conference on Object-Oriented Programming, {ECOOP} 2019,
July 15-19, 2019, London, United Kingdom},
series = {LIPIcs},
volume = {134},
pages = {5:1--5:28},
publisher = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
year = {2019},
url = {https://doi.org/10.4230/LIPIcs.ECOOP.2019.5},
doi = {10.4230/LIPICS.ECOOP.2019.5},
timestamp = {Tue, 11 Feb 2020 15:52:14 +0100},
biburl = {https://dblp.org/rec/conf/ecoop/RobertsMH019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/KirkL19,
author = {James R. Kirk and
John E. Laird},
editor = {Sarit Kraus},
title = {Learning Hierarchical Symbolic Representations to Support Interactive
Task Learning and Knowledge Transfer},
booktitle = {Proceedings of the Twenty-Eighth International Joint Conference on
Artificial Intelligence, {IJCAI} 2019, Macao, China, August 10-16,
2019},
pages = {6095--6102},
publisher = {ijcai.org},
year = {2019},
url = {https://doi.org/10.24963/ijcai.2019/844},
doi = {10.24963/IJCAI.2019/844},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ijcai/KirkL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismir/HuangHRDWHH19,
author = {Cheng{-}Zhi Anna Huang and
Curtis Hawthorne and
Adam Roberts and
Monica Dinculescu and
James Wexler and
Leon Hong and
Jacob Howcroft},
editor = {Arthur Flexer and
Geoffroy Peeters and
Juli{\'{a}}n Urbano and
Anja Volk},
title = {Approachable Music Composition with Machine Learning at Scale},
booktitle = {Proceedings of the 20th International Society for Music Information
Retrieval Conference, {ISMIR} 2019, Delft, The Netherlands, November
4-8, 2019},
pages = {793--800},
year = {2019},
url = {http://archives.ismir.net/ismir2019/paper/000097.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ismir/HuangHRDWHH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/netsoft/ZhangLRIGG19,
author = {Tianzhu Zhang and
Leonardo Linguaglossa and
James Roberts and
Luigi Iannone and
Massimo Gallo and
Paolo Giaccone},
editor = {Christian Jacquenet and
Filip De Turck and
Prosper Chemouil and
Flavio Esposito and
Olivier Festor and
Walter Cerroni and
Stefano Secci},
title = {A benchmarking methodology for evaluating software switch performance
for {NFV}},
booktitle = {5th {IEEE} Conference on Network Softwarization, NetSoft 2019, Paris,
France, June 24-28, 2019},
pages = {251--253},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/NETSOFT.2019.8806695},
doi = {10.1109/NETSOFT.2019.8806695},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/netsoft/ZhangLRIGG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/networking/AhmadiRLM19,
author = {Mahdieh Ahmadi and
James Roberts and
Emilio Leonardi and
Ali Movaghar},
title = {Poster: Impact of traffic characteristics on request aggregation in
an {NDN} router},
booktitle = {2019 {IFIP} Networking Conference, Networking 2019, Warsaw, Poland,
May 20-22, 2019},
pages = {1--2},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.23919/IFIPNetworking46909.2019.8999462},
doi = {10.23919/IFIPNETWORKING46909.2019.8999462},
timestamp = {Wed, 12 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/networking/AhmadiRLM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/Gariano0MH019,
author = {Isaac Oscar Gariano and
Richard Roberts and
Stefan Marr and
Michael Homer and
James Noble},
editor = {Daniele Bonetta and
Yu David Liu},
title = {Which of my transient type checks are not (almost) free?},
booktitle = {Proceedings of the 11th {ACM} {SIGPLAN} International Workshop on
Virtual Machines and Intermediate Languages, VMIL@SPLASH 2019, Athens,
Greece, October 22, 2019},
pages = {58--66},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3358504.3361232},
doi = {10.1145/3358504.3361232},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/Gariano0MH019.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tpcg/JacksonRR19,
author = {James Jackson and
Panagiotis D. Ritsos and
Jonathan C. Roberts},
editor = {Franck P. Vidal and
Gary K. L. Tam and
Jonathan C. Roberts},
title = {Towards a Tool for the Creation of Micro-visualisations},
booktitle = {Computer Graphics {\&} Visual Computing, {CGVC} 2019, Bangor,
UK, September 12-13, 2019},
pages = {141--145},
publisher = {Eurographics Association},
year = {2019},
url = {https://doi.org/10.2312/cgvc.20191270},
doi = {10.2312/CGVC.20191270},
timestamp = {Wed, 29 Apr 2020 12:18:40 +0200},
biburl = {https://dblp.org/rec/conf/tpcg/JacksonRR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1903-06419,
author = {Mahdieh Ahmadi and
James Roberts and
Emilio Leonardi and
Ali Movaghar},
title = {Impact of Traffic Characteristics on Request Aggregation in an {NDN}
Router},
journal = {CoRR},
volume = {abs/1903.06419},
year = {2019},
url = {http://arxiv.org/abs/1903.06419},
eprinttype = {arXiv},
eprint = {1903.06419},
timestamp = {Wed, 12 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1903-06419.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-06637,
author = {Cheng{-}Zhi Anna Huang and
Curtis Hawthorne and
Adam Roberts and
Monica Dinculescu and
James Wexler and
Leon Hong and
Jacob Howcroft},
title = {The Bach Doodle: Approachable music composition with machine learning
at scale},
journal = {CoRR},
volume = {abs/1907.06637},
year = {2019},
url = {http://arxiv.org/abs/1907.06637},
eprinttype = {arXiv},
eprint = {1907.06637},
timestamp = {Tue, 23 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1907-06637.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1908-06659,
author = {Mahdieh Ahmadi and
James Roberts and
Emilio Leonardi and
Ali Movaghar},
title = {Cache Subsidies for an Optimal Memory for Bandwidth Tradeoff in the
Access Network},
journal = {CoRR},
volume = {abs/1908.06659},
year = {2019},
url = {http://arxiv.org/abs/1908.06659},
eprinttype = {arXiv},
eprint = {1908.06659},
timestamp = {Wed, 12 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1908-06659.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-05581,
author = {Isaac Oscar Gariano and
Richard Roberts and
Stefan Marr and
Michael Homer and
James Noble},
title = {Which of My Transient Type Checks Are Not (Almost) Free?},
journal = {CoRR},
volume = {abs/1909.05581},
year = {2019},
url = {http://arxiv.org/abs/1909.05581},
eprinttype = {arXiv},
eprint = {1909.05581},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-05581.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aci/BurlisonMBHRHH18,
author = {Jonathan D. Burlison and
Robert B. McDaniel and
Donald K. Baker and
Murad Hasan and
Jennifer Robertson and
Scott C. Howard and
James M. Hoffman},
title = {Using {EHR} Data to Detect Prescribing Errors in Rapidly Discontinued
Medication Orders},
journal = {Appl. Clin. Inform.},
volume = {09},
number = {01},
pages = {82--88},
year = {2018},
url = {https://doi.org/10.1055/s-0037-1621703},
doi = {10.1055/S-0037-1621703},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aci/BurlisonMBHRHH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/MagerkoBBDMORRS18,
author = {Brian Magerko and
Julio C{\'{e}}sar Baham{\'{o}}n and
Michael Buro and
Rossana Damiano and
Jo Mazeika and
Santiago Onta{\~{n}}{\'{o}}n and
Justus Robertson and
James Ryan and
Kristin Siu},
title = {The 13th {AAAI} Conference on Artificial Intelligence and Interactive
Digital Entertainment},
journal = {{AI} Mag.},
volume = {39},
number = {2},
pages = {75--78},
year = {2018},
url = {https://doi.org/10.1609/aimag.v39i2.2798},
doi = {10.1609/AIMAG.V39I2.2798},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/MagerkoBBDMORRS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/caee/NowostawskiMM18,
author = {Mariusz Nowostawski and
Simon McCallum and
Deepti Mishra},
title = {Gamifying research in software engineering},
journal = {Comput. Appl. Eng. Educ.},
volume = {26},
number = {5},
pages = {1641--1652},
year = {2018},
url = {https://doi.org/10.1002/cae.21994},
doi = {10.1002/CAE.21994},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/caee/NowostawskiMM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dsj/BurnsRPBC18,
author = {A. J. Burns and
Tom L. Roberts and
Clay Posey and
Rebecca J. Bennett and
James F. Courtney},
title = {Intentions to Comply Versus Intentions to Protect: {A} {VIE} Theory
Approach to Understanding the Influence of Insiders' Awareness of
Organizational {SETA} Efforts},
journal = {Decis. Sci.},
volume = {49},
number = {6},
pages = {1187--1228},
year = {2018},
url = {https://doi.org/10.1111/deci.12304},
doi = {10.1111/DECI.12304},
timestamp = {Sat, 18 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dsj/BurnsRPBC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhci/DavidRC18,
author = {Meredith E. David and
James A. Roberts and
Brett Christenson},
title = {Too Much of a Good Thing: Investigating the Association between Actual
Smartphone Use and Individual Well-Being},
journal = {Int. J. Hum. Comput. Interact.},
volume = {34},
number = {3},
pages = {265--275},
year = {2018},
url = {https://doi.org/10.1080/10447318.2017.1349250},
doi = {10.1080/10447318.2017.1349250},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhci/DavidRC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/WuTMIFJKASGGRBS18,
author = {Honghan Wu and
Giulia Toti and
Katherine I. Morley and
Zina M. Ibrahim and
Amos Folarin and
Richard G. Jackson and
Ismail Emre Kartoglu and
Asha Agrawal and
Clive Stringer and
Darren Gale and
Genevieve Gorrell and
Angus Roberts and
Matthew T. M. Broadbent and
Robert Stewart and
Richard J. B. Dobson},
title = {SemEHR: {A} general-purpose semantic search system to surface semantic
data from clinical notes for tailored care, trial recruitment, and
clinical research},
journal = {J. Am. Medical Informatics Assoc.},
volume = {25},
number = {5},
pages = {530--537},
year = {2018},
url = {https://doi.org/10.1093/jamia/ocx160},
doi = {10.1093/JAMIA/OCX160},
timestamp = {Mon, 09 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/WuTMIFJKASGGRBS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/VelupillaiSLRSM18,
author = {Sumithra Velupillai and
Hanna Suominen and
Maria Liakata and
Angus Roberts and
Anoop D. Shah and
Katherine Morley and
David Osborn and
Joseph Hayes and
Robert Stewart and
Johnny Downs and
Wendy W. Chapman and
Rina Dutta},
title = {Using clinical Natural Language Processing for health outcomes research:
Overview and actionable suggestions for future advances},
journal = {J. Biomed. Informatics},
volume = {88},
pages = {11--19},
year = {2018},
url = {https://doi.org/10.1016/j.jbi.2018.10.005},
doi = {10.1016/J.JBI.2018.10.005},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jbi/VelupillaiSLRSM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/JacksonKSGRSWAL18,
author = {Richard G. Jackson and
Ismail Emre Kartoglu and
Clive Stringer and
Genevieve Gorrell and
Angus Roberts and
Xingyi Song and
Honghan Wu and
Asha Agrawal and
Kenneth Lui and
Tudor Groza and
Damian Lewsley and
Doug Northwood and
Amos Folarin and
Robert Stewart and
Richard J. B. Dobson},
title = {CogStack - experiences of deploying integrated information retrieval
and extraction services in a large National Health Service Foundation
Trust hospital},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {18},
number = {1},
pages = {47:1--47:13},
year = {2018},
url = {https://doi.org/10.1186/s12911-018-0623-9},
doi = {10.1186/S12911-018-0623-9},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/JacksonKSGRSWAL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/SunMPSSBBJPSOKP18,
author = {Benjamin B. Sun and
Joseph C. Maranville and
James E. Peters and
David Stacey and
James R. Staley and
James A. Blackshaw and
Stephen Burgess and
Tao Jiang and
Ellie Paige and
Praveen Surendran and
Clare Oliver{-}Williams and
Mihir A. Kamat and
Bram P. Prins and
Sheri K. Wilcox and
Erik S. Zimmerman and
An Chi and
Narinder Bansal and
Sarah L. Spain and
Angela M. Wood and
Nicholas W. Morrell and
John R. Bradley and
Nebojsa Janjic and
David J. Roberts and
Willem H. Ouwehand and
John A. Todd and
Nicole Soranzo and
Karsten Suhre and
Dirk S. Paul and
Caroline S. Fox and
Robert M. Plenge and
John Danesh and
Heiko Runz and
Adam S. Butterworth},
title = {Genomic atlas of the human plasma proteome},
journal = {Nat.},
volume = {558},
number = {7708},
pages = {73--79},
year = {2018},
url = {https://doi.org/10.1038/s41586-018-0175-2},
doi = {10.1038/S41586-018-0175-2},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/SunMPSSBBJPSOKP18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HolmesLBRHTSBBB18,
author = {Niall Holmes and
James Leggett and
Elena Boto and
Gillian Roberts and
Ryan M. Hill and
Tim M. Tierney and
Vishal Shah and
Gareth R. Barnes and
Matthew J. Brookes and
Richard Bowtell},
title = {A bi-planar coil system for nulling background magnetic fields in
scalp mounted magnetoencephalography},
journal = {NeuroImage},
volume = {181},
pages = {760--774},
year = {2018},
url = {https://doi.org/10.1016/j.neuroimage.2018.07.028},
doi = {10.1016/J.NEUROIMAGE.2018.07.028},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/HolmesLBRHTSBBB18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/TierneyHMBRLBDL18,
author = {Tim M. Tierney and
Niall Holmes and
Sofie S. Meyer and
Elena Boto and
Gillian Roberts and
James Leggett and
Sarah Buck and
Leonardo Duque{-}Mu{\~{n}}oz and
Vladimir Litvak and
Sven Bestmann and
Torsten Baldeweg and
Richard Bowtell and
Matthew J. Brookes and
Gareth R. Barnes},
title = {Cognitive neuroscience using wearable magnetometer arrays: Non-invasive
assessment of language function},
journal = {NeuroImage},
volume = {181},
pages = {513--520},
year = {2018},
url = {https://doi.org/10.1016/j.neuroimage.2018.07.035},
doi = {10.1016/J.NEUROIMAGE.2018.07.035},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/TierneyHMBRLBDL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pajais/HuangfuHMR18,
author = {Luwen Huangfu and
Stephen C. Hayne and
James Ma and
Nicholas H. Roberts},
title = {Exploratory Analysis of Out-of-Hospital Days Based on Cancer Patients
in China},
journal = {Pac. Asia J. Assoc. Inf. Syst.},
volume = {10},
number = {4},
pages = {6},
year = {2018},
url = {https://aisel.aisnet.org/pajais/vol10/iss4/6},
timestamp = {Thu, 26 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pajais/HuangfuHMR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/synthese/RobertsAS18,
author = {Pendaran Roberts and
James Andow and
Kelly Ann Schmidtke},
title = {Lay intuitions about epistemic normativity},
journal = {Synth.},
volume = {195},
number = {7},
pages = {3267--3287},
year = {2018},
url = {https://doi.org/10.1007/s11229-017-1371-6},
doi = {10.1007/S11229-017-1371-6},
timestamp = {Thu, 09 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/synthese/RobertsAS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tetci/PengMLLRT18,
author = {Bei Peng and
James MacGlashan and
Robert Tyler Loftin and
Michael L. Littman and
David L. Roberts and
Matthew E. Taylor},
title = {Curriculum Design for Machine Learners in Sequential Decision Tasks},
journal = {{IEEE} Trans. Emerg. Top. Comput. Intell.},
volume = {2},
number = {4},
pages = {268--277},
year = {2018},
url = {https://doi.org/10.1109/TETCI.2018.2829980},
doi = {10.1109/TETCI.2018.2829980},
timestamp = {Sun, 18 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tetci/PengMLLRT18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/RobertsRJH18,
author = {Jonathan C. Roberts and
Panagiotis D. Ritsos and
James R. Jackson and
Christopher James Headleand},
title = {The Explanatory Visualization Framework: An Active Learning Framework
for Teaching Creative Computing Using Explanatory Visualizations},
journal = {{IEEE} Trans. Vis. Comput. Graph.},
volume = {24},
number = {1},
pages = {791--801},
year = {2018},
url = {https://doi.org/10.1109/TVCG.2017.2745878},
doi = {10.1109/TVCG.2017.2745878},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvcg/RobertsRJH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcis/HuangfuHMR18,
author = {Luwen Huangfu and
Stephen C. Hayne and
James Ma and
Nicholas H. Roberts},
title = {Exploratory Study for Readmission in Cancer Patients},
booktitle = {24th Americas Conference on Information Systems, {AMCIS} 2018, New
Orleans, LA, USA, August 16-18, 2018},
publisher = {Association for Information Systems},
year = {2018},
url = {https://aisel.aisnet.org/amcis2018/Health/Presentations/23},
timestamp = {Thu, 26 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/amcis/HuangfuHMR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/animalci/HrolenokBBRKRGW18,
author = {Brian Hrolenok and
Tucker Balch and
David Byrd and
Rebecca Roberts and
Chanho Kim and
James M. Rehg and
Scott Gilliland and
Kim Wallen},
editor = {Melody Moore Jackson and
Clara Mancini},
title = {Use of position tracking to infer social structure in rhesus macaques},
booktitle = {Proceedings of the Fifth International Conference on Animal-Computer
Interaction, {ACI} 2018, Atlanta, GA, USA, December 4-6, 2018},
pages = {15:1--15:5},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3295598.3295613},
doi = {10.1145/3295598.3295613},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/animalci/HrolenokBBRKRGW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ei-mobmu/RuschenMKC18,
author = {Raoul van R{\"{u}}schen and
Simon McCallum and
Stefan Kim and
Reiner Creutzburg},
editor = {David Akopian and
Reiner Creutzburg},
title = {Volumetric Terrain Rendering with WebGL},
booktitle = {Mobile Devices and Multimedia: Enabling Technologies, Algorithms,
and Applications 2018, Burlingame, CA, USA, January 28 - February
1, 2018},
pages = {1--14},
publisher = {Society for Imaging Science and Technology},
year = {2018},
url = {https://doi.org/10.2352/ISSN.2470-1173.2018.06.MOBMU-136},
doi = {10.2352/ISSN.2470-1173.2018.06.MOBMU-136},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ei-mobmu/RuschenMKC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/FosterBHDEEGSED18,
author = {Marc Foster and
Eric Beppler and
Timothy Holder and
James Dieffenderfer and
Patrick D. Erb and
Kristy Everette and
Margaret Gruen and
Tamara Somers and
Tom Evans and
Michael A. Daniele and
David L. Roberts and
Alper Bozkurt},
title = {A System for Assessment of Canine-Human Interaction during Animal-Assisted
Therapies},
booktitle = {40th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2018, Honolulu, HI, USA, July
18-21, 2018},
pages = {4347--4350},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/EMBC.2018.8513384},
doi = {10.1109/EMBC.2018.8513384},
timestamp = {Thu, 24 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/FosterBHDEEGSED18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpsr/GongRR18,
author = {YiXi Gong and
James Roberts and
Dario Rossi},
title = {Per-Flow Fairness in the Datacenter Network},
booktitle = {{IEEE} 19th International Conference on High Performance Switching
and Routing, {HPSR} 2018, Bucharest, Romania, June 18-20, 2018},
pages = {1--6},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/HPSR.2018.8850759},
doi = {10.1109/HPSR.2018.8850759},
timestamp = {Fri, 24 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpsr/GongRR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/i2mtc/RobertsA18,
author = {James Roberts and
Alaeddin S. A. Abuabed},
title = {Software enabled pseudo-random pattern generator},
booktitle = {{IEEE} International Instrumentation and Measurement Technology Conference,
{I2MTC} 2018, Houston, TX, USA, May 14-17, 2018},
pages = {1--6},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/I2MTC.2018.8409847},
doi = {10.1109/I2MTC.2018.8409847},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/i2mtc/RobertsA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/LangstonSSER18,
author = {James Langston and
Karl Schoder and
Michael Steurer and
Chris S. Edrington and
Rodney G. Roberts},
title = {Analysis of Linear Interface Algorithms for Power Hardware- in - the-
Loop Simulation},
booktitle = {{IECON} 2018 - 44th Annual Conference of the {IEEE} Industrial Electronics
Society, Washington, DC, USA, October 21-23, 2018},
pages = {4005--4012},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/IECON.2018.8591497},
doi = {10.1109/IECON.2018.8591497},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/iecon/LangstonSSER18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/its/MudrickSPLRA18,
author = {Nicholas V. Mudrick and
Robert Sawyer and
Megan J. Price and
James C. Lester and
Candice Roberts and
Roger Azevedo},
editor = {Roger Nkambou and
Roger Azevedo and
Julita Vassileva},
title = {Identifying How Metacognitive Judgments Influence Student Performance
During Learning with MetaTutorIVH},
booktitle = {Intelligent Tutoring Systems - 14th International Conference, {ITS}
2018, Montreal, QC, Canada, June 11-15, 2018, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {10858},
pages = {140--149},
publisher = {Springer},
year = {2018},
url = {https://doi.org/10.1007/978-3-319-91464-0\_14},
doi = {10.1007/978-3-319-91464-0\_14},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/its/MudrickSPLRA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/networking/AddankiLRR18,
author = {Vamsi Addanki and
Leonardo Linguaglossa and
James Roberts and
Dario Rossi},
editor = {Claudio Casetti and
Fernando A. Kuipers and
James P. G. Sterbenz and
Burkhard Stiller},
title = {Controlling Software Router Resource Sharing by Fair Packet Dropping},
booktitle = {2018 {IFIP} Networking Conference and Workshops, Networking 2018,
Zurich, Switzerland, May 14-16, 2018},
pages = {388--396},
publisher = {{IFIP}},
year = {2018},
url = {http://dl.ifip.org/db/conf/networking/networking2018/6B3-1570418849.pdf},
doi = {10.23919/IFIPNETWORKING.2018.8696549},
timestamp = {Thu, 27 Jun 2024 12:35:50 +0200},
biburl = {https://dblp.org/rec/conf/networking/AddankiLRR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/AddankiLRR18,
author = {Vamsi Addanki and
Leonardo Linguaglossa and
James Roberts and
Dario Rossi},
title = {Fair dropping for multi-resource fairness in software routers Extended
Abstract},
booktitle = {Proceedings of the {ACM} {SIGCOMM} 2018 Conference on Posters and
Demos, {SIGCOMM} 2018, Budapest, Hungary, August 20-25, 2018},
pages = {132--134},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3234200.3234210},
doi = {10.1145/3234200.3234210},
timestamp = {Fri, 24 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigcomm/AddankiLRR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1807-00661,
author = {Richard Roberts and
Stefan Marr and
Michael Homer and
James Noble},
title = {Shallow Types for Insightful Programs: Grace is Optional, Performance
is Not},
journal = {CoRR},
volume = {abs/1807.00661},
year = {2018},
url = {http://arxiv.org/abs/1807.00661},
eprinttype = {arXiv},
eprint = {1807.00661},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1807-00661.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chb/RobertsD17,
author = {James A. Roberts and
Meredith E. David},
title = {Put down your phone and listen to me: How boss phubbing undermines
the psychological conditions necessary for employee engagement},
journal = {Comput. Hum. Behav.},
volume = {75},
pages = {206--217},
year = {2017},
url = {https://doi.org/10.1016/j.chb.2017.05.021},
doi = {10.1016/J.CHB.2017.05.021},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/chb/RobertsD17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/expert/LairdGAFJLSSTTW17,
author = {John E. Laird and
Kevin A. Gluck and
John R. Anderson and
Kenneth D. Forbus and
Odest Chadwicke Jenkins and
Christian Lebiere and
Dario D. Salvucci and
Matthias Scheutz and
Andrea Thomaz and
J. Gregory Trafton and
Robert E. Wray and
Shiwali Mohan and
James R. Kirk},
title = {Interactive Task Learning},
journal = {{IEEE} Intell. Syst.},
volume = {32},
number = {4},
pages = {6--21},
year = {2017},
url = {https://doi.org/10.1109/MIS.2017.3121552},
doi = {10.1109/MIS.2017.3121552},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/expert/LairdGAFJLSSTTW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isf/BurnsPCRN17,
author = {A. J. Burns and
Clay Posey and
James F. Courtney and
Tom L. Roberts and
Prabhashi Nanayakkara},
title = {Organizational information security as a complex adaptive system:
insights from three agent-based models},
journal = {Inf. Syst. Frontiers},
volume = {19},
number = {3},
pages = {509--524},
year = {2017},
url = {https://doi.org/10.1007/s10796-015-9608-8},
doi = {10.1007/S10796-015-9608-8},
timestamp = {Sat, 18 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/isf/BurnsPCRN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/AndersonKWRRBC17,
author = {Brian A. Anderson and
Hiroto Kuwabara and
Dean F. Wong and
Joshua Roberts and
Arman Rahmim and
James R. Brasic and
Susan M. Courtney},
title = {Linking dopaminergic reward signals to the development of attentional
bias: {A} positron emission tomographic study},
journal = {NeuroImage},
volume = {157},
pages = {27--33},
year = {2017},
url = {https://doi.org/10.1016/j.neuroimage.2017.05.062},
doi = {10.1016/J.NEUROIMAGE.2017.05.062},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/AndersonKWRRBC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/GolloRC17,
author = {Leonardo L. Gollo and
James A. Roberts and
Luca Cocchi},
title = {Mapping how local perturbations influence systems-level brain dynamics},
journal = {NeuroImage},
volume = {160},
pages = {97--112},
year = {2017},
url = {https://doi.org/10.1016/j.neuroimage.2017.01.057},
doi = {10.1016/J.NEUROIMAGE.2017.01.057},
timestamp = {Wed, 30 Oct 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/GolloRC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/MikkelsenBBBBCC17,
author = {Mark Mikkelsen and
Peter B. Barker and
Pallab K. Bhattacharyya and
Maiken K. Brix and
Pieter F. Buur and
Kim M. Cecil and
Kimberly L. Chan and
David Y.{-}T. Chen and
Alexander R. Craven and
Koen Cuypers and
Michael Dacko and
Niall W. Duncan and
Ulrike Dydak and
David A. Edmondson and
Gabriele Ende and
Lars Ersland and
Fei Gao and
Ian Greenhouse and
Ashley D. Harris and
Naying He and
Stefanie Heba and
Nigel Hoggard and
Tun{-}Wei Hsu and
Jacobus F. A. Jansen and
Alayar Kangarlu and
Thomas Lange and
R. Marc Lebel and
Yan Li and
Chien{-}Yuan Lin and
Jy{-}Kang Liou and
Jiing{-}Feng Lirng and
Feng Liu and
Ruoyun Ma and
Celine Maes and
Marta Moreno{-}Ortega and
Scott O. Murray and
Sean Noah and
Ralph Noeske and
Michael D. Noseworthy and
Georg Oeltzschner and
James J. Prisciandaro and
Nicolaas A. J. Puts and
Timothy P. L. Roberts and
Markus Sack and
Napapon Sailasuta and
Muhammad G. Saleh and
Michael{-}Paul Schallmo and
Nicholas Simard and
Stephan P. Swinnen and
Martin Tegenthoff and
Peter Truong and
Guangbin Wang and
Iain D. Wilkinson and
Hans{-}J{\"{o}}rg Wittsack and
Hongmin Xu and
Fuhua Yan and
Chencheng Zhang and
Vadim Zipunnikov and
Helge J. Z{\"{o}}llner and
Richard A. E. Edden},
title = {Big {GABA:} Edited {MR} spectroscopy at 24 research sites},
journal = {NeuroImage},
volume = {159},
pages = {32--45},
year = {2017},
url = {https://doi.org/10.1016/j.neuroimage.2017.07.021},
doi = {10.1016/J.NEUROIMAGE.2017.07.021},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/MikkelsenBBBBCC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/RobertsPRMB17,
author = {James A. Roberts and
Alistair Perry and
Gloria M. P. Roberts and
Philip B. Mitchell and
Michael Breakspear},
title = {Consistency-based thresholding of the human connectome},
journal = {NeuroImage},
volume = {145},
pages = {118--129},
year = {2017},
url = {https://doi.org/10.1016/j.neuroimage.2016.09.053},
doi = {10.1016/J.NEUROIMAGE.2016.09.053},
timestamp = {Wed, 30 Oct 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/RobertsPRMB17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nms/Allen-Robertson17,
author = {James Allen{-}Robertson},
title = {The materiality of digital media: The hard disk drive, phonograph,
magnetic tape and optical media in technical close-up},
journal = {New Media Soc.},
volume = {19},
number = {3},
pages = {455--470},
year = {2017},
url = {https://doi.org/10.1177/1461444815606368},
doi = {10.1177/1461444815606368},
timestamp = {Thu, 17 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nms/Allen-Robertson17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaifs/CastroRMB17,
author = {Brenda Castro and
Montana Roberts and
Karla Mena and
Jim Boerkoel},
title = {Who Takes the Lead? Automated Scheduling for Human-Robot Teams},
booktitle = {2017 {AAAI} Fall Symposia, Arlington, Virginia, USA, November 9-11,
2017},
pages = {85--89},
publisher = {{AAAI} Press},
year = {2017},
url = {https://aaai.org/ocs/index.php/FSS/FSS17/paper/view/15964},
timestamp = {Tue, 13 Nov 2018 19:43:23 +0100},
biburl = {https://dblp.org/rec/conf/aaaifs/CastroRMB17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/LindesMKL17,
author = {Peter Lindes and
Aaron Mininger and
James R. Kirk and
John E. Laird},
editor = {Mohit Bansal and
Cynthia Matuszek and
Jacob Andreas and
Yoav Artzi and
Yonatan Bisk},
title = {Grounding Language for Interactive Task Learning},
booktitle = {Proceedings of the First Workshop on Language Grounding for Robotics,
RoboNLP@ACL 2017, Vancouver, Canada, August 3, 2017},
pages = {1--9},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://doi.org/10.18653/v1/w17-2801},
doi = {10.18653/V1/W17-2801},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acl/LindesMKL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aiide/BarotBCEGGMPRST17,
author = {Camille Barot and
Michael Branon and
Rogelio E. Cardona{-}Rivera and
Markus Eger and
Michelle L. Glatz and
Nancy L. Green and
James Mattice and
Colin M. Potts and
Justus Robertson and
Makiko Shukonobe and
Laura Tateosian and
Brandon R. Thorne and
R. Michael Young},
title = {Bardic: Generating Multimedia Narratives for Game Logs},
booktitle = {The Workshops of the Thirteenth {AAAI} Conference on Artificial Intelligence
and Interactive Digital Entertainment, {AIIDE} Workshops 2017, Snowbird,
UT, USA, October 5-6, 2017},
series = {{AAAI} Technical Report},
volume = {{WS-17}},
publisher = {{AAAI} Press},
year = {2017},
url = {https://aaai.org/ocs/index.php/AIIDE/AIIDE17/paper/view/15843},
timestamp = {Tue, 08 Feb 2022 18:32:58 +0100},
biburl = {https://dblp.org/rec/conf/aiide/BarotBCEGGMPRST17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atal/PengMLLRT17,
author = {Bei Peng and
James MacGlashan and
Robert T. Loftin and
Michael L. Littman and
David L. Roberts and
Matthew E. Taylor},
editor = {Kate Larson and
Michael Winikoff and
Sanmay Das and
Edmund H. Durfee},
title = {Curriculum Design for Machine Learners in Sequential Decision Tasks},
booktitle = {Proceedings of the 16th Conference on Autonomous Agents and MultiAgent
Systems, {AAMAS} 2017, S{\~{a}}o Paulo, Brazil, May 8-12, 2017},
pages = {1682--1684},
publisher = {{ACM}},
year = {2017},
url = {http://dl.acm.org/citation.cfm?id=3091403},
timestamp = {Sun, 18 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/atal/PengMLLRT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/avr/BoletsisM17,
author = {Costas Boletsis and
Simon McCallum},
editor = {Lucio Tommaso De Paolis and
Patrick Bourdot and
Antonio Mongelli},
title = {The Smartkuber Case Study: Lessons Learned from the Development of
an Augmented Reality Serious Game for Cognitive Screening},
booktitle = {Augmented Reality, Virtual Reality, and Computer Graphics - 4th International
Conference, {AVR} 2017, Ugento, Italy, June 12-15, 2017, Proceedings,
Part {I}},
series = {Lecture Notes in Computer Science},
volume = {10324},
pages = {457--472},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-60922-5\_36},
doi = {10.1007/978-3-319-60922-5\_36},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/avr/BoletsisM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/KordjamshidiRMP17,
author = {Parisa Kordjamshidi and
Taher Rahgooy and
Marie{-}Francine Moens and
James Pustejovsky and
Umar Manzoor and
Kirk Roberts},
editor = {Linda Cappellato and
Nicola Ferro and
Lorraine Goeuriot and
Thomas Mandl},
title = {{CLEF} 2017: Multimodal Spatial Role Labeling Task Working Notes},
booktitle = {Working Notes of {CLEF} 2017 - Conference and Labs of the Evaluation
Forum, Dublin, Ireland, September 11-14, 2017},
series = {{CEUR} Workshop Proceedings},
volume = {1866},
publisher = {CEUR-WS.org},
year = {2017},
url = {https://ceur-ws.org/Vol-1866/invited\_paper\_19.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:41 +0100},
biburl = {https://dblp.org/rec/conf/clef/KordjamshidiRMP17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/KordjamshidiRMP17a,
author = {Parisa Kordjamshidi and
Taher Rahgooy and
Marie{-}Francine Moens and
James Pustejovsky and
Umar Manzoor and
Kirk Roberts},
editor = {Gareth J. F. Jones and
S{\'{e}}amus Lawless and
Julio Gonzalo and
Liadh Kelly and
Lorraine Goeuriot and
Thomas Mandl and
Linda Cappellato and
Nicola Ferro},
title = {{CLEF} 2017: Multimodal Spatial Role Labeling (mSpRL) Task Overview},
booktitle = {Experimental {IR} Meets Multilinguality, Multimodality, and Interaction
- 8th International Conference of the {CLEF} Association, {CLEF} 2017,
Dublin, Ireland, September 11-14, 2017, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {10456},
pages = {367--376},
publisher = {Springer},
year = {2017},
url = {https://doi.org/10.1007/978-3-319-65813-1\_32},
doi = {10.1007/978-3-319-65813-1\_32},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/clef/KordjamshidiRMP17a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edbt/PoppeLRDDFOSVPW17,
author = {Olga Poppe and
Chuan Lei and
Elke A. Rundensteiner and
Daniel J. Dougherty and
Goutham Deva and
Nicholas Fajardo and
James Owens and
Thomas Schweich and
MaryAnn Van Valkenburg and
Sarun Paisarnsrisomsuk and
Pitchaya Wiratchotisatian and
George Gettel and
Robert Hollinger and
Devin Roberts and
Daniel Tocco},
editor = {Volker Markl and
Salvatore Orlando and
Bernhard Mitschang and
Periklis Andritsos and
Kai{-}Uwe Sattler and
Sebastian Bre{\ss}},
title = {{CAESAR:} Context-Aware Event Stream Analytics for Urban Transportation
Services},
booktitle = {Proceedings of the 20th International Conference on Extending Database
Technology, {EDBT} 2017, Venice, Italy, March 21-24, 2017},
pages = {590--593},
publisher = {OpenProceedings.org},
year = {2017},
url = {https://doi.org/10.5441/002/edbt.2017.77},
doi = {10.5441/002/EDBT.2017.77},
timestamp = {Thu, 13 Apr 2023 09:56:59 +0200},
biburl = {https://dblp.org/rec/conf/edbt/PoppeLRDDFOSVPW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/MacGlashanHLPWR17,
author = {James MacGlashan and
Mark K. Ho and
Robert Tyler Loftin and
Bei Peng and
Guan Wang and
David L. Roberts and
Matthew E. Taylor and
Michael L. Littman},
editor = {Doina Precup and
Yee Whye Teh},
title = {Interactive Learning from Policy-Dependent Human Feedback},
booktitle = {Proceedings of the 34th International Conference on Machine Learning,
{ICML} 2017, Sydney, NSW, Australia, 6-11 August 2017},
series = {Proceedings of Machine Learning Research},
volume = {70},
pages = {2285--2294},
publisher = {{PMLR}},
year = {2017},
url = {http://proceedings.mlr.press/v70/macglashan17a.html},
timestamp = {Sun, 18 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icml/MacGlashanHLPWR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/BonaldRV17,
author = {Thomas Bonald and
James W. Roberts and
Christian Vitale},
title = {Convergence to multi-resource fairness under end-to-end window control},
booktitle = {2017 {IEEE} Conference on Computer Communications, {INFOCOM} 2017,
Atlanta, GA, USA, May 1-4, 2017},
pages = {1--9},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/INFOCOM.2017.8057180},
doi = {10.1109/INFOCOM.2017.8057180},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/infocom/BonaldRV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/MacGlashanHLPRT17,
author = {James MacGlashan and
Mark K. Ho and
Robert Tyler Loftin and
Bei Peng and
David L. Roberts and
Matthew E. Taylor and
Michael L. Littman},
title = {Interactive Learning from Policy-Dependent Human Feedback},
journal = {CoRR},
volume = {abs/1701.06049},
year = {2017},
url = {http://arxiv.org/abs/1701.06049},
eprinttype = {arXiv},
eprint = {1701.06049},
timestamp = {Sun, 18 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/MacGlashanHLPRT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aamas/LoftinPMLTHR16,
author = {Robert T. Loftin and
Bei Peng and
James MacGlashan and
Michael L. Littman and
Matthew E. Taylor and
Jeff Huang and
David L. Roberts},
title = {Learning behaviors via human-delivered discrete feedback: modeling
implicit feedback strategies to speed up learning},
journal = {Auton. Agents Multi Agent Syst.},
volume = {30},
number = {1},
pages = {30--59},
year = {2016},
url = {https://doi.org/10.1007/s10458-015-9283-7},
doi = {10.1007/S10458-015-9283-7},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aamas/LoftinPMLTHR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chb/RobertsD16,
author = {James A. Roberts and
Meredith E. David},
title = {My life has become a major distraction from my cell phone: Partner
phubbing and relationship satisfaction among romantic partners},
journal = {Comput. Hum. Behav.},
volume = {54},
pages = {134--141},
year = {2016},
url = {https://doi.org/10.1016/j.chb.2015.07.058},
doi = {10.1016/J.CHB.2015.07.058},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/chb/RobertsD16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/digearth/LewisLPBEIDIMMO16,
author = {Adam Lewis and
Leo Lymburner and
Matthew B. J. Purss and
Brendan P. Brooke and
Benjamin J. K. Evans and
Alex Ip and
Arnold G. Dekker and
James R. Irons and
Stuart Minchin and
Norman Mueller and
Simon Oliver and
Dale O. Roberts and
Barbara Ryan and
Medhavy Thankappan and
Robert Woodcock and
Lesley Wyborn},
title = {Rapid, high-resolution detection of environmental change over continental
scales from satellite data - the Earth Observation Data Cube},
journal = {Int. J. Digit. Earth},
volume = {9},
number = {1},
pages = {106--111},
year = {2016},
url = {https://doi.org/10.1080/17538947.2015.1111952},
doi = {10.1080/17538947.2015.1111952},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/digearth/LewisLPBEIDIMMO16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/BennettRWHW16,
author = {James C. Bennett and
David E. Robertson and
Phillip G. D. Ward and
H. A. Prasantha Hapuarachchi and
Quan J. Wang},
title = {Calibrating hourly rainfall-runoff models with daily forcings for
streamflow forecasting applications in meso-scale catchments},
journal = {Environ. Model. Softw.},
volume = {76},
pages = {20--36},
year = {2016},
url = {https://doi.org/10.1016/j.envsoft.2015.11.006},
doi = {10.1016/J.ENVSOFT.2015.11.006},
timestamp = {Fri, 27 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/envsoft/BennettRWHW16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/firstmonday/AllenR16,
author = {Peter James Allen and
Lynne D. Roberts},
title = {The impact of academic sponsorship on Web survey dropout and item
non-response},
journal = {First Monday},
volume = {21},
number = {2},
year = {2016},
url = {https://doi.org/10.5210/fm.v21i2.6144},
doi = {10.5210/FM.V21I2.6144},
timestamp = {Mon, 04 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/firstmonday/AllenR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsg/BoletsisM16,
author = {Costas Boletsis and
Simon McCallum},
title = {Augmented Reality Cubes for Cognitive Gaming: Preliminary Usability
and Game Experience Testing},
journal = {Int. J. Serious Games},
volume = {3},
number = {1},
year = {2016},
url = {https://doi.org/10.17083/ijsg.v3i1.106},
doi = {10.17083/IJSG.V3I1.106},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijsg/BoletsisM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/EvansBHLBBRRBGG16,
author = {R. Scott Evans and
Jose Benuzillo and
Benjamin D. Horne and
James F. Lloyd and
Alejandra Bradshaw and
Deborah Budge and
Kismet Rasmusson and
Colleen Roberts and
Jason Buckway and
Norma Geer and
Teresa Garrett and
Donald L. Lapp{\'{e}}},
title = {Automated identification and predictive tools to help identify high-risk
heart failure patients: pilot evaluation},
journal = {J. Am. Medical Informatics Assoc.},
volume = {23},
number = {5},
pages = {872--878},
year = {2016},
url = {https://doi.org/10.1093/jamia/ocv197},
doi = {10.1093/JAMIA/OCV197},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/EvansBHLBBRRBGG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/McDanielBBHRHHS16,
author = {Robert B. McDaniel and
Jonathan D. Burlison and
Donald K. Baker and
Murad Hasan and
Jennifer Robertson and
Christine Hartford and
Scott C. Howard and
Andras Sablauer and
James M. Hoffman},
title = {Alert dwell time: introduction of a measure to evaluate interruptive
clinical decision support alerts},
journal = {J. Am. Medical Informatics Assoc.},
volume = {23},
number = {e1},
pages = {e138--e141},
year = {2016},
url = {https://doi.org/10.1093/jamia/ocv144},
doi = {10.1093/JAMIA/OCV144},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/McDanielBBHRHHS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HareRRBPMMCBCD16,
author = {Dominic J. Hare and
Erika P. Raven and
Blaine R. Roberts and
Mirjana Bogeski and
Stuart D. Portbury and
Catriona A. McLean and
Colin L. Masters and
James R. Connor and
Ashley I. Bush and
Peter J. Crouch and
Philip A. Doble},
title = {Laser ablation-inductively coupled plasma-mass spectrometry imaging
of white and gray matter iron distribution in Alzheimer's disease
frontal cortex},
journal = {NeuroImage},
volume = {137},
pages = {124--131},
year = {2016},
url = {https://doi.org/10.1016/j.neuroimage.2016.05.057},
doi = {10.1016/J.NEUROIMAGE.2016.05.057},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/HareRRBPMMCBCD16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/RobertsPLRMSCB16,
author = {James A. Roberts and
Alistair Perry and
Anton R. Lord and
Gloria M. P. Roberts and
Philip B. Mitchell and
Robert E. Smith and
Fernando Calamante and
Michael Breakspear},
title = {The contribution of geometry to the human connectome},
journal = {NeuroImage},
volume = {124},
pages = {379--393},
year = {2016},
url = {https://doi.org/10.1016/j.neuroimage.2015.09.009},
doi = {10.1016/J.NEUROIMAGE.2015.09.009},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/RobertsPLRMSCB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigpro/DArcaRH16,
author = {Eleonora D'Arca and
Neil M. Robertson and
James R. Hopgood},
title = {Robust indoor speaker recognition in a network of audio and video
sensors},
journal = {Signal Process.},
volume = {129},
pages = {137--149},
year = {2016},
url = {https://doi.org/10.1016/j.sigpro.2016.04.014},
doi = {10.1016/J.SIGPRO.2016.04.014},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigpro/DArcaRH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sma/GrayLGRRW16,
author = {Brian R. Gray and
Vyacheslav Lyubchich and
Yulia R. Gel and
James T. Rogala and
Dale M. Robertson and
Xiaoqiao Wei},
title = {Estimation of river and stream temperature trends under haphazard
sampling},
journal = {Stat. Methods Appl.},
volume = {25},
number = {1},
pages = {89--105},
year = {2016},
url = {https://doi.org/10.1007/s10260-015-0334-7},
doi = {10.1007/S10260-015-0334-7},
timestamp = {Mon, 25 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sma/GrayLGRRW16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/RobertsHR16,
author = {Jonathan C. Roberts and
Chris Headleand and
Panagiotis D. Ritsos},
title = {Sketching Designs Using the Five Design-Sheet Methodology},
journal = {{IEEE} Trans. Vis. Comput. Graph.},
volume = {22},
number = {1},
pages = {419--428},
year = {2016},
url = {https://doi.org/10.1109/TVCG.2015.2467271},
doi = {10.1109/TVCG.2015.2467271},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvcg/RobertsHR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaifs/LoftinMPTLR16,
author = {Robert Tyler Loftin and
James MacGlashan and
Bei Peng and
Matthew E. Taylor and
Michael L. Littman and
David L. Roberts},
title = {Towards Behavior-Aware Model Learning from Human-Generated Trajectories},
booktitle = {2016 {AAAI} Fall Symposia, Arlington, Virginia, USA, November 17-19,
2016},
publisher = {{AAAI} Press},
year = {2016},
url = {http://aaai.org/ocs/index.php/FSS/FSS16/paper/view/14094},
timestamp = {Sun, 18 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aaaifs/LoftinMPTLR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atal/PengMLLRT16,
author = {Bei Peng and
James MacGlashan and
Robert Tyler Loftin and
Michael L. Littman and
David L. Roberts and
Matthew E. Taylor},
editor = {Catholijn M. Jonker and
Stacy Marsella and
John Thangarajah and
Karl Tuyls},
title = {A Need for Speed: Adapting Agent Action Speed to Improve Task Learning
from Non-Expert Humans},
booktitle = {Proceedings of the 2016 International Conference on Autonomous Agents
{\&} Multiagent Systems, Singapore, May 9-13, 2016},
pages = {957--965},
publisher = {{ACM}},
year = {2016},
url = {http://dl.acm.org/citation.cfm?id=2937065},
timestamp = {Sun, 18 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/atal/PengMLLRT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bionlp/GorrellORCMS16,
author = {Genevieve Gorrell and
Sherifat Oduola and
Angus Roberts and
Tom Craig and
Craig Morgan and
Robert Stewart},
editor = {Kevin Bretonnel Cohen and
Dina Demner{-}Fushman and
Sophia Ananiadou and
Jun'ichi Tsujii},
title = {Identifying First Episodes of Psychosis in Psychiatric Patient Records
using Machine Learning},
booktitle = {Proceedings of the 15th Workshop on Biomedical Natural Language Processing,
BioNLP@ACL 2016, Berlin, Germany, August 12, 2016},
pages = {196--205},
publisher = {Association for Computational Linguistics},
year = {2016},
url = {https://doi.org/10.18653/v1/W16-2927},
doi = {10.18653/V1/W16-2927},
timestamp = {Fri, 06 Aug 2021 00:41:22 +0200},
biburl = {https://dblp.org/rec/conf/bionlp/GorrellORCMS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/DominguezCVR16,
author = {Ignacio X. Dom{\'{\i}}nguez and
Rogelio Enrique Cardona{-}Rivera and
James K. Vance and
David L. Roberts},
editor = {Jofish Kaye and
Allison Druin and
Cliff Lampe and
Dan Morris and
Juan Pablo Hourcade},
title = {The Mimesis Effect: The Effect of Roles on Player Choice in Interactive
Narrative Role-Playing Games},
booktitle = {Proceedings of the 2016 {CHI} Conference on Human Factors in Computing
Systems, San Jose, CA, USA, May 7-12, 2016},
pages = {3438--3449},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2858036.2858141},
doi = {10.1145/2858036.2858141},
timestamp = {Wed, 01 Jun 2022 08:38:38 +0200},
biburl = {https://dblp.org/rec/conf/chi/DominguezCVR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dihu/RobertsWBWBFRJP16,
author = {Ben Roberts and
Alban Webb and
Liam Berriman and
Sharon Webb and
James Baker and
M. Beatrice Fazi and
Andrew Robertson and
Ben Jackson and
Jack Pay and
Simon Wibberley and
Chris Kiefer},
editor = {Maciej Eder and
Jan Rybicki},
title = {Sussex Humanities Lab - Emotion, Automation and Sonic Socialities},
booktitle = {11th Annual International Conference of the Alliance of Digital Humanities
Organizations, {DH} 2016, Krakow, Poland, July 11-16, 2016, Conference
Abstracts},
pages = {874--876},
publisher = {Alliance of Digital Humanities Organizations {(ADHO)}},
year = {2016},
url = {http://dh2016.adho.org/abstracts/240},
timestamp = {Fri, 10 Jul 2020 11:43:01 +0200},
biburl = {https://dblp.org/rec/conf/dihu/RobertsWBWBFRJP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/SthapitHRT16,
author = {Saurav Sthapit and
James R. Hopgood and
Neil M. Robertson and
John Thompson},
title = {Offloading to neighbouring nodes in smart camera network},
booktitle = {24th European Signal Processing Conference, {EUSIPCO} 2016, Budapest,
Hungary, August 29 - September 2, 2016},
pages = {1823--1827},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/EUSIPCO.2016.7760563},
doi = {10.1109/EUSIPCO.2016.7760563},
timestamp = {Sat, 20 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eusipco/SthapitHRT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gala/BoletsisM16,
author = {Costas Boletsis and
Simon McCallum},
editor = {Rosa Bottino and
Johan Jeuring and
Remco C. Veltkamp},
title = {Evaluating a Gaming System for Cognitive Screening and Sleep Duration
Assessment of Elderly Players: {A} Pilot Study},
booktitle = {Games and Learning Alliance - 5th International Conference, {GALA}
2016, Utrecht, The Netherlands, December 5-7, 2016, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {10056},
pages = {107--119},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-50182-6\_10},
doi = {10.1007/978-3-319-50182-6\_10},
timestamp = {Tue, 14 May 2019 10:00:41 +0200},
biburl = {https://dblp.org/rec/conf/gala/BoletsisM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/KirkML16,
author = {James R. Kirk and
Aaron Mininger and
John E. Laird},
editor = {Subbarao Kambhampati},
title = {A Demonstration of Interactive Task Learning},
booktitle = {Proceedings of the Twenty-Fifth International Joint Conference on
Artificial Intelligence, {IJCAI} 2016, New York, NY, USA, 9-15 July
2016},
pages = {4248--4249},
publisher = {{IJCAI/AAAI} Press},
year = {2016},
url = {http://www.ijcai.org/Abstract/16/644},
timestamp = {Tue, 20 Aug 2019 16:19:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/KirkML16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/JoubertJGBRLH16,
author = {Niels Joubert and
Jane L. E and
Dan B. Goldman and
Floraine Berthouzoz and
Mike Roberts and
James A. Landay and
Pat Hanrahan},
title = {Towards a Drone Cinematographer: Guiding Quadrotor Cameras using Visual
Composition Principles},
journal = {CoRR},
volume = {abs/1610.01691},
year = {2016},
url = {http://arxiv.org/abs/1610.01691},
eprinttype = {arXiv},
eprint = {1610.01691},
timestamp = {Thu, 01 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/JoubertJGBRLH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/MohanKL16,
author = {Shiwali Mohan and
James R. Kirk and
John E. Laird},
title = {A Computational Model for Situated Task Learning with Interactive
Instruction},
journal = {CoRR},
volume = {abs/1604.06849},
year = {2016},
url = {http://arxiv.org/abs/1604.06849},
eprinttype = {arXiv},
eprint = {1604.06849},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/MohanKL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aisthci/BurnsYRCE15,
author = {A. J. Burns and
Jacob A. Young and
Tom L. Roberts and
James F. Courtney and
T. Selwyn Ellis},
title = {Exploring the Role of Contextual Integrity in Electronic Medical Record
{(EMR)} System Workaround Decisions: An Information Security and Privacy
Perspective},
journal = {{AIS} Trans. Hum. Comput. Interact.},
volume = {7},
number = {3},
pages = {4},
year = {2015},
url = {https://aisel.aisnet.org/thci/vol7/iss3/4},
timestamp = {Sat, 18 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aisthci/BurnsYRCE15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/comj/RobertsWWK15,
author = {Charles Roberts and
Graham Wakefield and
Matthew Wright and
JoAnn Kuchera{-}Morin},
title = {Designing Musical Instruments for the Browser},
journal = {Comput. Music. J.},
volume = {39},
number = {1},
pages = {27--40},
year = {2015},
url = {https://doi.org/10.1162/COMJ\_a\_00283},
doi = {10.1162/COMJ\_A\_00283},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/comj/RobertsWWK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocs/ItaniSSHBCRCG15,
author = {Mohamed A. Itani and
Ulf D. Schiller and
Sebastian Schmieschek and
James Hetherington and
Miguel O. Bernabeu and
Hoskote Chandrashekar and
Fergus Robertson and
Peter V. Coveney and
Derek Groen},
title = {An automated multiscale ensemble simulation approach for vascular
blood flow},
journal = {J. Comput. Sci.},
volume = {9},
pages = {150--155},
year = {2015},
url = {https://doi.org/10.1016/j.jocs.2015.04.008},
doi = {10.1016/J.JOCS.2015.04.008},
timestamp = {Tue, 25 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jocs/ItaniSSHBCRCG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbcas/RoyKYCGLKBCFORS15,
author = {Abhishek Roy and
Alicia Klinefelter and
Farah B. Yahya and
Xing Chen and
Luisa Patricia Gonzalez{-}Guerrero and
Christopher J. Lukas and
Divya Akella Kamakshi and
James Boley and
Kyle Craig and
Muhammad Faisal and
Seunghyun Oh and
Nathan E. Roberts and
Yousef Shakhsheer and
Aatmesh Shrivastava and
Dilip P. Vasudevan and
David D. Wentzloff and
Benton H. Calhoun},
title = {A 6.45 {\(\mu\)}W Self-Powered SoC With Integrated Energy-Harvesting
Power Management and {ULP} Asymmetric Radios for Portable Biomedical
Systems},
journal = {{IEEE} Trans. Biomed. Circuits Syst.},
volume = {9},
number = {6},
pages = {862--874},
year = {2015},
url = {https://doi.org/10.1109/TBCAS.2015.2498643},
doi = {10.1109/TBCAS.2015.2498643},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbcas/RoyKYCGLKBCFORS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaifs/MohanKML15,
author = {Shiwali Mohan and
James Roberts Kirk and
Aaron Mininger and
John E. Laird},
title = {Agent Requirements for Effective and Efficient Task-Oriented Dialog},
booktitle = {2015 {AAAI} Fall Symposia, Arlington, Virginia, USA, November 12-14,
2015},
pages = {94--99},
publisher = {{AAAI} Press},
year = {2015},
url = {http://www.aaai.org/ocs/index.php/FSS/FSS15/paper/view/11701},
timestamp = {Wed, 14 Nov 2018 16:20:12 +0100},
biburl = {https://dblp.org/rec/conf/aaaifs/MohanKML15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acmicn/ElayoubiR15,
author = {Salah{-}Eddine Elayoubi and
James Roberts},
editor = {Ignacio Solis and
Antonio Carzaniga and
K. K. Ramakrishnan},
title = {Performance and Cost Effectiveness of Caching in Mobile Access Networks},
booktitle = {Proceedings of the 2nd International Conference on Information-Centric
Networking, {ICN} '15, San Francisco, California, USA, September 30
- October 2, 2015},
pages = {79--88},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2810156.2810168},
doi = {10.1145/2810156.2810168},
timestamp = {Tue, 06 Nov 2018 16:58:41 +0100},
biburl = {https://dblp.org/rec/conf/acmicn/ElayoubiR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biostec/ChampionHYENLBN15,
author = {Mia D. Champion and
Ryan A. Hlady and
Huihuang Yan and
Jared Evans and
Jeff Nie and
Jeong{-}Heon Lee and
James M. Bogenberger and
Kannabiran Nandakumar and
Jaime I. D{\'{a}}vila and
Raymond M. Moore and
Asha A. Nair and
Daniel R. O'Brien and
Yuan{-}Xiao Zhu and
K. Martin Kort{\"{u}}m and
Tamas Ordog and
Zhiguo Zhang and
Richard W. Joseph and
A. Keith Stewart and
Jean{-}Pierre A. Kocher and
Eric Jonasch and
Keith D. Robertson and
Raoul Tibes and
Thai H. Ho},
editor = {Oscar Pastor and
Christine Sinoquet and
Ana L. N. Fred and
Hugo Gamboa and
Dirk Elias},
title = {Bioinformatics Strategies for Identifying Regions of Epigenetic Deregulation
Associated with Aberrant Transcript Splicing and RNA-editing},
booktitle = {{BIOINFORMATICS} 2015 - Proceedings of the International Conference
on Bioinformatics Models, Methods and Algorithms, Lisbon, Portugal,
12-15 January, 2015},
pages = {163--170},
publisher = {SciTePress},
year = {2015},
timestamp = {Thu, 21 Jan 2021 13:58:22 +0100},
biburl = {https://dblp.org/rec/conf/biostec/ChampionHYENLBN15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/BoletsisML15,
author = {Costas Boletsis and
Simon McCallum and
Brynjar Fowels Landmark},
editor = {Jia Zhou and
Gavriel Salvendy},
title = {The Use of Smartwatches for Health Monitoring in Home-Based Dementia
Care},
booktitle = {Human Aspects of {IT} for the Aged Population. Design for Everyday
Life - First International Conference, {ITAP} 2015, Held as Part of
{HCI} International 2015, Los Angeles, CA, USA, August 2-7, 2015.
Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {9194},
pages = {15--26},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-20913-5\_2},
doi = {10.1007/978-3-319-20913-5\_2},
timestamp = {Wed, 25 Sep 2019 18:09:57 +0200},
biburl = {https://dblp.org/rec/conf/hci/BoletsisML15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci/RobertsACC15,
author = {Zach Roberts and
Blake Arnsdorff and
James Cunningham and
Dan Chiappe},
editor = {Sakae Yamamoto},
title = {A Method for Calculating Air Traffic Controller Communication Complexity},
booktitle = {Human Interface and the Management of Information. Information and
Knowledge in Context - 17th International Conference, {HCI} International
2015, Los Angeles, CA, USA, August 2-7, 2015, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {9173},
pages = {25--32},
publisher = {Springer},
year = {2015},
url = {https://doi.org/10.1007/978-3-319-20618-9\_3},
doi = {10.1007/978-3-319-20618-9\_3},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/hci/RobertsACC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/BurnsRPBC15,
author = {A. J. Burns and
Tom L. Roberts and
Clay Posey and
Rebecca J. Bennett and
James F. Courtney},
editor = {Tung X. Bui and
Ralph H. Sprague Jr.},
title = {Assessing the Role of Security Education, Training, and Awareness
on Insiders' Security-Related Behavior: An Expectancy Theory Approach},
booktitle = {48th Hawaii International Conference on System Sciences, {HICSS} 2015,
Kauai, Hawaii, USA, January 5-8, 2015},
pages = {3930--3940},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/HICSS.2015.471},
doi = {10.1109/HICSS.2015.471},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/BurnsRPBC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmc/RobertsWK15,
author = {Charles Roberts and
Matthew Wright and
JoAnn Kuchera{-}Morin},
title = {Music Programming in Gibber},
booktitle = {Looking Back, Looking Forward: Proceedings of the 41st International
Computer Music Conference, {ICMC} 2015, Denton, TX, USA, September
25 - October 1, 2015},
publisher = {Michigan Publishing},
year = {2015},
url = {https://hdl.handle.net/2027/spo.bbp2372.2015.009},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icmc/RobertsWK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/KlinefelterRSGS15,
author = {Alicia Klinefelter and
Nathan E. Roberts and
Yousef Shakhsheer and
Patricia Gonz{\'{a}}lez and
Aatmesh Shrivastava and
Abhishek Roy and
Kyle Craig and
Muhammad Faisal and
James Boley and
Seunghyun Oh and
Yanqing Zhang and
Divya Akella and
David D. Wentzloff and
Benton H. Calhoun},
title = {21.3 {A} 6.45{\(\mu\)}W self-powered IoT SoC with integrated energy-harvesting
power management and {ULP} asymmetric radios},
booktitle = {2015 {IEEE} International Solid-State Circuits Conference, {ISSCC}
2015, Digest of Technical Papers, San Francisco, CA, USA, February
22-26, 2015},
pages = {1--3},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ISSCC.2015.7063087},
doi = {10.1109/ISSCC.2015.7063087},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isscc/KlinefelterRSGS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mie/EvansBBLNARRHL15,
author = {R. Scott Evans and
Deborah Budge and
Jose Benuzillo and
James F. Lloyd and
Jen Nixon and
Rami Alharethi and
Kismet Rasmusson and
Colleen Roberts and
Benjamin D. Horne and
Donald L. Lapp{\'{e}}},
editor = {Ronald Cornet and
Lacramioara Stoicu{-}Tivadar and
Alexander H{\"{o}}rbst and
Carlos Luis Parra Calder{\'{o}}n and
Stig Kj{\ae}r Andersen and
Mira Hercigonja{-}Szekeres},
title = {Decision Support to Help Identify Patients for Advanced Heart Failure
Therapies},
booktitle = {Digital Healthcare Empowering Europeans - Proceedings of MIE2015,
Madrid Spain, 27-29 May, 2015},
series = {Studies in Health Technology and Informatics},
volume = {210},
pages = {948},
publisher = {{IOS} Press},
year = {2015},
url = {https://doi.org/10.3233/978-1-61499-512-8-948},
doi = {10.3233/978-1-61499-512-8-948},
timestamp = {Wed, 03 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mie/EvansBBLNARRHL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nime/RobertsWK15,
author = {Charles Roberts and
Matthew Wright and
JoAnn Kuchera{-}Morin},
editor = {Edgar Berdahl and
Jesse T. Allison},
title = {Beyond editing: extended interaction with textual code fragments},
booktitle = {15th International Conference on New Interfaces for Musical Expression,
{NIME} 2015, Baton Rouge, Louisiana, USA, May 31 - June 3, 2015},
pages = {126--131},
publisher = {nime.org},
year = {2015},
url = {https://doi.org/10.5281/zenodo.1179164},
doi = {10.5281/ZENODO.1179164},
timestamp = {Tue, 04 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nime/RobertsWK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nime/RosliYWWWRHE15,
author = {Muhammad Hafiz Wan Rosli and
Karl Yerkes and
Matthew Wright and
Timothy Wood and
Hannah Wolfe and
Charlie Roberts and
Anis Haron and
Fernando Rinc{\'{o}}n Estrada},
editor = {Edgar Berdahl and
Jesse T. Allison},
title = {Ensemble feedback instruments},
booktitle = {15th International Conference on New Interfaces for Musical Expression,
{NIME} 2015, Baton Rouge, Louisiana, USA, May 31 - June 3, 2015},
pages = {144--149},
publisher = {nime.org},
year = {2015},
url = {https://doi.org/10.5281/zenodo.1179170},
doi = {10.5281/ZENODO.1179170},
timestamp = {Tue, 04 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nime/RosliYWWWRHE15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/saso/RobertsonAMPTM15,
author = {Seth Robertson and
Scott Alexander and
Josephine Micallef and
Jonathan Pucci and
James Tanis and
Anthony Macera},
title = {{CINDAM:} Customized Information Networks for Deception and Attack
Mitigation},
booktitle = {2015 {IEEE} International Conference on Self-Adaptive and Self-Organizing
Systems Workshops, {SASO} Workshops 2015, Cambridge, MA, USA, September
21-25, 2015},
pages = {114--119},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/SASOW.2015.23},
doi = {10.1109/SASOW.2015.23},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/saso/RobertsonAMPTM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/JamesDPRT15,
author = {Oliver James and
Sylvan Dieckmann and
Simon Pabst and
Paul{-}George H. Roberts and
Kip S. Thorne},
title = {Building interstellar's black hole: the gravitational renderer},
booktitle = {Special Interest Group on Computer Graphics and Interactive Techniques
Conference, {SIGGRAPH} '15, Los Angeles, CA, USA, August 9-13, 2015,
Talks Proceedings},
pages = {21:1},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2775280.2792510},
doi = {10.1145/2775280.2792510},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/siggraph/JamesDPRT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmetrics/BonaldR15,
author = {Thomas Bonald and
James W. Roberts},
editor = {Bill Lin and
Jun (Jim) Xu and
Sudipta Sengupta and
Devavrat Shah},
title = {Multi-Resource Fairness: Objectives, Algorithms and Performance},
booktitle = {Proceedings of the 2015 {ACM} {SIGMETRICS} International Conference
on Measurement and Modeling of Computer Systems, Portland, OR, USA,
June 15-19, 2015},
pages = {31--42},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2745844.2745869},
doi = {10.1145/2745844.2745869},
timestamp = {Mon, 01 Aug 2022 08:51:52 +0200},
biburl = {https://dblp.org/rec/conf/sigmetrics/BonaldR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/teletraffic/ElayoubiR15,
author = {Salah{-}Eddine Elayoubi and
James Roberts},
title = {Performance Evaluation of Video Transcoding and Caching Solutions
in Mobile Networks},
booktitle = {27th International Teletraffic Congress, {ITC} 2015, Ghent, Belgium,
September 8-10, 2015},
pages = {55--63},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/ITC.2015.14},
doi = {10.1109/ITC.2015.14},
timestamp = {Sat, 12 Nov 2022 12:58:28 +0100},
biburl = {https://dblp.org/rec/conf/teletraffic/ElayoubiR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/IntiSBJRHC15,
author = {Rajesh Inti and
Sudip Shekhar and
Ganesh Balamurugan and
James E. Jaussi and
Clark Roberts and
Tzu{-}Chien Hsueh and
Bryan Casper},
title = {A 0.5-to-0.75V, 3-to-8 Gbps/lane, 385-to-790 fJ/b, bi-directional,
quad-lane forwarded-clock transceiver in 22nm {CMOS}},
booktitle = {Symposium on {VLSI} Circuits, {VLSIC} 2015, Kyoto, Japan, June 17-19,
2015},
pages = {346},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/VLSIC.2015.7231317},
doi = {10.1109/VLSIC.2015.7231317},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/IntiSBJRHC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ItaniSSHBCRCG15,
author = {Mohamed A. Itani and
Ulf D. Schiller and
Sebastian Schmieschek and
James Hetherington and
Miguel O. Bernabeu and
Hoskote Chandrashekar and
Fergus Robertson and
Peter V. Coveney and
Derek Groen},
title = {An automated multiscale ensemble simulation approach for vascular
blood flow},
journal = {CoRR},
volume = {abs/1504.07795},
year = {2015},
url = {http://arxiv.org/abs/1504.07795},
eprinttype = {arXiv},
eprint = {1504.07795},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/ItaniSSHBCRCG15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cg/Kuchera-MorinWWRASHM14,
author = {JoAnn Kuchera{-}Morin and
Matthew Wright and
Graham Wakefield and
Charles Roberts and
Dennis Adderton and
Behzad Sajadi and
Tobias H{\"{o}}llerer and
Aditi Majumder},
title = {Immersive full-surround multi-user system design},
journal = {Comput. Graph.},
volume = {40},
pages = {10--21},
year = {2014},
url = {https://doi.org/10.1016/j.cag.2013.12.004},
doi = {10.1016/J.CAG.2013.12.004},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cg/Kuchera-MorinWWRASHM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/entropy/LadymanR14,
author = {James Ladyman and
Katie Robertson},
title = {Going Round in Circles: Landauer vs. Norton on the Thermodynamics
of Computation},
journal = {Entropy},
volume = {16},
number = {4},
pages = {2278--2290},
year = {2014},
url = {https://doi.org/10.3390/e16042278},
doi = {10.3390/E16042278},
timestamp = {Tue, 14 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/entropy/LadymanR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/HolzworthHV14,
author = {Dean P. Holzworth and
Neil I. Huth and
Peter G. de Voil and
Eric J. Zurcher and
Neville I. Herrmann and
Greg McLean and
Karine Chenu and
Erik J. van Oosterom and
Valerie O. Snow and
Chris Murphy and
Andrew D. Moore and
Hamish E. Brown and
Jeremy P. M. Whish and
Shaun Verrall and
Justin Fainges and
Lindsay W. Bell and
Allan S. Peake and
Perry L. Poulton and
Zvi Hochman and
Peter J. Thorburn and
Donald S. Gaydon and
Neal P. Dalgliesh and
Daniel Rodr{\'{\i}}guez and
Howard Cox and
Scott C. Chapman and
Alastair Doherty and
Edmar I. Teixeira and
Joanna Sharp and
Rogerio Cichota and
Iris Vogeler and
Frank Y. Li and
Enli Wang and
Graeme L. Hammer and
Michael J. Robertson and
John P. Dimes and
Anthony M. Whitbread and
James Hunt and
Harm van Rees and
Tim McClelland and
Peter S. Carberry and
John N. G. Hargreaves and
Neil MacLeoda and
Cam McDonald and
Justin Harsdorf and
Sara Wedgwood and
Brian A. Keating},
title = {{APSIM} - Evolution towards a new generation of agricultural systems
simulation},
journal = {Environ. Model. Softw.},
volume = {62},
pages = {327--350},
year = {2014},
url = {https://doi.org/10.1016/j.envsoft.2014.07.009},
doi = {10.1016/J.ENVSOFT.2014.07.009},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/envsoft/HolzworthHV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MusahJBHHKSKSIMLHRMC14,
author = {Tawfiq Musah and
James E. Jaussi and
Ganesh Balamurugan and
Sami Hyvonen and
Tzu{-}Chien Hsueh and
Gokce Keskin and
Sudip Shekhar and
Joseph T. Kennedy and
Shreyas Sen and
Rajesh Inti and
Mozhgan Mansuri and
Michael Leddige and
Bryce Horine and
Clark Roberts and
Randy Mooney and
Bryan Casper},
title = {A 4-32 Gb/s Bidirectional Link With 3-Tap FFE/6-Tap {DFE} and Collaborative
{CDR} in 22 nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {49},
number = {12},
pages = {3079--3090},
year = {2014},
url = {https://doi.org/10.1109/JSSC.2014.2348556},
doi = {10.1109/JSSC.2014.2348556},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/MusahJBHHKSKSIMLHRMC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pe/BonaldR14,
author = {Thomas Bonald and
James W. Roberts},
title = {Enhanced cluster computing performance through proportional fairness},
journal = {Perform. Evaluation},
volume = {79},
pages = {134--145},
year = {2014},
url = {https://doi.org/10.1016/j.peva.2014.07.009},
doi = {10.1016/J.PEVA.2014.07.009},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pe/BonaldR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/JohnsenAMBRMB14,
author = {Kyle Johnsen and
Sun Joo (Grace) Ahn and
James Moore and
Scott Brown and
Thomas P. Robertson and
Amanda Marable and
Aryabrata Basu},
title = {Mixed Reality Virtual Pets to Reduce Childhood Obesity},
journal = {{IEEE} Trans. Vis. Comput. Graph.},
volume = {20},
number = {4},
pages = {523--530},
year = {2014},
url = {https://doi.org/10.1109/TVCG.2014.33},
doi = {10.1109/TVCG.2014.33},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tvcg/JohnsenAMBRMB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/LoftinMPTLHR14,
author = {Robert Tyler Loftin and
James MacGlashan and
Bei Peng and
Matthew E. Taylor and
Michael L. Littman and
Jeff Huang and
David L. Roberts},
editor = {Carla E. Brodley and
Peter Stone},
title = {A Strategy-Aware Technique for Learning Behaviors from Discrete Human
Feedback},
booktitle = {Proceedings of the Twenty-Eighth {AAAI} Conference on Artificial Intelligence,
July 27 -31, 2014, Qu{\'{e}}bec City, Qu{\'{e}}bec, Canada},
pages = {937--943},
publisher = {{AAAI} Press},
year = {2014},
url = {https://doi.org/10.1609/aaai.v28i1.8839},
doi = {10.1609/AAAI.V28I1.8839},
timestamp = {Mon, 04 Sep 2023 15:06:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/LoftinMPTLHR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/BurlisonBBHMRHH14,
author = {Jonathan D. Burlison and
Lisbeth Bowlin and
Donald K. Baker and
Murad Hasan and
R. Ben McDaniel and
Jennifer Robertson and
Scott C. Howard and
James M. Hoffman},
title = {Leveraging the Electronic Health Record to Identify Prescribing Errors
through Rapidly Discontinued Medication Orders},
booktitle = {{AMIA} 2014, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 15-19, 2014},
publisher = {{AMIA}},
year = {2014},
url = {https://knowledge.amia.org/56638-amia-1.1540970/t-005-1.1543914/f-005-1.1543915/a-259-1.1544894/a-260-1.1544891},
timestamp = {Wed, 17 Apr 2024 11:47:48 +0200},
biburl = {https://dblp.org/rec/conf/amia/BurlisonBBHMRHH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/GanzSTWR14,
author = {Aura Ganz and
James M. Schafer and
Yang Tao and
Carole Wilson and
Meg Robertson},
title = {{PERCEPT-II:} Smartphone based indoor navigation system for the blind},
booktitle = {36th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2014, Chicago, IL, USA, August
26-30, 2014},
pages = {3662--3665},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/EMBC.2014.6944417},
doi = {10.1109/EMBC.2014.6944417},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/embc/GanzSTWR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eva/BisbyCJRN14,
author = {Helena Bisby and
Adam Cooper and
Stephen James and
Alec Robertson and
Kia Ng},
editor = {Kia Ng and
Jonathan P. Bowen and
Sarah McDaid},
title = {A Tactile Audio Visual Instrument using Sound Source Localisation},
booktitle = {Electronic Visualisation and the Arts, {EVA} 2014, London, UK, 8-10
July 2014},
series = {Workshops in Computing},
publisher = {{BCS}},
year = {2014},
url = {https://doi.org/10.14236/ewic/eva2014.24},
doi = {10.14236/EWIC/EVA2014.24},
timestamp = {Fri, 27 Aug 2021 10:57:10 +0200},
biburl = {https://dblp.org/rec/conf/eva/BisbyCJRN14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/DArcaRH14,
author = {Eleonora D'Arca and
Neil M. Robertson and
James R. Hopgood},
title = {Look who's talking: Detecting the dominant speaker in a cluttered
scenario},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2014, Florence, Italy, May 4-9, 2014},
pages = {1532--1536},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ICASSP.2014.6853854},
doi = {10.1109/ICASSP.2014.6853854},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icassp/DArcaRH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/HsuehBJHKKMSISM14,
author = {Tzu{-}Chien Hsueh and
Ganesh Balamurugan and
James E. Jaussi and
Sami Hyvonen and
Joseph T. Kennedy and
G{\"{o}}k{\c{c}}e Keskin and
Tawfiq Musah and
Sudip Shekhar and
Rajesh Inti and
Shreyas Sen and
Mozhgan Mansuri and
Clark Roberts and
Bryan Casper},
title = {26.4 {A} 25.6Gb/s differential and {DDR4/GDDR5} dual-mode transmitter
with digital clock calibration in 22nm {CMOS}},
booktitle = {2014 {IEEE} International Conference on Solid-State Circuits Conference,
{ISSCC} 2014, Digest of Technical Papers, San Francisco, CA, USA,
February 9-13, 2014},
pages = {444--445},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISSCC.2014.6757506},
doi = {10.1109/ISSCC.2014.6757506},
timestamp = {Mon, 09 Aug 2021 14:54:04 +0200},
biburl = {https://dblp.org/rec/conf/isscc/HsuehBJHKKMSISM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/JaussiBHHMKSKSI14,
author = {James E. Jaussi and
Ganesh Balamurugan and
Sami Hyvonen and
Tzu{-}Chien Hsueh and
Tawfiq Musah and
G{\"{o}}k{\c{c}}e Keskin and
Sudip Shekhar and
Joseph T. Kennedy and
Shreyas Sen and
Rajesh Inti and
Mozhgan Mansuri and
Michael Leddige and
Bryce Horine and
Clark Roberts and
Randy Mooney and
Bryan Casper},
title = {26.2 {A} 205mW 32Gb/s 3-Tap FFE/6-tap {DFE} bidirectional serial link
in 22nm {CMOS}},
booktitle = {2014 {IEEE} International Conference on Solid-State Circuits Conference,
{ISSCC} 2014, Digest of Technical Papers, San Francisco, CA, USA,
February 9-13, 2014},
pages = {440--441},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ISSCC.2014.6757504},
doi = {10.1109/ISSCC.2014.6757504},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isscc/JaussiBHHMKSKSI14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/RobertsWKH14,
author = {Charles Roberts and
Matthew Wright and
JoAnn Kuchera{-}Morin and
Tobias H{\"{o}}llerer},
editor = {Kien A. Hua and
Yong Rui and
Ralf Steinmetz and
Alan Hanjalic and
Apostol Natsev and
Wenwu Zhu},
title = {Gibber: Abstractions for Creative Multimedia Programming},
booktitle = {Proceedings of the {ACM} International Conference on Multimedia, {MM}
'14, Orlando, FL, USA, November 03 - 07, 2014},
pages = {67--76},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2647868.2654949},
doi = {10.1145/2647868.2654949},
timestamp = {Tue, 20 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mm/RobertsWKH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nime/RobertsWKH14,
author = {Charlie Roberts and
Matthew Wright and
JoAnn Kuchera{-}Morin and
Tobias H{\"{o}}llerer},
editor = {Baptiste Caramiaux and
Koray Tahiroglu and
Rebecca Fiebrink and
Atau Tanaka},
title = {Rapid Creation and Publication of Digital Musical Instruments},
booktitle = {14th International Conference on New Interfaces for Musical Expression,
{NIME} 2014, London, United Kingdom, June 30 - July 4, 2014},
pages = {239--242},
publisher = {nime.org},
year = {2014},
url = {https://doi.org/10.5281/zenodo.1178919},
doi = {10.5281/ZENODO.1178919},
timestamp = {Tue, 04 Apr 2023 16:52:05 +0200},
biburl = {https://dblp.org/rec/conf/nime/RobertsWKH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nime/WakefieldRWWY14,
author = {Graham Wakefield and
Charlie Roberts and
Matthew Wright and
Timothy Wood and
Karl Yerkes},
editor = {Baptiste Caramiaux and
Koray Tahiroglu and
Rebecca Fiebrink and
Atau Tanaka},
title = {Collaborative Live-Coding with an Immersive Instrument},
booktitle = {14th International Conference on New Interfaces for Musical Expression,
{NIME} 2014, London, United Kingdom, June 30 - July 4, 2014},
pages = {505--508},
publisher = {nime.org},
year = {2014},
url = {https://doi.org/10.5281/zenodo.1178975},
doi = {10.5281/ZENODO.1178975},
timestamp = {Tue, 04 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nime/WakefieldRWWY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ondm/IndrePR14,
author = {Raluca{-}Maria Indre and
Jelena Pesic and
James Roberts},
title = {{POPI:} {A} Passive Optical Pod Interconnect for high performance
data centers},
booktitle = {18th International Conference on Optical Network Design and Modeling,
{ONDM} 2014, Stockholm, Sweden, May 19-22, 2014},
pages = {84--89},
publisher = {{IEEE}},
year = {2014},
url = {https://ieeexplore.ieee.org/document/6855766/},
timestamp = {Wed, 11 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ondm/IndrePR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ozchi/NansenRVRBD14,
author = {Bjorn Nansen and
Luke van Ryn and
Frank Vetere and
Toni Robertson and
Margot Brereton and
Paul Dourish},
editor = {Tuck Wah Leong},
title = {An internet of social things},
booktitle = {Proceedings of the 26th Australian Computer-Human Interaction Conference
on Designing Futures - the Future of Design, {OZCHI} '14, Sydney,
New South Wales, Australia, December 2-5, 2014},
pages = {87--96},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2686612.2686624},
doi = {10.1145/2686612.2686624},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ozchi/NansenRVRBD14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ro-man/LoftinPMLTHR14,
author = {Robert Tyler Loftin and
Bei Peng and
James MacGlashan and
Michael L. Littman and
Matthew E. Taylor and
Jeff Huang and
David L. Roberts},
title = {Learning something from nothing: Leveraging implicit human feedback
strategies},
booktitle = {The 23rd {IEEE} International Symposium on Robot and Human Interactive
Communication, {IEEE} {RO-MAN} 2014, Edinburgh, UK, August 25-29,
2014},
pages = {607--612},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ROMAN.2014.6926319},
doi = {10.1109/ROMAN.2014.6926319},
timestamp = {Sun, 18 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ro-man/LoftinPMLTHR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/BonaldR14,
author = {Thomas Bonald and
James W. Roberts},
title = {Enhanced Cluster Computing Performance Through Proportional Fairness},
journal = {CoRR},
volume = {abs/1404.2266},
year = {2014},
url = {http://arxiv.org/abs/1404.2266},
eprinttype = {arXiv},
eprint = {1404.2266},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/BonaldR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/BonaldR14a,
author = {Thomas Bonald and
James W. Roberts},
title = {Multi-resource fairness: Objectives, algorithms and performance},
journal = {CoRR},
volume = {abs/1410.0782},
year = {2014},
url = {http://arxiv.org/abs/1410.0782},
eprinttype = {arXiv},
eprint = {1410.0782},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/BonaldR14a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biodb/ArighiCCKWFDCSDMLHGJRMBDBLCSPHALCMCBWLWTRSNCDW13,
author = {Cecilia N. Arighi and
Ben Carterette and
K. Bretonnel Cohen and
Martin Krallinger and
W. John Wilbur and
Petra Fey and
Robert J. Dodson and
Laurel Cooper and
Ceri E. Van Slyke and
Wasila M. Dahdul and
Paula M. Mabee and
Donghui Li and
Bethany R. Harris and
Marc Gillespie and
Silvia Jimenez and
Phoebe M. Roberts and
Lisa Matthews and
Kevin G. Becker and
Harold J. Drabkin and
Susan M. Bello and
Luana Licata and
Andrew Chatr{-}aryamontri and
Mary L. Schaeffer and
Julie Park and
Melissa A. Haendel and
Kimberly Van Auken and
Yuling Li and
Juancarlos Chan and
Hans{-}Michael M{\"{u}}ller and
Hong Cui and
James P. Balhoff and
Chi{-}Yang Wu and
Zhiyong Lu and
Chih{-}Hsuan Wei and
Catalina O. Tudor and
Kalpana Raja and
Suresh Subramani and
Jeyakumar Natarajan and
Juan Miguel Cejuela and
Pratibha Dubey and
Cathy H. Wu},
title = {An overview of the BioCreative 2012 Workshop Track {III:} interactive
text mining task},
journal = {Database J. Biol. Databases Curation},
volume = {2013},
year = {2013},
url = {https://doi.org/10.1093/database/bas056},
doi = {10.1093/DATABASE/BAS056},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/biodb/ArighiCCKWFDCSDMLHGJRMBDBLCSPHALCMCBWLWTRSNCDW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/ZiminMPRSY13,
author = {Aleksey V. Zimin and
Guillaume Mar{\c{c}}ais and
Daniela Puiu and
Michael Roberts and
Steven L. Salzberg and
James A. Yorke},
title = {The MaSuRCA genome assembler},
journal = {Bioinform.},
volume = {29},
number = {21},
pages = {2669--2677},
year = {2013},
url = {https://doi.org/10.1093/bioinformatics/btt476},
doi = {10.1093/BIOINFORMATICS/BTT476},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/ZiminMPRSY13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/ObaraRAG13,
author = {Boguslaw Obara and
Mark A. J. Roberts and
Judith P. Armitage and
Vicente Grau},
title = {Bacterial cell identification in differential interference contrast
microscopy images},
journal = {{BMC} Bioinform.},
volume = {14},
pages = {134},
year = {2013},
url = {https://doi.org/10.1186/1471-2105-14-134},
doi = {10.1186/1471-2105-14-134},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/ObaraRAG13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cga/WakefieldHKRW13,
author = {Graham Wakefield and
Tobias H{\"{o}}llerer and
JoAnn Kuchera{-}Morin and
Charles Roberts and
Matthew Wright},
title = {Spatial Interaction in a Multiuser Immersive Instrument},
journal = {{IEEE} Computer Graphics and Applications},
volume = {33},
number = {6},
pages = {14--20},
year = {2013},
url = {https://doi.org/10.1109/MCG.2013.99},
doi = {10.1109/MCG.2013.99},
timestamp = {Tue, 20 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cga/WakefieldHKRW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/datascience/ThiemanRK13,
author = {James R. Thieman and
D. Aaron Roberts and
Todd King},
title = {{SPASE:} The Connection along Solar and Space Physics Data Centers},
journal = {Data Sci. J.},
volume = {12},
pages = {WDS147--WDS153},
year = {2013},
url = {https://doi.org/10.2481/dsj.WDS-025},
doi = {10.2481/DSJ.WDS-025},
timestamp = {Tue, 30 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/datascience/ThiemanRK13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jais/LowryGTHR13,
author = {Paul Benjamin Lowry and
James Eric Gaskin and
Nathan W. Twyman and
Bryan I. Hammer and
Tom L. Roberts},
title = {Taking "Fun and Games" Seriously: Proposing the Hedonic-Motivation
System Adoption Model {(HMSAM)}},
journal = {J. Assoc. Inf. Syst.},
volume = {14},
number = {11},
pages = {2},
year = {2013},
url = {https://doi.org/10.17705/1jais.00347},
doi = {10.17705/1JAIS.00347},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jais/LowryGTHR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocnet/CudaIRR13,
author = {Davide Cuda and
Raluca{-}Maria Indre and
Esther Le Rouzic and
James Roberts},
title = {Building a Low-Energy Transparent Optical Wide Area Network With "Multipaths"},
journal = {{JOCN}},
volume = {5},
number = {1},
pages = {56--67},
year = {2013},
url = {https://doi.org/10.1364/jocn.5.000056},
doi = {10.1364/JOCN.5.000056},
timestamp = {Fri, 12 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jocnet/CudaIRR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/MansuriJKHSBORMC13,
author = {Mozhgan Mansuri and
James E. Jaussi and
Joseph T. Kennedy and
Tzu{-}Chien Hsueh and
Sudip Shekhar and
Ganesh Balamurugan and
Frank O'Mahony and
Clark Roberts and
Randy Mooney and
Bryan Casper},
title = {A Scalable 0.128-1 Tb/s, 0.8-2.6 pJ/bit, 64-Lane Parallel {I/O} in
32-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {48},
number = {12},
pages = {3229--3242},
year = {2013},
url = {https://doi.org/10.1109/JSSC.2013.2279052},
doi = {10.1109/JSSC.2013.2279052},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/MansuriJKHSBORMC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/FernandesCBHCJRTSLSC13,
author = {Andrea C. Fernandes and
Danielle Cloete and
Matthew T. M. Broadbent and
Richard D. Hayes and
Chin{-}Kuo Chang and
Richard G. Jackson and
Angus Roberts and
Jason Tsang and
Murat Soncul and
Jennifer Liebscher and
Robert Stewart and
Felicity Callard},
title = {Development and evaluation of a de-identification procedure for a
case register sourced from mental health electronic records},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {13},
pages = {71},
year = {2013},
url = {https://doi.org/10.1186/1472-6947-13-71},
doi = {10.1186/1472-6947-13-71},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/midm/FernandesCBHCJRTSLSC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/misq/PoseyRLBC13,
author = {Clay Posey and
Tom L. Roberts and
Paul Benjamin Lowry and
Rebecca J. Bennett and
James F. Courtney},
title = {Insiders' Protection of Organizational Information Assets: Development
of a Systematics-Based Taxonomy and Theory of Diversity for Protection-Motivated
Behaviors},
journal = {{MIS} Q.},
volume = {37},
number = {4},
pages = {1189--1210},
year = {2013},
url = {https://doi.org/10.25300/misq/2013/37.4.09},
doi = {10.25300/MISQ/2013/37.4.09},
timestamp = {Thu, 30 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/misq/PoseyRLBC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/RobertsonHTCBVGMB13,
author = {James C. Robertson and
Nate C. Hurley and
Marcello Tortorici and
Giuseppe Ciossani and
Maria Teresa Borrello and
Nadeem A. Vellore and
A. Ganesan and
Andrea Mattevi and
Riccardo Baron},
title = {Expanding the Druggable Space of the LSD1/CoREST Epigenetic Target:
New Potential Binding Regions for Drug-Like Molecules, Peptides, Protein
Partners, and Chromatin},
journal = {PLoS Comput. Biol.},
volume = {9},
number = {7},
year = {2013},
url = {https://doi.org/10.1371/journal.pcbi.1003158},
doi = {10.1371/JOURNAL.PCBI.1003158},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/RobertsonHTCBVGMB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ram/DorigoFGMNBBBBBBCCDCDFFGGLMMOOPPRRSSSSTTTV13,
author = {Marco Dorigo and
Dario Floreano and
Luca Maria Gambardella and
Francesco Mondada and
Stefano Nolfi and
Tarek Baaboura and
Mauro Birattari and
Michael Bonani and
Manuele Brambilla and
Arne Brutschy and
Daniel Burnier and
Alexandre Campo and
Anders Lyhne Christensen and
Antal Decugniere and
Gianni Di Caro and
Frederick Ducatelle and
Eliseo Ferrante and
Alexander F{\"{o}}rster and
Javier Martinez Gonzales and
Jerome Guzzi and
Valentin Longchamp and
St{\'{e}}phane Magnenat and
Nithin Mathews and
Marco Antonio Montes de Oca and
Rehan O'Grady and
Carlo Pinciroli and
Giovanni Pini and
Philippe R{\'{e}}tornaz and
James F. Roberts and
Valerio Sperati and
Timothy S. Stirling and
Alessandro Stranieri and
Thomas St{\"{u}}tzle and
Vito Trianni and
Elio Tuci and
Ali Emre Turgut and
Florian Vaussard},
title = {Swarmanoid: {A} Novel Concept for the Study of Heterogeneous Robotic
Swarms},
journal = {{IEEE} Robotics Autom. Mag.},
volume = {20},
number = {4},
pages = {60--71},
year = {2013},
url = {https://doi.org/10.1109/MRA.2013.2252996},
doi = {10.1109/MRA.2013.2252996},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ram/DorigoFGMNBBBBBBCCDCDFFGGLMMOOPPRRSSSSTTTV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/RobertsGD13,
author = {Martin G. Roberts and
James Graham and
Hugh Devlin},
title = {Image Texture in Dental Panoramic Radiographs as a Potential Biomarker
of Osteoporosis},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {60},
number = {9},
pages = {2384--2392},
year = {2013},
url = {https://doi.org/10.1109/TBME.2013.2256908},
doi = {10.1109/TBME.2013.2256908},
timestamp = {Tue, 21 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/RobertsGD13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/MacfarlaneORJPW13,
author = {David G. Macfarlane and
Henry M. Odbert and
Duncan A. Robertson and
Mike R. James and
Harry Pinkerton and
Geoffrey Wadge},
title = {Topographic and Thermal Mapping of Volcanic Terrain Using the {AVTIS}
Ground-Based 94-GHz Dual-Mode Radar/Radiometric Imager},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {51},
number = {1},
pages = {455--472},
year = {2013},
url = {https://doi.org/10.1109/TGRS.2012.2202667},
doi = {10.1109/TGRS.2012.2202667},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/MacfarlaneORJPW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aldt/ChalupskyDHKMMORWX13,
author = {Hans Chalupsky and
Robert DeMarco and
Eduard H. Hovy and
Paul B. Kantor and
Alisa Matlin and
Priyam Mitra and
Birnur Ozbas and
Fred S. Roberts and
James Wojtowicz and
Minge Xie},
editor = {Patrice Perny and
Marc Pirlot and
Alexis Tsouki{\`{a}}s},
title = {Estimating Violation Risk for Fisheries Regulations},
booktitle = {Algorithmic Decision Theory - Third International Conference, {ADT}
2013, Bruxelles, Belgium, November 12-14, 2013, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8176},
pages = {297--308},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-41575-3\_23},
doi = {10.1007/978-3-642-41575-3\_23},
timestamp = {Mon, 03 Jan 2022 22:21:02 +0100},
biburl = {https://dblp.org/rec/conf/aldt/ChalupskyDHKMMORWX13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/HughesHR13,
author = {Ashley Hughes and
James R. Hopgood and
Neil M. Robertson},
title = {Height approximation for audio source localisation and tracking},
booktitle = {21st European Signal Processing Conference, {EUSIPCO} 2013, Marrakech,
Morocco, September 9-13, 2013},
pages = {1--5},
publisher = {{IEEE}},
year = {2013},
url = {https://ieeexplore.ieee.org/document/6811559/},
timestamp = {Mon, 09 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eusipco/HughesHR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/MillerDERHS13,
author = {Michele H. Miller and
James DeClerck and
William J. Endres and
Laura Roberts and
Kevin Hale and
Sheryl A. Sorby},
editor = {Randa L. Shehab and
James J. Sluss and
Deborah Anne Trytten},
title = {Evaluation of computer modules to teach metacognition and motivation
strategies},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2013, Oklahoma City,
Oklahoma, USA, October 23-26, 2013},
pages = {707--709},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/FIE.2013.6684918},
doi = {10.1109/FIE.2013.6684918},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fie/MillerDERHS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gfheu/McCallumB13,
author = {Simon McCallum and
Costas Boletsis},
editor = {Ben A. M. Schouten and
Stephen Fedtke and
Tilde Bekker and
Marlies P. Schijven and
Alex Gekker},
title = {A Taxonomy of Serious Games for Dementia},
booktitle = {Games for Health - Proceedings of the 3rd European Conference on Gaming
and Playful Interaction in Health Care, {GFHEU} 2013, Amsterdam, The
Netherlands, October 28-29, 2013},
pages = {219--232},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-658-02897-8\_17},
doi = {10.1007/978-3-658-02897-8\_17},
timestamp = {Sat, 19 Oct 2019 20:15:18 +0200},
biburl = {https://dblp.org/rec/conf/gfheu/McCallumB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/DArcaRH13,
author = {Eleonora D'Arca and
Neil M. Robertson and
James R. Hopgood},
title = {Using The Voice Spectrum For Improved Tracking Of People In {A} Joint
Audio-Video Scheme},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2013, Vancouver, BC, Canada, May 26-31, 2013},
pages = {3622--3626},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICASSP.2013.6638333},
doi = {10.1109/ICASSP.2013.6638333},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icassp/DArcaRH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/LarsonHHRSRSAKNSWLO13,
author = {Jay Walter Larson and
Markus Hegland and
Brendan Harding and
Stephen G. Roberts and
Linda Stals and
Alistair P. Rendell and
Peter E. Strazdins and
Md. Mohsin Ali and
Christoph Kowitz and
Ross H. Nobes and
James Southern and
Nicholas Wilson and
M. Li and
Y. Oishi},
editor = {Vassil Alexandrov and
Michael Lees and
Valeria V. Krzhizhanovskaya and
Jack J. Dongarra and
Peter M. A. Sloot},
title = {Fault-Tolerant Grid-Based Solvers: Combining Concepts from Sparse
Grids and MapReduce},
booktitle = {Proceedings of the International Conference on Computational Science,
{ICCS} 2013, Barcelona, Spain, 5-7 June, 2013},
series = {Procedia Computer Science},
volume = {18},
pages = {130--139},
publisher = {Elsevier},
year = {2013},
url = {https://doi.org/10.1016/j.procs.2013.05.176},
doi = {10.1016/J.PROCS.2013.05.176},
timestamp = {Tue, 19 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccS/LarsonHHRSRSAKNSWLO13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/DArcaHRH13,
author = {Eleonora D'Arca and
Ashley Hughes and
Neil M. Robertson and
James R. Hopgood},
title = {Video tracking through occlusions by fast audio source localisation},
booktitle = {{IEEE} International Conference on Image Processing, {ICIP} 2013,
Melbourne, Australia, September 15-18, 2013},
pages = {2660--2664},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ICIP.2013.6738548},
doi = {10.1109/ICIP.2013.6738548},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icip/DArcaHRH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/MillerJRBCJJFSRMUB13,
author = {Timothy L. Miller and
Mark W. James and
Jason B. Roberts and
Sayak K. Biswas and
Daniel Cecil and
W. Linwood Jones and
James W. Johnson and
Spencer Farrar and
Saleem Sahawneh and
Christopher S. Ruf and
Mary Morris and
Eric Uhlhorn and
Peter G. Black},
title = {The Hurricane Imaging Radiometer: Present and future},
booktitle = {2013 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2013, Melbourne, Australia, July 21-26, 2013},
pages = {1897--1899},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/IGARSS.2013.6723174},
doi = {10.1109/IGARSS.2013.6723174},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/igarss/MillerJRBCJJFSRMUB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/MansuriJKHSBORMC13,
author = {Mozhgan Mansuri and
James E. Jaussi and
Joseph T. Kennedy and
Tzu{-}Chien Hsueh and
Sudip Shekhar and
Ganesh Balamurugan and
Frank O'Mahony and
Clark Roberts and
Randy Mooney and
Bryan Casper},
title = {A scalable 0.128-to-1Tb/s 0.8-to-2.6pJ/b 64-lane parallel {I/O} in
32nm {CMOS}},
booktitle = {2013 {IEEE} International Solid-State Circuits Conference - Digest
of Technical Papers, {ISSCC} 2013, San Francisco, CA, USA, February
17-21, 2013},
pages = {402--403},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ISSCC.2013.6487788},
doi = {10.1109/ISSCC.2013.6487788},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/MansuriJKHSBORMC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medinfo/AswaniBB13,
author = {Niraj Aswani and
Thomas Beckers and
Erich Birngruber and
C{\'{e}}lia Boyer and
Andreas Burner and
Jakub Bystron and
Khalid Choukri and
Sarah Cruchet and
Hamish Cunningham and
Jan Dedek and
Ljiljana Dolamic and
Ren{\'{e}} Donner and
Sebastian Dungs and
Ivan Eggel and
Antonio Foncubierta{-}Rodr{\'{\i}}guez and
Norbert Fuhr and
Adam Funk and
Alba Garcia Seco de Herrera and
Arnaud Gaudinat and
Georgi Georgiev and
Julien Gobeill and
Lorraine Goeuriot and
Paz Gomez and
Robert Mark Greenwood and
Manfred Gschwandtner and
Allan Hanbury and
Jan Hajic and
Jaroslava Hlav{\'{a}}cov{\'{a}} and
Markus Holzer and
Gareth J. F. Jones and
Blanca Jordan and
Matthias Jordan and
Klemens Kaderk and
Franz Kainberger and
Liadh Kelly and
Sascha Kriewel and
Marlene Kritz and
Georg Langs and
Nolan Lawson and
Dimitrios Markonis and
Iv{\'{a}}n Mart{\'{\i}}nez and
Vassil Momtchev and
Alexandre Masselot and
H{\'{e}}l{\`{e}}ne Mazo and
Henning M{\"{u}}ller and
Jo{\~{a}}o R. M. Palotti and
Pavel Pecina and
Konstantin Pentchev and
Deyan Peychev and
Natalia Pletneva and
Diana Pottecher and
Angus Roberts and
Patrick Ruch and
Alexander Sachs and
Matthias Samwald and
Priscille Schneller and
Veronika Stefanov and
Miguel Angel Tinte and
Zdenka Uresov{\'{a}} and
Alejandro Vargas and
Dina Vishnyakova},
editor = {Christoph Ulrich Lehmann and
Elske Ammenwerth and
Christian N{\o}hr},
title = {Khresmoi - Multilingual Semantic Search of Medical Text and Images},
booktitle = {{MEDINFO} 2013 - Proceedings of the 14th World Congress on Medical
and Health Informatics, 20-13 August 2013, Copenhagen, Denmark},
series = {Studies in Health Technology and Informatics},
volume = {192},
pages = {1266},
publisher = {{IOS} Press},
year = {2013},
timestamp = {Tue, 16 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/medinfo/AswaniBB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nime/RobertsWW13,
author = {Charles Roberts and
Graham Wakefield and
Matthew Wright},
editor = {Woon Seung Yeo and
Kyogu Lee and
Alexander Sigman and
Haru (Hyunkyung) Ji and
Graham Wakefield},
title = {The Web Browser As Synthesizer And Interface},
booktitle = {13th International Conference on New Interfaces for Musical Expression,
{NIME} 2013, Daejeon, Republic of Korea, May 27-30, 2013},
pages = {313--318},
publisher = {nime.org},
year = {2013},
url = {https://doi.org/10.5281/zenodo.1178648},
doi = {10.5281/ZENODO.1178648},
timestamp = {Tue, 04 Apr 2023 16:52:05 +0200},
biburl = {https://dblp.org/rec/conf/nime/RobertsWW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/parco/LarsonSHHRSRAS13,
author = {Jay Walter Larson and
Peter E. Strazdins and
Markus Hegland and
Brendan Harding and
Stephen G. Roberts and
Linda Stals and
Alistair P. Rendell and
Md. Mohsin Ali and
James Southern},
editor = {Michael Bader and
Arndt Bode and
Hans{-}Joachim Bungartz and
Michael Gerndt and
Gerhard R. Joubert and
Frans J. Peters},
title = {Managing Complexity in the Parallel Sparse Grid Combination Technique},
booktitle = {Parallel Computing: Accelerating Computational Science and Engineering
(CSE), Proceedings of the International Conference on Parallel Computing,
ParCo 2013, 10-13 September 2013, Garching (near Munich), Germany},
series = {Advances in Parallel Computing},
volume = {25},
pages = {593--602},
publisher = {{IOS} Press},
year = {2013},
url = {https://doi.org/10.3233/978-1-61499-381-0-593},
doi = {10.3233/978-1-61499-381-0-593},
timestamp = {Tue, 19 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/parco/LarsonSHHRSRAS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ranlp/GorrellRJS13,
author = {Genevieve Gorrell and
Angus Roberts and
Richard G. Jackson and
Robert Stewart},
editor = {Guergana Savova and
Kevin Bretonnel Cohen and
Galia Angelova},
title = {Finding Negative Symptoms of Schizophrenia in Patient Records},
booktitle = {Proceedings of the Workshop on {NLP} for Medicine and Biology associated
with {RANLP} 2013, Hissar, Bulgaria, September 13, 2013},
pages = {9--17},
publisher = {{INCOMA} Ltd. Shoumen, {BULGARIA}},
year = {2013},
url = {https://aclanthology.org/W13-5102/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ranlp/GorrellRJS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sgda/BoletsisM13,
author = {Costas Boletsis and
Simon McCallum},
editor = {Minhua Ma and
Manuel Fradinho Duarte de Oliveira and
Sobah Abbas Petersen and
Jannicke Baalsrud Hauge},
title = {The Table Mystery: An Augmented Reality Collaborative Game for Chemistry
Education},
booktitle = {Serious Games Development and Applications - 4th International Conference,
{SGDA} 2013, Trondheim, Norway, September 25-27, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8101},
pages = {86--95},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-40790-1\_9},
doi = {10.1007/978-3-642-40790-1\_9},
timestamp = {Sun, 12 Nov 2023 02:15:34 +0100},
biburl = {https://dblp.org/rec/conf/sgda/BoletsisM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sgda/HansenAM13,
author = {Olav Brenna Hansen and
Adiljan Abdurihim and
Simon McCallum},
editor = {Minhua Ma and
Manuel Fradinho Duarte de Oliveira and
Sobah Abbas Petersen and
Jannicke Baalsrud Hauge},
title = {Emotion Recognition for Mobile Devices with a Potential Use in Serious
Games for Autism Spectrum Disorder},
booktitle = {Serious Games Development and Applications - 4th International Conference,
{SGDA} 2013, Trondheim, Norway, September 25-27, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8101},
pages = {1--14},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-40790-1\_1},
doi = {10.1007/978-3-642-40790-1\_1},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sgda/HansenAM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sgda/McCallumB13,
author = {Simon McCallum and
Costas Boletsis},
editor = {Minhua Ma and
Manuel Fradinho Duarte de Oliveira and
Sobah Abbas Petersen and
Jannicke Baalsrud Hauge},
title = {Dementia Games: {A} Literature Review of Dementia-Related Serious
Games},
booktitle = {Serious Games Development and Applications - 4th International Conference,
{SGDA} 2013, Trondheim, Norway, September 25-27, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8101},
pages = {15--27},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-40790-1\_2},
doi = {10.1007/978-3-642-40790-1\_2},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sgda/McCallumB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/teletraffic/RobertsS13,
author = {James Roberts and
Nada Sbihi},
title = {Exploring the memory-bandwidth tradeoff in an information-centric
network},
booktitle = {25th International Teletraffic Congress, {ITC} 2013, Shanghai, China,
September 10-12, 2013},
pages = {1--9},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ITC.2013.6662936},
doi = {10.1109/ITC.2013.6662936},
timestamp = {Sat, 12 Nov 2022 12:58:29 +0100},
biburl = {https://dblp.org/rec/conf/teletraffic/RobertsS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/daglib/p/McCallumM13,
author = {Simon McCallum and
Jayson Mackie},
editor = {Magy Seif El{-}Nasr and
Anders Drachen and
Alessandro Canossa},
title = {WebTics: {A} Web Based Telemetry and Metrics System for Small and
Medium Games},
booktitle = {Game Analytics, Maximizing the Value of Player Data},
pages = {169--193},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-1-4471-4769-5\_10},
doi = {10.1007/978-1-4471-4769-5\_10},
timestamp = {Sun, 25 Oct 2020 22:32:05 +0100},
biburl = {https://dblp.org/rec/books/daglib/p/McCallumM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/RobertsS13,
author = {James Roberts and
Nada Sbihi},
title = {Exploring the Memory-Bandwidth Tradeoff in an Information-Centric
Network},
journal = {CoRR},
volume = {abs/1309.5220},
year = {2013},
url = {http://arxiv.org/abs/1309.5220},
eprinttype = {arXiv},
eprint = {1309.5220},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/RobertsS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/arobots/RobertsSZF12,
author = {James F. Roberts and
Timothy S. Stirling and
Jean{-}Christophe Zufferey and
Dario Floreano},
title = {3-D relative positioning sensor for indoor flying robots},
journal = {Auton. Robots},
volume = {33},
number = {1-2},
pages = {5--20},
year = {2012},
url = {https://doi.org/10.1007/s10514-012-9277-0},
doi = {10.1007/S10514-012-9277-0},
timestamp = {Thu, 18 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/arobots/RobertsSZF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ccr/BonaldR12,
author = {Thomas Bonald and
James W. Roberts},
title = {Internet and the Erlang formula},
journal = {Comput. Commun. Rev.},
volume = {42},
number = {1},
pages = {23--30},
year = {2012},
url = {https://doi.org/10.1145/2096149.2096153},
doi = {10.1145/2096149.2096153},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ccr/BonaldR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/RonanVHMRSBJF12,
author = {Lisa Ronan and
Natalie L. Voets and
Morgan G. Hough and
Clare E. Mackay and
Neil Roberts and
John Suckling and
Edward T. Bullmore and
Anthony James and
Paul C. Fletcher},
title = {Consistency and interpretation of changes in millimeter-scale cortical
intrinsic curvature across three independent datasets in schizophrenia},
journal = {NeuroImage},
volume = {63},
number = {1},
pages = {611--621},
year = {2012},
url = {https://doi.org/10.1016/j.neuroimage.2012.06.034},
doi = {10.1016/J.NEUROIMAGE.2012.06.034},
timestamp = {Fri, 16 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/RonanVHMRSBJF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/NathanACLSHBHGDHAHMCFFKRAM12,
author = {Arokia Nathan and
Arman Ahnood and
Matthew T. Cole and
Sungsik Lee and
Yuji Suzuki and
Pritesh Hiralal and
Francesco Bonaccorso and
Tawfique Hasan and
Luis Garcia{-}Gancedo and
Andriy Dyadyusha and
Samiul Haque and
Piers Andrew and
Stephan Hofmann and
James Moultrie and
Daping Chu and
Andrew J. Flewitt and
Andrea C. Ferrari and
Michael J. Kelly and
John Robertson and
Gehan A. J. Amaratunga and
William I. Milne},
title = {Flexible Electronics: The Next Ubiquitous Platform},
journal = {Proc. {IEEE}},
volume = {100},
number = {Centennial-Issue},
pages = {1486--1517},
year = {2012},
url = {https://doi.org/10.1109/JPROC.2012.2190168},
doi = {10.1109/JPROC.2012.2190168},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pieee/NathanACLSHBHGDHAHMCFFKRAM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/FreyerRRB12,
author = {Frank Freyer and
James A. Roberts and
Petra Ritter and
Michael Breakspear},
title = {A Canonical Model of Multistability and Scale-Invariance in Biological
Systems},
journal = {PLoS Comput. Biol.},
volume = {8},
number = {8},
year = {2012},
url = {https://doi.org/10.1371/journal.pcbi.1002634},
doi = {10.1371/JOURNAL.PCBI.1002634},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/FreyerRRB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaifs/MohanMKL12,
author = {Shiwali Mohan and
Aaron Mininger and
James R. Kirk and
John E. Laird},
title = {Learning Grounded Language through Situated Interactive Instruction},
booktitle = {Robots Learning Interactively from Human Teachers, Papers from the
2012 {AAAI} Fall Symposium, Arlington, Virginia, USA, November 2-4,
2012},
series = {{AAAI} Technical Report},
volume = {{FS-12-07}},
publisher = {{AAAI}},
year = {2012},
url = {http://www.aaai.org/ocs/index.php/FSS/FSS12/paper/view/5662},
timestamp = {Tue, 08 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aaaifs/MohanMKL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcis/BurnsNCR12,
author = {A. J. Burns and
Prabashi Nanayakkara and
James F. Courtney and
Tom L. Roberts},
title = {Complex Adaptive Systems, Agent-Based Modeling and Information Assurance},
booktitle = {18th Americas Conference on Information Systems, {AMCIS} 2012, Seattle,
Washington, USA, August 9-11, 2012},
publisher = {Association for Information Systems},
year = {2012},
url = {http://aisel.aisnet.org/amcis2012/proceedings/DecisionSupport/34},
timestamp = {Sat, 18 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/amcis/BurnsNCR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dihu/LittauerWRLPB12,
author = {Richard Littauer and
James Winters and
Sean Roberts and
Hannah Little and
Michael Pleyer and
Bill Benzon},
editor = {Jan Christoph Meister},
title = {Academic Research in the Blogosphere: Adapting to New Opportunities
and Risks on the Internet},
booktitle = {7th Annual International Conference of the Alliance of Digital Humanities
Organizations, {DH} 2012, Hamburg, Germany, July 16-22, 2012, Conference
Abstracts},
pages = {268--269},
publisher = {Hamburg University Press},
year = {2012},
url = {http://www.dh2012.uni-hamburg.de/conference/programme/abstracts/academic-research-in-the-blogosphere-adapting-to-new-opportunities-and-risks-on-the-internet.1.html},
timestamp = {Thu, 09 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dihu/LittauerWRLPB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/GanzSPWR12,
author = {Aura Ganz and
James M. Schafer and
Elaine Puleo and
Carole Wilson and
Meg Robertson},
title = {Quantitative and qualitative evaluation of {PERCEPT} indoor navigation
system for visually impaired users},
booktitle = {Annual International Conference of the {IEEE} Engineering in Medicine
and Biology Society, {EMBC} 2012, San Diego, CA, USA, August 28 -
September 1, 2012},
pages = {5815--5818},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/EMBC.2012.6347316},
doi = {10.1109/EMBC.2012.6347316},
timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
biburl = {https://dblp.org/rec/conf/embc/GanzSPWR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/WhitingDLRDCM12,
author = {James Gerald Holland Whiting and
Nasser Djennati and
Yeong Yeh Lee and
Elaine V. Robertson and
Mohammad Hossein Derakhshan and
Patricia Connolly and
Kenneth E. L. McColl},
title = {Towards minimally invasive monitoring for gastroenterology -An external
Squamocolumnar Junction Locator},
booktitle = {Annual International Conference of the {IEEE} Engineering in Medicine
and Biology Society, {EMBC} 2012, San Diego, CA, USA, August 28 -
September 1, 2012},
pages = {1574--1577},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/EMBC.2012.6346244},
doi = {10.1109/EMBC.2012.6346244},
timestamp = {Mon, 29 Mar 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/WhitingDLRDCM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/MillerRHLDES12,
author = {Michele H. Miller and
Laura Roberts and
Kevin Hale and
David Lanier and
James DeClerck and
William J. Endres and
Sheryl A. Sorby},
editor = {Richard J. LeBlanc and
Ann E. K. Sobel},
title = {Work in progress: Development of computer modules to improve student
metacognition and motivation strategies},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2012, Seattle, WA,
USA, October 3-6, 2012},
pages = {1--2},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/FIE.2012.6462407},
doi = {10.1109/FIE.2012.6462407},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fie/MillerRHLDES12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/DerawiMWB12,
author = {Mohammad Omar Derawi and
Simon McCallum and
Heiko Witte and
Patrick Bours},
editor = {Anil K. Jain and
Arun Ross and
Salil Prabhakar and
Jaihie Kim},
title = {Biometric access control using Near Field Communication and smart
phones},
booktitle = {5th {IAPR} International Conference on Biometrics, {ICB} 2012, New
Delhi, India, March 29 - April 1, 2012},
pages = {490--497},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICB.2012.6199798},
doi = {10.1109/ICB.2012.6199798},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/icb/DerawiMWB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/StirlingRZF12,
author = {Timothy S. Stirling and
James F. Roberts and
Jean{-}Christophe Zufferey and
Dario Floreano},
title = {Indoor navigation with a swarm of flying robots},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2012, 14-18 May, 2012, St. Paul, Minnesota, {USA}},
pages = {4641--4647},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ICRA.2012.6224987},
doi = {10.1109/ICRA.2012.6224987},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/icra/StirlingRZF12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/RufRBJM12,
author = {Christopher Ruf and
J. Brent Roberts and
Sayak K. Biswas and
Mark W. James and
Timothy Miller},
title = {Calibration and image reconstruction for The Hurricane Imaging Radiometer
{(HIRAD)}},
booktitle = {2012 {IEEE} International Geoscience and Remote Sensing Symposium,
{IGARSS} 2012, Munich, Germany, July 22-27, 2012},
pages = {4641--4643},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/IGARSS.2012.6350431},
doi = {10.1109/IGARSS.2012.6350431},
timestamp = {Fri, 30 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/igarss/RufRBJM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/imaging/AriefMH12,
author = {Ibrahim Arief and
Simon McCallum and
Jon Yngve Hardeberg},
title = {Realtime Estimation of Illumination Direction for Augmented Reality
on Mobile Devices},
booktitle = {20th Color and Imaging Conference, {CIC} 2012, Los Angeles, California,
USA, November 12-16, 2012},
pages = {111--116},
publisher = {Society for Imaging Science and Technology},
year = {2012},
url = {https://doi.org/10.2352/CIC.2012.20.1.art00020},
doi = {10.2352/CIC.2012.20.1.ART00020},
timestamp = {Sat, 15 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/imaging/AriefMH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/FrickerRRS12,
author = {Christine Fricker and
Philippe Robert and
James Roberts and
Nada Sbihi},
title = {Impact of traffic mix on caching performance in a content-centric
network},
booktitle = {2012 Proceedings {IEEE} {INFOCOM} Workshops, Orlando, FL, USA, March
25-30, 2012},
pages = {310--315},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/INFCOMW.2012.6193511},
doi = {10.1109/INFCOMW.2012.6193511},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/infocom/FrickerRRS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/OueslatiRS12,
author = {Sara Oueslati and
James Roberts and
Nada Sbihi},
editor = {Albert G. Greenberg and
Kazem Sohraby},
title = {Flow-aware traffic control for a content-centric network},
booktitle = {Proceedings of the {IEEE} {INFOCOM} 2012, Orlando, FL, USA, March
25-30, 2012},
pages = {2417--2425},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/INFCOM.2012.6195631},
doi = {10.1109/INFCOM.2012.6195631},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/infocom/OueslatiRS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nime/RobertsWW12,
author = {Charles Roberts and
Graham Wakefield and
Matthew Wright},
editor = {Georg Essl and
R. Brent Gillespie and
Michael Gurevich and
Sile O'Modhrain},
title = {Mobile Controls On-The-Fly: An Abstraction for Distributed NIMEs},
booktitle = {12th International Conference on New Interfaces for Musical Expression,
{NIME} 2012, Ann Arbor, Michigan, USA, May 21-23, 2012},
publisher = {nime.org},
year = {2012},
url = {https://doi.org/10.5281/zenodo.1180581},
doi = {10.5281/ZENODO.1180581},
timestamp = {Tue, 04 Apr 2023 16:52:05 +0200},
biburl = {https://dblp.org/rec/conf/nime/RobertsWW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ondm/CudaIRR12,
author = {Davide Cuda and
Raluca{-}Maria Indre and
Esther Le Rouzic and
James Roberts},
editor = {Dimitra Simeonidou},
title = {Getting routers out of the core: Building an all-optical network with
"multipaths"},
booktitle = {16th International Conference on Optical Network Design and Modelling,
{ONDM} 2012, Colchester, United Kingdom, April 17-20, 2012},
pages = {1--6},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ONDM.2012.6210205},
doi = {10.1109/ONDM.2012.6210205},
timestamp = {Wed, 16 Oct 2019 14:14:48 +0200},
biburl = {https://dblp.org/rec/conf/ondm/CudaIRR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/phealth/McCallum12,
author = {Simon McCallum},
editor = {Bernd Blobel and
Peter Pharow and
Filipe Sousa},
title = {Gamification and Serious Games for Personalized Health},
booktitle = {pHealth 2012 - Proceedings of the 9th International Conference on
Wearable Micro and Nano Technologies for Personalized Health, Porto,
Portugal, June 26-28, 2012},
series = {Studies in Health Technology and Informatics},
volume = {177},
pages = {85--96},
publisher = {{IOS} Press},
year = {2012},
url = {https://doi.org/10.3233/978-1-61499-069-7-85},
doi = {10.3233/978-1-61499-069-7-85},
timestamp = {Wed, 04 Mar 2020 14:10:38 +0100},
biburl = {https://dblp.org/rec/conf/phealth/McCallum12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/socialcom/FondRNTC12,
author = {Timothy La Fond and
Dan Roberts and
Jennifer Neville and
James Tyler and
Stacey L. Connaughton},
title = {The Impact of Communication Structure and Interpersonal Dependencies
on Distributed Teams},
booktitle = {2012 International Conference on Privacy, Security, Risk and Trust,
{PASSAT} 2012, and 2012 International Confernece on Social Computing,
SocialCom 2012, Amsterdam, Netherlands, September 3-5, 2012},
pages = {558--565},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/SocialCom-PASSAT.2012.117},
doi = {10.1109/SOCIALCOM-PASSAT.2012.117},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/socialcom/FondRNTC12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/teletraffic/FrickerRR12,
author = {Christine Fricker and
Philippe Robert and
James Roberts},
title = {A versatile and accurate approximation for {LRU} cache performance},
booktitle = {24th International Teletraffic Congress, {ITC} 2012, Krak{\'{o}}w,
Poland, September 4-7, 2012},
pages = {1--8},
publisher = {{IEEE}},
year = {2012},
url = {https://ieeexplore.ieee.org/document/6331818/},
timestamp = {Sat, 12 Nov 2022 12:58:29 +0100},
biburl = {https://dblp.org/rec/conf/teletraffic/FrickerRR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1202-0108,
author = {Christine Fricker and
Philippe Robert and
James Roberts and
Nada Sbihi},
title = {Impact of traffic mix on caching performance in a content-centric
network},
journal = {CoRR},
volume = {abs/1202.0108},
year = {2012},
url = {http://arxiv.org/abs/1202.0108},
eprinttype = {arXiv},
eprint = {1202.0108},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1202-0108.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1202-3974,
author = {Christine Fricker and
Philippe Robert and
James Roberts},
title = {A versatile and accurate approximation for {LRU} cache performance},
journal = {CoRR},
volume = {abs/1202.3974},
year = {2012},
url = {http://arxiv.org/abs/1202.3974},
eprinttype = {arXiv},
eprint = {1202.3974},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1202-3974.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/ethos/AllenRobertson11,
author = {James Allen{-}Robertson},
title = {Digital culture industry: a history of digital distribution},
school = {University of York, {UK}},
year = {2011},
url = {https://ethos.bl.uk/OrderDetails.do?uin=uk.bl.ethos.546806},
timestamp = {Tue, 05 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/ethos/AllenRobertson11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/Marchler-BauerLACDDFGGGGHJKLLMMORSTYZZZB11,
author = {Aron Marchler{-}Bauer and
Shennan Lu and
John B. Anderson and
Farideh Chitsaz and
Myra K. Derbyshire and
Carol DeWeese{-}Scott and
Jessica H. Fong and
Lewis Y. Geer and
Renata C. Geer and
Noreen R. Gonzales and
Marc Gwadz and
David I. Hurwitz and
John D. Jackson and
Zhaoxi Ke and
Christopher J. Lanczycki and
Fu Lu and
Gabriele H. Marchler and
Mikhail Mullokandov and
Marina V. Omelchenko and
Cynthia L. Robertson and
James S. Song and
Narmada Thanki and
Roxanne A. Yamashita and
Dachuan Zhang and
Naigong Zhang and
Chanjuan Zheng and
Stephen H. Bryant},
title = {{CDD:} a Conserved Domain Database for the functional annotation of
proteins},
journal = {Nucleic Acids Res.},
volume = {39},
number = {Database-Issue},
pages = {225--229},
year = {2011},
url = {https://doi.org/10.1093/nar/gkq1189},
doi = {10.1093/NAR/GKQ1189},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nar/Marchler-BauerLACDDFGGGGHJKLLMMORSTYZZZB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/HamadehRAMMAP11,
author = {Abdullah Hamadeh and
Mark A. J. Roberts and
Elias August and
Patrick E. McSharry and
Philip K. Maini and
Judith P. Armitage and
Antonis Papachristodoulou},
title = {Feedback Control Architecture and the Bacterial Chemotaxis Network},
journal = {PLoS Comput. Biol.},
volume = {7},
number = {5},
year = {2011},
url = {https://doi.org/10.1371/journal.pcbi.1001130},
doi = {10.1371/JOURNAL.PCBI.1001130},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/HamadehRAMMAP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/questa/AntunesFR11,
author = {Nelson Antunes and
Christine Fricker and
James Roberts},
title = {Stability of multi-server polling system with server limits},
journal = {Queueing Syst. Theory Appl.},
volume = {68},
number = {3-4},
pages = {229--235},
year = {2011},
url = {https://doi.org/10.1007/s11134-011-9254-x},
doi = {10.1007/S11134-011-9254-X},
timestamp = {Mon, 18 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/questa/AntunesFR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccece/LoweMMRLS11,
author = {Brad Lowe and
David G. Michelson and
James Maynard and
Brian Roberts and
Geoff Ledingham and
Alan Swain},
title = {The Wavefront Wireless Commercialization Centre},
booktitle = {Proceedings of the 24th Canadian Conference on Electrical and Computer
Engineering, {CCECE} 2011, Niagara Falls, Ontario, Canada, 8-11 May,
2011},
pages = {1563--1566},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/CCECE.2011.6030729},
doi = {10.1109/CCECE.2011.6030729},
timestamp = {Wed, 06 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ccece/LoweMMRLS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/HamadehARMAIP11,
author = {Abdullah Hamadeh and
Elias August and
Mark A. J. Roberts and
Philip K. Maini and
Judith P. Armitage and
Brian P. Ingalls and
Antonis Papachristodoulou},
title = {Feedback control architecture of the R. sphaeroides chemotaxis network},
booktitle = {50th {IEEE} Conference on Decision and Control and European Control
Conference, 11th European Control Conference, {CDC/ECC} 2011, Orlando,
FL, USA, December 12-15, 2011},
pages = {3014--3019},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/CDC.2011.6161020},
doi = {10.1109/CDC.2011.6161020},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cdc/HamadehARMAIP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/HeatonRG11,
author = {James T. Heaton and
Mark Robertson and
Cliff Griffin},
title = {Development of a wireless electromyographically controlled electrolarynx
voice prosthesis},
booktitle = {33rd Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2011, Boston, MA, USA, August
30 - Sept. 3, 2011},
pages = {5352--5355},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/IEMBS.2011.6091324},
doi = {10.1109/IEMBS.2011.6091324},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/HeatonRG11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/JourneeCRJS11,
author = {Matthew Journee and
Xiaoqi Chen and
James Robertson and
Mark Jermy and
Mathieu Sellier},
title = {An investigation into improved non-contact adhesion mechanism suitable
for wall climbing robotic applications},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2011, Shanghai, China, 9-13 May 2011},
pages = {4915--4920},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/ICRA.2011.5979842},
doi = {10.1109/ICRA.2011.5979842},
timestamp = {Fri, 27 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icra/JourneeCRJS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/teletraffic/AugeOR11,
author = {Jordan Aug{\'{e}} and
Sara Oueslati and
James Roberts},
editor = {{\AA}ke Arvidsson and
Gustavo de Veciana and
Steven H. Low and
Charles R. Kalmanek and
Deep Medhi},
title = {Measurement-based admission control for flow-aware implicit service
differentiation},
booktitle = {23rd International Teletraffic Congress, {ITC} 2011, San Francisco,
CA, USA, September 6-9, 2011},
pages = {206--213},
publisher = {{IEEE}},
year = {2011},
url = {https://ieeexplore.ieee.org/document/6038483/},
timestamp = {Sat, 12 Nov 2022 12:58:30 +0100},
biburl = {https://dblp.org/rec/conf/teletraffic/AugeOR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/teletraffic/RobertR11,
author = {Philippe Robert and
James Roberts},
editor = {{\AA}ke Arvidsson and
Gustavo de Veciana and
Steven H. Low and
Charles R. Kalmanek and
Deep Medhi},
title = {A flow-aware {MAC} protocol for a passive optical metropolitan area
network},
booktitle = {23rd International Teletraffic Congress, {ITC} 2011, San Francisco,
CA, USA, September 6-9, 2011},
pages = {166--173},
publisher = {{IEEE}},
year = {2011},
url = {https://ieeexplore.ieee.org/document/6038478/},
timestamp = {Sat, 12 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/teletraffic/RobertR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1102-3538,
author = {Philippe Robert and
James Roberts},
title = {A Flow-aware {MAC} Protocol for a Passive Optical Metropolitan Area
Network},
journal = {CoRR},
volume = {abs/1102.3538},
year = {2011},
url = {http://arxiv.org/abs/1102.3538},
eprinttype = {arXiv},
eprint = {1102.3538},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1102-3538.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1110-1245,
author = {Davide Cuda and
Raluca{-}Maria Indre and
Esther Le Rouzic and
James Roberts},
title = {Getting routers out of the core: Building an optical wide area network
with "multipaths"},
journal = {CoRR},
volume = {abs/1110.1245},
year = {2011},
url = {http://arxiv.org/abs/1110.1245},
eprinttype = {arXiv},
eprint = {1110.1245},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1110-1245.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/DaveyJDR10,
author = {Robert P. Davey and
Stephen A. James and
Jo L. Dicks and
Ian N. Roberts},
title = {{TURNIP:} tracking unresolved nucleotide polymorphisms in large hard-to-assemble
regions of repetitive {DNA} sequence},
journal = {Bioinform.},
volume = {26},
number = {22},
pages = {2908--2909},
year = {2010},
url = {https://doi.org/10.1093/bioinformatics/btq557},
doi = {10.1093/BIOINFORMATICS/BTQ557},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/DaveyJDR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chb/DennistonBKEMKRFR10,
author = {Maxine M. Denniston and
Nancy D. Brener and
Laura Kann and
Danice K. Eaton and
Timothy McManus and
Tonja M. Kyle and
Alice M. Roberts and
Katherine H. Flint and
James G. Ross},
title = {Comparison of paper-and-pencil versus Web administration of the Youth
Risk Behavior Survey {(YRBS):} Participation, data quality, and perceived
privacy and anonymity},
journal = {Comput. Hum. Behav.},
volume = {26},
number = {5},
pages = {1054--1060},
year = {2010},
url = {https://doi.org/10.1016/j.chb.2010.03.006},
doi = {10.1016/J.CHB.2010.03.006},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/chb/DennistonBKEMKRFR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/datascience/ThiemanRKHPR10,
author = {James R. Thieman and
D. Aaron Roberts and
Todd King and
Christopher C. Harvey and
Christopher H. Perry and
Phil Richards},
title = {{SPASE} and the Heliophysics Virtual Observatories},
journal = {Data Sci. J.},
volume = {9},
pages = {IGY85--IGY93},
year = {2010},
url = {https://doi.org/10.2481/dsj.SS\_IGY-019},
doi = {10.2481/DSJ.SS\_IGY-019},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/datascience/ThiemanRKHPR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esi/KingTR10,
author = {Todd King and
James R. Thieman and
D. Aaron Roberts},
title = {{SPASE} 2.0: a standard data model for space physics},
journal = {Earth Sci. Informatics},
volume = {3},
number = {1-2},
pages = {67--73},
year = {2010},
url = {https://doi.org/10.1007/s12145-010-0053-4},
doi = {10.1007/S12145-010-0053-4},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/esi/KingTR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijt/AllenR10,
author = {Peter James Allen and
Lynne D. Roberts},
title = {The Ethics of Outsourcing Online Survey Research},
journal = {Int. J. Technoethics},
volume = {1},
number = {3},
pages = {35--48},
year = {2010},
url = {https://doi.org/10.4018/jte.2010070104},
doi = {10.4018/JTE.2010070104},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijt/AllenR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijt/AllenSR10,
author = {Peter James Allen and
Katherine Shepherd and
Lynne D. Roberts},
title = {Peer-to-Peer File-Sharing: Psychological Reactance and the Theory
of Planned Behaviour},
journal = {Int. J. Technoethics},
volume = {1},
number = {4},
pages = {49--64},
year = {2010},
url = {https://doi.org/10.4018/jte.2010100104},
doi = {10.4018/JTE.2010100104},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijt/AllenSR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/OMahonyJKBMRSMC10,
author = {Frank O'Mahony and
James E. Jaussi and
Joseph T. Kennedy and
Ganesh Balamurugan and
Mozhgan Mansuri and
Clark Roberts and
Sudip Shekhar and
Randy Mooney and
Bryan Casper},
title = {A 47 , {\(^\times\)}, 10 Gb/s 1.4 mW/Gb/s Parallel Interface in 45
nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {45},
number = {12},
pages = {2828--2837},
year = {2010},
url = {https://doi.org/10.1109/JSSC.2010.2076214},
doi = {10.1109/JSSC.2010.2076214},
timestamp = {Sun, 30 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/OMahonyJKBMRSMC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/KimCJWGNZRRWS10,
author = {Jaebum Kim and
Ryan Cunningham and
Brian James and
Stefan Wyder and
Joshua D. Gibson and
Oliver Niehuis and
Evgeny M. Zdobnov and
Hugh M. Robertson and
Gene E. Robinson and
John H. Werren and
Saurabh Sinha},
title = {Functional Characterization of Transcription Factor Motifs Using Cross-species
Comparison across Large Evolutionary Distances},
journal = {PLoS Comput. Biol.},
volume = {6},
number = {1},
year = {2010},
url = {https://doi.org/10.1371/journal.pcbi.1000652},
doi = {10.1371/JOURNAL.PCBI.1000652},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/KimCJWGNZRRWS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/globecom/AntunesFRR10,
author = {Nelson Antunes and
Christine Fricker and
Philippe Robert and
James Roberts},
title = {GATE-Driven Dynamic Wavelength and Bandwidth Allocation for {WDM}
EPONs},
booktitle = {Proceedings of the Global Communications Conference, 2010. {GLOBECOM}
2010, 6-10 December 2010, Miami, Florida, {USA}},
pages = {1--5},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/GLOCOM.2010.5683190},
doi = {10.1109/GLOCOM.2010.5683190},
timestamp = {Fri, 02 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/globecom/AntunesFRR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpsr/RobertsonBN10,
author = {Glenn Robertson and
James Bedenbaugh and
Srihari Nelakuditi},
title = {Fast convergence with fast reroute in {IP} networks},
booktitle = {Proceedings of the 11th {IEEE} International Conference on High Performance
Switching and Routing, {HPSR} 2010, 13-16 June 2010, Richardson, Texas,
{USA}},
pages = {100--106},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/HPSR.2010.5580263},
doi = {10.1109/HPSR.2010.5580263},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/hpsr/RobertsonBN10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iitm/BownFSSFGIRSS10,
author = {James Bown and
Kenneth Fee and
Adam Sampson and
Mark M. Shovman and
Ruth Falconer and
Alexey N. Goltsov and
J. Issacs and
Paul Robertson and
Kenneth C. Scott{-}Brown and
Andrea Szymkowiak},
editor = {M. D. Tiwari and
R. C. Tripathi and
Anupam Agrawal},
title = {Information visualization and the arts-science-social science interface},
booktitle = {Proceedings of the First International Conference on Intelligent Interactive
Technologies and Multimedia, {IITM} '10, Allahabad, India, December
27-30, 2010},
pages = {9--17},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1963564.1963566},
doi = {10.1145/1963564.1963566},
timestamp = {Fri, 28 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iitm/BownFSSFGIRSS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/TaylorCR10,
author = {C. James Taylor and
Arun Chotai and
David Robertson},
title = {State dependent control of a robotic manipulator used for nuclear
decommissioning activities},
booktitle = {2010 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, October 18-22, 2010, Taipei, Taiwan},
pages = {2413--2418},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/IROS.2010.5650272},
doi = {10.1109/IROS.2010.5650272},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/TaylorCR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/RobertsGD10,
author = {Martin G. Roberts and
James Graham and
Hugh Devlin},
title = {Improving the detection of osteoporosis from dental radiographs using
active appearance models},
booktitle = {Proceedings of the 2010 {IEEE} International Symposium on Biomedical
Imaging: From Nano to Macro, Rotterdam, The Netherlands, 14-17 April,
2010},
pages = {440--443},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ISBI.2010.5490314},
doi = {10.1109/ISBI.2010.5490314},
timestamp = {Wed, 04 Oct 2023 17:01:25 +0200},
biburl = {https://dblp.org/rec/conf/isbi/RobertsGD10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isscc/OMahonyKJBMRSMC10,
author = {Frank O'Mahony and
Joseph T. Kennedy and
James E. Jaussi and
Ganesh Balamurugan and
Mozhgan Mansuri and
Clark Roberts and
Sudip Shekhar and
Randy Mooney and
Bryan Casper},
title = {A 47{\texttimes}10Gb/s 1.4mW/(Gb/s) parallel interface in 45nm {CMOS}},
booktitle = {{IEEE} International Solid-State Circuits Conference, {ISSCC} 2010,
Digest of Technical Papers, San Francisco, CA, USA, 7-11 February,
2010},
pages = {156--157},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ISSCC.2010.5434009},
doi = {10.1109/ISSCC.2010.5434009},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/isscc/OMahonyKJBMRSMC10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nime/RobertsWKP10,
author = {Charles Roberts and
Matthew Wright and
JoAnn Kuchera{-}Morin and
Lance Putnam},
title = {Dynamic Interactivity Inside the AlloSphere},
booktitle = {10th International Conference on New Interfaces for Musical Expression,
{NIME} 2010, Sydney, Australia, June 15-18, 2010},
pages = {57--62},
publisher = {nime.org},
year = {2010},
url = {https://doi.org/10.5281/zenodo.1177883},
doi = {10.5281/ZENODO.1177883},
timestamp = {Tue, 04 Apr 2023 16:52:05 +0200},
biburl = {https://dblp.org/rec/conf/nime/RobertsWKP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/teletraffic/AntunesFRR10,
author = {Nelson Antunes and
Christine Fricker and
Philippe Robert and
James Roberts},
title = {Traffic capacity of large {WDM} passive optical networks},
booktitle = {22nd International Teletraffic Congress, {ITC} 2010, Amsterdam, The
Netherlands, September 7-9, 2010},
pages = {1--8},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ITC.2010.5608742},
doi = {10.1109/ITC.2010.5608742},
timestamp = {Sat, 12 Nov 2022 12:58:30 +0100},
biburl = {https://dblp.org/rec/conf/teletraffic/AntunesFRR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1002-2384,
author = {Nelson Antunes and
Christine Fricker and
Philippe Robert and
James Roberts},
title = {Upstream traffic capacity of a {WDM} {EPON} under online GATE-driven
scheduling},
journal = {CoRR},
volume = {abs/1002.2384},
year = {2010},
url = {http://arxiv.org/abs/1002.2384},
eprinttype = {arXiv},
eprint = {1002.2384},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1002-2384.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1002-2385,
author = {Nelson Antunes and
Christine Fricker and
Philippe Robert and
James Roberts},
title = {Traffic Capacity of Large {WDM} Passive Optical Networks},
journal = {CoRR},
volume = {abs/1002.2385},
year = {2010},
url = {http://arxiv.org/abs/1002.2385},
eprinttype = {arXiv},
eprint = {1002.2385},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1002-2385.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/adt/Roberts09,
author = {James Roberts},
title = {The clean-slate approach to future Internet design: a survey of research
initiatives},
journal = {Ann. des T{\'{e}}l{\'{e}}communications},
volume = {64},
number = {5-6},
pages = {271--276},
year = {2009},
url = {https://doi.org/10.1007/s12243-009-0109-y},
doi = {10.1007/S12243-009-0109-Y},
timestamp = {Wed, 20 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/adt/Roberts09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcsb/RobertsAHMMAP09,
author = {Mark A. J. Roberts and
Elias August and
Abdullah Hamadeh and
Philip K. Maini and
Patrick E. McSharry and
Judith P. Armitage and
Antonis Papachristodoulou},
title = {A model invalidation-based approach for elucidating biological signalling
pathways, applied to the chemotaxis pathway in R. sphaeroides},
journal = {{BMC} Syst. Biol.},
volume = {3},
pages = {105},
year = {2009},
url = {https://doi.org/10.1186/1752-0509-3-105},
doi = {10.1186/1752-0509-3-105},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcsb/RobertsAHMMAP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejasp/NewmanDWERPDWKMMR09,
author = {Timothy R. Newman and
Daniel DePardo and
Alexander M. Wyglinski and
Joseph B. Evans and
Rakesh Rajbanshi and
Victor R. Petty and
Dinesh Datla and
Frederick Weidling and
Paul J. Kolodzy and
Michael J. Marcus and
Gary J. Minden and
James A. Roberts},
title = {Measurements and Analysis of Secondary User Device Effects on Digital
Television Receivers},
journal = {{EURASIP} J. Adv. Signal Process.},
volume = {2009},
year = {2009},
url = {https://doi.org/10.1155/2009/510867},
doi = {10.1155/2009/510867},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ejasp/NewmanDWERPDWKMMR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tamm/BeanlandRS09,
author = {Kevin Beanland and
James W. Roberts and
Craig Stevenson},
title = {Modifications of Thomae's Function and Differentiability},
journal = {Am. Math. Mon.},
volume = {116},
number = {6},
pages = {531--535},
year = {2009},
url = {http://www.jstor.org/stable/40391145},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tamm/BeanlandRS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/CataldoMRH09,
author = {Marcelo Cataldo and
Audris Mockus and
Jeffrey A. Roberts and
James D. Herbsleb},
title = {Software Dependencies, Work Dependencies, and Their Impact on Failures},
journal = {{IEEE} Trans. Software Eng.},
volume = {35},
number = {6},
pages = {864--878},
year = {2009},
url = {https://doi.org/10.1109/TSE.2009.42},
doi = {10.1109/TSE.2009.42},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tse/CataldoMRH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcis/BrewerCRR09,
author = {Kristen L. Brewer and
James F. Courtney and
Sandra M. Richardson and
Tom L. Roberts},
editor = {Robert C. Nickerson and
Ramesh Sharda},
title = {Inquiring Decision Systems: {A} Churchmanian Approach to Ethical Decision
Making},
booktitle = {Proceedings of the 15th Americas Conference on Information Systems,
{AMCIS} 2009, San Francisco, California, USA, August 6-9, 2009},
pages = {600},
publisher = {Association for Information Systems},
year = {2009},
url = {http://aisel.aisnet.org/amcis2009/600},
timestamp = {Mon, 02 Jan 2012 19:01:22 +0100},
biburl = {https://dblp.org/rec/conf/amcis/BrewerCRR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bionlp/SarafrazEMDRN09,
author = {Farzaneh Sarafraz and
James M. Eales and
Reza Mohammadi and
Jonathan E. Dickerson and
David Robertson and
Goran Nenadic},
title = {Biomedical Event Detection using Rules, Conditional Random Fields
and Parse Tree Distances},
booktitle = {Proceedings of the BioNLP 2009 Workshop Companion Volume for Shared
Task, BioNLP@HLT-NAACL 2009 - Shared Task, Boulder, Colorado, USA,
June 5, 2009},
pages = {115--118},
publisher = {Association for Computational Linguistics},
year = {2009},
url = {https://aclanthology.org/W09-1417/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bionlp/SarafrazEMDRN09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/GruensteinOLRZRMSGC09,
author = {Alexander Gruenstein and
Jarrod Orszulak and
Sean Liu and
Shannon C. Roberts and
Jeff Zabel and
Bryan Reimer and
Bruce Mehler and
Stephanie Seneff and
James R. Glass and
Joseph F. Coughlin},
editor = {Dan R. Olsen Jr. and
Richard B. Arthur and
Ken Hinckley and
Meredith Ringel Morris and
Scott E. Hudson and
Saul Greenberg},
title = {City browser: developing a conversational automotive {HMI}},
booktitle = {Proceedings of the 27th International Conference on Human Factors
in Computing Systems, {CHI} 2009, Extended Abstracts Volume, Boston,
MA, USA, April 4-9, 2009},
pages = {4291--4296},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1520340.1520655},
doi = {10.1145/1520340.1520655},
timestamp = {Fri, 14 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/GruensteinOLRZRMSGC09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/BonaldIR09,
author = {Thomas Bonald and
Ali Ibrahim and
James W. Roberts},
title = {Enhanced Spatial Reuse in Multi-Cell WLANs},
booktitle = {{INFOCOM} 2009. 28th {IEEE} International Conference on Computer Communications,
Joint Conference of the {IEEE} Computer and Communications Societies,
19-25 April 2009, Rio de Janeiro, Brazil},
pages = {2626--2630},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/INFCOM.2009.5062200},
doi = {10.1109/INFCOM.2009.5062200},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/infocom/BonaldIR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/RobertsSZF09,
author = {James F. Roberts and
Timothy S. Stirling and
Jean{-}Christophe Zufferey and
Dario Floreano},
title = {2.5D infrared range and bearing system for collective robotics},
booktitle = {2009 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, October 11-15, 2009, St. Louis, MO, {USA}},
pages = {3659--3664},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/IROS.2009.5354263},
doi = {10.1109/IROS.2009.5354263},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/RobertsSZF09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ispa/EspenshadePLRC09,
author = {Jeremy Espenshade and
Andrew Pangborn and
Gregor von Laszewski and
Douglas Roberts and
James S. Cavenaugh},
title = {Accelerating Partitional Algorithms for Flow Cytometry on GPUs},
booktitle = {{IEEE} International Symposium on Parallel and Distributed Processing
with Applications, {ISPA} 2009, Chengdu, Sichuan, China, 10-12 August
2009},
pages = {226--233},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/ISPA.2009.29},
doi = {10.1109/ISPA.2009.29},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ispa/EspenshadePLRC09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ngi/IbrahimMR09,
author = {Ali Ibrahim and
Luca Muscariello and
James Roberts},
title = {A Single Channel Signalling Mechanism for Power/Rate Control in WLANs},
booktitle = {Next Generation Internet Networks, 2009. {NGI} '09, Aviero, Portugal,
July 1-3, 2009},
pages = {1--8},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/NGI.2009.5175752},
doi = {10.1109/NGI.2009.5175752},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/ngi/IbrahimMR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/teletraffic/BonaldORR09,
author = {Thomas Bonald and
Sara Oueslati and
James W. Roberts and
Charlotte Roger},
title = {Swing: Traffic capacity of a simple {WDM} ring network},
booktitle = {21st International Teletraffic Congress, {ITC} 2009, Paris, France,
September 15-17, 2009},
pages = {1--8},
publisher = {{IEEE}},
year = {2009},
url = {https://ieeexplore.ieee.org/document/5300240/},
timestamp = {Sat, 12 Nov 2022 12:58:30 +0100},
biburl = {https://dblp.org/rec/conf/teletraffic/BonaldORR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/teletraffic/IbrahimR09,
author = {Ali Ibrahim and
James Roberts},
title = {A traffic-oriented approach for channel assignment in {WLAN}},
booktitle = {21st International Teletraffic Congress, {ITC} 2009, Paris, France,
September 15-17, 2009},
pages = {1--8},
publisher = {{IEEE}},
year = {2009},
url = {https://ieeexplore.ieee.org/document/5300226/},
timestamp = {Sat, 12 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/teletraffic/IbrahimR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/um/DucheneautPHPRCBB09,
author = {Nicolas Ducheneaut and
Kurt Partridge and
Qingfeng Huang and
Bob Price and
Michael Roberts and
Ed H. Chi and
Victoria Bellotti and
Bo Begole},
editor = {Geert{-}Jan Houben and
Gordon I. McCalla and
Fabio Pianesi and
Massimo Zancanaro},
title = {Collaborative Filtering Is Not Enough? Experiments with a Mixed-Model
Recommender for Leisure Activities},
booktitle = {User Modeling, Adaptation, and Personalization, 17th International
Conference, {UMAP} 2009, formerly {UM} and AH, Trento, Italy, June
22-26, 2009. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5535},
pages = {295--306},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-02247-0\_28},
doi = {10.1007/978-3-642-02247-0\_28},
timestamp = {Tue, 14 May 2019 10:00:47 +0200},
biburl = {https://dblp.org/rec/conf/um/DucheneautPHPRCBB09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wiopt/BonaldIR09,
author = {Thomas Bonald and
Ali Ibrahim and
James W. Roberts},
editor = {Song Chong and
Wan Choi},
title = {The impact of association on the capacity of WLANs},
booktitle = {7th International Symposium on Modeling and Optimization in Mobile,
Ad Hoc, and Wireless Networks, WiOpt 2009, Seoul, Korea, June 23-27,
2009},
pages = {1--10},
publisher = {{IEEE}},
year = {2009},
url = {https://doi.org/10.1109/WIOPT.2009.5291644},
doi = {10.1109/WIOPT.2009.5291644},
timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
biburl = {https://dblp.org/rec/conf/wiopt/BonaldIR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/WhiteRYP08,
author = {James Robert White and
Michael Roberts and
James A. Yorke and
Mihai Pop},
title = {Figaro: a novel statistical method for vector sequence removal},
journal = {Bioinform.},
volume = {24},
number = {4},
pages = {462--467},
year = {2008},
url = {https://doi.org/10.1093/bioinformatics/btm632},
doi = {10.1093/BIOINFORMATICS/BTM632},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/WhiteRYP08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/EalesPSR08,
author = {James M. Eales and
John W. Pinney and
Robert D. Stevens and
David L. Robertson},
title = {Methodology capture: discriminating between the "best" and the rest
of community practice},
journal = {{BMC} Bioinform.},
volume = {9},
year = {2008},
url = {https://doi.org/10.1186/1471-2105-9-359},
doi = {10.1186/1471-2105-9-359},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bmcbi/EalesPSR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esi/HarveyGKPRT08,
author = {Christopher C. Harvey and
Michel Gangloff and
Todd King and
Christopher H. Perry and
D. Aaron Roberts and
James R. Thieman},
title = {Virtual observatories for space and solar physics research},
journal = {Earth Sci. Informatics},
volume = {1},
number = {1},
pages = {5--13},
year = {2008},
url = {https://doi.org/10.1007/s12145-008-0008-1},
doi = {10.1007/S12145-008-0008-1},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/esi/HarveyGKPRT08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/BakkenCLRCC08,
author = {Suzanne Bakken and
Leanne M. Currie and
Nam{-}Ju Lee and
W. Dan Roberts and
Sarah A. Collins and
James J. Cimino},
title = {Integrating evidence into clinical information systems for nursing
decision support},
journal = {Int. J. Medical Informatics},
volume = {77},
number = {6},
pages = {413--420},
year = {2008},
url = {https://doi.org/10.1016/j.ijmedinf.2007.08.006},
doi = {10.1016/J.IJMEDINF.2007.08.006},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijmi/BakkenCLRCC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/VangalHRDWTFSJJ08,
author = {Sriram R. Vangal and
Jason Howard and
Gregory Ruhl and
Saurabh Dighe and
Howard Wilson and
James W. Tschanz and
David Finan and
Arvind P. Singh and
Tiju Jacob and
Shailendra Jain and
Vasantha Erraguntla and
Clark Roberts and
Yatin Vasant Hoskote and
Nitin Borkar and
Shekhar Borkar},
title = {An 80-Tile Sub-100-W TeraFLOPS Processor in 65-nm {CMOS}},
journal = {{IEEE} J. Solid State Circuits},
volume = {43},
number = {1},
pages = {29--41},
year = {2008},
url = {https://doi.org/10.1109/JSSC.2007.910957},
doi = {10.1109/JSSC.2007.910957},
timestamp = {Wed, 20 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/VangalHRDWTFSJJ08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/RomeroGCRAW08,
author = {I{\~{n}}aki Romero and
Neil R. Grubb and
Gareth R. Clegg and
Colin E. Robertson and
Paul S. Addison and
James N. Watson},
title = {T-Wave Alternans Found in Preventricular Tachyarrhythmias in {CCU}
Patients Using a Wavelet Transform-Based Methodology},
journal = {{IEEE} Trans. Biomed. Eng.},
volume = {55},
number = {11},
pages = {2658--2665},
year = {2008},
url = {https://doi.org/10.1109/TBME.2008.923912},
doi = {10.1109/TBME.2008.923912},
timestamp = {Wed, 02 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tbe/RomeroGCRAW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acssc/CaldwellR08,
author = {James Caldwell and
Clark Robertson},
title = {Long block length reed solomon coded M-ary hyper phase-shift keying},
booktitle = {42nd Asilomar Conference on Signals, Systems and Computers, {ACSSC}
2008, Pacific Grove, CA, USA, October 26-29, 2008},
pages = {413--417},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/ACSSC.2008.5074437},
doi = {10.1109/ACSSC.2008.5074437},
timestamp = {Thu, 05 Jan 2023 10:07:58 +0100},
biburl = {https://dblp.org/rec/conf/acssc/CaldwellR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atal/NeufeldSRMWB08,
author = {James Neufeld and
Michael Sokolsky and
Jason Roberts and
Adam Milstein and
Stephen Walsh and
Michael H. Bowling},
editor = {Lin Padgham and
David C. Parkes and
J{\"{o}}rg P. M{\"{u}}ller and
Simon Parsons},
title = {Autonomous geocaching: navigation and goal finding in outdoor domains},
booktitle = {7th International Joint Conference on Autonomous Agents and Multiagent
Systems {(AAMAS} 2008), Estoril, Portugal, May 12-16, 2008, Volume
1},
pages = {47--54},
publisher = {{IFAAMAS}},
year = {2008},
url = {https://dl.acm.org/citation.cfm?id=1402395},
timestamp = {Fri, 30 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/atal/NeufeldSRMWB08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/AugustPRRJ08,
author = {Elias August and
Antonis Papachristodoulou and
Benjamin Recht and
Mark Andrew James Roberts and
Ali Jadbabaie},
title = {Determining interconnections in biochemical networks using linear
programming},
booktitle = {Proceedings of the 47th {IEEE} Conference on Decision and Control,
{CDC} 2008, December 9-11, 2008, Canc{\'{u}}n, Mexico},
pages = {3311--3316},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/CDC.2008.4739286},
doi = {10.1109/CDC.2008.4739286},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cdc/AugustPRRJ08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/BellottiBCDFIKNPPRRSW08,
author = {Victoria Bellotti and
James Bo Begole and
Ed Huai{-}hsin Chi and
Nicolas Ducheneaut and
Ji Fang and
Ellen Isaacs and
Tracy Holloway King and
Mark W. Newman and
Kurt Partridge and
Bob Price and
Paul Rasmussen and
Michael Roberts and
Diane J. Schiano and
Alan Walendowski},
editor = {Mary Czerwinski and
Arnold M. Lund and
Desney S. Tan},
title = {Activity-based serendipitous recommendations with the Magitti mobile
leisure guide},
booktitle = {Proceedings of the 2008 Conference on Human Factors in Computing Systems,
{CHI} 2008, 2008, Florence, Italy, April 5-10, 2008},
pages = {1157--1166},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1357054.1357237},
doi = {10.1145/1357054.1357237},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/BellottiBCDFIKNPPRRSW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/RobertsZF08,
author = {James F. Roberts and
Jean{-}Christophe Zufferey and
Dario Floreano},
title = {Energy management for indoor hovering robots},
booktitle = {2008 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, September 22-26, 2008, Acropolis Convention Center, Nice,
France},
pages = {1242--1247},
publisher = {{IEEE}},
year = {2008},
url = {https://doi.org/10.1109/IROS.2008.4650856},
doi = {10.1109/IROS.2008.4650856},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/RobertsZF08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmetrics/BonaldIR08,
author = {Thomas Bonald and
Ali Ibrahim and
James W. Roberts},
editor = {Zhen Liu and
Vishal Misra and
Prashant J. Shenoy},
title = {Traffic capacity of multi-cell {WLANS}},
booktitle = {Proceedings of the 2008 {ACM} {SIGMETRICS} International Conference
on Measurement and Modeling of Computer Systems, {SIGMETRICS} 2008,
Annapolis, MD, USA, June 2-6, 2008},
pages = {419--430},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1375457.1375504},
doi = {10.1145/1375457.1375504},
timestamp = {Fri, 30 Jul 2021 16:13:32 +0200},
biburl = {https://dblp.org/rec/conf/sigmetrics/BonaldIR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wowmom/RobertsDBPPBWR08,
author = {Michael Roberts and
Nicolas Ducheneaut and
James Bo Begole and
Kurt Partridge and
Bob Price and
Victoria Bellotti and
Alan Walendowski and
Paul Rasmussen},
title = {Scalable architecture for context-aware activity-detecting mobile
recommendation systems},
booktitle = {9th {IEEE} International Symposium on a World of Wireless, Mobile
and Multimedia Networks, {WOWMOM} 2008, Newport Beach, CA, USA, 23-26
June, 2008},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/WOWMOM.2008.4594884},
doi = {10.1109/WOWMOM.2008.4594884},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wowmom/RobertsDBPPBWR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmetrics/BonaldR07,
author = {Thomas Bonald and
James W. Roberts},
title = {Scheduling network traffic},
journal = {{SIGMETRICS} Perform. Evaluation Rev.},
volume = {34},
number = {4},
pages = {29--35},
year = {2007},
url = {https://doi.org/10.1145/1243401.1243408},
doi = {10.1145/1243401.1243408},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigmetrics/BonaldR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/RobertsonNM07,
author = {D. Robertson and
Pawel Niewczas and
James R. McDonald},
title = {Interrogation of a Dual-Fiber-Bragg-Grating Sensor Using an Arrayed
Waveguide Grating},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {56},
number = {6},
pages = {2641--2645},
year = {2007},
url = {https://doi.org/10.1109/TIM.2007.908156},
doi = {10.1109/TIM.2007.908156},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tim/RobertsonNM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/McCalleyHRMQRLPYH07,
author = {James D. McCalley and
Vasant G. Honavar and
Sarah M. Ryan and
William Q. Meeker and
Daji Qiao and
Ronald A. Roberts and
Yuan Li and
Jyotishman Pathak and
Mujing Ye and
Yili Hong},
editor = {Yong Shi and
G. Dick van Albada and
Jack J. Dongarra and
Peter M. A. Sloot},
title = {Integrated Decision Algorithms for Auto-steered Electric Transmission
System Asset Management},
booktitle = {Computational Science - {ICCS} 2007, 7th International Conference
Beijing, China, May 27-30, 2007, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {4487},
pages = {1066--1073},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-72584-8\_140},
doi = {10.1007/978-3-540-72584-8\_140},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccS/McCalleyHRMQRLPYH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/teletraffic/IbrahimR07,
author = {Ali Ibrahim and
James Roberts},
editor = {Lorne Mason and
Tadeusz Drwiega and
James Yan},
title = {Modeling {IEEE} 802.11 in Mesh Networks},
booktitle = {Managing Traffic Performance in Converged Networks, 20th International
Teletraffic Congress, {ITC20} 2007, Ottawa, Canada, June 17-21, 2007,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4516},
pages = {816--828},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-72990-7\_71},
doi = {10.1007/978-3-540-72990-7\_71},
timestamp = {Sat, 12 Nov 2022 12:58:31 +0100},
biburl = {https://dblp.org/rec/conf/teletraffic/IbrahimR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/PritskerMRWDHEBWKRAB07,
author = {A. Alan B. Pritsker and
David L. Martin and
Janet S. Reust and
Mary Ann Flanigan Wagner and
O. Patrick Daily and
Ann M. Harper and
Erick B. Edwards and
Leah E. Bennett and
James R. Wilson and
Michael E. Kuhl and
John P. Roberts and
Margaret D. Allen and
James F. Burdick},
editor = {Shane G. Henderson and
Bahar Biller and
Ming{-}Hua Hsieh and
John Shortle and
Jeffrey D. Tew and
Russell R. Barton},
title = {Organ transplantation policy evaluation {(1995)}},
booktitle = {Proceedings of the Winter Simulation Conference, {WSC} 2007, Washington,
DC, USA, December 9-12, 2007},
pages = {10},
publisher = {{WSC}},
year = {2007},
url = {https://dl.acm.org/citation.cfm?id=1352011},
timestamp = {Thu, 10 Jun 2021 22:19:45 +0200},
biburl = {https://dblp.org/rec/conf/wsc/PritskerMRWDHEBWKRAB07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jct/GeelenGRW06,
author = {James F. Geelen and
Bert Gerards and
Neil Robertson and
Geoff Whittle},
title = {Obstructions to branch-decomposition of matroids},
journal = {J. Comb. Theory {B}},
volume = {96},
number = {4},
pages = {560--570},
year = {2006},
url = {https://doi.org/10.1016/j.jctb.2005.11.001},
doi = {10.1016/J.JCTB.2005.11.001},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jct/GeelenGRW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/KeimRTW06,
author = {Daniel A. Keim and
George G. Robertson and
James J. Thomas and
Jarke J. van Wijk},
title = {Guest Editorial: Special Section on Visual Analytics},
journal = {{IEEE} Trans. Vis. Comput. Graph.},
volume = {12},
number = {6},
pages = {1361--1362},
year = {2006},
url = {https://doi.org/10.1109/TVCG.2006.93},
doi = {10.1109/TVCG.2006.93},
timestamp = {Mon, 10 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvcg/KeimRTW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcis/RamakrishnaMPITR06,
author = {Hindupur Ramakrishna and
Marcelo Mejia and
James B. Pick and
Jos{\'{e}} Incera and
Keri Then and
Keith Roberts},
editor = {Guillermo Rodr{\'{\i}}guez{-}Abitia and
Ignacio Ania B.},
title = {Estudio Exploratorio de los Factores Relacionados con el {\'{E}}xito
en una Colaboraci{\'{o}}n Internacional Apoyada por Medios Electr{\'{o}}nicos},
booktitle = {Connecting the Americas. 12th Americas Conference on Information Systems,
{AMCIS} 2006, Acapulco, Mexico, August 4-6, 2006},
pages = {506},
publisher = {Association for Information Systems},
year = {2006},
url = {http://aisel.aisnet.org/amcis2006/506},
timestamp = {Thu, 21 Jun 2018 07:21:45 +0200},
biburl = {https://dblp.org/rec/conf/amcis/RamakrishnaMPITR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ciss/OueslatiR06,
author = {Sara Oueslati and
James W. Roberts},
title = {Comparing Flow-Aware and Flow-Oblivious Adaptive Routing},
booktitle = {40th Annual Conference on Information Sciences and Systems, {CISS}
2006, Princeton, NJ, USA, 22-24 March 2006},
pages = {655--660},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/CISS.2006.286549},
doi = {10.1109/CISS.2006.286549},
timestamp = {Wed, 10 May 2023 17:14:27 +0200},
biburl = {https://dblp.org/rec/conf/ciss/OueslatiR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpc/CatlettAA06,
author = {Charlie Catlett and
William E. Allcock and
Phil Andrews and
Ruth A. Aydt and
Ray Bair and
Natasha Balac and
Bryan Banister and
Trish Barker and
Mark Bartelt and
Peter H. Beckman and
Francine Berman and
Gary R. Bertoline and
Alan Blatecky and
Jay Boisseau and
Jim Bottum and
Sharon Brunett and
Julian J. Bunn and
Michelle Butler and
David Carver and
John Cobb and
Tim Cockerill and
Peter Couvares and
Maytal Dahan and
Diana Diehl and
Thom H. Dunning and
Ian T. Foster and
Kelly P. Gaither and
Dennis Gannon and
Sebastien Goasguen and
Michael Grobe and
David L. Hart and
Matt Heinzel and
Chris Hempel and
Wendy Huntoon and
Joseph A. Insley and
Christopher T. Jordan and
Ivan R. Judson and
Anke Kamrath and
Nicholas T. Karonis and
Carl Kesselman and
Patricia A. Kovatch and
Lex Lane and
Scott A. Lathrop and
Michael J. Levine and
David Lifka and
Lee Liming and
Miron Livny and
Rich Loft and
Doru Marcusiu and
Jim Marsteller and
Stuart Martin and
D. Scott McCaulay and
John McGee and
Laura McGinnis and
Michael A. McRobbie and
Paul Messina and
Reagan W. Moore and
Richard Lee Moore and
John{-}Paul Navarro and
Jeff Nichols and
Michael E. Papka and
Rob Pennington and
Greg Pike and
Jim Pool and
Raghurama Reddy and
Daniel A. Reed and
Tony Rimovsky and
Eric Roberts and
Ralph Roskies and
Sergiu Sanielevici and
J. Ray Scott and
Anurag Shankar and
Mark Sheddon and
Mike Showerman and
Derek Simmel and
Abe Singer and
Dane Skow and
Shava Smallen and
Warren Smith and
Carol X. Song and
Rick L. Stevens and
Craig A. Stewart and
Robert B. Stock and
Nathan Stone and
John Towns and
Tomislav Urban and
Mike Vildibill and
Edward Walker and
Von Welch and
Nancy Wilkins{-}Diehr and
Roy Williams and
Linda Winkler and
Lan Zhao and
Ann Zimmerman},
editor = {Lucio Grandinetti},
title = {TeraGrid: Analysis of Organization, System Architecture, and Middleware
Enabling New Types of Applications},
booktitle = {High Performance Computing and Grids in Action - Selected Papers from
the 2006 International Advanced Research Workshop on High Performance
Computing and Grids, Cetraro, Italy, 2006},
series = {Advances in Parallel Computing},
volume = {16},
pages = {225--249},
publisher = {{IOS} Press},
year = {2006},
timestamp = {Tue, 24 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hpc/CatlettAA06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hvei/Fenimore0CRAIBS06,
author = {Charles Fenimore and
John Irvine and
David M. Cannon and
John Roberts and
Ana Ivelisse Avil{\'{e}}s and
Steven Isreal and
Michelle Brennan and
Larry Simon and
James D. Miller and
Donna Haverkamp and
Paul F. Tighe and
Michael Gross},
editor = {Bernice E. Rogowitz and
Thrasyvoulos N. Pappas and
Scott J. Daly},
title = {Perceptual study of the impact of varying frame rate on motion imagery
interpretability},
booktitle = {Human Vision and Electronic Imaging XI, San Jose, CA, USA, January
15, 2006},
series = {{SPIE} Proceedings},
volume = {6057},
pages = {60570P},
publisher = {{SPIE}},
year = {2006},
url = {https://doi.org/10.1117/12.651124},
doi = {10.1117/12.651124},
timestamp = {Wed, 28 Mar 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hvei/Fenimore0CRAIBS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/McCalleyHRMRQL06,
author = {James D. McCalley and
Vasant G. Honavar and
Sarah M. Ryan and
William Q. Meeker and
Ronald A. Roberts and
Daji Qiao and
Yuan Li},
editor = {Vassil N. Alexandrov and
G. Dick van Albada and
Peter M. A. Sloot and
Jack J. Dongarra},
title = {Auto-steered Information-Decision Processes for Electric System Asset
Management},
booktitle = {Computational Science - {ICCS} 2006, 6th International Conference,
Reading, UK, May 28-31, 2006, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {3993},
pages = {440--447},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11758532\_59},
doi = {10.1007/11758532\_59},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/iccS/McCalleyHRMRQL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icis/HerbslebR06,
author = {James D. Herbsleb and
Jeffrey A. Roberts},
title = {Collaboration In Software Engineering Projects: {A} Theory Of Coordination},
booktitle = {Proceedings of the International Conference on Information Systems,
{ICIS} 2006, Milwaukee, Wisconsin, USA, December 10-13, 2006},
pages = {38},
publisher = {Association for Information Systems},
year = {2006},
url = {http://aisel.aisnet.org/icis2006/38},
timestamp = {Thu, 29 Dec 2011 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icis/HerbslebR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/MaidenRR06,
author = {Neil A. M. Maiden and
Suzanne Robertson and
James Robertson},
editor = {Leon J. Osterweil and
H. Dieter Rombach and
Mary Lou Soffa},
title = {Creative requirements: invention and its role in requirements engineering},
booktitle = {28th International Conference on Software Engineering {(ICSE} 2006),
Shanghai, China, May 20-28, 2006},
pages = {1073--1074},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1134285.1134512},
doi = {10.1145/1134285.1134512},
timestamp = {Mon, 26 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icse/MaidenRR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isi/AnandMMPR06,
author = {Saket Anand and
David Madigan and
Richard J. Mammone and
Saumitr Pathak and
Fred S. Roberts},
editor = {Sharad Mehrotra and
Daniel Dajun Zeng and
Hsinchun Chen and
Bhavani Thuraisingham and
Fei{-}Yue Wang},
title = {Experimental Analysis of Sequential Decision Making Algorithms for
Port of Entry Inspection Procedures},
booktitle = {Intelligence and Security Informatics, {IEEE} International Conference
on Intelligence and Security Informatics, {ISI} 2006, San Diego, CA,
USA, May 23-24, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3975},
pages = {319--330},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11760146\_28},
doi = {10.1007/11760146\_28},
timestamp = {Wed, 29 Jun 2022 15:37:43 +0200},
biburl = {https://dblp.org/rec/conf/isi/AnandMMPR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/RobertsBCCGKRTUY06,
author = {Eric S. Roberts and
Kim B. Bruce and
James H. Cross II and
Robb Cutler and
Scott Grissom and
Karl J. Klee and
Susan H. Rodger and
Fran Trees and
Ian Utting and
Frank Yellin},
editor = {Doug Baldwin and
Paul T. Tymann and
Susan M. Haller and
Ingrid Russell},
title = {The {ACM} java task force: final report},
booktitle = {Proceedings of the 37th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 2006, Houston, Texas, USA, March 3-5, 2006},
pages = {131--132},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1121341.1121384},
doi = {10.1145/1121341.1121384},
timestamp = {Mon, 30 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigcse/RobertsBCCGKRTUY06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wicon/KempfR06,
author = {James Kempf and
Phil Roberts},
editor = {Maria Papadopouli},
title = {Industry track: towards an internet mobility management architecture},
booktitle = {2nd International {ICST} Conference on Wireless Internet, {WICON}
2006, Boston, MA, USA, August 2-5, 2006},
pages = {24},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1234161.1234185},
doi = {10.1145/1234161.1234185},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wicon/KempfR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ac/AliBSMBBMRRTY05,
author = {Shoukat Ali and
Tracy D. Braun and
Howard Jay Siegel and
Anthony A. Maciejewski and
Noah Beck and
Ladislau B{\"{o}}l{\"{o}}ni and
Muthucumaru Maheswaran and
Albert I. Reuther and
James P. Robertson and
Mitchell D. Theys and
Bin Yao},
title = {Characterizing Resource Allocation Heuristics for Heterogeneous Computing
Systems},
journal = {Adv. Comput.},
volume = {63},
pages = {93--129},
year = {2005},
url = {https://doi.org/10.1016/S0065-2458(04)63003-8},
doi = {10.1016/S0065-2458(04)63003-8},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ac/AliBSMBBMRRTY05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijwmip/LegarretaARGCRW05,
author = {I. Romero Legarreta and
Paul S. Addison and
M. J. Reed and
Neil R. Grubb and
Gareth R. Clegg and
Colin E. Robertson and
James N. Watson},
title = {Continuous Wavelet Transform Modulus Maxima Analysis of the Electrocardiogram:
Beat Characterisation and Beat-to-Beat Measurement},
journal = {Int. J. Wavelets Multiresolution Inf. Process.},
volume = {3},
number = {1},
pages = {19--42},
year = {2005},
url = {https://doi.org/10.1142/S0219691305000774},
doi = {10.1142/S0219691305000774},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijwmip/LegarretaARGCRW05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/itpro/MichaelRVW05,
author = {James Bret Michael and
Steven E. Roberts and
Jeffrey M. Voas and
Thomas C. Wingfield},
title = {The Role of Policy in Balancing Outsourcing and Homeland Security},
journal = {{IT} Prof.},
volume = {7},
number = {4},
pages = {19--23},
year = {2005},
url = {https://doi.org/10.1109/MITP.2005.100},
doi = {10.1109/MITP.2005.100},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/itpro/MichaelRVW05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/software/RobertsonH05,
author = {James Robertson and
Connie Heitmeyer},
title = {Point/Counterpoint},
journal = {{IEEE} Softw.},
volume = {22},
number = {1},
pages = {48--51},
year = {2005},
url = {https://doi.org/10.1109/MS.2005.16},
doi = {10.1109/MS.2005.16},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/software/RobertsonH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ancs/KortebiMOR05,
author = {Abdesselem Kortebi and
Luca Muscariello and
Sara Oueslati and
James W. Roberts},
editor = {Alan D. Berenbaum and
Kai Li and
Jonathan S. Turner},
title = {Minimizing the overhead in implementing flow-aware networking},
booktitle = {Proceedings of the 2005 {ACM/IEEE} Symposium on Architecture for Networking
and Communications Systems, {ANCS} 2005, Princeton, New Jersey, USA,
October 16-18, 2005},
pages = {153--162},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1095890.1095912},
doi = {10.1145/1095890.1095912},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ancs/KortebiMOR05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/RobertsonAGPZC05,
author = {Scott P. Robertson and
Palakorn Achananuparp and
James L. Goldman and
Sang Joon Park and
Nan Zhou and
Matthew J. Clare},
editor = {Gerrit C. van der Veer and
Carolyn Gale},
title = {Voting and political information gathering on paper and online},
booktitle = {Extended Abstracts Proceedings of the 2005 Conference on Human Factors
in Computing Systems, {CHI} 2005, Portland, Oregon, USA, April 2-7,
2005},
pages = {1753--1756},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1056808.1057014},
doi = {10.1145/1056808.1057014},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/RobertsonAGPZC05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lanman/HegdePR05,
author = {Nidhi Hegde and
Alexandre Prouti{\`{e}}re and
James W. Roberts},
title = {Evaluating the voice capacity of 802.11 {WLAN} under distributed control},
booktitle = {The 14th {IEEE} Workshop on Local and Metropolitan Area Networks,
{LANMAN} 2005, Chania, Crete, Greece, September 18, 2005},
publisher = {{IEEE}},
year = {2005},
url = {https://doi.org/10.1109/LANMAN.2005.1541525},
doi = {10.1109/LANMAN.2005.1541525},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lanman/HegdePR05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/RobertsBCCGKRTUY05,
author = {Eric S. Roberts and
Kim B. Bruce and
Robb Cutler and
James H. Cross II and
Scott B. Grissom and
Karl J. Klee and
Susan H. Rodger and
Fran Trees and
Ian Utting and
Frank Yellin},
editor = {Wanda P. Dann and
Thomas L. Naps and
Paul T. Tymann and
Doug Baldwin},
title = {The {ACM} java task force: status report},
booktitle = {Proceedings of the 36th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 2005, St. Louis, Missouri, USA, February 23-27,
2005},
pages = {46--47},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1047344.1047348},
doi = {10.1145/1047344.1047348},
timestamp = {Mon, 30 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigcse/RobertsBCCGKRTUY05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmetrics/KortebiMOR05,
author = {Abdesselem Kortebi and
Luca Muscariello and
Sara Oueslati and
James W. Roberts},
editor = {Derek L. Eager and
Carey L. Williamson and
Sem C. Borst and
John C. S. Lui},
title = {Evaluating the number of active flows in a scheduler realizing fair
statistical bandwidth sharing},
booktitle = {Proceedings of the International Conference on Measurements and Modeling
of Computer Systems, {SIGMETRICS} 2005, June 6-10, 2005, Banff, Alberta,
Canada},
pages = {217--228},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1064212.1064237},
doi = {10.1145/1064212.1064237},
timestamp = {Fri, 30 Jul 2021 16:13:32 +0200},
biburl = {https://dblp.org/rec/conf/sigmetrics/KortebiMOR05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/spieVIP/0001FCRISWMATBH05,
author = {John M. Irvine and
Charles Fenimore and
David M. Cannon and
John Roberts and
Steven A. Israel and
Larry Simon and
Charles Watts and
James D. Miller and
Ana Ivelisse Avil{\'{e}}s and
Paul F. Tighe and
Richard J. Behrens and
Donna Haverkamp},
editor = {Zia{-}ur Rahman and
Robert A. Schowengerdt and
Stephen E. Reichenbach},
title = {Factors affecting development of a motion imagery quality metric},
booktitle = {Visual Information Processing XIV, Orlando, Florida, USA, March 28,
2005},
series = {{SPIE} Proceedings},
volume = {5817},
pages = {116--123},
publisher = {{SPIE}},
year = {2005},
url = {https://doi.org/10.1117/12.603946},
doi = {10.1117/12.603946},
timestamp = {Fri, 06 May 2022 13:45:23 +0200},
biburl = {https://dblp.org/rec/conf/spieVIP/0001FCRISWMATBH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/adt/BonaldOR04,
author = {Thomas Bonald and
Philippe Olivier and
James W. Roberts},
title = {Dimensioning {IP} access links carrying data traffic},
journal = {Ann. des T{\'{e}}l{\'{e}}communications},
volume = {59},
number = {11-12},
pages = {1315--1337},
year = {2004},
url = {https://doi.org/10.1007/BF03179723},
doi = {10.1007/BF03179723},
timestamp = {Wed, 20 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/adt/BonaldOR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/RobertsHHMY04,
author = {Michael Roberts and
Wayne B. Hayes and
Brian R. Hunt and
Stephen M. Mount and
James A. Yorke},
title = {Reducing storage requirements for biological sequence comparison},
journal = {Bioinform.},
volume = {20},
number = {18},
pages = {3363--3369},
year = {2004},
url = {https://doi.org/10.1093/bioinformatics/bth408},
doi = {10.1093/BIOINFORMATICS/BTH408},
timestamp = {Thu, 12 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/RobertsHHMY04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/Roberts04,
author = {James W. Roberts},
title = {A survey on statistical bandwidth sharing},
journal = {Comput. Networks},
volume = {45},
number = {3},
pages = {319--332},
year = {2004},
url = {https://doi.org/10.1016/j.comnet.2004.03.010},
doi = {10.1016/J.COMNET.2004.03.010},
timestamp = {Thu, 04 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cn/Roberts04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcb/RobertsHYBD04,
author = {Michael Roberts and
Brian R. Hunt and
James A. Yorke and
Randall A. Bolanos and
Arthur L. Delcher},
title = {A Preprocessor for Shotgun Assembly of Large Genomes},
journal = {J. Comput. Biol.},
volume = {11},
number = {4},
pages = {734--752},
year = {2004},
url = {https://doi.org/10.1089/cmb.2004.11.734},
doi = {10.1089/CMB.2004.11.734},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcb/RobertsHYBD04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/OchsnerRCRCGG04,
author = {Kevin N. Ochsner and
Rebecca D. Ray and
Jeffrey C. Cooper and
Elaine R. Robertson and
Sita Chopra and
John D. E. Gabrieli and
James J. Gross},
title = {For better or for worse: neural systems supporting the cognitive down-
and up-regulation of negative emotion},
journal = {NeuroImage},
volume = {23},
number = {2},
pages = {483--499},
year = {2004},
url = {https://doi.org/10.1016/j.neuroimage.2004.06.030},
doi = {10.1016/J.NEUROIMAGE.2004.06.030},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/OchsnerRCRCGG04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nn/RobinsM04,
author = {Anthony V. Robins and
Simon McCallum},
title = {A robust method for distinguishing between learned and spurious attractors},
journal = {Neural Networks},
volume = {17},
number = {3},
pages = {313--326},
year = {2004},
url = {https://doi.org/10.1016/j.neunet.2003.11.007},
doi = {10.1016/J.NEUNET.2003.11.007},
timestamp = {Fri, 30 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nn/RobinsM04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/Roberts04,
author = {James W. Roberts},
title = {Internet traffic, QoS, and pricing},
journal = {Proc. {IEEE}},
volume = {92},
number = {9},
pages = {1389--1399},
year = {2004},
url = {https://doi.org/10.1109/JPROC.2004.832959},
doi = {10.1109/JPROC.2004.832959},
timestamp = {Thu, 04 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pieee/Roberts04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tecs/RobertsonI04,
author = {Ian Robertson and
James Irvine},
title = {A design flow for partially reconfigurable hardware},
journal = {{ACM} Trans. Embed. Comput. Syst.},
volume = {3},
number = {2},
pages = {257--283},
year = {2004},
url = {https://doi.org/10.1145/993396.993399},
doi = {10.1145/993396.993399},
timestamp = {Fri, 03 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tecs/RobertsonI04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aipr/IrvineFCRISWMBATB04,
author = {John M. Irvine and
Charles Fenimore and
David M. Cannon and
John Roberts and
Steven A. Israel and
Larry Simon and
Charles Watts and
James D. Miller and
Michelle Brennan and
Ana Ivelisse Avil{\'{e}}s and
Paul F. Tighe and
Richard J. Behrens},
title = {Feasibility Study for the Development of a Motion Imagery Quality
Metric},
booktitle = {33rd Applied Image Pattern Recognition Workshop {(AIPR} 2004), Emerging
Technologies and Applications for Imagery Pattern Recognition, 13-15
October 2004, Washington, DC, USA, Proceedings},
pages = {179--183},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/AIPR.2004.25},
doi = {10.1109/AIPR.2004.25},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aipr/IrvineFCRISWMBATB04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cscw/CarpenterNMRDBFJ04,
author = {Keri Carpenter and
Bonnie A. Nardi and
James Moore and
Scott P. Robertson and
Daniel Drezner and
Ian Benson and
Kirsten A. Foot and
Quintus Jett},
editor = {James D. Herbsleb and
Gary M. Olson},
title = {Online political organizing: lessons from the field},
booktitle = {Proceedings of the 2004 {ACM} Conference on Computer Supported Cooperative
Work, {CSCW} 2004, Chicago, Illinois, USA, November 6-10, 2004},
pages = {59--62},
publisher = {{ACM}},
year = {2004},
url = {https://doi.org/10.1145/1031607.1031618},
doi = {10.1145/1031607.1031618},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cscw/CarpenterNMRDBFJ04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/RobertsP04,
author = {G. Keith Roberts and
James B. Pick},
title = {Technology Factors in Corporate Adoption of Mobile Cell Phones: {A}
Case Study Analysis},
booktitle = {37th Hawaii International Conference on System Sciences {(HICSS-37}
2004), {CD-ROM} / Abstracts Proceedings, 5-8 January 2004, Big Island,
HI, {USA}},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/HICSS.2004.1265678},
doi = {10.1109/HICSS.2004.1265678},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/RobertsP04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iptps/SitDR04,
author = {Emil Sit and
Frank Dabek and
James Robertson},
editor = {Geoffrey M. Voelker and
Scott Shenker},
title = {UsenetDHT: {A} Low Overhead Usenet Server},
booktitle = {Peer-to-Peer Systems III, Third International Workshop, {IPTPS} 2004,
La Jolla, CA, USA, February 26-27, 2004, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {3279},
pages = {206--216},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30183-7\_20},
doi = {10.1007/978-3-540-30183-7\_20},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/iptps/SitDR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lisa/CrouthamelRST04,
author = {Joseph R. Crouthamel and
James M. Roberts and
Christopher M. Sanchez and
Christopher J. Tengi},
editor = {Lee Damon},
title = {PatchMaker: {A} Physical Network Patch Manager Tool},
booktitle = {Proceedings of the 18th Conference on Systems Administration {(LISA}
2004), Atlanta, USA, November 14-19, 2004},
pages = {171--176},
publisher = {{USENIX}},
year = {2004},
url = {http://www.usenix.org/publications/library/proceedings/lisa04/tech/crouthamel.html},
timestamp = {Tue, 02 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/lisa/CrouthamelRST04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lisa/TengiRCMS04,
author = {Christopher J. Tengi and
James M. Roberts and
Joseph R. Crouthamel and
Chris M. Miller and
Christopher M. Sanchez},
editor = {Lee Damon},
title = {autoMAC: {A} Tool for Automating Network Moves, Adds, and Changes},
booktitle = {Proceedings of the 18th Conference on Systems Administration {(LISA}
2004), Atlanta, USA, November 14-19, 2004},
pages = {113--120},
publisher = {{USENIX}},
year = {2004},
url = {http://www.usenix.org/publications/library/proceedings/lisa04/tech/tengi.html},
timestamp = {Tue, 02 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/lisa/TengiRCMS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nsdi/DabekLSRKM04,
author = {Frank Dabek and
Jinyang Li and
Emil Sit and
James Robertson and
M. Frans Kaashoek and
Robert Tappan Morris},
editor = {Robert Tappan Morris and
Stefan Savage},
title = {Designing a {DHT} for Low Latency and High Throughput},
booktitle = {1st Symposium on Networked Systems Design and Implementation {(NSDI}
2004), March 29-31, 2004, San Francisco, California, USA, Proceedings},
pages = {85--98},
publisher = {{USENIX}},
year = {2004},
url = {http://www.usenix.org/events/nsdi04/tech/dabek.html},
timestamp = {Tue, 02 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nsdi/DabekLSRKM04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/BonaldR03,
author = {Thomas Bonald and
James W. Roberts},
title = {Congestion at flow level and the impact of user behaviour},
journal = {Comput. Networks},
volume = {42},
number = {4},
pages = {521--536},
year = {2003},
url = {https://doi.org/10.1016/S1389-1286(03)00200-7},
doi = {10.1016/S1389-1286(03)00200-7},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cn/BonaldR03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcb/LangmeadYMD03,
author = {Christopher James Langmead and
Anthony K. Yan and
C. Robertson McClung and
Bruce Randall Donald},
title = {Phase-Independent Rhythmic Analysis of Genome-Wide Expression Patterns},
journal = {J. Comput. Biol.},
volume = {10},
number = {3/4},
pages = {521--536},
year = {2003},
url = {https://doi.org/10.1089/10665270360688165},
doi = {10.1089/10665270360688165},
timestamp = {Wed, 19 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcb/LangmeadYMD03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jct/GeelenGRW03,
author = {James F. Geelen and
A. M. H. Gerards and
Neil Robertson and
Geoff Whittle},
title = {On the excluded minors for the matroids of branch-width \emph{k}},
journal = {J. Comb. Theory {B}},
volume = {88},
number = {2},
pages = {261--265},
year = {2003},
url = {https://doi.org/10.1016/S0095-8956(02)00046-1},
doi = {10.1016/S0095-8956(02)00046-1},
timestamp = {Fri, 07 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jct/GeelenGRW03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamads/HensonRRSRC03,
author = {Shandelle M. Henson and
James R. Reilly and
Suzanne L. Robertson and
Matthew C. Schu and
Eric William Davis Rozier and
J. M. Cushing},
title = {Predicting Irregularities in Population Cycles},
journal = {{SIAM} J. Appl. Dyn. Syst.},
volume = {2},
number = {2},
pages = {238--253},
year = {2003},
url = {https://doi.org/10.1137/S1111111102411262},
doi = {10.1137/S1111111102411262},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamads/HensonRRSRC03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003},
url = {https://doi.org/10.1145/945546.945549},
doi = {10.1145/945546.945549},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcis/RobertsP03,
author = {G. Keith Roberts and
James B. Pick},
title = {Case Study Analysis of Corporate Decision-Making for Cell Phone Deployment},
booktitle = {9th Americas Conference on Information Systems, {AMCIS} 2003, Tampa,
FL, USA, August 4-6, 2003},
pages = {14},
publisher = {Association for Information Systems},
year = {2003},
url = {http://aisel.aisnet.org/amcis2003/14},
timestamp = {Mon, 09 Jan 2012 12:52:36 +0100},
biburl = {https://dblp.org/rec/conf/amcis/RobertsP03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/compsac/MichaelWR03,
author = {James Bret Michael and
Thomas C. Wingfield and
Steven E. Roberts},
title = {Homeland Security's Cyber Component: {A} Survey of Legal Issues},
booktitle = {27th International Computer Software and Applications Conference {(COMPSAC}
2003): Design and Assessment of Trustworthy Software-Based Systems,
3-6 November 2003, Dallas, TX, USA, Proceedings},
pages = {24},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/CMPSAC.2003.1245317},
doi = {10.1109/CMPSAC.2003.1245317},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/compsac/MichaelWR03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:conf/qofis/KarlssonRSAABDEFGHKLMIMMPPQRV03,
author = {Gunnar Karlsson and
James Roberts and
Ioannis Stavrakakis and
Antonio Alves and
Stefano Avallone and
Fernando Boavida and
Salvatore D'Antonio and
Marcello Esposito and
Vikt{\'{o}}ria Fodor and
Mauro Gargiulo and
Jarmo Harju and
Yevgeni Koucheryavy and
Fengyi Li and
Ian Marsh and
Ignacio M{\'{a}}s Ivars and
Dmitri Moltchanov and
Edmundo Monteiro and
Antonis Panagakis and
Antonio Pescap{\`{e}} and
Gon{\c{c}}alo Quadros and
Simon Pietro Romano and
Giorgio Ventre},
editor = {Michael Smirnov and
Ernst W. Biersack and
Chris Blondia and
Olivier Bonaventure and
Olga Casals and
Gunnar Karlsson and
George Pavlou and
Bruno Quoitin and
James Roberts and
Ioannis Stavrakakis and
Burkhard Stiller and
Panos Trimintzios and
Piet Van Mieghem},
title = {Traffic Management},
booktitle = {Quality of Future Internet Services, {COST} Action 263 Final Report},
series = {Lecture Notes in Computer Science},
volume = {2856},
pages = {10--79},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/978-3-540-45190-7\_2},
doi = {10.1007/978-3-540-45190-7\_2},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/qofis/KarlssonRSAABDEFGHKLMIMMPPQRV03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:conf/qofis/StillerBCDHLMPRSTV03,
author = {Burkhard Stiller and
Pere Barlet{-}Ros and
John Cushnie and
Jordi Domingo{-}Pascual and
David Hutchison and
Rui J. Lopes and
Andreas Mauthe and
Mihai Popa and
James Roberts and
Josep Sol{\'{e}}{-}Pareta and
Denis Trcek and
Carlos Veciana{-}Nogu{\'{e}}s},
editor = {Michael Smirnov and
Ernst W. Biersack and
Chris Blondia and
Olivier Bonaventure and
Olga Casals and
Gunnar Karlsson and
George Pavlou and
Bruno Quoitin and
James Roberts and
Ioannis Stavrakakis and
Burkhard Stiller and
Panos Trimintzios and
Piet Van Mieghem},
title = {Pricing and QoS},
booktitle = {Quality of Future Internet Services, {COST} Action 263 Final Report},
series = {Lecture Notes in Computer Science},
volume = {2856},
pages = {263--291},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/978-3-540-45190-7\_7},
doi = {10.1007/978-3-540-45190-7\_7},
timestamp = {Mon, 26 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/qofis/StillerBCDHLMPRSTV03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:conf/qofis/2003final,
editor = {Michael Smirnov and
Ernst W. Biersack and
Chris Blondia and
Olivier Bonaventure and
Olga Casals and
Gunnar Karlsson and
George Pavlou and
Bruno Quoitin and
James Roberts and
Ioannis Stavrakakis and
Burkhard Stiller and
Panos Trimintzios and
Piet Van Mieghem},
title = {Quality of Future Internet Services, {COST} Action 263 Final Report},
series = {Lecture Notes in Computer Science},
volume = {2856},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/b13823},
doi = {10.1007/B13823},
isbn = {3-540-20193-9},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/qofis/2003final.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/WesselinkIJDRR02,
author = {Jan{-}Jaap Wesselink and
Beatriz de la Iglesia and
Stephen A. James and
Jo L. Dicks and
Ian N. Roberts and
Victor J. Rayward{-}Smith},
title = {Determining a unique defining {DNA} sequence for yeast species using
hashing techniques},
journal = {Bioinform.},
volume = {18},
number = {7},
pages = {1004--1010},
year = {2002},
url = {https://doi.org/10.1093/bioinformatics/18.7.1004},
doi = {10.1093/BIOINFORMATICS/18.7.1004},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/WesselinkIJDRR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/BenameurFOR02,
author = {Nabil Benameur and
Slim Ben Fredj and
Sara Oueslati{-}Boulahia and
James W. Roberts},
title = {Quality of service and flow level admission control in the Internet},
journal = {Comput. Networks},
volume = {40},
number = {1},
pages = {57--71},
year = {2002},
url = {https://doi.org/10.1016/S1389-1286(02)00266-9},
doi = {10.1016/S1389-1286(02)00266-9},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cn/BenameurFOR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/comcom/KangasharjuRR02,
author = {Jussi Kangasharju and
James W. Roberts and
Keith W. Ross},
title = {Object replication strategies in content distribution networks},
journal = {Comput. Commun.},
volume = {25},
number = {4},
pages = {376--383},
year = {2002},
url = {https://doi.org/10.1016/S0140-3664(01)00409-1},
doi = {10.1016/S0140-3664(01)00409-1},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/comcom/KangasharjuRR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/icl/VijayanR02,
author = {Logeshwaran Vijayan and
James Roberts},
title = {{BER} performance of 2D-RAKE receivers in {DS-CDMA} over frequency-selective,
slow Rayleigh fading channels},
journal = {{IEEE} Commun. Lett.},
volume = {6},
number = {10},
pages = {434--436},
year = {2002},
url = {https://doi.org/10.1109/LCOMM.2002.804239},
doi = {10.1109/LCOMM.2002.804239},
timestamp = {Thu, 20 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/icl/VijayanR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/software/Robertson02,
author = {James Robertson},
title = {Eureka! Why Analysts Should Invent Requirements},
journal = {{IEEE} Softw.},
volume = {19},
number = {4},
pages = {20--22},
year = {2002},
url = {https://doi.org/10.1109/MS.2002.1020281},
doi = {10.1109/MS.2002.1020281},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/software/Robertson02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ton/MassoulieR02,
author = {Laurent Massouli{\'{e}} and
James Roberts},
title = {Bandwidth sharing: objectives and algorithms},
journal = {{IEEE/ACM} Trans. Netw.},
volume = {10},
number = {3},
pages = {320--328},
year = {2002},
url = {https://doi.org/10.1109/TNET.2002.1012364},
doi = {10.1109/TNET.2002.1012364},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ton/MassoulieR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ascilite/JamesR02,
author = {Patrick James and
Ian W. Roberts},
editor = {Andy Williamson and
Cathy Gunn and
Alison Young and
Tony Clear},
title = {"Full steam ahead": managing the learning environment of an Australiawide
research training program in the earth and environmental sciences},
booktitle = {Winds of Changing in the Sea of Learning, Proceedings of the 19th
Annual Conference of the Australian Society for Computers in Tertiary
Education (ASCILITE), Auckland, New Zealand, 8-11 December 2002},
pages = {927},
publisher = {{UNITEC} Institute of Technology, Auckland, New Zealand},
year = {2002},
timestamp = {Tue, 17 Jun 2003 15:32:29 +0200},
biburl = {https://dblp.org/rec/conf/ascilite/JamesR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csb/LangmeadMD02,
author = {Christopher James Langmead and
C. Robertson McClung and
Bruce Randall Donald},
title = {A Maximum Entropy Algorithm for Rhythmic Analysis of Genome-Wide Expression
Patterns},
booktitle = {1st {IEEE} Computer Society Bioinformatics Conference, {CSB} 2002,
Stanford, CA, USA, August 14-16, 2002},
pages = {237--245},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/CSB.2002.1039346},
doi = {10.1109/CSB.2002.1039346},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/csb/LangmeadMD02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fpga/RobertsonILR02,
author = {Ian Robertson and
James Irvine and
Patrick Lysaght and
David Robinson},
editor = {Martine D. F. Schlag and
Steve Trimberger},
title = {Timing verification of dynamically reconfigurable logic for the xilinx
virtex {FPGA} series},
booktitle = {Proceedings of the {ACM/SIGDA} International Symposium on Field Programmable
Gate Arrays, {FPGA} 2002, Monterey, CA, USA, February 24-26, 2002},
pages = {127--135},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/503048.503068},
doi = {10.1145/503048.503068},
timestamp = {Fri, 03 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/fpga/RobertsonILR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fpl/RobertsonILR02,
author = {Ian Robertson and
James Irvine and
Patrick Lysaght and
David Robinson},
editor = {Manfred Glesner and
Peter Zipf and
Michel Renovell},
title = {Improved Functional Simulation of Dynamically Reconfigurable Logic},
booktitle = {Field-Programmable Logic and Applications, Reconfigurable Computing
Is Going Mainstream, 12th International Conference, {FPL} 2002, Montpellier,
France, September 2-4, 2002, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2438},
pages = {152--161},
publisher = {Springer},
year = {2002},
url = {https://doi.org/10.1007/3-540-46117-5\_17},
doi = {10.1007/3-540-46117-5\_17},
timestamp = {Sat, 30 Sep 2023 09:41:27 +0200},
biburl = {https://dblp.org/rec/conf/fpl/RobertsonILR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/recomb/LangmeadYMD02,
author = {Christopher James Langmead and
Anthony K. Yan and
C. Robertson McClung and
Bruce Randall Donald},
editor = {Gene Myers and
Sridhar Hannenhalli and
David Sankoff and
Sorin Istrail and
Pavel A. Pevzner and
Michael S. Waterman},
title = {Phase-independent rhythmic analysis of genome-wide expression patterns},
booktitle = {Proceedings of the Sixth Annual International Conference on Computational
Biology, {RECOMB} 2002, Washington, DC, USA, April 18-21, 2002},
pages = {205--215},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/565196.565223},
doi = {10.1145/565196.565223},
timestamp = {Wed, 19 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/recomb/LangmeadYMD02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigdoc/HalstedR02,
author = {Kari L. Halsted and
James H. (Jamie) Roberts},
editor = {Kathy Haramundanis and
Michael Priestley},
title = {Eclipse help system: an open source user assistance offering},
booktitle = {Proceedings of the 20st annual international conference on Documentation,
{SIGDOC} 2002, Toronto, Ontario, Canada, October 20-23, 2002},
pages = {49--59},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/584955.584964},
doi = {10.1145/584955.584964},
timestamp = {Tue, 06 Nov 2018 11:07:46 +0100},
biburl = {https://dblp.org/rec/conf/sigdoc/HalstedR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/comcom/KangasharjuRR01,
author = {Jussi Kangasharju and
Keith W. Ross and
James W. Roberts},
title = {Performance evaluation of redirection schemes in content distribution
networks},
journal = {Comput. Commun.},
volume = {24},
number = {2},
pages = {207--214},
year = {2001},
url = {https://doi.org/10.1016/S0140-3664(00)00316-9},
doi = {10.1016/S0140-3664(00)00316-9},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/comcom/KangasharjuRR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/BraunSBBMRRTYHF01,
author = {Tracy D. Braun and
Howard Jay Siegel and
Noah Beck and
Ladislau B{\"{o}}l{\"{o}}ni and
Muthucumaru Maheswaran and
Albert I. Reuther and
James P. Robertson and
Mitchell D. Theys and
Bin Yao and
Debra A. Hensgen and
Richard F. Freund},
title = {A Comparison of Eleven Static Heuristics for Mapping a Class of Independent
Tasks onto Heterogeneous Distributed Computing Systems},
journal = {J. Parallel Distributed Comput.},
volume = {61},
number = {6},
pages = {810--837},
year = {2001},
url = {https://doi.org/10.1006/jpdc.2000.1714},
doi = {10.1006/JPDC.2000.1714},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jpdc/BraunSBBMRRTYHF01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/CostanzoCHKORSBHKLLTG01,
author = {Maria C. Costanzo and
Matthew E. Crawford and
Jodi E. Hirschman and
Janice E. Kranz and
Philip Olsen and
Laura S. Robertson and
Marek S. Skrzypek and
Burkhard R. Braun and
Kelley Lennon{-}Hopkins and
Pinar Kondu and
Carey Lengieza and
Jodi E. Lew{-}Smith and
Michael Tillberg and
James I. Garrels},
title = {YPDTM, PombePDTM and WormPDTM: model organism volumes of the BioKnowledgeTM
Library, an integrated resource for protein information},
journal = {Nucleic Acids Res.},
volume = {29},
number = {1},
pages = {75--79},
year = {2001},
url = {https://doi.org/10.1093/nar/29.1.75},
doi = {10.1093/NAR/29.1.75},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/CostanzoCHKORSBHKLLTG01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/FunkTRB01,
author = {Christopher C. Funk and
James Theiler and
Dar A. Roberts and
Christoph C. Borel},
title = {Clustering to improve matched filter detection of weak gas plumes
in hyperspectral thermal imagery},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {39},
number = {7},
pages = {1410--1420},
year = {2001},
url = {https://doi.org/10.1109/36.934073},
doi = {10.1109/36.934073},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/FunkTRB01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/ParksFR01,
author = {Harold V. Parks and
James E. Faller and
Douglas S. Robertson},
title = {A suspended laser interferometer for determining the Newtonian constant
of gravitation},
journal = {{IEEE} Trans. Instrum. Meas.},
volume = {50},
number = {2},
pages = {598--600},
year = {2001},
url = {https://doi.org/10.1109/19.918200},
doi = {10.1109/19.918200},
timestamp = {Tue, 13 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tim/ParksFR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/BonaldPR01,
author = {Thomas Bonald and
Alexandre Prouti{\`{e}}re and
James W. Roberts},
title = {Statistical Guarantees for Streaming Flows Using Expedited Forwarding},
booktitle = {Proceedings {IEEE} {INFOCOM} 2001, The Conference on Computer Communications,
Twentieth Annual Joint Conference of the {IEEE} Computer and Communications
Societies, Twenty years into the communications odyssey, Anchorage,
Alaska, USA, April 22-26, 2001},
pages = {1104--1112},
publisher = {{IEEE} Comptuer Society},
year = {2001},
url = {https://doi.org/10.1109/INFCOM.2001.916304},
doi = {10.1109/INFCOM.2001.916304},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/infocom/BonaldPR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/FayolleFLMR01,
author = {Guy Fayolle and
Arnaud de La Fortelle and
Jean{-}Marc Lasgouttes and
Laurent Massouli{\'{e}} and
James Roberts},
title = {Best-effort Networks: Modeling and Performance Analysis via Large
Networks Asymptotics},
booktitle = {Proceedings {IEEE} {INFOCOM} 2001, The Conference on Computer Communications,
Twentieth Annual Joint Conference of the {IEEE} Computer and Communications
Societies, Twenty years into the communications odyssey, Anchorage,
Alaska, USA, April 22-26, 2001},
pages = {709--716},
publisher = {{IEEE} Comptuer Society},
year = {2001},
url = {https://doi.org/10.1109/INFCOM.2001.916259},
doi = {10.1109/INFCOM.2001.916259},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/infocom/FayolleFLMR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/qofis/BenameurFDOR01,
author = {Nabil Benameur and
Slim Ben Fredj and
Frank Delcoigne and
Sara Oueslati{-}Boulahia and
James W. Roberts},
editor = {Mikhail I. Smirnov and
Jon Crowcroft and
James Roberts and
Fernando Boavida},
title = {Integrated Admission Control for Streaming and Elastic Traffic},
booktitle = {Quality of Future Internet Services, Second {COST} 263 International
Workshop, Qofis 2001, Coimbra, Portugal, September 24-26, 2001, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2156},
pages = {69--81},
publisher = {Springer},
year = {2001},
url = {https://doi.org/10.1007/3-540-45412-8\_6},
doi = {10.1007/3-540-45412-8\_6},
timestamp = {Tue, 14 May 2019 10:00:54 +0200},
biburl = {https://dblp.org/rec/conf/qofis/BenameurFDOR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/FredBPRR01,
author = {Slim Ben Fredj and
Thomas Bonald and
Alexandre Prouti{\`{e}}re and
G. R{\'{e}}gni{\'{e}} and
James W. Roberts},
editor = {Rene L. Cruz and
George Varghese},
title = {Statistical bandwidth sharing: a study of congestion at flow level},
booktitle = {Proceedings of the {ACM} {SIGCOMM} 2001 Conference on Applications,
Technologies, Architectures, and Protocols for Computer Communication,
August 27-31, 2001, San Diego, CA, {USA}},
pages = {111--122},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/383059.383068},
doi = {10.1145/383059.383068},
timestamp = {Wed, 21 Jul 2021 16:09:54 +0200},
biburl = {https://dblp.org/rec/conf/sigcomm/FredBPRR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmetrics/BonaldR01,
author = {Thomas Bonald and
James W. Roberts},
editor = {Mary K. Vernon},
title = {Performance modeling of elastic traffic in overload},
booktitle = {Proceedings of the Joint International Conference on Measurements
and Modeling of Computer Systems, SIGMETRICS/Performance 2001, June
16-20, 2001, Cambridge, MA, {USA}},
pages = {342--343},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/378420.378845},
doi = {10.1145/378420.378845},
timestamp = {Fri, 30 Jul 2021 16:13:33 +0200},
biburl = {https://dblp.org/rec/conf/sigmetrics/BonaldR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/qofis/2001,
editor = {Mikhail I. Smirnov and
Jon Crowcroft and
James Roberts and
Fernando Boavida},
title = {Quality of Future Internet Services, Second {COST} 263 International
Workshop, Qofis 2001, Coimbra, Portugal, September 24-26, 2001, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2156},
publisher = {Springer},
year = {2001},
url = {https://doi.org/10.1007/3-540-45412-8},
doi = {10.1007/3-540-45412-8},
isbn = {3-540-42602-7},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/qofis/2001.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cg/EbertRSPKR00,
author = {David S. Ebert and
Randall M. Rohrer and
Christopher D. Shaw and
Pradyut Panda and
James M. Kukla and
D. Aaron Roberts},
title = {Procedural shape generation for multi-dimensional data visualization},
journal = {Comput. Graph.},
volume = {24},
number = {3},
pages = {375--384},
year = {2000},
url = {https://doi.org/10.1016/S0097-8493(00)00033-9},
doi = {10.1016/S0097-8493(00)00033-9},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cg/EbertRSPKR00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/re/RobertsonR00,
author = {James Robertson and
Suzanne Robertson},
title = {Requirements Management: {A} Cinderella Story},
journal = {Requir. Eng.},
volume = {5},
number = {2},
pages = {134--136},
year = {2000},
url = {https://doi.org/10.1007/PL00010346},
doi = {10.1007/PL00010346},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/re/RobertsonR00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcst/CooperWJRS00,
author = {Rory A. Cooper and
Lana M. Widman and
Daniel K. Jones and
Rick N. Robertson and
James F. Ster},
title = {Force sensing control for electric powered wheelchairs},
journal = {{IEEE} Trans. Control. Syst. Technol.},
volume = {8},
number = {1},
pages = {112--117},
year = {2000},
url = {https://doi.org/10.1109/87.817696},
doi = {10.1109/87.817696},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcst/CooperWJRS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/telsys/MassoulieR00,
author = {Laurent Massouli{\'{e}} and
James Roberts},
title = {Bandwidth sharing and admission control for elastic traffic},
journal = {Telecommun. Syst.},
volume = {15},
number = {1-2},
pages = {185--201},
year = {2000},
url = {https://doi.org/10.1023/A:1019138827659},
doi = {10.1023/A:1019138827659},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/telsys/MassoulieR00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/HajimowlanaMJR00,
author = {S. Hossain Hajimowlana and
Roberto Muscedere and
Graham A. Jullien and
James W. Roberts},
title = {Defect detection in web inspection using fuzzy fusion of texture features},
booktitle = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2000,
Emerging Technologies for the 21st Century, Geneva, Switzerland, 28-31
May 2000, Proceedings},
pages = {718--721},
publisher = {{IEEE}},
year = {2000},
url = {https://doi.org/10.1109/ISCAS.2000.856161},
doi = {10.1109/ISCAS.2000.856161},
timestamp = {Fri, 13 Aug 2021 09:26:01 +0200},
biburl = {https://dblp.org/rec/conf/iscas/HajimowlanaMJR00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/networking/Oueslati-BoulahiaR00,
author = {Sara Oueslati{-}Boulahia and
James W. Roberts},
editor = {Guy Pujolle and
Harry G. Perros and
Serge Fdida and
Ulf K{\"{o}}rner and
Ioannis Stavrakakis},
title = {Impact of "Trunk Reservation" on Elastic Flow Routing},
booktitle = {{NETWORKING} 2000, Broadband Communications, High Performance Networking,
and Performance of Communication Networks, {IFIP-TC6} / European Commission
International Conference, Paris, France, May 14-19, 2000, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1815},
pages = {823--834},
publisher = {Springer},
year = {2000},
url = {https://doi.org/10.1007/3-540-45551-5\_69},
doi = {10.1007/3-540-45551-5\_69},
timestamp = {Tue, 14 May 2019 10:00:44 +0200},
biburl = {https://dblp.org/rec/conf/networking/Oueslati-BoulahiaR00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/RobertsCECCS00,
author = {Eric Roberts and
C. Fay Cover and
Gerald L. Engel and
Carl K. Chang and
James H. Cross II and
Russell L. Shackelford},
editor = {Lillian (Boots) Cassel and
Nell B. Dale and
Henry MacKay Walker and
Susan M. Haller},
title = {Curriculum 2001: Evaluating the Strawman Report Representatives of
the {ACM/IEEE-CS} Task Force (Panel Session)},
booktitle = {Proceedings of the 31st {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 2000, Austin, Texas, USA, March 7-12, 2000},
pages = {411--412},
publisher = {{ACM}},
year = {2000},
url = {https://doi.org/10.1145/330908.331900},
doi = {10.1145/330908.331900},
timestamp = {Tue, 23 Mar 2021 10:54:19 +0100},
biburl = {https://dblp.org/rec/conf/sigcse/RobertsCECCS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/qofis/2000,
editor = {Jon Crowcroft and
James Roberts and
Mikhail I. Smirnov},
title = {Quality of Future Internet Services, First {COST} 263 International
Workshop, QofIS 2000, Berlin, Germany, September 25-26, 2000, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1922},
publisher = {Springer},
year = {2000},
url = {https://doi.org/10.1007/3-540-39939-9},
doi = {10.1007/3-540-39939-9},
isbn = {3-540-41076-7},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/qofis/2000.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cse/KuntzPDRS99,
author = {Matthew C. Kuntz and
Olga Perkovic and
Karin A. Dahmen and
Bruce W. Roberts and
James P. Sethna},
title = {Hysteresis, avalanches, and noise},
journal = {Comput. Sci. Eng.},
volume = {1},
number = {4},
pages = {73--81},
year = {1999},
url = {https://doi.org/10.1109/5992.774844},
doi = {10.1109/5992.774844},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cse/KuntzPDRS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jodl/ShawKSENZMR99,
author = {Christopher D. Shaw and
James M. Kukla and
Ian Soboroff and
David S. Ebert and
Charles K. Nicholas and
Amen Zwa and
Ethan L. Miller and
D. Aaron Roberts},
title = {Interactive Volumetric Information Visualization for Document Corpus
Management},
journal = {Int. J. Digit. Libr.},
volume = {2},
number = {2-3},
pages = {144--156},
year = {1999},
url = {https://doi.org/10.1007/s007990050043},
doi = {10.1007/S007990050043},
timestamp = {Fri, 11 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jodl/ShawKSENZMR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/EvansMSPFESSM0PP99,
author = {Joseph B. Evans and
Gary J. Minden and
K. Sam Shanmugan and
Glenn Prescott and
Victor S. Frost and
Benjamin J. Ewy and
Ricardo J. S{\'{a}}nchez and
Craig Sparks and
K. Malinimohan and
James A. Roberts and
Richard G. Plumb and
David W. Petr},
title = {The rapidly deployable radio network},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {17},
number = {4},
pages = {689--703},
year = {1999},
url = {https://doi.org/10.1109/49.761045},
doi = {10.1109/49.761045},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/EvansMSPFESSM0PP99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nn/RobinsM99,
author = {Anthony V. Robins and
Simon McCallum},
title = {The consolidation of learning during sleep: comparing the pseudorehearsal
and unlearning accounts},
journal = {Neural Networks},
volume = {12},
number = {7-8},
pages = {1191--1206},
year = {1999},
url = {https://doi.org/10.1016/S0893-6080(99)00056-8},
doi = {10.1016/S0893-6080(99)00056-8},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nn/RobinsM99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rti/HajimowlanaMJR99,
author = {S. Hossain Hajimowlana and
Roberto Muscedere and
Graham A. Jullien and
James W. Roberts},
title = {An In-Camera Data Stream Processing System for Defect Detection in
Web Inspection Tasks},
journal = {Real Time Imaging},
volume = {5},
number = {1},
pages = {23--34},
year = {1999},
url = {https://doi.org/10.1006/rtim.1998.0145},
doi = {10.1006/RTIM.1998.0145},
timestamp = {Thu, 21 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/rti/HajimowlanaMJR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dexaw/RobertsonR99,
author = {Suzanne Robertson and
James Robertson},
title = {Reliable Requirements through the Quality Gateway},
booktitle = {10th International Workshop on Database {\&} Expert Systems Applications,
Florence, Italy, September 1-3, 1999, Proceedings},
pages = {357--363},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/DEXA.1999.795193},
doi = {10.1109/DEXA.1999.795193},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dexaw/RobertsonR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hcw/BraunSBBMRRTYHF99,
author = {Tracy D. Braun and
Howard Jay Siegel and
Noah Beck and
Ladislau B{\"{o}}l{\"{o}}ni and
Muthucumaru Maheswaran and
Albert I. Reuther and
James P. Robertson and
Mitchell D. Theys and
Bin Yao and
Debra A. Hensgen and
Richard F. Freund},
title = {A Comparison Study of Static Mapping Heuristics for a Class of Meta-tasks
on Heterogeneous Computing Systems},
booktitle = {8th Heterogeneous Computing Workshop, {HCW} 1999, San Juan, Puerto
Rico, April12, 1999},
pages = {15--29},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/HCW.1999.765093},
doi = {10.1109/HCW.1999.765093},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hcw/BraunSBBMRRTYHF99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/MassoulieR99,
author = {Laurent Massouli{\'{e}} and
James Roberts},
title = {Bandwidth Sharing: Objectives and Algorithms},
booktitle = {Proceedings {IEEE} {INFOCOM} '99, The Conference on Computer Communications,
Eighteenth Annual Joint Conference of the {IEEE} Computer and Communications
Societies, The Future Is Now, New York, NY, USA, March 21-25, 1999},
pages = {1395--1403},
publisher = {{IEEE} Computer Society},
year = {1999},
url = {https://doi.org/10.1109/INFCOM.1999.752159},
doi = {10.1109/INFCOM.1999.752159},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/infocom/MassoulieR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/npiv/ShawHBER99,
author = {Christopher D. Shaw and
James A. Hall and
Christine Blahut and
David S. Ebert and
D. Aaron Roberts},
editor = {David S. Ebert and
Christopher D. Shaw},
title = {Using Shape to Visualize Multivariate Data},
booktitle = {Workshop on New Paradigms in Information Visualization and Manipulation,
{NPIVM} 1999, in conjunction with the Eigth {ACM} International Conference
on Information and Knowledge Management, {CIKM} 1999, Kansas City,
Missouri, USA, November 6, 1999, Proceedings},
pages = {17--20},
publisher = {{ACM}},
year = {1999},
url = {https://doi.org/10.1145/331770.331777},
doi = {10.1145/331770.331777},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/npiv/ShawHBER99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nzgrad/McCallumR99,
author = {Simon McCallum and
Anthony V. Robins},
editor = {Stuart A. Yeates},
title = {Mechanisms for Memory Consolidation},
booktitle = {Third New Zealand Computer Science Research Students' Conference,
Te Kohinga Marama Marae, Hamilton, New Zealand, April 6-9, 1999},
pages = {30--37},
publisher = {University of Waikato},
year = {1999},
timestamp = {Mon, 23 Nov 2020 17:36:12 +0100},
biburl = {https://dblp.org/rec/conf/nzgrad/McCallumR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vissym/EbertRSPKR99,
author = {David S. Ebert and
Randall M. Rohrer and
Christopher D. Shaw and
Pradyut Panda and
James M. Kukla and
D. Aaron Roberts},
editor = {M. Eduard Gr{\"{o}}ller and
Helwig L{\"{o}}ffelmann and
William Ribarsky},
title = {Procedural Shape Generation for Multi-dimensional Data Visualization},
booktitle = {1st Joint Eurographics - {IEEE} {TCVG} Symposium on Visualization,
VisSym 1999, Vienna, Austria, May 26-28, 1999},
pages = {3--12},
publisher = {Eurographics Association},
year = {1999},
url = {https://doi.org/10.1007/978-3-7091-6803-5\_1},
doi = {10.1007/978-3-7091-6803-5\_1},
timestamp = {Wed, 01 Jul 2020 11:58:33 +0200},
biburl = {https://dblp.org/rec/conf/vissym/EbertRSPKR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/visualization/ShawHER99,
author = {Christopher D. Shaw and
James A. Hall and
David S. Ebert and
D. Aaron Roberts},
editor = {David S. Ebert and
Markus H. Gross and
Bernd Hamann},
title = {Interactive Lens Visualization Techniques},
booktitle = {10th {IEEE} Visualization Conference, {IEEE} Vis 1999, San Francisco,
CA, USA, October 24-29, 1999, Proceedings},
pages = {155--160},
publisher = {{IEEE} Computer Society and {ACM}},
year = {1999},
url = {https://doi.org/10.1109/VISUAL.1999.809882},
doi = {10.1109/VISUAL.1999.809882},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/visualization/ShawHER99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/connection/RobinsM98,
author = {Anthony V. Robins and
Simon McCallum},
title = {Catastrophic Forgetting and the Pseudorehearsal Solution in Hopfield-type
Networks},
journal = {Connect. Sci.},
volume = {10},
number = {2},
pages = {121--135},
year = {1998},
url = {https://doi.org/10.1080/095400998116530},
doi = {10.1080/095400998116530},
timestamp = {Fri, 02 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/connection/RobinsM98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/MoradiRG98,
author = {Hamid Moradi and
James A. Roberts and
Jerzy W. Grzymala{-}Busse},
title = {Entropy of English Text: Experiments with Humans and a Machine Learning
System Based on Rough Sets},
journal = {Inf. Sci.},
volume = {104},
number = {1-2},
pages = {31--47},
year = {1998},
url = {https://doi.org/10.1016/S0020-0255(97)00074-1},
doi = {10.1016/S0020-0255(97)00074-1},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/isci/MoradiRG98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iswc/NeavesB98,
author = {Philip Neaves and
James Bedford{-}Roberts},
title = {Dynamic Connection of Wearable Computers to Companion Devices using
Near-Field Radio},
booktitle = {Second International Symposium on Wearable Computers {(ISWC} 1998),
Pittsburgh, Pennsylvania, USA, 19-20 October 1998, Proceedings},
pages = {156--157},
publisher = {{IEEE} Computer Society},
year = {1998},
url = {https://doi.org/10.1109/ISWC.1998.729543},
doi = {10.1109/ISWC.1998.729543},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iswc/NeavesB98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miip/BarrettRAH98,
author = {James R. Barrett and
David A. Roberts and
George F. Alheid and
Stephen F. Hall},
editor = {Kenneth M. Hanson},
title = {Observer performance on wavelet-compressed neurological images},
booktitle = {Medical Imaging 1998: Image Processing, San Diego, CA, United States,
21-26 February 1998},
series = {{SPIE} Proceedings},
volume = {3338},
publisher = {{SPIE}},
year = {1998},
url = {https://doi.org/10.1117/12.310970},
doi = {10.1117/12.310970},
timestamp = {Wed, 25 Jul 2018 18:08:09 +0200},
biburl = {https://dblp.org/rec/conf/miip/BarrettRAH98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pimrc/IrvineRD98,
author = {James Irvine and
David Robertson and
John Dunlop},
title = {The {MOSTRAIN} (mobile services for high speed trains) system demonstrator},
booktitle = {The 9th {IEEE} International Symposium on Personal, Indoor and Mobile
Radio Communications, {PIMRC} 1998, Boston, MA, USA, September 8-11,
1998},
pages = {1004--1008},
publisher = {{IEEE}},
year = {1998},
url = {https://doi.org/10.1109/PIMRC.1998.734711},
doi = {10.1109/PIMRC.1998.734711},
timestamp = {Tue, 19 May 2020 15:57:12 +0200},
biburl = {https://dblp.org/rec/conf/pimrc/IrvineRD98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/srds/BraunSBBMRRTY98,
author = {Tracy D. Braun and
Howard Jay Siegel and
Noah Beck and
Ladislau B{\"{o}}l{\"{o}}ni and
Muthucumaru Maheswaran and
Albert I. Reuther and
James P. Robertson and
Mitchell D. Theys and
Bin Yao},
title = {A Taxonomy for Describing Matching and Scheduling Heuristics for Mixed-Machine
Heterogeneous Computing Systems},
booktitle = {The Seventeenth Symposium on Reliable Distributed Systems, {SRDS}
1998, West Lafayette, Indiana, USA, October 20-22, 1998, Proceedings},
pages = {330--335},
publisher = {{IEEE} Computer Society},
year = {1998},
url = {https://doi.ieeecomputersociety.org/10.1109/SRDS.1998.10000},
doi = {10.1109/SRDS.1998.10000},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/srds/BraunSBBMRRTY98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcae/KapadiaRF98,
author = {Nirav H. Kapadia and
James P. Robertson and
Jos{\'{e}} A. B. Fortes},
title = {Interface issues in running computer architecture tools via the www},
booktitle = {Proceedings of the 1998 workshop on Computer architecture education,
WCAE@ISCA 1998, Barcelona, Spain, June 1998},
pages = {32},
publisher = {{ACM}},
year = {1998},
url = {https://doi.org/10.1145/1275182.1275214},
doi = {10.1145/1275182.1275214},
timestamp = {Tue, 06 Nov 2018 16:57:55 +0100},
biburl = {https://dblp.org/rec/conf/wcae/KapadiaRF98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/HamdiRR97,
author = {Maher Hamdi and
James W. Roberts and
Pierre Rolin},
title = {Rate Control for {VBR} Video Coders in Broad-Band Networks},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {15},
number = {6},
pages = {1040--1051},
year = {1997},
url = {https://doi.org/10.1109/49.611158},
doi = {10.1109/49.611158},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/HamdiRR97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvrmed/BzostekSBCRATK97,
author = {Andrew Bzostek and
Steven Schreiner and
Aaron C. Barnes and
Jeffrey A. Cadeddu and
W. W. Roberts and
James H. Anderson and
Russell H. Taylor and
Louis R. Kavoussi},
editor = {Jocelyne Troccaz and
W. Eric L. Grimson and
Ralf M{\"{o}}sges},
title = {An automated system for precise percutaneous access of the renal collecting
system},
booktitle = {CVRMed-MRCAS'97, First Joint Conference Computer Vision, Virtual Reality
and Robotics in Medicine and Medial Robotics and Computer-Assisted
Surgery, Grenoble, France, March 19-22, 1997, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1205},
pages = {299--308},
publisher = {Springer},
year = {1997},
url = {https://doi.org/10.1007/BFb0029249},
doi = {10.1007/BFB0029249},
timestamp = {Sun, 02 Jun 2019 21:19:09 +0200},
biburl = {https://dblp.org/rec/conf/cvrmed/BzostekSBCRATK97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dimacs/EllingtonRJC97,
author = {Andrew D. Ellington and
Michael P. Robertson and
Ken D. James and
J. Colin Cox},
editor = {Harvey Rubin and
David Harlan Wood},
title = {Strategies for {DNA} computing},
booktitle = {{DNA} Based Computers, Proceedings of a {DIMACS} Workshop, Philadelphia,
Pennsylvania, USA, June 23-25, 1997},
series = {{DIMACS} Series in Discrete Mathematics and Theoretical Computer Science},
volume = {48},
pages = {173--184},
publisher = {{DIMACS/AMS}},
year = {1997},
url = {https://doi.org/10.1090/dimacs/048/13},
doi = {10.1090/DIMACS/048/13},
timestamp = {Mon, 22 May 2023 16:07:35 +0200},
biburl = {https://dblp.org/rec/conf/dimacs/EllingtonRJC97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ics/LeeRF97,
author = {Hyuk{-}Jae Lee and
James P. Robertson and
Jos{\'{e}} A. B. Fortes},
editor = {Steven J. Wallach and
Hans P. Zima},
title = {Generalized Cannon's Algorithm for Parallel Matrix Multiplication},
booktitle = {Proceedings of the 11th international conference on Supercomputing,
{ICS} 1997, Vienna, Austria, July 7-11, 1997},
pages = {44--51},
publisher = {{ACM}},
year = {1997},
url = {https://doi.org/10.1145/263580.263591},
doi = {10.1145/263580.263591},
timestamp = {Tue, 06 Nov 2018 11:07:03 +0100},
biburl = {https://dblp.org/rec/conf/ics/LeeRF97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip6-3/Roberts97,
author = {James W. Roberts},
editor = {Toshiharu Hasegawa and
Hideaki Takagi and
Yutaka Takahashi},
title = {Realizing quality of service guarantees in multiservice networks},
booktitle = {Performance and Management of Complex Communication Networks, {IFIP}
{TC6} / {WG6.3} {\&} {WG7.3} International Conference on the Performance
and Management of Complex Communication Networks (PMCCN'97), 17-21
November 1997, Tsukuba Science City, Japan},
series = {{IFIP} Conference Proceedings},
volume = {120},
pages = {277--293},
publisher = {Chapman {\&} Hall},
year = {1997},
timestamp = {Fri, 10 Jul 2015 17:21:29 +0200},
biburl = {https://dblp.org/rec/conf/ifip6-3/Roberts97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iswc/HullNB97,
author = {Richard Hull and
Philip Neaves and
James Bedford{-}Roberts},
title = {Towards Situated Computing},
booktitle = {First International Symposium on Wearable Computers {(ISWC} 1997),
Cambridge, Massachusetts, USA, 13-14 October 1997, Proceedings},
pages = {146--153},
publisher = {{IEEE} Computer Society},
year = {1997},
url = {https://doi.org/10.1109/ISWC.1997.629931},
doi = {10.1109/ISWC.1997.629931},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iswc/HullNB97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mse/SimpsonRABBBBGE97,
author = {M. L. Simpson and
James M. Rochelle and
G. T. Alley and
T. V. Blalock and
Charles L. Britton Jr. and
Donald W. Bouldin and
W. L. Bryan and
R. C. Gonzalez and
M. Nance Ericson and
M. J. Paulus and
E. J. Kennedy and
Stephen F. Smith and
M. J. Roberts and
Alan L. Wintenberg},
title = {The University of Tennessee/Oak Ridge National Laboratory joint program
in mixed-signal {VLSI} and monolithic sensors},
booktitle = {1997 {IEEE} International Conference on Microelectronic Systems Education,
{MSE} '97, Arlington, VA, USA, July 21-23, 1997},
pages = {34--35},
publisher = {{IEEE} Computer Society},
year = {1997},
url = {https://doi.org/10.1109/MSE.1997.612536},
doi = {10.1109/MSE.1997.612536},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mse/SimpsonRABBBBGE97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/WalkerRBJJ97,
author = {Steve Walker and
Stephen E. Robertson and
Mohand Boughanem and
Gareth J. F. Jones and
Karen Sparck Jones},
editor = {Ellen M. Voorhees and
Donna K. Harman},
title = {Okapi at {TREC-6} Automatic ad hoc, VLC, routing, filtering and {QSDR}},
booktitle = {Proceedings of The Sixth Text REtrieval Conference, {TREC} 1997, Gaithersburg,
Maryland, USA, November 19-21, 1997},
series = {{NIST} Special Publication},
volume = {500-240},
pages = {125--136},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {1997},
url = {http://trec.nist.gov/pubs/trec6/papers/city\_proc\_auto.ps},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/WalkerRBJJ97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/daglib/0084525,
author = {James Robertson and
Suzanne Robertson},
title = {Vollst{\"{a}}ndige Systemanalyse},
publisher = {Hanser},
year = {1996},
isbn = {978-3-446-18115-1},
timestamp = {Wed, 27 Apr 2011 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/daglib/0084525.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/ethos/Roberts96a,
author = {Marcus James Roberts},
title = {A cooperative approach to networked information resource discovery},
school = {University of Nottingham, {UK}},
year = {1996},
url = {https://ethos.bl.uk/OrderDetails.do?uin=uk.bl.ethos.338531},
timestamp = {Tue, 05 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/ethos/Roberts96a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/izs/HamdiR96,
author = {Maher Hamdi and
James W. Roberts},
editor = {Bernhard Plattner},
title = {Burstiness Bounds Based Muliplexing Schemes for {VBR} Video Connections
in the {B-ISDN}},
booktitle = {Broadband Communications - Networks, Services, Applications, Future
Directions, 1996 International Zurich Seminar on Digital Communications,
IZS'96, Zurich, Switzerland, February 21-23, 1996, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1044},
pages = {53--64},
publisher = {Springer},
year = {1996},
url = {https://doi.org/10.1007/BFb0022217},
doi = {10.1007/BFB0022217},
timestamp = {Tue, 14 May 2019 10:00:54 +0200},
biburl = {https://dblp.org/rec/conf/izs/HamdiR96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/RobertsMV96,
editor = {James W. Roberts and
Ugo Mocci and
Jorma T. Virtamo},
title = {Broadband Network Teletraffic - Performance Evaluation and Design
of Broadband Multiservice Networks: Final Report of Action {COST}
242},
series = {Lecture Notes in Computer Science},
volume = {1155},
publisher = {Springer},
year = {1996},
url = {https://doi.org/10.1007/3-540-61815-5},
doi = {10.1007/3-540-61815-5},
isbn = {3-540-61815-5},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/sp/RobertsMV96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/BargalloR95,
author = {Juan M. Bargallo and
James A. Roberts},
title = {Performance of {BPSK} and {TCM} using the exponential multipath profile
model for spread-spectrum indoor radio channels},
journal = {{IEEE} Trans. Commun.},
volume = {43},
number = {2/3/4},
pages = {615--623},
year = {1995},
url = {https://doi.org/10.1109/26.380080},
doi = {10.1109/26.380080},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcom/BargalloR95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wc/DunlopIRC95,
author = {John Dunlop and
James Irvine and
David Robertson and
Peter Cosimini},
title = {Performance of a statistically multiplexed access mechanism for a
{TDMA} radio interface},
journal = {{IEEE} Wirel. Commun.},
volume = {2},
number = {3},
pages = {56--64},
year = {1995},
url = {https://doi.org/10.1109/98.388929},
doi = {10.1109/98.388929},
timestamp = {Fri, 03 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/wc/DunlopIRC95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccs/Roberts95,
author = {James D. Roberts},
editor = {Gerard Ellis and
Robert Levinson and
William Rich and
John F. Sowa},
title = {A New Parallelization of Subgraphs Isomorphism Refinement for Classification
and Retrieval of Conceptual Structures},
booktitle = {Conceptual Structures: Applications, Implementation and Theory, Third
International Conference on Conceptual Structures, {ICCS} '95, Santa
Cruz, California, USA, August 14-18, 1995, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {954},
pages = {202--216},
publisher = {Springer},
year = {1995},
url = {https://doi.org/10.1007/3-540-60161-9\_39},
doi = {10.1007/3-540-60161-9\_39},
timestamp = {Tue, 14 May 2019 10:00:37 +0200},
biburl = {https://dblp.org/rec/conf/iccs/Roberts95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mmnet/HamdiR95,
author = {Maher Hamdi and
James W. Roberts},
title = {QoS Guarantees for Shaped Bit Rate Video Connections in Broadband
Networks},
booktitle = {Proceedings of the International Conference on Multimedia Networking,
MmNet 1995, Aizu, Japan, September 26-29, 1995},
pages = {153--162},
publisher = {{IEEE} Computer Society},
year = {1995},
timestamp = {Mon, 20 Mar 2017 14:07:43 +0100},
biburl = {https://dblp.org/rec/conf/mmnet/HamdiR95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/PritskerMRWDHEBWKRAB95,
author = {A. Alan B. Pritsker and
David L. Martin and
Janet S. Reust and
Mary Ann Flanigan Wagner and
O. Patrick Daily and
Ann M. Harper and
Erick B. Edwards and
Leah E. Bennett and
James R. Wilson and
Michael E. Kuhl and
John P. Roberts and
Margaret D. Allen and
James F. Burdick},
editor = {William R. Lilegdon and
David Goldsman and
Christos Alexopoulos and
Keebom Kang},
title = {Organ Transplantation Policy Evaluation},
booktitle = {Proceedings of the 27th conference on Winter simulation, {WSC} 1995,
Arlington, VA, USA, December 3-6, 1995},
pages = {1314--1323},
publisher = {{IEEE} Computer Society},
year = {1995},
url = {https://doi.org/10.1109/WSC.1995.479041},
doi = {10.1109/WSC.1995.479041},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wsc/PritskerMRWDHEBWKRAB95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/anor/BensaouGRS94,
author = {Brahim Bensaou and
Jacky Guibert and
James W. Roberts and
Alain Simonian},
title = {Performance of an {ATM} multiplexer queue in the fluid approximation
using the Bene{\v{s}} approach},
journal = {Ann. Oper. Res.},
volume = {49},
number = {1},
pages = {137--160},
year = {1994},
url = {https://doi.org/10.1007/BF02031595},
doi = {10.1007/BF02031595},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/anor/BensaouGRS94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsis/Sprowls94f,
author = {Clay Sprowls},
title = {Complete systems analysis: The workbook, the textbook, the answers:
James and Susan Robertson Dorset House New York {(1994)} 2 Vols 592
pp {\textdollar}74.75 {ISBN} 0 932633 25 0},
journal = {J. Strateg. Inf. Syst.},
volume = {3},
number = {3},
pages = {254--255},
year = {1994},
url = {https://doi.org/10.1016/0963-8687(94)90030-2},
doi = {10.1016/0963-8687(94)90030-2},
timestamp = {Tue, 25 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jsis/Sprowls94f.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamrev/Robertson94,
author = {James B. Robertson},
title = {Continuous-Time Markov Chains {(W.} J. Anderson)},
journal = {{SIAM} Rev.},
volume = {36},
number = {2},
pages = {316--317},
year = {1994},
url = {https://doi.org/10.1137/1036084},
doi = {10.1137/1036084},
timestamp = {Tue, 29 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamrev/Robertson94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/000194,
author = {James A. Roberts},
title = {Packet error rates for {DPSK} and differentially encoded coherent
{BPSK}},
journal = {{IEEE} Trans. Commun.},
volume = {42},
number = {234},
pages = {1441--1444},
year = {1994},
url = {https://doi.org/10.1109/TCOMM.1994.582796},
doi = {10.1109/TCOMM.1994.582796},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcom/000194.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/0001B94,
author = {James A. Roberts and
Juan M. Bargallo},
title = {{DPSK} performance for indoor wireless Rician fading channels},
journal = {{IEEE} Trans. Commun.},
volume = {42},
number = {234},
pages = {592--596},
year = {1994},
url = {https://doi.org/10.1109/TCOMM.1994.577086},
doi = {10.1109/TCOMM.1994.577086},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcom/0001B94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/Roberts93,
author = {James W. Roberts},
title = {Traffic Control in the {B-ISDN}},
journal = {Comput. Networks {ISDN} Syst.},
volume = {25},
number = {10},
pages = {1055--1064},
year = {1993},
url = {https://doi.org/10.1016/0169-7552(93)90066-D},
doi = {10.1016/0169-7552(93)90066-D},
timestamp = {Thu, 14 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cn/Roberts93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/atmn/RobertsBC93,
author = {James W. Roberts and
Brahim Bensaou and
Y. Canetti},
editor = {Harry G. Perros and
Guy Pujolle and
Y. Takahashi},
title = {A Traffic Control Framework for High Speed Data Transmission},
booktitle = {Modelling and Performance Evaluation of {ATM} Technology, Proceedings
of the {IFIP} {TC6} Task Group/WG6.4 International Workshop on Performance
of Communication Systems, Martinique, French Caribbean Island, January
25-27, 1993},
series = {{IFIP} Transactions},
volume = {{C-15}},
pages = {243--262},
publisher = {North-Holland},
year = {1993},
timestamp = {Mon, 07 Jan 2002 15:53:45 +0100},
biburl = {https://dblp.org/rec/conf/atmn/RobertsBC93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ngits/MorganHHCQRO93,
author = {Konrad Morgan and
Laura Holland and
Philip Hardy and
James Casey and
Tonny Quinn and
Keith Roberts and
Richard Oldfield},
editor = {Opher Etzion and
Arie Segev},
title = {Next Generation Criminal Intelligence Systems: How Novel Knowledge
Based Applications and Multi-Media Interfaces May Merge},
booktitle = {NGITS' 93 - The International Workshop on Next Generation Information
Technologies and Systems, Technion, Haifa, Israel, June 28-30, 1993},
year = {1993},
timestamp = {Thu, 08 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ngits/MorganHHCQRO93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cg/FrameR92,
author = {Michael Frame and
James Robertson},
title = {A generalized mandelbrot set and the role of critical points},
journal = {Comput. Graph.},
volume = {16},
number = {1},
pages = {35--40},
year = {1992},
url = {https://doi.org/10.1016/0097-8493(92)90068-7},
doi = {10.1016/0097-8493(92)90068-7},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cg/FrameR92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dt/ChuDDHBROJR92,
author = {Yaohan Chu and
Donald L. Dietmeyer and
James R. Duley and
Fredrick J. Hill and
Mario Barbacci and
Charles W. Rose and
Greg M. Ordy and
Bill Johnson and
Martin Roberts},
title = {Three Decades of HDLs: Part I, {CDL} Through {TI-HDL}},
journal = {{IEEE} Des. Test Comput.},
volume = {9},
number = {2},
pages = {69--81},
year = {1992},
url = {https://doi.org/10.1109/54.143147},
doi = {10.1109/54.143147},
timestamp = {Wed, 11 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dt/ChuDDHBROJR92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pe/RobertsG92,
author = {James Roberts and
Fabrice Guillemin},
title = {Jitter in {ATM} Networks and its Impact on Peak Rate Enforcement},
journal = {Perform. Evaluation},
volume = {16},
number = {1-3},
pages = {35--48},
year = {1992},
url = {https://doi.org/10.1016/0166-5316(92)90066-P},
doi = {10.1016/0166-5316(92)90066-P},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pe/RobertsG92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigchi/GoldensonCGMMPC92,
author = {Dennis R. Goldenson and
Ravinder Chandhok and
David Garlan and
Glenn Meter and
Philip L. Miller and
John Pane and
Jacobo Carrasquel and
James A. Roberts and
Edward Skwarecki},
title = {{GENIE:} Developing and Assessing State-of-the-Art Integrated Programming
Environments},
journal = {{ACM} {SIGCHI} Bull.},
volume = {24},
number = {2},
pages = {39--40},
year = {1992},
url = {https://doi.org/10.1145/142386.1055544},
doi = {10.1145/142386.1055544},
timestamp = {Sun, 20 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigchi/GoldensonCGMMPC92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/CrainSSHR92,
author = {Robert C. Crain and
Joseph M. Sussman and
Thomas J. Schriber and
James O. Henriksen and
Stephen D. Roberts},
editor = {Robert C. Crain},
title = {The Winter Simulation Conference: Celebrating Twenty-Five Years of
Progress},
booktitle = {Proceedings of the 24th Winter Simulation Conference, Arlington, VA,
USA, December 13-16, 1992},
pages = {3--33},
publisher = {{ACM} Press},
year = {1992},
url = {https://doi.org/10.1145/167293.167297},
doi = {10.1145/167293.167297},
timestamp = {Thu, 10 Jun 2021 22:17:49 +0200},
biburl = {https://dblp.org/rec/conf/wsc/CrainSSHR92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cm/Roberts91,
author = {James W. Roberts},
title = {Variable-bit-rate traffic control in {B-ISDN}},
journal = {{IEEE} Commun. Mag.},
volume = {29},
number = {9},
pages = {50--56},
year = {1991},
url = {https://doi.org/10.1109/35.90493},
doi = {10.1109/35.90493},
timestamp = {Wed, 02 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cm/Roberts91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/MartinPB91,
author = {Bruce E. Martin and
Claus H. Pedersen and
James Bedford{-}Roberts},
title = {An Object-Based Taxonomy for Distributed Computing Systems},
journal = {Computer},
volume = {24},
number = {8},
pages = {17--27},
year = {1991},
url = {https://doi.org/10.1109/2.84873},
doi = {10.1109/2.84873},
timestamp = {Wed, 12 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/computer/MartinPB91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsac/NorrosRSV91,
author = {Ilkka Norros and
James W. Roberts and
Alain Simonian and
Jorma T. Virtamo},
title = {The Superposition of Variable Bit Rate Sources in an {ATM} Multiplexer},
journal = {{IEEE} J. Sel. Areas Commun.},
volume = {9},
number = {3},
pages = {378--387},
year = {1991},
url = {https://doi.org/10.1109/49.76636},
doi = {10.1109/49.76636},
timestamp = {Thu, 02 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jsac/NorrosRSV91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamsc/EisenhutDRW91,
author = {R. D. Eisenhut and
Robert S. Dittus and
Stephen D. Roberts and
James R. Wilson},
title = {Comparing Averaged-Out Utilities of Probability Trees Having Random
Parameters},
journal = {{SIAM} J. Sci. Comput.},
volume = {12},
number = {5},
pages = {1140--1161},
year = {1991},
url = {https://doi.org/10.1137/0912060},
doi = {10.1137/0912060},
timestamp = {Thu, 30 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamsc/EisenhutDRW91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/RobertsV91,
author = {James W. Roberts and
Jorma T. Virtamo},
title = {The superposition of periodic cell arrival streams in an {ATM} multiplexer},
journal = {{IEEE} Trans. Commun.},
volume = {39},
number = {2},
pages = {298--303},
year = {1991},
url = {https://doi.org/10.1109/26.76467},
doi = {10.1109/26.76467},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcom/RobertsV91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/CarterR90,
author = {Tony M. Carter and
James E. Robertson},
title = {The Set Theory of Arithmetic Decomposition},
journal = {{IEEE} Trans. Computers},
volume = {39},
number = {8},
pages = {993--1005},
year = {1990},
url = {https://doi.org/10.1109/12.57037},
doi = {10.1109/12.57037},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/CarterR90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/CarterR90a,
author = {Tony M. Carter and
James E. Robertson},
title = {Radix-16 Signed-Digit Division},
journal = {{IEEE} Trans. Computers},
volume = {39},
number = {12},
pages = {1424--1433},
year = {1990},
url = {https://doi.org/10.1109/12.61063},
doi = {10.1109/12.61063},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/CarterR90a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/CordyER90,
author = {James R. Cordy and
Nicholas L. Eliot and
Michael G. Robertson},
title = {TuringTool: {A} User Interface to Aid in the Software Maintenance
Task},
journal = {{IEEE} Trans. Software Eng.},
volume = {16},
number = {3},
pages = {294--301},
year = {1990},
url = {https://doi.org/10.1109/32.48937},
doi = {10.1109/32.48937},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tse/CordyER90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/DeBrotaDRW89,
author = {David J. DeBrota and
Robert S. Dittus and
Stephen D. Roberts and
James R. Wilson},
title = {Visual interactive fitting of bounded Johnson distributions},
journal = {Simul.},
volume = {52},
number = {5},
pages = {199--205},
year = {1989},
url = {https://doi.org/10.1177/003754978905200505},
doi = {10.1177/003754978905200505},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simulation/DeBrotaDRW89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/DeBrotaDRW89a,
author = {David J. DeBrota and
Robert S. Dittus and
Stephen D. Roberts and
James R. Wilson},
title = {Errata},
journal = {Simul.},
volume = {53},
number = {5},
pages = {220},
year = {1989},
url = {https://doi.org/10.1177/003754978905300507},
doi = {10.1177/003754978905300507},
timestamp = {Mon, 08 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simulation/DeBrotaDRW89a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccd/MillerRM89,
author = {James Miller and
Ben Roberts and
Paul Madland},
title = {High performance circuits for the i486TM processor},
booktitle = {Computer Design: {VLSI} in Computers and Processors, {ICCD} 1989.
Proceedings., 1989 {IEEE} International Conference on, Cambridge,
MA, USA, October 2-4, 1989},
pages = {188--192},
publisher = {{IEEE}},
year = {1989},
url = {https://doi.org/10.1109/ICCD.1989.63353},
doi = {10.1109/ICCD.1989.63353},
timestamp = {Mon, 09 Aug 2021 14:54:02 +0200},
biburl = {https://dblp.org/rec/conf/iccd/MillerRM89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/DeBrotaDSRW89,
author = {David J. DeBrota and
Robert S. Dittus and
James J. Swain and
Stephen D. Roberts and
James R. Wilson},
editor = {Edward A. MacNair and
Kenneth J. Musselman and
Philip Heidelberger},
title = {Modeling input processes with Johnson distributions},
booktitle = {Proceedings of the 21st Winter Simulation Conference, Washington,
DC, USA, December 4-6, 1989},
pages = {308--318},
publisher = {{ACM} Press},
year = {1989},
url = {https://doi.org/10.1145/76738.76777},
doi = {10.1145/76738.76777},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wsc/DeBrotaDSRW89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/FriesSZRLG88,
author = {Richard C. Fries and
Kenneth J. Stoeger and
David A. Zombatfalvy and
James A. Roberts and
Jeffrey M. Leen and
Tani A. Grove},
title = {A reliability assurance database for analysis of medical product performance},
booktitle = {First Annual {IEEE} Symposium on Computer-Based Medical Systems (CBMS'88),
June 8-10, 1988, Minneapolis, MN, {USA}},
pages = {9--14},
publisher = {{IEEE}},
year = {1988},
url = {https://doi.org/10.1109/ECBS.1988.5438},
doi = {10.1109/ECBS.1988.5438},
timestamp = {Wed, 30 Oct 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cbms/FriesSZRLG88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/DeBrotaRSDWV88,
author = {David J. DeBrota and
Stephen D. Roberts and
James J. Swain and
Robert S. Dittus and
James R. Wilson and
Sekhar Venkatraman},
editor = {Michael A. Abrams and
Peter L. Haigh and
John Craig Comfort},
title = {Input modeling with the Johnson system of distributions},
booktitle = {Proceedings of the 20th conference on Winter simulation, {WSC} 1988,
San Diego, California, USA, December 12-14, 1988},
pages = {165--179},
publisher = {{ACM}},
year = {1988},
url = {https://doi.org/10.1145/318123.318182},
doi = {10.1145/318123.318182},
timestamp = {Thu, 10 Jun 2021 22:21:21 +0200},
biburl = {https://dblp.org/rec/conf/wsc/DeBrotaRSDWV88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pe/DziongR87,
author = {Zbigniew Dziong and
James W. Roberts},
title = {Congestion Probabilities in a Circuit-Switched Integrated Services
Network},
journal = {Perform. Evaluation},
volume = {7},
number = {4},
pages = {267--284},
year = {1987},
url = {https://doi.org/10.1016/0166-5316(87)90013-7},
doi = {10.1016/0166-5316(87)90013-7},
timestamp = {Sat, 22 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/pe/DziongR87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/LiaoR87,
author = {Ke{-}Qiang Liao and
James Roberts},
title = {Videoconference Traffic and Network Design},
journal = {{IEEE} Trans. Commun.},
volume = {35},
number = {3},
pages = {275--282},
year = {1987},
url = {https://doi.org/10.1109/TCOM.1987.1096762},
doi = {10.1109/TCOM.1987.1096762},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcom/LiaoR87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/BurnsR87,
author = {James E. Burns and
Edward L. Robertson},
title = {Two Complementary Course Sequences on the Design and Implementation
of Software Products},
journal = {{IEEE} Trans. Software Eng.},
volume = {13},
number = {11},
pages = {1170--1175},
year = {1987},
url = {https://doi.org/10.1109/TSE.1987.232866},
doi = {10.1109/TSE.1987.232866},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tse/BurnsR87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/arith/Robertson87,
author = {James E. Robertson},
editor = {Mary Jane Irwin and
Renato Stefanelli},
title = {Error detection and correction for addition and subtraction, through
use of higher radix extensions of hamming codes},
booktitle = {8th {IEEE} Symposium on Computer Arithmetic, {ARITH} 1987, Como, Italy,
May 18-21, 1987},
pages = {226--229},
publisher = {{IEEE} Computer Society},
year = {1987},
url = {https://doi.org/10.1109/ARITH.1987.6158714},
doi = {10.1109/ARITH.1987.6158714},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/arith/Robertson87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/RobertsL86,
author = {James Roberts and
Ke{-}Qiang Liao},
title = {Traffic Models for Telecommunication Services with Advance Capacity
Reservation},
journal = {Comput. Networks},
volume = {10},
pages = {221--229},
year = {1986},
url = {https://doi.org/10.1016/0169-7552(85)90018-2},
doi = {10.1016/0169-7552(85)90018-2},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cn/RobertsL86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/wsc/1986,
editor = {James R. Wilson and
James O. Henriksen and
Stephen D. Roberts},
title = {Proceedings of the 18th conference on Winter simulation, {WSC} 1986,
Washington, DC, USA, December 8-10, 1986},
publisher = {{ACM}},
year = {1986},
url = {http://dl.acm.org/citation.cfm?id=318242},
isbn = {0-911801-11-1},
timestamp = {Thu, 10 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wsc/1986.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/arith/Robertson83,
author = {James E. Robertson},
editor = {T. R. N. Rao and
Peter Kornerup},
title = {Conditions for the distributivity of multiplication with respect to
set addition and their effect on the design of array multipliers},
booktitle = {6th {IEEE} Symposium on Computer Arithmetic, {ARITH} 1983, Aarhus,
Denmark, June 20-22, 1983},
pages = {67--71},
publisher = {{IEEE} Computer Society},
year = {1983},
url = {https://doi.org/10.1109/ARITH.1983.6158097},
doi = {10.1109/ARITH.1983.6158097},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/arith/Robertson83.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/RobertsBKPR82,
author = {Stephen D. Roberts and
Jerry Banks and
James Kho and
Udo W. Pooch and
John S. Ramberg},
editor = {Yen W. Chao and
Orlando S. Madrigal},
title = {Teaching simulation to undergraduates},
booktitle = {Proceedings of the 14th conference on Winter Simulation, {WSC} 1982,
San Diego, CA, USA, December 6-8, 1982},
pages = {706},
publisher = {{ACM}},
year = {1982},
url = {http://dl.acm.org/citation.cfm?id=1035965},
timestamp = {Thu, 10 Jun 2021 22:20:01 +0200},
biburl = {https://dblp.org/rec/conf/wsc/RobertsBKPR82.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/arith/Robertson81,
author = {James E. Robertson},
editor = {Kishor S. Trivedi and
Daniel E. Atkins},
title = {A systematic approach to the design of structures for arithmetic},
booktitle = {5th {IEEE} Symposium on Computer Arithmetic, {ARITH} 1981, Ann Arbor,
MI, USA, May 16-19, 1981},
pages = {35--41},
publisher = {{IEEE} Computer Society},
year = {1981},
url = {https://doi.org/10.1109/ARITH.1981.6159291},
doi = {10.1109/ARITH.1981.6159291},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/arith/Robertson81.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/RobertsH80,
author = {James A. Roberts and
Timothy J. Healy},
title = {Packet Radio Performance Over Slow Rayleigh Fading Channels},
journal = {{IEEE} Trans. Commun.},
volume = {28},
number = {2},
pages = {279--286},
year = {1980},
url = {https://doi.org/10.1109/TCOM.1980.1094655},
doi = {10.1109/TCOM.1980.1094655},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcom/RobertsH80.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/RobertsTW79,
author = {James A. Roberts and
Ernest T. Tsui and
David C. Watson},
title = {Signal-to-Noise Ratio Evaluations for Nonlinear Amplifiers},
journal = {{IEEE} Trans. Commun.},
volume = {27},
number = {1},
pages = {197--201},
year = {1979},
url = {https://doi.org/10.1109/TCOM.1979.1094260},
doi = {10.1109/TCOM.1979.1094260},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcom/RobertsTW79.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/arith/ChowR78,
author = {Catherine Y. Chow and
James E. Robertson},
title = {Logical design of a redundant binary adder},
booktitle = {4th {IEEE} Symposium on Computer Arithmetic, {ARITH} 1978, Santa Monica,
CA, USA, October 25-27, 1978},
pages = {109--115},
publisher = {{IEEE} Computer Society},
year = {1978},
url = {https://doi.org/10.1109/ARITH.1978.6155767},
doi = {10.1109/ARITH.1978.6155767},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/arith/ChowR78.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/Roberts78,
author = {James L. Roberts},
title = {An all-digital phase-measurement techniques using clipped-quadrature
correlation},
booktitle = {{IEEE} International Conference on Acoustics, Speech, and Signal Processing,
{ICASSP} '78, Tulsa, Oklahoma, USA, April 10-12, 1978},
pages = {674--677},
publisher = {{IEEE}},
year = {1978},
url = {https://doi.org/10.1109/ICASSP.1978.1170495},
doi = {10.1109/ICASSP.1978.1170495},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icassp/Roberts78.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/RobertsSS78,
author = {Stephen D. Roberts and
James Schier and
Thom Sulanke},
editor = {Harold Joseph Highland and
Norman R. Nielsen and
Larry G. Hull},
title = {An introduction to modeling with {INS}},
booktitle = {Proceedings of the 10th conference on Winter simulation, {WSC} 1978,
Miami Beach, FL, USA, December 4-6, 1978},
pages = {343--353},
publisher = {{ACM}},
year = {1978},
url = {http://dl.acm.org/citation.cfm?id=811244},
timestamp = {Thu, 10 Jun 2021 22:20:34 +0200},
biburl = {https://dblp.org/rec/conf/wsc/RobertsSS78.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/RobertsFS77,
author = {Stephen D. Roberts and
Mark Fox and
James Schier},
editor = {Harold Joseph Highland and
Robert G. Sargent and
J. William Schmidt and
Mitchell G. Spiegel and
Paul F. Roth and
Sara Torrence and
Claude M. Delfosse and
Larry G. Hull},
title = {Using {INS} to model systems with active resources},
booktitle = {Proceedings of the 9th conference on Winter simulation, {WSC} 1977,
Gaithersburg, MD, USA, December 5-7, 1977},
pages = {536--544},
publisher = {{ACM}},
year = {1977},
url = {http://dl.acm.org/citation.cfm?id=811258},
timestamp = {Wed, 10 Aug 2016 15:47:43 +0200},
biburl = {https://dblp.org/rec/conf/wsc/RobertsFS77.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/ShaftR76,
author = {Paul D. Shaft and
James A. Roberts},
title = {Optimum Allocation of Multibeam Communications Satellite Resources},
journal = {{IEEE} Trans. Commun.},
volume = {24},
number = {10},
pages = {1195--1200},
year = {1976},
url = {https://doi.org/10.1109/TCOM.1976.1093209},
doi = {10.1109/TCOM.1976.1093209},
timestamp = {Tue, 01 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tcom/ShaftR76.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acm/LaneHRJSO76,
author = {Malcolm G. Lane and
Henry K. Hess and
Carol A. Roberts and
Ray J. Jakubek and
Steve Silverstein and
James Van Ornum},
editor = {John A. Gosden and
Olin G. Johnson},
title = {{SIGMINI} (Paper Session)},
booktitle = {Proceedings of the 1976 Annual Conference, Houston, Texas, USA, October
20-22, 1976},
pages = {258},
publisher = {{ACM}},
year = {1976},
url = {https://doi.org/10.1145/800191.805592},
doi = {10.1145/800191.805592},
timestamp = {Wed, 14 Apr 2021 11:40:49 +0200},
biburl = {https://dblp.org/rec/conf/acm/LaneHRJSO76.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmetrics/SharpR74,
author = {Joseph C. Sharp and
James N. Roberts},
editor = {John H. Howard Jr. and
Philip J. Kiviat and
James D. Connell and
Stuart Trask and
J. William Atwood},
title = {An adaptive policy driven scheduler},
booktitle = {Proceedings of the 1974 {ACM} {SIGMETRICS} conference on Measurement
and evaluation, {SIGMETRICS} 1974, USA, 1974},
pages = {199--208},
publisher = {{ACM}},
year = {1974},
url = {https://doi.org/10.1145/800277.809386},
doi = {10.1145/800277.809386},
timestamp = {Mon, 02 Aug 2021 11:33:21 +0200},
biburl = {https://dblp.org/rec/conf/sigmetrics/SharpR74.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mst/Robertson73,
author = {James B. Robertson},
title = {The Mixing Properties of Certain Processes Related to Markov Chains},
journal = {Math. Syst. Theory},
volume = {7},
number = {1},
pages = {39--43},
year = {1973},
url = {https://doi.org/10.1007/BF01824805},
doi = {10.1007/BF01824805},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mst/Robertson73.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/RobertsonT73,
author = {James E. Robertson and
Kishor S. Trivedi},
title = {The Status of Investigations into Computer Hardware Design Based on
the Use of Continued Fractions},
journal = {{IEEE} Trans. Computers},
volume = {22},
number = {6},
pages = {555--560},
year = {1973},
url = {https://doi.org/10.1109/TC.1973.5009106},
doi = {10.1109/TC.1973.5009106},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/RobertsonT73.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/DurhamR73,
author = {James D. Durham and
Stephen D. Roberts},
editor = {Joseph M. Sussman},
title = {A dynamic control system for hospital inventories},
booktitle = {Proceedings of the 6th conference on Winter simulation, {WSC} 1973,
San Francisco, CA, USA, January 17-19, 1973},
pages = {886},
publisher = {{ACM}},
year = {1973},
url = {https://doi.org/10.1145/800293.811656},
doi = {10.1145/800293.811656},
timestamp = {Thu, 10 Jun 2021 16:43:03 +0200},
biburl = {https://dblp.org/rec/conf/wsc/DurhamR73.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/arith/RobertsonT72,
author = {James E. Robertson and
Kishor S. Trivedi},
title = {The status of investigations into the use of continued fractions for
computer hardware},
booktitle = {2nd {IEEE} Symposium on Computer Arithmetic, {ARITH} 1972, College
Park, MD, USA, May 15-16, 1972},
pages = {1--30},
publisher = {{IEEE} Computer Society},
year = {1972},
url = {https://doi.org/10.1109/ARITH.1972.6153902},
doi = {10.1109/ARITH.1972.6153902},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/arith/RobertsonT72.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/Robertson70,
author = {James E. Robertson},
title = {The Correspondence Between Methods of Digital Division and Multiplier
Recoding Procedures},
journal = {{IEEE} Trans. Computers},
volume = {19},
number = {8},
pages = {692--701},
year = {1970},
url = {https://doi.org/10.1109/T-C.1970.223018},
doi = {10.1109/T-C.1970.223018},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/Robertson70.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/AkersGR70,
author = {Sheldon B. Akers Jr. and
James M. Geyer and
Donald L. Roberts},
editor = {Ralph J. Preiss},
title = {{IC} mask layout with a single conductor layer},
booktitle = {Proceedings of the 7th Design Automation Workshop, {DAC} '70, San
Francisco, California, USA, June 22-25, 1970},
pages = {7--16},
publisher = {{ACM}},
year = {1970},
url = {https://doi.org/10.1145/800160.805107},
doi = {10.1145/800160.805107},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dac/AkersGR70.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mst/KeynesR69,
author = {Harvey B. Keynes and
James B. Robertson},
title = {Generators for Topological Entropy and Expansiveness},
journal = {Math. Syst. Theory},
volume = {3},
number = {1},
pages = {51--59},
year = {1969},
url = {https://doi.org/10.1007/BF01695625},
doi = {10.1007/BF01695625},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mst/KeynesR69.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/focs/Robertson61,
author = {James E. Robertson},
title = {Problems in the physical realization of speed independent circuits},
booktitle = {2nd Annual Symposium on Switching Circuit Theory and Logical Design,
Detroit, Michigan, USA, October 17-20, 1961},
pages = {106--108},
publisher = {{IEEE} Computer Society},
year = {1961},
url = {https://doi.org/10.1109/FOCS.1961.28},
doi = {10.1109/FOCS.1961.28},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/focs/Robertson61.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/CarrPRS59,
author = {John W. Carr III and
Alan J. Perlis and
James E. Robertson and
Norman R. Scott},
title = {A Visit to Computation Centers in the Soviet Union},
journal = {Commun. {ACM}},
volume = {2},
number = {6},
pages = {8--20},
year = {1959},
url = {https://doi.org/10.1145/368336.368342},
doi = {10.1145/368336.368342},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/CarrPRS59.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip/MetzeR59,
author = {Gernot Metze and
James E. Robertson},
title = {Elimination of carry propagation in digital computers},
booktitle = {Information Processing, Proceedings of the 1st International Conference
on Information Processing, UNESCO, Paris 15-20 June 1959},
pages = {389--395},
publisher = {{UNESCO} (Paris)},
year = {1959},
timestamp = {Fri, 26 Jul 2019 12:25:09 +0200},
biburl = {https://dblp.org/rec/conf/ifip/MetzeR59.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/Robertson58,
author = {James E. Robertson},
title = {A New Class of Digital Division Methods},
journal = {{IRE} Trans. Electron. Comput.},
volume = {7},
number = {3},
pages = {218--222},
year = {1958},
url = {https://doi.org/10.1109/TEC.1958.5222579},
doi = {10.1109/TEC.1958.5222579},
timestamp = {Mon, 25 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/Robertson58.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/Robertson56,
author = {James E. Robertson},
title = {Odd Binary Asynchronous Counters},
journal = {{IRE} Trans. Electron. Comput.},
volume = {5},
number = {1},
pages = {12--15},
year = {1956},
url = {https://doi.org/10.1109/TEC.1956.5219785},
doi = {10.1109/TEC.1956.5219785},
timestamp = {Mon, 25 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/Robertson56.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/Robertson55,
author = {James E. Robertson},
title = {Two's Complement Multiplication in Binary Parallel Digital Computers},
journal = {{IRE} Trans. Electron. Comput.},
volume = {4},
number = {3},
pages = {118--119},
year = {1955},
url = {https://doi.org/10.1109/IRETELC.1955.5407911},
doi = {10.1109/IRETELC.1955.5407911},
timestamp = {Mon, 25 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/Robertson55.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/us/Robertson52,
author = {James E. Robertson},
title = {Error Detection and Correction in Binary Parallel Digital Computers},
school = {University of Illinois Urbana-Champaign, {USA}},
year = {1952},
url = {https://hdl.handle.net/2142/56914},
timestamp = {Thu, 14 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/us/Robertson52.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-07-04 20:01 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
