default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Jack Rose"
download as .bib file
@article{DBLP:journals/npjdm/RobbLWWHMFBGMJBPHMHYBCD24,
author = {Tamsin J. Robb and
Yinan Liu and
Braden Woodhouse and
Charlotta Windahl and
Daniel G. Hurley and
Grant McArthur and
Stephen B. Fox and
Lisa Brown and
Parry Guilford and
Alice Minhinnick and
Christopher Jackson and
Cherie Blenkiron and
Kate Parker and
Kimiora Henare and
Rose McColl and
Bianca Haux and
Nick Young and
Veronica Boyle and
Laird Cameron and
Sanjeev Deva and
Jane Reeve and
Cristin G. Print and
Michael Davis and
Uwe Rieger and
Ben Lawrence},
title = {Blending space and time to talk about cancer in extended reality},
journal = {npj Digit. Medicine},
volume = {7},
number = {1},
year = {2024},
url = {https://doi.org/10.1038/s41746-024-01262-x},
doi = {10.1038/S41746-024-01262-X},
timestamp = {Tue, 22 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/RobbLWWHMFBGMJBPHMHYBCD24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/crypto/DoernerKR24,
author = {Jack Doerner and
Yashvanth Kondi and
Leah Namisa Rosenbloom},
editor = {Leonid Reyzin and
Douglas Stebila},
title = {Sometimes You Can't Distribute Random-Oracle-Based Proofs},
booktitle = {Advances in Cryptology - {CRYPTO} 2024 - 44th Annual International
Cryptology Conference, Santa Barbara, CA, USA, August 18-22, 2024,
Proceedings, Part {V}},
series = {Lecture Notes in Computer Science},
volume = {14924},
pages = {323--358},
publisher = {Springer},
year = {2024},
url = {https://doi.org/10.1007/978-3-031-68388-6\_12},
doi = {10.1007/978-3-031-68388-6\_12},
timestamp = {Wed, 28 Aug 2024 21:54:02 +0200},
biburl = {https://dblp.org/rec/conf/crypto/DoernerKR24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hri/XuHYSRTTHKMGH0A24,
author = {Wei Xu and
Tim Huff and
Siyang Ye and
Joshua Rafael Sanchez and
Darius Rose and
Harry Tung and
Yuang Tong and
Jack Hatcher and
Matthew Klein and
Eric Morales and
Davy Guo and
Yusam Hsu and
Haonan Peng and
Zubin Assadian and
John Raiti},
editor = {Dan Grollman and
Elizabeth Broadbent and
Wendy Ju and
Harold Soh and
Tom Williams},
title = {Virtual Reality-based Human-Robot Interaction for Remote Pick-and-Place
Tasks},
booktitle = {Companion of the 2024 {ACM/IEEE} International Conference on Human-Robot
Interaction, {HRI} 2024, Boulder, CO, USA, March 11-15, 2024},
pages = {1148--1152},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3610978.3640748},
doi = {10.1145/3610978.3640748},
timestamp = {Mon, 01 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hri/XuHYSRTTHKMGH0A24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icra/ONeillRMGPLPGMJ24,
author = {Abby O'Neill and
Abdul Rehman and
Abhiram Maddukuri and
Abhishek Gupta and
Abhishek Padalkar and
Abraham Lee and
Acorn Pooley and
Agrim Gupta and
Ajay Mandlekar and
Ajinkya Jain and
Albert Tung and
Alex Bewley and
Alexander Herzog and
Alex Irpan and
Alexander Khazatsky and
Anant Rai and
Anchit Gupta and
Andrew Wang and
Anikait Singh and
Animesh Garg and
Aniruddha Kembhavi and
Annie Xie and
Anthony Brohan and
Antonin Raffin and
Archit Sharma and
Arefeh Yavary and
Arhan Jain and
Ashwin Balakrishna and
Ayzaan Wahid and
Ben Burgess{-}Limerick and
Beomjoon Kim and
Bernhard Sch{\"{o}}lkopf and
Blake Wulfe and
Brian Ichter and
Cewu Lu and
Charles Xu and
Charlotte Le and
Chelsea Finn and
Chen Wang and
Chenfeng Xu and
Cheng Chi and
Chenguang Huang and
Christine Chan and
Christopher Agia and
Chuer Pan and
Chuyuan Fu and
Coline Devin and
Danfei Xu and
Daniel Morton and
Danny Driess and
Daphne Chen and
Deepak Pathak and
Dhruv Shah and
Dieter B{\"{u}}chler and
Dinesh Jayaraman and
Dmitry Kalashnikov and
Dorsa Sadigh and
Edward Johns and
Ethan Paul Foster and
Fangchen Liu and
Federico Ceola and
Fei Xia and
Feiyu Zhao and
Freek Stulp and
Gaoyue Zhou and
Gaurav S. Sukhatme and
Gautam Salhotra and
Ge Yan and
Gilbert Feng and
Giulio Schiavi and
Glen Berseth and
Gregory Kahn and
Guanzhi Wang and
Hao Su and
Haoshu Fang and
Haochen Shi and
Henghui Bao and
Heni Ben Amor and
Henrik I. Christensen and
Hiroki Furuta and
Homer Walke and
Hongjie Fang and
Huy Ha and
Igor Mordatch and
Ilija Radosavovic and
Isabel Leal and
Jacky Liang and
Jad Abou{-}Chakra and
Jaehyung Kim and
Jaimyn Drake and
Jan Peters and
Jan Schneider and
Jasmine Hsu and
Jeannette Bohg and
Jeffrey Bingham and
Jeffrey Wu and
Jensen Gao and
Jiaheng Hu and
Jiajun Wu and
Jialin Wu and
Jiankai Sun and
Jianlan Luo and
Jiayuan Gu and
Jie Tan and
Jihoon Oh and
Jimmy Wu and
Jingpei Lu and
Jingyun Yang and
Jitendra Malik and
Jo{\~{a}}o Silv{\'{e}}rio and
Joey Hejna and
Jonathan Booher and
Jonathan Tompson and
Jonathan Yang and
Jordi Salvador and
Joseph J. Lim and
Junhyek Han and
Kaiyuan Wang and
Kanishka Rao and
Karl Pertsch and
Karol Hausman and
Keegan Go and
Keerthana Gopalakrishnan and
Ken Goldberg and
Kendra Byrne and
Kenneth Oslund and
Kento Kawaharazuka and
Kevin Black and
Kevin Lin and
Kevin Zhang and
Kiana Ehsani and
Kiran Lekkala and
Kirsty Ellis and
Krishan Rana and
Krishnan Srinivasan and
Kuan Fang and
Kunal Pratap Singh and
Kuo{-}Hao Zeng and
Kyle Hatch and
Kyle Hsu and
Laurent Itti and
Lawrence Yunliang Chen and
Lerrel Pinto and
Li Fei{-}Fei and
Liam Tan and
Linxi Jim Fan and
Lionel Ott and
Lisa Lee and
Luca Weihs and
Magnum Chen and
Marion Lepert and
Marius Memmel and
Masayoshi Tomizuka and
Masha Itkina and
Mateo Guaman Castro and
Max Spero and
Maximilian Du and
Michael Ahn and
Michael C. Yip and
Mingtong Zhang and
Mingyu Ding and
Minho Heo and
Mohan Kumar Srirama and
Mohit Sharma and
Moo Jin Kim and
Naoaki Kanazawa and
Nicklas Hansen and
Nicolas Heess and
Nikhil J. Joshi and
Niko S{\"{u}}nderhauf and
Ning Liu and
Norman Di Palo and
Nur Muhammad (Mahi) Shafiullah and
Oier Mees and
Oliver Kroemer and
Osbert Bastani and
Pannag R. Sanketi and
Patrick Tree Miller and
Patrick Yin and
Paul Wohlhart and
Peng Xu and
Peter David Fagan and
Peter Mitrano and
Pierre Sermanet and
Pieter Abbeel and
Priya Sundaresan and
Qiuyu Chen and
Quan Vuong and
Rafael Rafailov and
Ran Tian and
Ria Doshi and
Roberto Mart{\'{\i}}n{-}Mart{\'{\i}}n and
Rohan Baijal and
Rosario Scalise and
Rose Hendrix and
Roy Lin and
Runjia Qian and
Ruohan Zhang and
Russell Mendonca and
Rutav Shah and
Ryan Hoque and
Ryan Julian and
Samuel Bustamante and
Sean Kirmani and
Sergey Levine and
Shan Lin and
Sherry Moore and
Shikhar Bahl and
Shivin Dass and
Shubham D. Sonawani and
Shuran Song and
Sichun Xu and
Siddhant Haldar and
Siddharth Karamcheti and
Simeon Adebola and
Simon Guist and
Soroush Nasiriany and
Stefan Schaal and
Stefan Welker and
Stephen Tian and
Subramanian Ramamoorthy and
Sudeep Dasari and
Suneel Belkhale and
Sungjae Park and
Suraj Nair and
Suvir Mirchandani and
Takayuki Osa and
Tanmay Gupta and
Tatsuya Harada and
Tatsuya Matsushima and
Ted Xiao and
Thomas Kollar and
Tianhe Yu and
Tianli Ding and
Todor Davchev and
Tony Z. Zhao and
Travis Armstrong and
Trevor Darrell and
Trinity Chung and
Vidhi Jain and
Vincent Vanhoucke and
Wei Zhan and
Wenxuan Zhou and
Wolfram Burgard and
Xi Chen and
Xiaolong Wang and
Xinghao Zhu and
Xinyang Geng and
Xiyuan Liu and
Liangwei Xu and
Xuanlin Li and
Yao Lu and
Yecheng Jason Ma and
Yejin Kim and
Yevgen Chebotar and
Yifan Zhou and
Yifeng Zhu and
Yilin Wu and
Ying Xu and
Yixuan Wang and
Yonatan Bisk and
Yoonyoung Cho and
Youngwoon Lee and
Yuchen Cui and
Yue Cao and
Yueh{-}Hua Wu and
Yujin Tang and
Yuke Zhu and
Yunchu Zhang and
Yunfan Jiang and
Yunshuang Li and
Yunzhu Li and
Yusuke Iwasawa and
Yutaka Matsuo and
Zehan Ma and
Zhuo Xu and
Zichen Jeff Cui and
Zichen Zhang and
Zipeng Lin},
title = {Open X-Embodiment: Robotic Learning Datasets and {RT-X} Models : Open
X-Embodiment Collaboration},
booktitle = {{IEEE} International Conference on Robotics and Automation, {ICRA}
2024, Yokohama, Japan, May 13-17, 2024},
pages = {6892--6903},
publisher = {{IEEE}},
year = {2024},
url = {https://doi.org/10.1109/ICRA57147.2024.10611477},
doi = {10.1109/ICRA57147.2024.10611477},
timestamp = {Mon, 14 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icra/ONeillRMGPLPGMJ24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigsoft/HassanLRGC00TOL24,
author = {Ahmed E. Hassan and
Dayi Lin and
Gopi Krishnan Rajbahadur and
Keheliya Gallaba and
Filipe Roseiro C{\^{o}}go and
Boyuan Chen and
Haoxiang Zhang and
Kishanthan Thangarajah and
Gustavo Ansaldi Oliva and
Jiahuei (Justina) Lin and
Wali Mohammad Abdullah and
Zhen Ming (Jack) Jiang},
editor = {Marcelo d'Amorim},
title = {Rethinking Software Engineering in the Era of Foundation Models: {A}
Curated Catalogue of Challenges in the Development of Trustworthy
FMware},
booktitle = {Companion Proceedings of the 32nd {ACM} International Conference on
the Foundations of Software Engineering, {FSE} 2024, Porto de Galinhas,
Brazil, July 15-19, 2024},
pages = {294--305},
publisher = {{ACM}},
year = {2024},
url = {https://doi.org/10.1145/3663529.3663849},
doi = {10.1145/3663529.3663849},
timestamp = {Fri, 19 Jul 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigsoft/HassanLRGC00TOL24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-15943,
author = {Ahmed E. Hassan and
Dayi Lin and
Gopi Krishnan Rajbahadur and
Keheliya Gallaba and
Filipe Roseiro C{\^{o}}go and
Boyuan Chen and
Haoxiang Zhang and
Kishanthan Thangarajah and
Gustavo Ansaldi Oliva and
Jiahuei Lin and
Wali Mohammad Abdullah and
Zhen Ming Jiang},
title = {Rethinking Software Engineering in the Foundation Model Era: {A} Curated
Catalogue of Challenges in the Development of Trustworthy FMware},
journal = {CoRR},
volume = {abs/2402.15943},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.15943},
doi = {10.48550/ARXIV.2402.15943},
eprinttype = {arXiv},
eprint = {2402.15943},
timestamp = {Tue, 26 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-15943.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/MorrisSAZSMHCSRHSCBCPMKT23,
author = {John H. Morris and
Karthik Soman and
Rabia E. Akbas and
Xiaoyuan Zhou and
Brett Smith and
Elaine C. Meng and
Conrad C. Huang and
Gabriel Cerono and
Gundolf Schenk and
Angela Rizk{-}Jackson and
Adil Harroud and
Lauren M. Sanders and
Sylvain V. Costes and
Krish Bharat and
Arjun Chakraborty and
Alexander R. Pico and
Taline Mardirossian and
Michael J. Keiser and
Alice Tang and
Josef Hardi and
Yongmei Shi and
Mark A. Musen and
Sharat Israni and
Sui Huang and
Peter W. Rose and
Charlotte A. Nelson and
Sergio E. Baranzini},
title = {The scalable precision medicine open knowledge engine {(SPOKE):} a
massive knowledge graph of biomedical information},
journal = {Bioinform.},
volume = {39},
number = {2},
year = {2023},
url = {https://doi.org/10.1093/bioinformatics/btad080},
doi = {10.1093/BIOINFORMATICS/BTAD080},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bioinformatics/MorrisSAZSMHCSRHSCBCPMKT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/ThornberryGCWMLRAESFBSZ23,
author = {Troy D. Thornberry and
Ru{-}Shan Gao and
Steven J. Ciciora and
Laurel A. Watts and
Richard J. McLaughlin and
Angelina Leonardi and
Karen H. Rosenlof and
Brian Argrow and
Jack Elston and
Maciej Stachura and
Joshua Fromm and
W. Alan Brewer and
Paul Schroeder and
Michael Zucker},
title = {A Lightweight Remote Sensing Payload for Wildfire Detection and Fire
Radiative Power Measurements},
journal = {Sensors},
volume = {23},
number = {7},
pages = {3514},
year = {2023},
url = {https://doi.org/10.3390/s23073514},
doi = {10.3390/S23073514},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/ThornberryGCWMLRAESFBSZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/RijkeThomasLMWTK23,
author = {Claude De Rijke{-}Thomas and
Jack C. Landy and
Robbie Mallett and
Rosemary C. Willatt and
Michel Tsamados and
Joshua King},
title = {Airborne Investigation of Quasi-Specular Ku-Band Radar Scattering
for Satellite Altimetry Over Snow-Covered Arctic Sea Ice},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {61},
pages = {1--19},
year = {2023},
url = {https://doi.org/10.1109/TGRS.2023.3318263},
doi = {10.1109/TGRS.2023.3318263},
timestamp = {Fri, 27 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/RijkeThomasLMWTK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smartcomp/GaoBRGWS23,
author = {Ye Gao and
Brian R. Baucom and
Karen Rose and
Kristina Gordon and
Hongning Wang and
John A. Stankovic},
title = {{E-ADDA:} Unsupervised Adversarial Domain Adaptation Enhanced by a
New Mahalanobis Distance Loss for Smart Computing},
booktitle = {2023 {IEEE} International Conference on Smart Computing, {SMARTCOMP}
2023, Nashville, TN, USA, June 26-30, 2023},
pages = {172--179},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/SMARTCOMP58114.2023.00039},
doi = {10.1109/SMARTCOMP58114.2023.00039},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/smartcomp/GaoBRGWS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-17330,
author = {Karthik Soman and
Peter W. Rose and
John H. Morris and
Rabia E. Akbas and
Brett Smith and
Braian Peetoom and
Catalina Villouta{-}Reyes and
Gabriel Cerono and
Yongmei Shi and
Angela Rizk{-}Jackson and
Sharat Israni and
Charlotte A. Nelson and
Sui Huang and
Sergio E. Baranzini},
title = {Biomedical knowledge graph-enhanced prompt generation for large language
models},
journal = {CoRR},
volume = {abs/2311.17330},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.17330},
doi = {10.48550/ARXIV.2311.17330},
eprinttype = {arXiv},
eprint = {2311.17330},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-17330.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/DoernerKR23,
author = {Jack Doerner and
Yashvanth Kondi and
Leah Namisa Rosenbloom},
title = {Sometimes You Can't Distribute Random-Oracle-Based Proofs},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {1381},
year = {2023},
url = {https://eprint.iacr.org/2023/1381},
timestamp = {Sat, 07 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/DoernerKR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/HutchinsAZBCRA22,
author = {Jack Hutchins and
Shamiul Alam and
Andre Zeumault and
Karsten Beckmann and
Nathaniel C. Cady and
Garrett S. Rose and
Ahmedullah Aziz},
title = {A Generalized Workflow for Creating Machine Learning-Powered Compact
Models for Multi-State Devices},
journal = {{IEEE} Access},
volume = {10},
pages = {115513--115519},
year = {2022},
url = {https://doi.org/10.1109/ACCESS.2022.3218333},
doi = {10.1109/ACCESS.2022.3218333},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/access/HutchinsAZBCRA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/BaranziniBMNSSK22,
author = {Sergio E. Baranzini and
Katy B{\"{o}}rner and
John H. Morris and
Charlotte A. Nelson and
Karthik Soman and
Erica Schleimer and
Michael J. Keiser and
Mark A. Musen and
Roger Pearce and
Tahsin Reza and
Brett Smith and
Bruce William Herr II and
Boris Oskotsky and
Angela Rizk{-}Jackson and
Katherine P. Rankin and
Stephan J. Sanders and
Riley Bove and
Peter W. Rose and
Sharat Israni and
Sui Huang},
title = {A Biomedical Open Knowledge Network Harnesses the Power of {AI} to
Understand Deep Human Biology},
journal = {{AI} Mag.},
volume = {43},
number = {1},
pages = {46--58},
year = {2022},
url = {https://doi.org/10.1609/aimag.v43i1.19125},
doi = {10.1609/AIMAG.V43I1.19125},
timestamp = {Tue, 05 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aim/BaranziniBMNSSK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/SeatonOBHJJJOSS22,
author = {Martin Seaton and
James O'Neill and
Brian Bien and
Christina Hood and
Mark Jackson and
Rose Jackson and
Kate Johnson and
Molly Oades and
Amy Stidworthy and
Jenny Stocker and
David Carruthers},
title = {A Multi-model Air Quality System for Health Research: Road model development
and evaluation},
journal = {Environ. Model. Softw.},
volume = {155},
pages = {105455},
year = {2022},
url = {https://doi.org/10.1016/j.envsoft.2022.105455},
doi = {10.1016/J.ENVSOFT.2022.105455},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/envsoft/SeatonOBHJJJOSS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/health/GaoSGRWS22,
author = {Ye Gao and
Asif Salekin and
Kristina Gordon and
Karen Rose and
Hongning Wang and
John A. Stankovic},
title = {Emotion Recognition Robust to Indoor Environmental Distortions and
Non-targeted Emotions Using Out-of-distribution Detection},
journal = {{ACM} Trans. Comput. Heal.},
volume = {3},
number = {2},
pages = {15:1--15:22},
year = {2022},
url = {https://doi.org/10.1145/3492300},
doi = {10.1145/3492300},
timestamp = {Mon, 13 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/health/GaoSGRWS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/McCoyRJAPWMJRLP22,
author = {Allison B. McCoy and
Elise M. Russo and
Kevin B. Johnson and
Bobby Addison and
Neal Patel and
Jonathan P. Wanderer and
Dara Eckerle Mize and
Jon G. Jackson and
Thomas J. Reese and
Sylinda Littlejohn and
Lorraine Patterson and
Tina French and
Debbie Preston and
Audra Rosenbury and
Charlie Valdez and
Scott D. Nelson and
Chetan V. Aher and
Mhd Wael Alrifai and
Jennifer Andrews and
Cheryl M. Cobb and
Sara N. Horst and
David P. Johnson and
Lindsey A. Knake and
Adam A. Lewis and
Laura Parks and
Sharidan K. Parr and
Pratik Patel and
Barron L. Patterson and
Christine M. Smith and
Krystle D. Suszter and
Robert W. Turer and
Lyndy J. Wilcox and
Aileen P. Wright and
Adam Wright},
title = {Clinician collaboration to improve clinical decision support: the
Clickbusters initiative},
journal = {J. Am. Medical Informatics Assoc.},
volume = {29},
number = {6},
pages = {1050--1059},
year = {2022},
url = {https://doi.org/10.1093/jamia/ocac027},
doi = {10.1093/JAMIA/OCAC027},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/McCoyRJAPWMJRLP22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/joc/ChenDKLRSC22,
author = {Megan Chen and
Jack Doerner and
Yashvanth Kondi and
Eysa Lee and
Schuyler Rosefield and
Abhi Shelat and
Ran Cohen},
title = {Multiparty Generation of an {RSA} Modulus},
journal = {J. Cryptol.},
volume = {35},
number = {2},
pages = {12},
year = {2022},
url = {https://doi.org/10.1007/s00145-021-09395-y},
doi = {10.1007/S00145-021-09395-Y},
timestamp = {Tue, 05 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/joc/ChenDKLRSC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/KeCTFCLC22,
author = {Yu Ke and
Ivy Cheng and
Gretchen Ser Hua Tan and
Rose Wai Yee Fok and
Jack Junjie Chan and
Kiley Wei{-}Jen Loh and
Alexandre Chan},
title = {Development and pilot testing of a decision aid for navigating breast
cancer survivorship care},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {22},
number = {1},
pages = {330},
year = {2022},
url = {https://doi.org/10.1186/s12911-022-02056-5},
doi = {10.1186/S12911-022-02056-5},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/KeCTFCLC22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/Torres-EspinACH22,
author = {Abel Torres{-}Espin and
Carlos A. Almeida and
Austin Chou and
J. Russell Huie and
Michael Chiu and
Romana Vavrek and
Jeff Sacramento and
Michael B. Orr and
John C. Gensel and
Jeffrey S. Grethe and
Maryann E. Martone and
Karim Fouad and
Adam R. Ferguson and
Warren Alilain and
Mark Bacon and
Nicholas Batty and
Michael Beattie and
Jacqueline Bresnahan and
Emily Burnside and
Sarah Busch and
Randall Carpenter and
Isaac Francos Quijorna and
Xiaohui Guo and
Agnes Haggerty and
Sarah Haroon and
Jack Harris and
Lyn Jakeman and
Linda Jones and
Naomi Kleitman and
Timothy Kopper and
Michael Aron Lane and
Francisco Magana and
David Magnuson and
Ines Maldonado and
Verena May and
Katelyn McFarlane and
Kazuhito Morioka and
Martin Oudega and
Philip Leo Pascual and
Jean{-}Baptiste Poline and
Ephron S. Rosenzweig and
Emma Schmidt and
Wolfram Tetzlaff and
Lana Zholudeva},
title = {Promoting {FAIR} Data Through Community-driven Agile Design: the Open
Data Commons for Spinal Cord Injury (odc-sci.org)},
journal = {Neuroinformatics},
volume = {20},
number = {1},
pages = {203--219},
year = {2022},
url = {https://doi.org/10.1007/s12021-021-09533-8},
doi = {10.1007/S12021-021-09533-8},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ni/Torres-EspinACH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pervasive/GaoJSMMWKGRWS22,
author = {Ye Gao and
Jason Jabbour and
Emma C. Schlegel and
Meiyi Ma and
Matthew McCall and
Lahiru N. S. Wijayasingha and
Eunjung Ko and
Kristina Gordon and
Karen Rose and
Hongning Wang and
John A. Stankovic},
title = {Out-of-the-Box Deployment to Support Research on In-Home Care of Alzheimer's
Patients},
journal = {{IEEE} Pervasive Comput.},
volume = {21},
number = {1},
pages = {37--47},
year = {2022},
url = {https://doi.org/10.1109/MPRV.2021.3106885},
doi = {10.1109/MPRV.2021.3106885},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pervasive/GaoJSMMWKGRWS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tse/ShiWCCJ22,
author = {Yong Shi and
Mingzhi Wen and
Filipe Roseiro C{\^{o}}go and
Boyuan Chen and
Zhen Ming Jiang},
title = {An Experience Report on Producing Verifiable Builds for Large-Scale
Commercial Systems},
journal = {{IEEE} Trans. Software Eng.},
volume = {48},
number = {9},
pages = {3361--3377},
year = {2022},
url = {https://doi.org/10.1109/TSE.2021.3092692},
doi = {10.1109/TSE.2021.3092692},
timestamp = {Tue, 25 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tse/ShiWCCJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/XiongSCCJ22,
author = {Jiawen Xiong and
Yong Shi and
Boyuan Chen and
Filipe Roseiro C{\^{o}}go and
Zhen Ming Jiang},
title = {Towards Build Verifiability for Java-based Systems},
booktitle = {44th {IEEE/ACM} International Conference on Software Engineering:
Software Engineering in Practice, {ICSE} {(SEIP)} 2022, Pittsburgh,
PA, USA, May 22-24, 2022},
pages = {297--306},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ICSE-SEIP55303.2022.9793937},
doi = {10.1109/ICSE-SEIP55303.2022.9793937},
timestamp = {Tue, 25 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icse/XiongSCCJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kdd/FitzGeraldAABBB22,
author = {Jack FitzGerald and
Shankar Ananthakrishnan and
Konstantine Arkoudas and
Davide Bernardi and
Abhishek Bhagia and
Claudio Delli Bovi and
Jin Cao and
Rakesh Chada and
Amit Chauhan and
Luoxin Chen and
Anurag Dwarakanath and
Satyam Dwivedi and
Turan Gojayev and
Karthik Gopalakrishnan and
Thomas Gueudr{\'{e}} and
Dilek Hakkani{-}Tur and
Wael Hamza and
Jonathan J. H{\"{u}}ser and
Kevin Martin Jose and
Haidar Khan and
Beiye Liu and
Jianhua Lu and
Alessandro Manzotti and
Pradeep Natarajan and
Karolina Owczarzak and
Gokmen Oz and
Enrico Palumbo and
Charith Peris and
Chandana Satya Prakash and
Stephen Rawls and
Andy Rosenbaum and
Anjali Shenoy and
Saleh Soltan and
Mukund Harakere Sridhar and
Lizhen Tan and
Fabian Triefenbach and
Pan Wei and
Haiyang Yu and
Shuai Zheng and
G{\"{o}}khan T{\"{u}}r and
Prem Natarajan},
editor = {Aidong Zhang and
Huzefa Rangwala},
title = {Alexa Teacher Model: Pretraining and Distilling Multi-Billion-Parameter
Encoders for Natural Language Understanding Systems},
booktitle = {{KDD} '22: The 28th {ACM} {SIGKDD} Conference on Knowledge Discovery
and Data Mining, Washington, DC, USA, August 14 - 18, 2022},
pages = {2893--2902},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3534678.3539173},
doi = {10.1145/3534678.3539173},
timestamp = {Tue, 06 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/kdd/FitzGeraldAABBB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-10001,
author = {Ye Gao and
Brian R. Baucom and
Karen Rose and
Kristina Gordon and
Hongning Wang and
John A. Stankovic},
title = {The Enforced Transfer: {A} Novel Domain Adaptation Algorithm},
journal = {CoRR},
volume = {abs/2201.10001},
year = {2022},
url = {https://arxiv.org/abs/2201.10001},
eprinttype = {arXiv},
eprint = {2201.10001},
timestamp = {Sat, 17 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2201-10001.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2202-05906,
author = {Jiawen Xiong and
Yong Shi and
Boyuan Chen and
Filipe Roseiro C{\^{o}}go and
Zhen Ming Jiang},
title = {Towards Build Verifiability for Java-based Systems},
journal = {CoRR},
volume = {abs/2202.05906},
year = {2022},
url = {https://arxiv.org/abs/2202.05906},
eprinttype = {arXiv},
eprint = {2202.05906},
timestamp = {Tue, 25 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2202-05906.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-07808,
author = {Jack FitzGerald and
Shankar Ananthakrishnan and
Konstantine Arkoudas and
Davide Bernardi and
Abhishek Bhagia and
Claudio Delli Bovi and
Jin Cao and
Rakesh Chada and
Amit Chauhan and
Luoxin Chen and
Anurag Dwarakanath and
Satyam Dwivedi and
Turan Gojayev and
Karthik Gopalakrishnan and
Thomas Gueudr{\'{e}} and
Dilek Hakkani{-}Tur and
Wael Hamza and
Jonathan J. H{\"{u}}ser and
Kevin Martin Jose and
Haidar Khan and
Beiye Liu and
Jianhua Lu and
Alessandro Manzotti and
Pradeep Natarajan and
Karolina Owczarzak and
Gokmen Oz and
Enrico Palumbo and
Charith Peris and
Chandana Satya Prakash and
Stephen Rawls and
Andy Rosenbaum and
Anjali Shenoy and
Saleh Soltan and
Mukund Harakere Sridhar and
Liz Tan and
Fabian Triefenbach and
Pan Wei and
Haiyang Yu and
Shuai Zheng and
G{\"{o}}khan T{\"{u}}r and
Prem Natarajan},
title = {Alexa Teacher Model: Pretraining and Distilling Multi-Billion-Parameter
Encoders for Natural Language Understanding Systems},
journal = {CoRR},
volume = {abs/2206.07808},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.07808},
doi = {10.48550/ARXIV.2206.07808},
eprinttype = {arXiv},
eprint = {2206.07808},
timestamp = {Tue, 06 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-07808.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-01448,
author = {Saleh Soltan and
Shankar Ananthakrishnan and
Jack FitzGerald and
Rahul Gupta and
Wael Hamza and
Haidar Khan and
Charith Peris and
Stephen Rawls and
Andy Rosenbaum and
Anna Rumshisky and
Chandana Satya Prakash and
Mukund Sridhar and
Fabian Triefenbach and
Apurv Verma and
G{\"{o}}khan T{\"{u}}r and
Prem Natarajan},
title = {AlexaTM 20B: Few-Shot Learning Using a Large-Scale Multilingual Seq2Seq
Model},
journal = {CoRR},
volume = {abs/2208.01448},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2208.01448},
doi = {10.48550/ARXIV.2208.01448},
eprinttype = {arXiv},
eprint = {2208.01448},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2208-01448.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-03149,
author = {Ye Gao and
Jason Jabbour and
Eunjung Ko and
Lahiru Nuwan Wijayasingha and
Sooyoung Kim and
Zetao Wang and
Meiyi Ma and
Karen Rose and
Kristina Gordon and
Hongning Wang and
John A. Stankovic},
title = {Integrating Voice-Based Machine Learning Technology into Complex Home
Environments},
journal = {CoRR},
volume = {abs/2211.03149},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.03149},
doi = {10.48550/ARXIV.2211.03149},
eprinttype = {arXiv},
eprint = {2211.03149},
timestamp = {Wed, 09 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-03149.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-12794,
author = {R{\'{e}}mi Lam and
Alvaro Sanchez{-}Gonzalez and
Matthew Willson and
Peter Wirnsberger and
Meire Fortunato and
Alexander Pritzel and
Suman V. Ravuri and
Timo Ewalds and
Ferran Alet and
Zach Eaton{-}Rosen and
Weihua Hu and
Alexander Merose and
Stephan Hoyer and
George Holland and
Jacklynn Stott and
Oriol Vinyals and
Shakir Mohamed and
Peter W. Battaglia},
title = {GraphCast: Learning skillful medium-range global weather forecasting},
journal = {CoRR},
volume = {abs/2212.12794},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.12794},
doi = {10.48550/ARXIV.2212.12794},
eprinttype = {arXiv},
eprint = {2212.12794},
timestamp = {Wed, 04 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-12794.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/TaylorROPRPSPPC21,
author = {Peter Taylor and
Joel Rahman and
Jackie O'Sullivan and
Geoffrey M. Podger and
Caroline Rosello and
Amit Parashar and
Ashmita Sengupta and
Jean Michel Perraud and
Carmel A. Pollino and
Mac Coombe},
title = {Basin futures, a novel cloud-based system for preliminary river basin
modelling and planning},
journal = {Environ. Model. Softw.},
volume = {141},
pages = {105049},
year = {2021},
url = {https://doi.org/10.1016/j.envsoft.2021.105049},
doi = {10.1016/J.ENVSOFT.2021.105049},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/envsoft/TaylorROPRPSPPC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fdgth/SathianathenHTS21,
author = {Niranjan Sathianathen and
Nicholas Heller and
Resha Tejpaul and
Bethany Stai and
Arveen Kalapara and
Jack Rickman and
Joshua Dean and
Makinna Oestreich and
Paul Blake and
Heather Kaluzniak and
Shaneabbas Raza and
Joel Rosenberg and
Keenan Moore and
Edward Walczak and
Zachary Rengel and
Zachary Edgerton and
Ranveer Vasdev and
Matthew Peterson and
Se{\'{a}}n McSweeney and
Sarah Peterson and
Nikolaos Papanikolopoulos and
Christopher Weight},
title = {Automatic Segmentation of Kidneys and Kidney Tumors: The KiTS19 International
Challenge},
journal = {Frontiers Digit. Health},
volume = {3},
pages = {797607},
year = {2021},
url = {https://doi.org/10.3389/fdgth.2021.797607},
doi = {10.3389/FDGTH.2021.797607},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fdgth/SathianathenHTS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HuiMZAABBBBBBBB21,
author = {Steve C. N. Hui and
Mark Mikkelsen and
Helge J. Z{\"{o}}llner and
Vishwadeep Ahluwalia and
Sarael Alcauter and
Laima Baltusis and
Deborah A. Barany and
Laura R. Barlow and
Robert Becker and
Jeffrey I. Berman and
Adam Berrington and
Pallab K. Bhattacharyya and
Jakob Udby Blicher and
Wolfgang Bogner and
Mark S. Brown and
Vince D. Calhoun and
Ryan Castillo and
Kim M. Cecil and
Richard A. E. Edden and
Yeo Bi Choi and
Winnie C. W. Chu and
William T. Clarke and
Alexander R. Craven and
Koen Cuypers and
Michael Dacko and
Camilo de la Fuente{-}Sandoval and
Patricia Desmond and
Aleksandra Domagalik and
Julien Dumont and
Niall W. Duncan and
Ulrike Dydak and
Katherine Dyke and
David A. Edmondson and
Gabriele Ende and
Lars Ersland and
C. John Evans and
Alan S. R. Fermin and
Antonio Ferretti and
Ariane Fillmer and
Tao Gong and
Ian Greenhouse and
James T. Grist and
Meng Gu and
Ashley D. Harris and
Katarzyna Hat and
Stefanie Heba and
Eva Heckova and
John P. Hegarty and
Kirstin{-}Friederike Heise and
Shiori Honda and
Aaron Jacobson and
Jacobus F. A. Jansen and
Christopher W. Jenkins and
Stephen J. Johnston and
Christoph Juchem and
Alayar Kangarlu and
Adam B. Kerr and
Karl Landheer and
Thomas Lange and
Phil Lee and
Swati Rane Levendovszky and
Catherine Limperopoulos and
Feng Liu and
William Lloyd and
David J. Lythgoe and
Maro G. Machizawa and
Erin L. MacMillan and
Richard J. Maddock and
Andrei V. Manzhurtsev and
Mar{\'{\i}}a L. Martinez{-}Gudino and
Jack J. Miller and
Heline Mirzakhanian and
Marta Moreno{-}Ortega and
Paul G. Mullins and
Shinichiro Nakajima and
Jamie Near and
Ralph Noeske and
Wibeke Nordh{\o}y and
Georg Oeltzschner and
Raul Osorio{-}Duran and
Mar{\'{\i}}a Concepci{\'{o}}n Garc{\'{\i}}a Otaduy and
Erick H. Pasaye and
Ronald Peeters and
Scott J. Peltier and
Ulrich Pilatus and
Nenad Polomac and
Eric C. Porges and
Subechhya Pradhan and
James Joseph Prisciandaro and
Nicolaas A. Puts and
Caroline D. Rae and
Francisco Reyes{-}Madrigal and
Timothy P. L. Roberts and
Caroline E. Robertson and
Jens T. Rosenberg and
Diana{-}Georgiana Rotaru and
Ruth L. O'Gorman Tuura and
Muhammad G. Saleh and
Kristian Sandberg and
Ryan Sangill and
Keith Schembri and
Anouk Schrantee and
Natalia A. Semenova and
Debra Singel and
Rouslan Sitnikov and
Jolinda Smith and
Yulu Song and
Craig E. L. Stark and
Diederick Stoffers and
Stephan P. Swinnen and
Rongwen Tain and
Costin Tanase and
Sofie Tapper and
Martin Tegenthoff and
Thomas Thiel and
Marc Thioux and
Peter Truong and
Pim van Dijk and
Nolan Vella and
Rishma Vidyasagar and
Andrej Vovk and
Guangbin Wang and
Lars T. Westlye and
Timothy K. Wilbur and
William R. Willoughby and
Martin Wilson and
Hans{-}J{\"{o}}rg Wittsack and
Adam J. Woods and
Yen{-}Chien Wu and
Junqian Xu and
Maria Yanez Lopez and
David Ka Wai Yeung and
Qun Zhao and
Xiaopeng Zhou and
Gasper Zupan},
title = {Frequency drift in {MR} spectroscopy at 3T},
journal = {NeuroImage},
volume = {241},
pages = {118430},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2021.118430},
doi = {10.1016/J.NEUROIMAGE.2021.118430},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/HuiMZAABBBBBBBB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/FehrKOGSGSBMMHK21,
author = {Jana Fehr and
Stefan Konigorski and
Stephen Olivier and
Resign Gunda and
Ashmika Surujdeen and
Dickman Gareta and
Theresa Smit and
Kathy Baisley and
Sashen Moodley and
Yumna Moosa and
Willem Hanekom and
Olivier Koole and
Thumbi Ndung'u and
Deenan Pillay and
Alison D. Grant and
Mark J. Siedner and
Christoph Lippert and
Emily B. Wong and
Anand Ramnanan and
Anele Mkhwanazi and
Antony Rapulana and
Anupa Singh and
Ashentha Govender and
Ayanda Zungu and
Boitsholo Mfolo and
Bongani Magwaza and
Bongumenzi Ndlovu and
Clive Mavimbela and
Costa Criticos and
Day Munatsi and
Dilip Kalyan and
Doctar Mlambo and
Fezeka Mfeka and
Freddy Mabetlela and
Gregory Ording{-}Jespersen and
Hannah Keal and
Hlengiwe Dlamini and
Hlengiwe Khathi and
Hlobisile Chonco and
Hlobisile Gumede and
Hlolisile Khumalo and
Hloniphile Ngubane and
Hollis Shen and
Hosea Kambonde and
Innocentia Mpofana and
Jabu Kwinda and
Jaco Dreyer and
Jade Cousins and
Jaikrishna Kalideen and
Janet Seeley and
Kandaseelan Chetty and
Kayleen Brien and
Kennedy Nyamande and
Kgaugelo Moropane and
Khabonina Malomane and
Khadija Khan and
Khanyisani Buthelezi and
Kimeshree Perumal and
Kobus Herbst and
Lindani Mthembu and
Logan Pillay and
Mandisi Dlamini and
Mandlakayise Zikhali and
Mbali Mbuyisa and
Mbuti Mofokeng and
Melusi Sibiya and
Mlungisi Dube and
Mosa Suleman and
Mpumelelo Steto and
Mzamo Buthelezi and
Nagavelli Padayachi and
Nceba Gqaleni and
Ngcebo Mhlongo and
Nokukhanya Ntshakala and
Nomathamsanqa Majozi and
Nombuyiselo Zondi and
Nomfundo Luthuli and
Nomfundo Ngema and
Nompilo Buthelezi and
Nonceba Mfeka and
Nondumiso Khuluse and
Nondumiso Mabaso and
Nondumiso Zitha and
Nonhlanhla Mfekayi and
Nonhlanhla Mzimela and
Nozipho Mbonambi and
Ntombiyenhlanhla Mkhwanazi and
Ntombiyenkosi Ntombela and
Pamela Ramkalawon and
Pfarelo Tshivase and
Phakamani Mkhwanazi and
Philippa Mathews and
Phumelele Mthethwa and
Phumla Ngcobo and
Ramesh Jackpersad and
Raynold Zondo and
Rochelle Singh and
Rose Myeni and
Sanah Bucibo and
Sandile Mthembu and
Sashin Harilall and
Senamile Makhari and
Seneme Mchunu and
Senzeni Mkhwanazi and
Sibahle Gumbi and
Siboniso Nene and
Sibusiso Mhlongo and
Sibusiso Mkhwanazi and
Sibusiso Nsibande and
Simphiwe Ntshangase and
Siphephelo Dlamini and
Sithembile Ngcobo and
Siyabonga Nsibande and
Siyabonga Nxumalo and
Sizwe Ndlela and
Skhumbuzo Mthombeni and
Smangaliso Zulu and
Sphiwe Clement Mthembu and
Sphiwe Ntuli and
Talente Ntimbane and
Thabile Zondi and
Thandeka Khoza and
Thengokwakhe Nkosi and
Thokozani Bhengu and
Thokozani Simelane and
Tshwaraganang Modise and
Tumi Madolo and
Velile Vellem and
Welcome Petros Mthembu and
Xolani Mkhize and
Zamashandu Mbatha and
Zinhle Buthelezi and
Zinhle Mthembu and
Zizile Sikhosana},
title = {Computer-aided interpretation of chest radiography reveals the spectrum
of tuberculosis in rural South Africa},
journal = {npj Digit. Medicine},
volume = {4},
year = {2021},
url = {https://doi.org/10.1038/s41746-021-00471-y},
doi = {10.1038/S41746-021-00471-Y},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/FehrKOGSGSBMMHK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/FehrKOGSGSBMMHK21a,
author = {Jana Fehr and
Stefan Konigorski and
Stephen Olivier and
Resign Gunda and
Ashmika Surujdeen and
Dickman Gareta and
Theresa Smit and
Kathy Baisley and
Sashen Moodley and
Yumna Moosa and
Willem Hanekom and
Olivier Koole and
Thumbi Ndung'u and
Deenan Pillay and
Alison D. Grant and
Mark J. Siedner and
Christoph Lippert and
Emily B. Wong and
Anand Ramnanan and
Anele Mkhwanazi and
Antony Rapulana and
Anupa Singh and
Ashentha Govender and
Ayanda Zungu and
Boitsholo Mfolo and
Bongani Magwaza and
Bongumenzi Ndlovu and
Clive Mavimbela and
Costa Criticos and
Day Munatsi and
Dilip Kalyan and
Doctar Mlambo and
Fezeka Mfeka and
Freddy Mabetlela and
Gregory Ording{-}Jespersen and
Hannah Keal and
Hlengiwe Dlamini and
Hlengiwe Khathi and
Hlobisile Chonco and
Hlobisile Gumede and
Hlolisile Khumalo and
Hloniphile Ngubane and
Hollis Shen and
Hosea Kambonde and
Innocentia Mpofana and
Jabu Kwinda and
Jaco Dreyer and
Jade Cousins and
Jaikrishna Kalideen and
Janet Seeley and
Kandaseelan Chetty and
Kayleen Brien and
Kennedy Nyamande and
Kgaugelo Moropane and
Khabonina Malomane and
Khadija Khan and
Khanyisani Buthelezi and
Kimeshree Perumal and
Kobus Herbst and
Lindani Mthembu and
Logan Pillay and
Mandisi Dlamini and
Mandlakayise Zikhali and
Mbali Mbuyisa and
Mbuti Mofokeng and
Melusi Sibiya and
Mlungisi Dube and
Mosa Suleman and
Mpumelelo Steto and
Mzamo Buthelezi and
Nagavelli Padayachi and
Nceba Gqaleni and
Ngcebo Mhlongo and
Nokukhanya Ntshakala and
Nomathamsanqa Majozi and
Nombuyiselo Zondi and
Nomfundo Luthuli and
Nomfundo Ngema and
Nompilo Buthelezi and
Nonceba Mfeka and
Nondumiso Khuluse and
Nondumiso Mabaso and
Nondumiso Zitha and
Nonhlanhla Mfekayi and
Nonhlanhla Mzimela and
Nozipho Mbonambi and
Ntombiyenhlanhla Mkhwanazi and
Ntombiyenkosi Ntombela and
Pamela Ramkalawon and
Pfarelo Tshivase and
Phakamani Mkhwanazi and
Philippa Mathews and
Phumelele Mthethwa and
Phumla Ngcobo and
Ramesh Jackpersad and
Raynold Zondo and
Rochelle Singh and
Rose Myeni and
Sanah Bucibo and
Sandile Mthembu and
Sashin Harilall and
Senamile Makhari and
Seneme Mchunu and
Senzeni Mkhwanazi and
Sibahle Gumbi and
Siboniso Nene and
Sibusiso Mhlongo and
Sibusiso Mkhwanazi and
Sibusiso Nsibande and
Simphiwe Ntshangase and
Siphephelo Dlamini and
Sithembile Ngcobo and
Siyabonga Nsibande and
Siyabonga Nxumalo and
Sizwe Ndlela and
Skhumbuzo Mthombeni and
Smangaliso Zulu and
Sphiwe Clement Mthembu and
Sphiwe Ntuli and
Talente Ntimbane and
Thabile Zondi and
Thandeka Khoza and
Thengokwakhe Nkosi and
Thokozani Bhengu and
Thokozani Simelane and
Tshwaraganang Modise and
Tumi Madolo and
Velile Vellem and
Welcome Petros Mthembu and
Xolani Mkhize and
Zamashandu Mbatha and
Zinhle Buthelezi and
Zinhle Mthembu and
Zizile Sikhosana},
title = {Publisher Correction: Computer-aided interpretation of chest radiography
reveals the spectrum of tuberculosis in rural South Africa},
journal = {npj Digit. Medicine},
volume = {4},
year = {2021},
url = {https://doi.org/10.1038/s41746-021-00485-6},
doi = {10.1038/S41746-021-00485-6},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/FehrKOGSGSBMMHK21a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/BakarRSA21,
author = {Habshah Abu Bakar and
Rosemizi Abd Rahim and
Ping Jack Soh and
Prayoot Akkaraekthalin},
title = {Liquid-Based Reconfigurable Antenna Technology: Recent Developments,
Challenges and Future},
journal = {Sensors},
volume = {21},
number = {3},
pages = {827},
year = {2021},
url = {https://doi.org/10.3390/s21030827},
doi = {10.3390/S21030827},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/BakarRSA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/PetersonBDPSMBG21,
author = {Susan K. Peterson and
Karen M. Basen{-}Engquist and
Wendy Demark{-}Wahnefried and
Alexander V. Prokhorov and
Eileen H. Shinn and
Stephanie L. Martch and
Beth M. Beadle and
Adam S. Garden and
Emilia Farcas and
G. Brandon Gunn and
Clifton D. Fuller and
William H. Morrison and
David I. Rosenthal and
Jack Phan and
Cathy Eng and
Paul M. Cinciripini and
Maher Karam{-}Hage and
Maria A. Camero Garcia and
Kevin Patrick},
title = {Feasibility of Mobile and Sensor Technology for Remote Monitoring
in Cancer Care and Prevention},
booktitle = {{AMIA} 2021, American Medical Informatics Association Annual Symposium,
San Diego, CA, USA, October 30, 2021 - November 3, 2021},
publisher = {{AMIA}},
year = {2021},
url = {https://knowledge.amia.org/74229-amia-1.4622266/t003-1.4626466/t003-1.4626467/3576643-1.4626564/3577303-1.4626561},
timestamp = {Wed, 17 Apr 2024 11:46:53 +0200},
biburl = {https://dblp.org/rec/conf/amia/PetersonBDPSMBG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hri/SandovalSCLCR21,
author = {Eduardo Ben{\'{\i}}tez Sandoval and
Jack Shi and
Dagoberto Cruz{-}Sandoval and
Binghao Li and
Massimiliano Lorenzo Cappuccio and
Simon Rosenbaum},
editor = {Cindy L. Bethel and
Ana Paiva and
Elizabeth Broadbent and
David Feil{-}Seifer and
Daniel Szafir},
title = {A Prototype of a Robot Memory Game: Exploring the Technical Limitations
of Human-Robot Interaction in a Playful Context},
booktitle = {Companion of the 2021 {ACM/IEEE} International Conference on Human-Robot
Interaction, {HRI} 2021, Boulder, CO, USA, March 8-11, 2021},
pages = {195--199},
publisher = {{ACM}},
year = {2021},
url = {https://doi.org/10.1145/3434074.3447158},
doi = {10.1145/3434074.3447158},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hri/SandovalSCLCR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/HilgardRBCP21,
author = {Sophie Hilgard and
Nir Rosenfeld and
Mahzarin R. Banaji and
Jack Cao and
David C. Parkes},
editor = {Marina Meila and
Tong Zhang},
title = {Learning Representations by Humans, for Humans},
booktitle = {Proceedings of the 38th International Conference on Machine Learning,
{ICML} 2021, 18-24 July 2021, Virtual Event},
series = {Proceedings of Machine Learning Research},
volume = {139},
pages = {4227--4238},
publisher = {{PMLR}},
year = {2021},
url = {http://proceedings.mlr.press/v139/hilgard21a.html},
timestamp = {Wed, 25 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/HilgardRBCP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sai/PapaJ21,
author = {Rosemary Papa and
Karen Moran Jackson},
editor = {Kohei Arai},
title = {Enduring Questions, Innovative Technologies: Educational Theories
Interface with {AI}},
booktitle = {Intelligent Computing - Proceedings of the 2021 Computing Conference,
Volume 2, {SAI} 2021, Virtual Event, 15-16 July, 2021},
series = {Lecture Notes in Networks and Systems},
volume = {284},
pages = {725--742},
publisher = {Springer},
year = {2021},
url = {https://doi.org/10.1007/978-3-030-80126-7\_51},
doi = {10.1007/978-3-030-80126-7\_51},
timestamp = {Tue, 21 Feb 2023 10:39:46 +0100},
biburl = {https://dblp.org/rec/conf/sai/PapaJ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpca/FarhanATGSHRD20,
author = {Mohammed A. Al Farhan and
Ahmad Abdelfattah and
Stanimire Tomov and
Mark Gates and
Dalal Sukkari and
Azzam Haidar and
Robert Rosenberg and
Jack J. Dongarra},
title = {{MAGMA} templates for scalable linear algebra on emerging architectures},
journal = {Int. J. High Perform. Comput. Appl.},
volume = {34},
number = {6},
year = {2020},
url = {https://doi.org/10.1177/1094342020938421},
doi = {10.1177/1094342020938421},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijhpca/FarhanATGSHRD20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/TurroAMGGSASFTS20,
author = {Ernest Turro and
William J. Astle and
Karyn Megy and
Stefan Gr{\"{a}}f and
Daniel Greene and
Olga Shamardina and
Hana Lango Allen and
Alba Sanchis{-}Juan and
Mattia Frontini and
Chantal Thys and
Jonathan Stephens and
Rutendo Mapeta and
Oliver S. Burren and
Kate Downes and
Matthias Haimel and
Salih Tuna and
Sri V. V. Deevi and
Timothy J. Aitman and
David L. H. Bennett and
Paul Calleja and
Keren Carss and
Mark J. Caulfield and
Patrick F. Chinnery and
Peter H. Dixon and
Daniel P. Gale and
Roger James and
Ania Koziell and
Michael A. Laffan and
Adam P. Levine and
Eamonn R. Maher and
Hugh S. Markus and
Joannella Morales and
Nicholas W. Morrell and
Andrew D. Mumford and
Elizabeth Ormondroyd and
Stuart Rankin and
Augusto Rendon and
Sylvia Richardson and
Irene Roberts and
Noemi B. A. Roy and
Moin A. Saleem and
Kenneth G. C. Smith and
Hannah Stark and
Rhea Y. Y. Tan and
Andreas C. Themistocleous and
Adrian J. Thrasher and
Hugh Watkins and
Andrew R. Webster and
Martin R. Wilkins and
Catherine Williamson and
James Whitworth and
Sean Humphray and
David R. Bentley and
Stephen Abbs and
Lara Abulhoul and
Julian Adlard and
Munaza Ahmed and
Hana Alachkar and
David J. Allsup and
Jeff Almeida{-}King and
Philip Ancliff and
Richard Antrobus and
Ruth Armstrong and
Gavin Arno and
Sofie Ashford and
Anthony Attwood and
Paul Aurora and
Christian Babbs and
Chiara Bacchelli and
Tamam Bakchoul and
Siddharth Banka and
Tadbir Bariana and
Julian Barwell and
Joana Batista and
Helen E. Baxendale and
Phil L. Beales and
Agnieszka Bierzynska and
Tina Biss and
Maria A. K. Bitner{-}Glindzicz and
Graeme C. M. Black and
Marta Bleda and
Iulia Blesneac and
Detlef Bockenhauer and
Harm Bogaard and
Christian J. Bourne and
Sara Boyce and
John R. Bradley and
Eugene Bragin and
Gerome Breen and
Paul Brennan and
Carole Brewer and
Matthew Brown and
Andrew C. Browning and
Michael J. Browning and
Rachel J. Buchan and
Matthew S. Buckland and
Teofila Bueser and
Carmen Bugarin Diz and
John Burn and
Siobhan O. Burns and
Nigel Burrows and
Carolyn Campbell and
Gerald Carr{-}White and
Ruth Casey and
Jenny Chambers and
John Chambers and
Melanie M. Y. Chan and
Calvin Cheah and
Floria Cheng and
Manali Chitre and
Martin T. Christian and
Colin Church and
Jill Clayton{-}Smith and
Maureen Cleary and
Naomi Clements Brod and
Gerry Coghlan and
Elizabeth Colby and
Trevor R. P. Cole and
Janine Collins and
Peter W. Collins and
Camilla Colombo and
Cecilia J. Compton and
Robin Condliffe and
Stuart A. Cook and
H. Terence Cook and
Nichola Cooper and
Paul A. Corris and
Abigail Furnell and
Fiona Cunningham and
Nicola S. Curry and
Antony J. Cutler and
Matthew J. Daniels and
Mehul Dattani and
Louise C. Daugherty and
John Davis and
Anthony De Soyza and
Timothy Dent and
Charu Deshpande and
Eleanor F. Dewhurst and
Sofia Douzgou and
Anna M. Drazyk and
Elizabeth Drewe and
Daniel Duarte and
Tina Dutt and
J. David M. Edgar and
Karen Edwards and
William Egner and
Melanie N. Ekani and
Perry Elliott and
Wendy N. Erber and
Marie Erwood and
Maria C. Estiu and
Dafydd Gareth Evans and
Gillian Evans and
Tamara Everington and
M{\'{e}}lanie Eyries and
Hiva Fassihi and
Remi Favier and
Jack Findhammer and
Debra Fletcher and
Frances A. Flinter and
R. Andres Floto and
Tom Fowler and
James Fox and
Amy J. Frary and
Courtney E. French and
Kathleen Freson and
Henning Gall and
Vijeya Ganesan and
Michael Gattens and
Claire Geoghegan and
Terence S. A. Gerighty and
Ali G. Gharavi and
Stefano Ghio and
Hossein{-}Ardeschir Ghofrani and
J. Simon R. Gibbs and
Kate Gibson and
Kimberly C. Gilmour and
Barbara Girerd and
Nicholas S. Gleadall and
Sarah Goddard and
David B. Goldstein and
Keith Gomez and
Pavels Gordins and
David Gosal and
Jodie Graham and
Luigi Grassi and
Lynn Greenhalgh and
Andreas Greinacher and
Paolo Gresele and
Philip Griffiths and
Sofia Grigoriadou and
Russell J. Grocock and
Detelina Grozeva and
Mark Gurnell and
Scott Hackett and
Charaka Hadinnapola and
William M. Hague and
Rosie Hague and
Matthew Hall and
Helen L. Hanson and
Eshika Haque and
Kirsty Harkness and
Andrew R. Harper and
Claire L. Harris and
Daniel Hart and
Ahamad Hassan and
Grant Hayman and
Alex Henderson and
Archana Herwadkar and
Jonathan Hoffman and
Simon Holden and
Rita Horvath and
Henry Houlden and
Arjan C. Houweling and
Luke S. G. E. Howard and
Fengyuan Hu and
Gavin Hudson and
Joseph Hughes and
Aarnoud P. Huissoon and
Marc Humbert and
Sarah Hunter and
Matthew E. Hurles and
Melita Irving and
Louise Izatt and
Sally A. Johnson and
Stephen Jolles and
Jennifer Jolley and
Dragana Josifova and
Neringa Jurkute and
Tim Karten and
Johannes Karten and
Mary A. Kasanicki and
Hanadi Kazkaz and
Rashid Kazmi and
Peter Kelleher and
Anne M. Kelly and
Wilf Kelsall and
Carly Kempster and
David G. Kiely and
Nathalie Kingston and
Robert Klima and
Nils Koelling and
Myrto Kostadima and
Gabor Kovacs and
Roman Kreuzhuber and
Taco W. Kuijpers and
Ajith Kumar and
Dinakantha Kumararatne and
Manju A. Kurian and
Fiona Lalloo and
Michele Lambert and
Allan Lawrie and
D. Mark Layton and
Nick Lench and
Claire Lentaigne and
Tracy Lester and
Rachel Linger and
Hilary Longhurst and
Lorena E. Lorenzo and
Eleni Louka and
Paul A. Lyons and
Rajiv D. Machado and
Robert V. MacKenzie Ross and
Bella Madan and
Jesmeen Maimaris and
Samantha Malka and
Sarah Mangles and
Kevin J. Marchbank and
Stephen Marks and
Hanns{-}Ulrich Marschall and
Andrew G. Marshall and
Jennifer Martin and
Mary Mathias and
Emma Matthews and
Heather Maxwell and
Paul McAlinden and
Mark I. McCarthy and
Harriet McKinney and
Aoife McMahon and
Stuart Meacham and
Adam J. Mead and
Ignacio Medina Castello and
Sarju G. Mehta and
Michel Michaelides and
Carolyn Millar and
Shehla N. Mohammed and
Shahin Moledina and
David Montani and
Anthony T. Moore and
Monika Mozere and
Keith W. Muir and
Andrea H. Nemeth and
William G. Newman and
Michael Newnham and
Sadia Noorani and
Paquita Nurden and
Jennifer O'Sullivan and
Samya Obaji and
Chris Odhams and
Steven Okoli and
Andrea Olschewski and
Horst Olschewski and
Kai Ren Ong and
S. Helen Oram and
Willem H. Ouwehand and
Claire Palles and
Sofia Papadia and
Soo{-}Mi Park and
David Parry and
Smita Patel and
Joan Paterson and
Andrew Peacock and
Simon H. Pearce and
John Peden and
Kathelijne Peerlinck and
Christopher J. Penkett and
Joanna Pepke{-}Zaba and
Romina Petersen and
Clarissa Pilkington and
Kenneth E. S. Poole and
Radhika Prathalingam and
Bethan Psaila and
Angela Pyle and
Richard Quinton and
Shamima Rahman and
Anupama Rao and
F. Lucy Raymond and
Paula J. Rayner{-}Matthews and
Christine Rees and
Tara Renton and
Christopher J. Rhodes and
Andrew S. C. Rice and
Alex Richter and
Leema Robert and
Anthony Rogers and
Sarah J. Rose and
Robert Ross{-}Russell and
Catherine Roughley and
Deborah M. Ruddy and
Omid Sadeghi{-}Alavijeh and
Nilesh J. Samani and
Crina Samarghitean and
Ravishankar B. Sargur and
Robert N. Sarkany and
Simon Satchell and
Sinisa Savic and
John A. Sayer and
Genevieve Sayer and
Laura Scelsi and
Andrew M. Schaefer and
Sol Schulman and
Richard Scott and
Marie Scully and
Claire Searle and
Werner Seeger and
Arjune Sen and
W. A. Carrock Sewell and
Denis Seyres and
Neil Shah and
Susan E. Shapiro and
Adam C. Shaw and
Patrick J. Short and
Keith Sibson and
Lucy Side and
Ilenia Simeoni and
Michael A. Simpson and
Matthew C. Sims and
Suthesh Sivapalaratnam and
Damian Smedley and
Katherine R. Smith and
Katie Snape and
Nicole Soranzo and
Florent Soubrier and
Laura Southgate and
Olivera Spasic{-}Boskovic and
Simon Staines and
Emily Staples and
Charles A. Steward and
Kathleen E. Stirrups and
Alex Stuckey and
Jay Suntharalingam and
Emilia M. Swietlik and
Petros Syrris and
R. Campbell Tait and
Kate Talks and
Katie Tate and
John M. Taylor and
Jenny C. Taylor and
James E. Thaventhiran and
Ellen Thomas and
David Thomas and
Moira J. Thomas and
Patrick Thomas and
Kate Thomson and
Glen Threadgold and
Tobias Tilly and
Marc Tischkowitz and
Catherine Titterton and
John A. Todd and
Cheng{-}Hock Toh and
Bas Tolhuis and
Ian P. Tomlinson and
Mark Toshner and
Matthew Traylor and
Carmen Treacy and
Paul Treadaway and
Richard Trembath and
Wojciech Turek and
Philip Twiss and
Tom Vale and
Chris Van Geet and
Natalie van Zuydam and
Maarten Vandekuilen and
Anthony M. Vandersteen and
Marta Vazquez{-}Lopez and
Julie von Ziegenweidt and
Anton Vonk{-}Noordegraaf and
Annette Wagner and
Quinten Waisfisz and
Suellen M. Walker and
Neil Walker and
Klaudia Walter and
James S. Ware and
Christopher Watt and
Lucy Wedderburn and
Wei Wei and
Steven B. Welch and
Julie Wessels and
Sarah K. Westbury and
John{-}Paul Westwood and
John Wharton and
Deborah Whitehorn and
Andrew O. M. Wilkie and
Brian T. Wilson and
Edwin K. S. Wong and
Nicholas W. Wood and
Yvette Wood and
Christopher Geoffrey Woods and
Emma R. Woodward and
Stephen J. Wort and
Austen Worth and
Michael Wright and
Katherine Yates and
Patrick F. K. Yong and
Timothy Young and
Ping Yu and
Patrick Yu{-}Wai{-}Man and
Eliska Zlamalova},
title = {Whole-genome sequencing of patients with rare diseases in a national
health system},
journal = {Nat.},
volume = {583},
number = {7814},
pages = {96--102},
year = {2020},
url = {https://doi.org/10.1038/s41586-020-2434-2},
doi = {10.1038/S41586-020-2434-2},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/TurroAMGGSASFTS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/YuRBCFLTCOAXCE20,
author = {Shanshan Yu and
Robert Rosenberg and
Carol J. Bruegge and
Lars Chapsky and
Dejian Fu and
Richard A. Lee and
Thomas E. Taylor and
Heather Cronk and
Christopher W. O'Dell and
Amit Angal and
Xiaoxiong Xiong and
David Crisp and
Annmarie Eldering},
title = {Stability Assessment of {OCO-2} Radiometric Calibration Using Aqua
{MODIS} as a Reference},
journal = {Remote. Sens.},
volume = {12},
number = {8},
pages = {1269},
year = {2020},
url = {https://doi.org/10.3390/rs12081269},
doi = {10.3390/RS12081269},
timestamp = {Mon, 27 Mar 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/remotesensing/YuRBCFLTCOAXCE20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/crypto/ChenCDKLRS20,
author = {Megan Chen and
Ran Cohen and
Jack Doerner and
Yashvanth Kondi and
Eysa Lee and
Schuyler Rosefield and
Abhi Shelat},
editor = {Daniele Micciancio and
Thomas Ristenpart},
title = {Multiparty Generation of an {RSA} Modulus},
booktitle = {Advances in Cryptology - {CRYPTO} 2020 - 40th Annual International
Cryptology Conference, {CRYPTO} 2020, Santa Barbara, CA, USA, August
17-21, 2020, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {12172},
pages = {64--93},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-56877-1\_3},
doi = {10.1007/978-3-030-56877-1\_3},
timestamp = {Mon, 28 Aug 2023 21:17:50 +0200},
biburl = {https://dblp.org/rec/conf/crypto/ChenCDKLRS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sai/PapaJBJ20,
author = {Rosemary Papa and
Karen Moran Jackson and
Ric Brown and
David Jackson},
editor = {Kohei Arai and
Supriya Kapoor and
Rahul Bhatia},
title = {Discourse Analysis on Learning Theories and {AI}},
booktitle = {Intelligent Computing - Proceedings of the 2020 Computing Conference,
Volume 3},
series = {Advances in Intelligent Systems and Computing},
volume = {1230},
pages = {665--672},
publisher = {Springer},
year = {2020},
url = {https://doi.org/10.1007/978-3-030-52243-8\_50},
doi = {10.1007/978-3-030-52243-8\_50},
timestamp = {Tue, 07 Jul 2020 16:12:39 +0200},
biburl = {https://dblp.org/rec/conf/sai/PapaJBJ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sensys/GaoMGRWS20,
author = {Ye Gao and
Meiyi Ma and
Kristina Gordon and
Karen Rose and
Hongning Wang and
John A. Stankovic},
editor = {Jin Nakazawa and
Polly Huang},
title = {A monitoring, modeling, and interactive recommendation system for
in-home caregivers: demo abstract},
booktitle = {SenSys '20: The 18th {ACM} Conference on Embedded Networked Sensor
Systems, Virtual Event, Japan, November 16-19, 2020},
pages = {587--588},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3384419.3430422},
doi = {10.1145/3384419.3430422},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sensys/GaoMGRWS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-07227,
author = {Hao Sheng and
Jeremy Irvin and
Sasankh Munukutla and
Shawn Zhang and
Christopher Cross and
Kyle Story and
Rose Rustowicz and
Cooper Elsworth and
Zutao Yang and
Mark Omara and
Ritesh Gautam and
Robert B. Jackson and
Andrew Y. Ng},
title = {OGNet: Towards a Global Oil and Gas Infrastructure Database using
Deep Learning on Remotely Sensed Imagery},
journal = {CoRR},
volume = {abs/2011.07227},
year = {2020},
url = {https://arxiv.org/abs/2011.07227},
eprinttype = {arXiv},
eprint = {2011.07227},
timestamp = {Tue, 01 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-07227.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/ChenCDKLRS20,
author = {Megan Chen and
Ran Cohen and
Jack Doerner and
Yashvanth Kondi and
Eysa Lee and
Schuyler Rosefield and
Abhi Shelat},
title = {Multiparty Generation of an {RSA} Modulus},
journal = {{IACR} Cryptol. ePrint Arch.},
pages = {370},
year = {2020},
url = {https://eprint.iacr.org/2020/370},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/iacr/ChenCDKLRS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/SnyderLPARRRGHS19,
author = {Michael P. Snyder and
Shin Lin and
Amanda Posgai and
Mark Atkinson and
Aviv Regev and
Jennifer Rood and
Orit Rozenblatt{-}Rosen and
Leslie Gaffney and
Anna Hupalowska and
Rahul Satija and
Nils Gehlenborg and
Jay Shendure and
Julia Laskin and
Pehr Harbury and
Nicholas A. Nystrom and
Jonathan C. Silverstein and
Ziv Bar{-}Joseph and
Kun Zhang and
Katy B{\"{o}}rner and
Yiing Lin and
Richard Conroy and
Dena Procaccini and
Ananda L. Roy and
Ajay Pillai and
Marishka Brown and
Zorina S. Galis and
Long Cai and
Cole Trapnell and
Dana Jackson and
Garry P. Nolan and
William James Greenleaf and
Sylvia K. Plevritis and
Sara Ahadi and
Stephanie A. Nevins and
Hayan Lee and
Christian Martijn Schuerch and
Sarah Black and
Vishal Gautham Venkataraaman and
Ed Esplin and
Aaron Horning and
Amir Bahmani and
Xin Sun and
Sanjay Jain and
James S. Hagood and
Gloria Pryhuber and
Peter V. Kharchenko and
Bernd Bodenmiller and
Todd Brusko and
Michael Clare{-}Salzler and
Harry Nick and
Kevin Otto and
Clive Wasserfall and
Marda Jorgensen and
Maigan Brusko and
Sergio Maffioletti and
Richard M. Caprioli and
Jeffrey M. Spraggins and
Danielle Gutierrez and
Nathan Heath Patterson and
Elizabeth K. Neumann and
Raymond Harris and
Mark P. de Caestecker and
Agnes B. Fogo and
Raf Van de Plas and
Ken Lau and
Guo{-}Cheng Yuan and
Qian Zhu and
Ruben Dries and
Peng Yin and
Sinem K. Saka and
Jocelyn Y. Kishi and
Yu Wang and
Isabel Goldaracena and
Dong Hye Ye and
Kristin E. Burnum{-}Johnson and
Paul D. Piehowski and
Charles Ansong and
Ying Zhu and
Tushar Desai and
Jay Mulye and
Peter Chou and
Monica Nagendran and
Sarah A. Teichmann and
Benedict Paten and
Robert F. Murphy and
Jian Ma and
Vladimir Yu. Kiselev and
Carl Kingsford and
Allyson Ricarte and
Maria Keays and
Sushma Anand Akoju and
Matthew Ruffalo and
Margaret Vella and
Chuck McCallum and
Leonard E. Cross and
Samuel H. Friedman and
Randy W. Heiland and
Bruce William Herr II and
Paul Macklin and
Ellen M. Quardokus and
Lisel Record and
James P. Sluka and
Griffin M. Weber and
Philip D. Blood and
Alexander Ropelewski and
William Shirey and
Robin M. Scibek and
Paula M. Mabee and
W. Christopher Lenhardt and
Kimberly Robasky and
Stavros Michailidis and
John C. Marioni and
Andrew Butler and
Tim Stuart and
Eyal Fisher and
Shila Ghazanfar and
G{\"{o}}kcen Eraslan and
Tommaso Biancalani and
Eeshit D. Vaishnav and
Pothur Srinivas and
Aaron Pawlyk and
Salvatore Sechi and
Elizabeth L. Wilder and
James Anderson},
title = {The human body at cellular resolution: the {NIH} Human Biomolecular
Atlas Program},
journal = {Nat.},
volume = {574},
number = {7777},
pages = {187--192},
year = {2019},
url = {https://doi.org/10.1038/s41586-019-1629-x},
doi = {10.1038/S41586-019-1629-X},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nature/SnyderLPARRRGHS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iticse/MehtaR19,
author = {Dinesh P. Mehta and
Jack Rosenthal},
editor = {Bruce Scharlau and
Roger McDermott and
Arnold Pears and
Mihaela Sabin},
title = {AlgoBOWL: {A} Competition-Based Group Project for Algorithms Courses},
booktitle = {Proceedings of the 2019 {ACM} Conference on Innovation and Technology
in Computer Science Education, Aberdeen, Scotland, UK, July 15-17,
2019},
pages = {471--477},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3304221.3319761},
doi = {10.1145/3304221.3319761},
timestamp = {Wed, 10 Mar 2021 13:17:16 +0100},
biburl = {https://dblp.org/rec/conf/iticse/MehtaR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wd/NakazibweSAM19,
author = {Jackline Nakazibwe and
Jonathan Serugunda and
Roseline N. Akol and
Stephen Mwanje},
title = {Optimizing Location of Edge Clouds with Baseband Units in Cloud Radio
Access Network},
booktitle = {2019 Wireless Days, {WD} 2019, Manchester, United Kingdom, April 24-26,
2019},
pages = {1--6},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/WD.2019.8734222},
doi = {10.1109/WD.2019.8734222},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wd/NakazibweSAM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19,
author = {Ziawasch Abedjan and
Nozha Boujemaa and
Stuart Campbell and
Patricia Casla and
Supriyo Chatterjea and
Sergio Consoli and
Crist{\'{o}}bal Costa Soria and
Paul Czech and
Marija Despenic and
Chiara Garattini and
Dirk Hamelinck and
Adrienne Heinrich and
Wessel Kraaij and
Jacek Kustra and
Aizea Lojo and
Marga Martin Sanchez and
Miguel Angel Mayer and
Matteo Melideo and
Ernestina Menasalvas and
Frank M{\o}ller Aarestrup and
Elvira Narro Artigot and
Milan Petkovic and
Diego Reforgiato Recupero and
Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
Gisele Roesems Kerremans and
Roland Roller and
M{\'{a}}rio Rom{\~{a}}o and
Stefan R{\"{u}}ping and
Felix Sasaki and
Wouter Spek and
Nenad Stojanovic and
Jack Thoms and
Andrejs Vasiljevs and
Wilfried Verachtert and
Roel Wuyts},
editor = {Sergio Consoli and
Diego Reforgiato Recupero and
Milan Petkovic},
title = {Data Science in Healthcare: Benefits, Challenges and Opportunities},
booktitle = {Data Science for Healthcare - Methodologies and Applications},
pages = {3--38},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-05249-2\_1},
doi = {10.1007/978-3-030-05249-2\_1},
timestamp = {Fri, 22 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1905-12686,
author = {Sophie Hilgard and
Nir Rosenfeld and
Mahzarin R. Banaji and
Jack Cao and
David C. Parkes},
title = {Learning Representations by Humans, for Humans},
journal = {CoRR},
volume = {abs/1905.12686},
year = {2019},
url = {http://arxiv.org/abs/1905.12686},
eprinttype = {arXiv},
eprint = {1905.12686},
timestamp = {Mon, 03 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1905-12686.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1912-01054,
author = {Nicholas Heller and
Fabian Isensee and
Klaus H. Maier{-}Hein and
Xiaoshuai Hou and
Chunmei Xie and
Fengyi Li and
Yang Nan and
Guangrui Mu and
Zhiyong Lin and
Miofei Han and
Guang Yao and
Yaozong Gao and
Yao Zhang and
Yixin Wang and
Feng Hou and
Jiawei Yang and
Guangwei Xiong and
Jiang Tian and
Cheng Zhong and
Jun Ma and
Jack Rickman and
Joshua Dean and
Bethany Stai and
Resha Tejpaul and
Makinna Oestreich and
Paul Blake and
Heather Kaluzniak and
Shaneabbas Raza and
Joel Rosenberg and
Keenan Moore and
Edward Walczak and
Zachary Rengel and
Zachary Edgerton and
Ranveer Vasdev and
Matthew Peterson and
Se{\'{a}}n McSweeney and
Sarah Peterson and
Arveen Kalapara and
Niranjan Sathianathen and
Christopher Weight and
Nikolaos Papanikolopoulos},
title = {The state of the art in kidney and kidney tumor segmentation in contrast-enhanced
{CT} imaging: Results of the KiTS19 Challenge},
journal = {CoRR},
volume = {abs/1912.01054},
year = {2019},
url = {http://arxiv.org/abs/1912.01054},
eprinttype = {arXiv},
eprint = {1912.01054},
timestamp = {Tue, 18 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1912-01054.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bica/KralikLRJERSLSL18,
author = {Jerald D. Kralik and
Jeehang Lee and
Paul S. Rosenbloom and
Philip C. Jackson Jr. and
Susan L. Epstein and
Oscar J. Romero and
Ricardo Sanz and
Othalia Larue and
Hedda R. Schmidtke and
Sang Wan Lee and
Keith McGreggor},
editor = {Alexei V. Samsonovich and
Christian Lebiere},
title = {Metacognition for a Common Model of Cognition},
booktitle = {Postproceedings of the 9th Annual International Conference on Biologically
Inspired Cognitive Architectures, {BICA} 2018 (Ninth Annual Meeting
of the {BICA} Society), August 22-24, 2018, Prague, Czech Republic},
series = {Procedia Computer Science},
volume = {145},
pages = {730--739},
publisher = {Elsevier},
year = {2018},
url = {https://doi.org/10.1016/j.procs.2018.11.046},
doi = {10.1016/J.PROCS.2018.11.046},
timestamp = {Fri, 08 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bica/KralikLRJERSLSL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fedcsis/LesecqDOFMFBSBJ18,
author = {Suzanne Lesecq and
Olivier Debicki and
Laurent Ouvry and
Christian Fabre and
Nicolas Mareau and
Julie Foucault and
Francois Birot and
Lo{\"{\i}}c Sevrin and
Steve Buckley and
Carl Jackson and
John Barrett and
Alan McGibney and
Susan Rea and
David Rojas and
Richard Banach and
Joseph Razavi and
Marc Correvon and
Gabriela Dudnik and
Jean{-}Marc Van Gyseghem and
Jean Herveg and
Nathalie Grandjean and
Florence Thiry and
Cian O'Murchu and
Alan Mathewson and
Rosemary O'Keeffe and
Andrea Di Matteo and
Vincenza Di Palma and
Fabio Quaglia and
Giuseppe Villa},
editor = {Maria Ganzha and
Leszek A. Maciaszek and
Marcin Paprzycki},
title = {Assistive Smart, Structured 3D Environmental Information for the Visually
Impaired and Blind: Leveraging the {INSPEX} Concept},
booktitle = {Communication Papers of the 2018 Federated Conference on Computer
Science and Information Systems, FedCSIS 2018, Pozna{\'{n}},
Poland, September 9-12, 2018},
series = {Annals of Computer Science and Information Systems},
volume = {17},
pages = {73--82},
year = {2018},
url = {https://doi.org/10.15439/2018F20},
doi = {10.15439/2018F20},
timestamp = {Tue, 23 Apr 2024 10:05:46 +0200},
biburl = {https://dblp.org/rec/conf/fedcsis/LesecqDOFMFBSBJ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icls/VossoughiJBRWP18,
author = {Shirin Vossoughi and
Ava Jackson and
Megan Bang and
Ann Rosebery and
Beth Warren and
Thomas M. Philip},
editor = {Manolis Mavrikis and
Kaska Porayska{-}Pomsta},
title = {Attunements to the Ethical in Design and Learning},
booktitle = {Rethinking learning in the digital age: Making the Learning Sciences
count - Proceedings of the 13th International Conference of the Learning
Sciences, {ICLS} 2018, London, UK, June 23-27, 2018},
publisher = {International Society of the Learning Sciences},
year = {2018},
url = {https://repository.isls.org/handle/1/605},
timestamp = {Thu, 06 May 2021 10:07:13 +0200},
biburl = {https://dblp.org/rec/conf/icls/VossoughiJBRWP18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nime/SarwateRFA18,
author = {Avneesh Sarwate and
Ryan Taylor Rose and
Jason Freeman and
Jack Armitage},
title = {Performance Systems for Live Coders and Non Coders},
booktitle = {18th International Conference on New Interfaces for Musical Expression,
{NIME} 2018, Blacksburg, VA, USA, June 3-6, 2018},
pages = {370--373},
publisher = {nime.org},
year = {2018},
url = {https://doi.org/10.5281/zenodo.1302627},
doi = {10.5281/ZENODO.1302627},
timestamp = {Tue, 04 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nime/SarwateRFA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1807-02741,
author = {Carina Curto and
Elizabeth Gross and
Jack Jeffries and
Katherine Morrison and
Zvi Rosen and
Anne Shiu and
Nora Youngs},
title = {Algebraic signatures of convex and non-convex codes},
journal = {CoRR},
volume = {abs/1807.02741},
year = {2018},
url = {http://arxiv.org/abs/1807.02741},
eprinttype = {arXiv},
eprint = {1807.02741},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1807-02741.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmi/CroninFDRJ17,
author = {Robert M. Cronin and
Daniel Fabbri and
Joshua C. Denny and
S. Trent Rosenbloom and
Gretchen Purcell Jackson},
title = {A comparison of rule-based and machine learning approaches for classifying
patient portal messages},
journal = {Int. J. Medical Informatics},
volume = {105},
pages = {110--120},
year = {2017},
url = {https://doi.org/10.1016/j.ijmedinf.2017.06.004},
doi = {10.1016/J.IJMEDINF.2017.06.004},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijmi/CroninFDRJ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siaga/CurtoGJMORSY17,
author = {Carina Curto and
Elizabeth Gross and
Jack Jeffries and
Katherine Morrison and
Mohamed Omar and
Zvi Rosen and
Anne Shiu and
Nora Youngs},
title = {What Makes a Neural Code Convex?},
journal = {{SIAM} J. Appl. Algebra Geom.},
volume = {1},
number = {1},
pages = {222--238},
year = {2017},
url = {https://doi.org/10.1137/16M1073170},
doi = {10.1137/16M1073170},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siaga/CurtoGJMORSY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cri/JacksonOBRKW17,
author = {Kathryn J. Jackson and
Elissa Oh and
Kathryn Balsley and
Marc B. Rosenman and
Abel N. Kho and
Theresa L. Walunas},
title = {Feasibility of using multi-site electronic health record laboratory
data to assess population-level quality measures of diabetes care
in Chicago},
booktitle = {Summit on Clinical Research Informatics, {CRI} 2017, San Francisco,
CA, USA, March 27-30, 2017},
publisher = {{AMIA}},
year = {2017},
url = {http://knowledge.amia.org/amia-64484-cri2017-1.3520710/t004-1.3521377/t004-1.3521378/a111-1.3521481/a112-1.3521478},
timestamp = {Wed, 20 Jun 2018 17:09:15 +0200},
biburl = {https://dblp.org/rec/conf/cri/JacksonOBRKW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cri/RosenmanOMJBCGK17,
author = {Marc B. Rosenman and
Elissa Oh and
Margaret B. Madden and
Kathryn L. Jackson and
Jess J. Behrens and
Isabel Chung and
Satyender Goel and
Abel N. Kho},
title = {The Virtue of Venn Diagrams in Visualizing Shared Data: Characterization
of a New Citywide Data Repository, HealthLNK},
booktitle = {Summit on Clinical Research Informatics, {CRI} 2017, San Francisco,
CA, USA, March 27-30, 2017},
publisher = {{AMIA}},
year = {2017},
url = {http://knowledge.amia.org/amia-64484-cri2017-1.3520710/t004-1.3521377/t004-1.3521378/a129-1.3521427/a130-1.3521424},
timestamp = {Tue, 23 Jan 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cri/RosenmanOMJBCGK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/LombardoAHWRMBB16,
author = {Michael V. Lombardo and
Bonnie Auyeung and
Rosemary Holt and
Jack Waldman and
Amber N. V. Ruigrok and
Natasha Mooney and
Edward T. Bullmore and
Simon Baron{-}Cohen and
Prantik Kundu},
title = {Improving effect size estimation and statistical power with multi-echo
fMRI and its impact on understanding the neural systems supporting
mentalizing},
journal = {NeuroImage},
volume = {142},
pages = {55--66},
year = {2016},
url = {https://doi.org/10.1016/j.neuroimage.2016.07.022},
doi = {10.1016/J.NEUROIMAGE.2016.07.022},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/LombardoAHWRMBB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/SatterthwaiteCR16,
author = {Theodore D. Satterthwaite and
John J. Connolly and
Kosha Ruparel and
Monica E. Calkins and
Chad Jackson and
Mark A. Elliott and
David R. Roalf and
Karthik Prabhakaran and
Ryan Hopson and
Meckenzie Behr and
Haijun Qiu and
Frank D. Mentch and
Rosetta Chiavacci and
Patrick Sleiman and
Ruben C. Gur and
Hakon Hakonarson and
Raquel E. Gur},
title = {The Philadelphia Neurodevelopmental Cohort: {A} publicly available
resource for the study of normal and abnormal brain development in
youth},
journal = {NeuroImage},
volume = {124},
pages = {1115--1119},
year = {2016},
url = {https://doi.org/10.1016/j.neuroimage.2015.03.056},
doi = {10.1016/J.NEUROIMAGE.2015.03.056},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/SatterthwaiteCR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mum/GaagGJLRU15,
author = {Philip Gaag and
Daniel Granvogl and
Robert Jackermeier and
Florian Ludwig and
Johannes Rosenl{\"{o}}hner and
Alexander Uitz},
editor = {Clemens Holzmann and
Ren{\'{e}} Mayrhofer},
title = {{FROY:} exploring sentiment-based movie recommendations},
booktitle = {Proceedings of the 14th International Conference on Mobile and Ubiquitous
Multimedia, Linz, Austria, November 30 - December 2, 2015},
pages = {345--349},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2836041.2841205},
doi = {10.1145/2836041.2841205},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mum/GaagGJLRU15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/KurmasR15,
author = {Zachary Kurmas and
Jack Rosenhauer},
editor = {Adrienne Decker and
Kurt Eiselt and
Carl Alphonce and
Jodi L. Tims},
title = {MIPSUnit: {A} Unit Testing Framework for {MIPS} Assembly (Abstract
Only)},
booktitle = {Proceedings of the 46th {ACM} Technical Symposium on Computer Science
Education, {SIGCSE} 2015, Kansas City, MO, USA, March 4-7, 2015},
pages = {689},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2676723.2691926},
doi = {10.1145/2676723.2691926},
timestamp = {Mon, 13 Dec 2021 09:32:31 +0100},
biburl = {https://dblp.org/rec/conf/sigcse/KurmasR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/taai/LinDJCJISCL15,
author = {Josan Wei{-}San Lin and
Hong{-}Jie Dai and
Jitendra Jonnagaddala and
Nai{-}Wun Chang and
Toni Rose Jue and
Usman Iqbal and
Joni Yu{-}Hsuan Shao and
I{-}Jen Chiang and
Yu{-}Chuan Li},
title = {Utilizing different word representation methods for twitter data in
adverse drug reactions extraction},
booktitle = {Conference on Technologies and Applications of Artificial Intelligence,
{TAAI} 2015, Tainan, Taiwan, November 20-22, 2015},
pages = {260--265},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/TAAI.2015.7407070},
doi = {10.1109/TAAI.2015.7407070},
timestamp = {Wed, 01 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/taai/LinDJCJISCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wh/GongRESHFDDPLS15,
author = {Jiaqi Gong and
Karen Moomaw Rose and
Ifat Afrin Emi and
Janet P. Specht and
Enamul Hoque and
Dawei Fan and
Sriram Raju Dandu and
Robert F. Dickerson and
Yelena Perkhounkova and
John C. Lach and
John A. Stankovic},
editor = {Wendy Nilsen and
Jack A. Stankovic},
title = {Home wireless sensing system for monitoring nighttime agitation and
incontinence in patients with Alzheimer's disease},
booktitle = {Proceedings of the conference on Wireless Health, {WH} 2015, Bethesda,
Maryland, USA, October 14-16, 2015},
pages = {5:1--5:8},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2811780.2822324},
doi = {10.1145/2811780.2822324},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wh/GongRESHFDDPLS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cstat/BakerJ14,
author = {Rose D. Baker and
Dan Jackson},
title = {Statistical application of barycentric rational interpolants: an alternative
to splines},
journal = {Comput. Stat.},
volume = {29},
number = {5},
pages = {1065--1081},
year = {2014},
url = {https://doi.org/10.1007/s00180-014-0480-7},
doi = {10.1007/S00180-014-0480-7},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cstat/BakerJ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/FlintWWKKSRHLLSMSNDS14,
author = {Robert D. Flint and
Po T. Wang and
Zachary A. Wright and
Christine E. King and
Max O. Krucoff and
Stephan U. Schuele and
Joshua M. Rosenow and
Frank P. K. Hsu and
Charles Yu Liu and
Jack J. Lin and
Mona Sazgar and
David E. Millett and
Susan J. Shaw and
Zoran Nenadic and
An H. Do and
Marc W. Slutzky},
title = {Extracting kinetic information from human motor cortical signals},
journal = {NeuroImage},
volume = {101},
pages = {695--703},
year = {2014},
url = {https://doi.org/10.1016/j.neuroimage.2014.07.049},
doi = {10.1016/J.NEUROIMAGE.2014.07.049},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/FlintWWKKSRHLLSMSNDS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mobisys/RosenYNJCM14,
author = {Sanae Rosen and
Hongyi Yao and
Ashkan Nikravesh and
Yunhan Jia and
David R. Choffnes and
Zhuoqing Morley Mao},
editor = {Andrew T. Campbell and
David Kotz and
Landon P. Cox and
Zhuoqing Morley Mao},
title = {Demo: Mapping global mobile performance trends with mobilyzer and
mobiPerf},
booktitle = {The 12th Annual International Conference on Mobile Systems, Applications,
and Services, MobiSys'14, Bretton Woods, NH, USA, June 16-19, 2014},
pages = {353},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2594368.2601469},
doi = {10.1145/2594368.2601469},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mobisys/RosenYNJCM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/ScottJHR13,
author = {Amanda M. McDougald Scott and
Gretchen Purcell Jackson and
Yun{-}Xian Ho and
S. Trent Rosenbloom},
title = {Adapting Comparative Effectiveness Research Summaries for Delivery
to Patients and Providers through a Patient Portal},
booktitle = {{AMIA} 2013, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 16-20, 2013},
publisher = {{AMIA}},
year = {2013},
url = {https://knowledge.amia.org/amia-55142-a2013e-1.580047/t-05-1.583941/f-005-1.583942/a-331-1.584086/a-334-1.584081},
timestamp = {Wed, 17 Apr 2024 11:47:55 +0200},
biburl = {https://dblp.org/rec/conf/amia/ScottJHR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/complexsystems/ParadisGMCK13,
author = {Rosemary D. Paradis and
Jinhong K. Guo and
Jack Moulton and
David Cameron and
Pentti Kanerva},
editor = {Cihan H. Dagli},
title = {Finding Semantic Equivalence of Text Using Random Index Vectors},
booktitle = {Proceedings of the Complex Adaptive Systems 2013 Conference, Baltimore
Marriott Inner Harbor at Camden Yards, Baltimore, Maryland, USA, November
13-15, 2013},
series = {Procedia Computer Science},
volume = {20},
pages = {454--459},
publisher = {Elsevier},
year = {2013},
url = {https://doi.org/10.1016/j.procs.2013.09.302},
doi = {10.1016/J.PROCS.2013.09.302},
timestamp = {Thu, 08 Jul 2021 16:04:01 +0200},
biburl = {https://dblp.org/rec/conf/complexsystems/ParadisGMCK13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/Rosenberger12,
author = {Jack Rosenberger},
title = {Computer science awards},
journal = {Commun. {ACM}},
volume = {55},
number = {3},
pages = {23},
year = {2012},
url = {https://doi.org/10.1145/2093548.2093557},
doi = {10.1145/2093548.2093557},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/Rosenberger12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/RosenbloomDTMHSMJJ12,
author = {S. Trent Rosenbloom and
Titus L. Daniels and
Thomas R. Talbot and
Taylor McClain and
Robert Hennes and
Shane P. Stenner and
Sue Muse and
Jim Jirjis and
Gretchen Purcell Jackson},
title = {Triaging patients at risk of influenza using a patient portal},
journal = {J. Am. Medical Informatics Assoc.},
volume = {19},
number = {4},
pages = {549--554},
year = {2012},
url = {https://doi.org/10.1136/amiajnl-2011-000382},
doi = {10.1136/AMIAJNL-2011-000382},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/RosenbloomDTMHSMJJ12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/TsaiR12,
author = {Jack Tsai and
Robert A. Rosenheck},
title = {Use of the internet and an online personal health record system by
{US} veterans: comparison of Veterans Affairs mental health service
users and other veterans nationally},
journal = {J. Am. Medical Informatics Assoc.},
volume = {19},
number = {6},
pages = {1089--1094},
year = {2012},
url = {https://doi.org/10.1136/amiajnl-2012-000971},
doi = {10.1136/AMIAJNL-2012-000971},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/TsaiR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/its/HowleyADMBR12,
author = {Iris K. Howley and
David Adamson and
Gregory Dyke and
Elijah Mayfield and
Jack L. Beuth and
Carolyn Penstein Ros{\'{e}}},
editor = {Stefano A. Cerri and
William J. Clancey and
Giorgos Papadourakis and
Kitty Panourgia},
title = {Group Composition and Intelligent Dialogue Tutors for Impacting Students'
Academic Self-efficacy},
booktitle = {Intelligent Tutoring Systems - 11th International Conference, {ITS}
2012, Chania, Crete, Greece, June 14-18, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7315},
pages = {551--556},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-30950-2\_71},
doi = {10.1007/978-3-642-30950-2\_71},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/its/HowleyADMBR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:journals/procedia/ParadisGOM12,
author = {Rosemary D. Paradis and
Jinhong K. Guo and
John Olden{-}Stahl and
Jack Moulton},
editor = {Cihan H. Dagli},
title = {Cognitive Category Learning},
booktitle = {Proceedings of the Complex Adaptive Systems 2012 Conference, Washington,
DC, USA, November 14-16, 2012},
series = {Procedia Computer Science},
volume = {12},
pages = {188--193},
publisher = {Elsevier},
year = {2012},
url = {https://doi.org/10.1016/j.procs.2012.09.052},
doi = {10.1016/J.PROCS.2012.09.052},
timestamp = {Thu, 08 Jul 2021 16:04:01 +0200},
biburl = {https://dblp.org/rec/journals/procedia/ParadisGOM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/Rosenberger11,
author = {Jack Rosenberger},
title = {{EMET} prize and other awards},
journal = {Commun. {ACM}},
volume = {54},
number = {1},
pages = {25},
year = {2011},
url = {https://doi.org/10.1145/1866739.1866767},
doi = {10.1145/1866739.1866767},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/Rosenberger11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/RosenbergerR11,
author = {Jack Rosenberger and
Judy Robertson},
title = {Smart career advice; laptops as a classroom distraction},
journal = {Commun. {ACM}},
volume = {54},
number = {1},
pages = {14--15},
year = {2011},
url = {https://doi.org/10.1145/1866739.1866743},
doi = {10.1145/1866739.1866743},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cacm/RosenbergerR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/OsbornRSAMJJJ11,
author = {Chandra Y. Osborn and
S. Trent Rosenbloom and
Shane P. Stenner and
Shilo Anders and
Sue Muse and
Kevin B. Johnson and
Jim Jirjis and
Gretchen Purcell Jackson},
title = {MyHealthAtVanderbilt: policies and procedures governing patient portal
functionality},
journal = {J. Am. Medical Informatics Assoc.},
volume = {18},
number = {Supplement},
pages = {18--23},
year = {2011},
url = {https://doi.org/10.1136/amiajnl-2011-000184},
doi = {10.1136/AMIAJNL-2011-000184},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/OsbornRSAMJJJ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/FujitaRZHKCGBCCDDGHHHKKLLMPRRSHK11,
author = {Pauline A. Fujita and
Brooke L. Rhead and
Ann S. Zweig and
Angie S. Hinrichs and
Donna Karolchik and
Melissa S. Cline and
Mary Goldman and
Galt P. Barber and
Hiram Clawson and
Ant{\'{o}}nio Coelho and
Mark Diekhans and
Timothy R. Dreszer and
Belinda Giardine and
Rachel A. Harte and
Jennifer Hillman{-}Jackson and
Fan Hsu and
Vanessa Kirkup and
Robert M. Kuhn and
Katrina Learned and
Chin H. Li and
Laurence R. Meyer and
Andy Pohl and
Brian J. Raney and
Kate R. Rosenbloom and
Kayla E. Smith and
David Haussler and
W. James Kent},
title = {The {UCSC} Genome Browser database: update 2011},
journal = {Nucleic Acids Res.},
volume = {39},
number = {Database-Issue},
pages = {876--882},
year = {2011},
url = {https://doi.org/10.1093/nar/gkq963},
doi = {10.1093/NAR/GKQ963},
timestamp = {Sat, 13 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/FujitaRZHKCGBCCDDGHHHKKLLMPRRSHK11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/OlsonJSR11,
author = {Nicholas Olson and
Nathan Jack and
Vrashank Shukla and
Elyse Rosenbaum},
editor = {Rakesh Patel and
Tom Andre and
Aurangzeb Khan},
title = {{CDM-ESD} induced damage in components using stacked-die packaging},
booktitle = {2011 {IEEE} Custom Integrated Circuits Conference, {CICC} 2011, San
Jose, CA, USA, Sept. 19-21, 2011},
pages = {1--4},
publisher = {{IEEE}},
year = {2011},
url = {https://doi.org/10.1109/CICC.2011.6055359},
doi = {10.1109/CICC.2011.6055359},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cicc/OlsonJSR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cscl/0001BR11,
author = {Rohit Kumar and
Jack L. Beuth and
Carolyn P. Ros{\'{e}}},
title = {Conversational Strategies that Support Idea Generation Productivity
in Groups},
booktitle = {Proceedings of the 9th International Conference on Computer Supported
Collaborative Learning, {CSCL} 2011, Hong Kong, July 4-8, 2011},
publisher = {International Society of the Learning Sciences},
year = {2011},
url = {https://repository.isls.org/handle/1/2475},
timestamp = {Mon, 26 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cscl/0001BR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ssdbm/JaeckschFRL11,
author = {Bernhard Jaecksch and
Franz Faerber and
Frank Rosenthal and
Wolfgang Lehner},
editor = {Judith Bayard Cushing and
James C. French and
Shawn Bowers},
title = {Hybrid Data-Flow Graphs for Procedural Domain-Specific Query Languages},
booktitle = {Scientific and Statistical Database Management - 23rd International
Conference, {SSDBM} 2011, Portland, OR, USA, July 20-22, 2011. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6809},
pages = {577--578},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-22351-8\_44},
doi = {10.1007/978-3-642-22351-8\_44},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/ssdbm/JaeckschFRL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/Rosenberger10,
author = {Jack Rosenberger},
title = {Thacker wins Turing Award},
journal = {Commun. {ACM}},
volume = {53},
number = {5},
pages = {21},
year = {2010},
url = {https://doi.org/10.1145/1735223.1735233},
doi = {10.1145/1735223.1735233},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/Rosenberger10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/Rosenberger10a,
author = {Jack Rosenberger},
title = {{CS} and technology leaders honored},
journal = {Commun. {ACM}},
volume = {53},
number = {6},
pages = {22},
year = {2010},
url = {https://doi.org/10.1145/1743546.1743557},
doi = {10.1145/1743546.1743557},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/Rosenberger10a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/Rosenberger10b,
author = {Jack Rosenberger},
title = {G{\"{o}}del Prize and other {CS} awards},
journal = {Commun. {ACM}},
volume = {53},
number = {8},
pages = {21},
year = {2010},
url = {https://doi.org/10.1145/1787234.1787267},
doi = {10.1145/1787234.1787267},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/Rosenberger10b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/Rosenberger10c,
author = {Jack Rosenberger},
title = {Kyoto prize and other {CS} awards},
journal = {Commun. {ACM}},
volume = {53},
number = {9},
pages = {21},
year = {2010},
url = {https://doi.org/10.1145/1810891.1810901},
doi = {10.1145/1810891.1810901},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/Rosenberger10c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/RheadKKHZFDSRRPPMLHHHGDCBHK10,
author = {Brooke L. Rhead and
Donna Karolchik and
Robert M. Kuhn and
Angie S. Hinrichs and
Ann S. Zweig and
Pauline A. Fujita and
Mark Diekhans and
Kayla E. Smith and
Kate R. Rosenbloom and
Brian J. Raney and
Andy Pohl and
Michael Pheasant and
Laurence R. Meyer and
Katrina Learned and
Fan Hsu and
Jennifer Hillman{-}Jackson and
Rachel A. Harte and
Belinda Giardine and
Timothy R. Dreszer and
Hiram Clawson and
Galt P. Barber and
David Haussler and
W. James Kent},
title = {The {UCSC} Genome Browser database: update 2010},
journal = {Nucleic Acids Res.},
volume = {38},
number = {Database-Issue},
pages = {613--619},
year = {2010},
url = {https://doi.org/10.1093/nar/gkp939},
doi = {10.1093/NAR/GKP939},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/RheadKKHZFDSRRPPMLHHHGDCBHK10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/its/KumarABR10,
author = {Rohit Kumar and
Hua Ai and
Jack L. Beuth and
Carolyn P. Ros{\'{e}}},
editor = {Vincent Aleven and
Judy Kay and
Jack Mostow},
title = {Socially Capable Conversational Tutors Can Be Effective in Collaborative
Learning Situations},
booktitle = {Intelligent Tutoring Systems, 10th International Conference, {ITS}
2010, Pittsburgh, PA, USA, June 14-18, 2010, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {6094},
pages = {156--164},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-13388-6\_20},
doi = {10.1007/978-3-642-13388-6\_20},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/its/KumarABR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/BuonaccorsiRORWJJP10,
author = {Giovanni A. Buonaccorsi and
C. J. Rose and
J. P. B. O'Connor and
Caleb Roberts and
Yvonne Watson and
Alan Jackson and
Gordon C. Jayson and
Geoffrey J. M. Parker},
editor = {Tianzi Jiang and
Nassir Navab and
Josien P. W. Pluim and
Max A. Viergever},
title = {Cross-Visit Tumor Sub-segmentation and Registration with Outlier Rejection
for Dynamic Contrast-Enhanced {MRI} Time Series Data},
booktitle = {Medical Image Computing and Computer-Assisted Intervention - {MICCAI}
2010, 13th International Conference, Beijing, China, September 20-24,
2010, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {6363},
pages = {121--128},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-15711-0\_16},
doi = {10.1007/978-3-642-15711-0\_16},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miccai/BuonaccorsiRORWJJP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vecpar/AgulloBDKLR10,
author = {Emmanuel Agullo and
Henricus Bouwmeester and
Jack J. Dongarra and
Jakub Kurzak and
Julien Langou and
Lee Rosenberg},
editor = {Jos{\'{e}} M. Laginha M. Palma and
Michel J. Dayd{\'{e}} and
Osni Marques and
Jo{\~{a}}o Correia Lopes},
title = {Towards an Efficient Tile Matrix Inversion of Symmetric Positive Definite
Matrices on Multicore Architectures},
booktitle = {High Performance Computing for Computational Science - {VECPAR} 2010
- 9th International conference, Berkeley, CA, USA, June 22-25, 2010,
Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {6449},
pages = {129--138},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-19328-6\_14},
doi = {10.1007/978-3-642-19328-6\_14},
timestamp = {Tue, 14 May 2019 10:00:36 +0200},
biburl = {https://dblp.org/rec/conf/vecpar/AgulloBDKLR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1002-4057,
author = {Emmanuel Agullo and
Henricus Bouwmeester and
Jack J. Dongarra and
Jakub Kurzak and
Julien Langou and
Lee Rosenberg},
title = {Towards an Efficient Tile Matrix Inversion of Symmetric Positive Definite
Matrices on Multicore Architectures},
journal = {CoRR},
volume = {abs/1002.4057},
year = {2010},
url = {http://arxiv.org/abs/1002.4057},
eprinttype = {arXiv},
eprint = {1002.4057},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1002-4057.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/JacksonMRSCRP09,
author = {Terri J. Jackson and
Jude L. Michel and
Rosemary Roberts and
Jennie Shepheard and
Diana Cheng and
Julie Rust and
Catherine Perry},
title = {Development of a validation algorithm for 'present on admission' flagging},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {9},
pages = {48},
year = {2009},
url = {https://doi.org/10.1186/1472-6947-9-48},
doi = {10.1186/1472-6947-9-48},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/JacksonMRSCRP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/AfsahiRBCPAOLAC08,
author = {Ali Afsahi and
Jacob J. Rael and
Arya Behzad and
Hung{-}Ming Chien and
Michael Pan and
Stephen Au and
Adedayo Ojo and
C. Paul Lee and
Seema Butala Anand and
Kevin Chien and
Stephen Wu and
Rozi Roufoogaran and
Alireza Zolfaghari and
John C. Leete and
Long H. Tran and
Keith A. Carter and
Mohammad Nariman and
David W. K. Yeung and
Walter Morton and
Mark Gonikberg and
Mukul Seth and
Marcellus Forbes and
Jay Pattin and
Luis Gutierrez and
Sumant Ranganathan and
Ning Li and
Eric Blecker and
Jack Lin and
Tom Kwan and
Rose Zhu and
Mark Chambers and
Maryam Rofougaran and
Ahmadreza Rofougaran and
Jason Trachewsky and
Pieter van Rooyen},
title = {A Low-Power Single-Weight-Combiner 802.11abg SoC in 0.13 {\(\mathrm{\mu}\)}m
{CMOS} for Embedded Applications Utilizing An Area and Power Efficient
Cartesian Phase Shifter and Mixer Circuit},
journal = {{IEEE} J. Solid State Circuits},
volume = {43},
number = {5},
pages = {1101--1118},
year = {2008},
url = {https://doi.org/10.1109/JSSC.2008.920338},
doi = {10.1109/JSSC.2008.920338},
timestamp = {Wed, 02 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jssc/AfsahiRBCPAOLAC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BosnellWKKACSGHJKBMMMMMPREa08,
author = {Rose Bosnell and
C. Wegner and
Zsigmond Tam{\'{a}}s Kincses and
T. Korteweg and
Federica Agosta and
Olga Ciccarelli and
Nicola De Stefano and
Achim Gass and
Jochen G. Hirsch and
Heidi Johansen{-}Berg and
Ludwig Kappos and
Frederik Barkhof and
Laura Mancini and
F. Manfredonia and
S. Marino and
David H. Miller and
Xavier Montalban and
Jackie Palace and
Maria Assunta Rocca and
Christian Enzinger and
Stefan Ropele and
Alex Rovira and
Stephen M. Smith and
Alan J. Thompson and
John S. Thornton and
Tarek A. Yousry and
Brandon J. Whitcher and
Massimo Filippi and
Paul M. Matthews},
title = {Reproducibility of fMRI in the clinical setting: Implications for
trial designs},
journal = {NeuroImage},
volume = {42},
number = {2},
pages = {603--610},
year = {2008},
url = {https://doi.org/10.1016/j.neuroimage.2008.05.005},
doi = {10.1016/J.NEUROIMAGE.2008.05.005},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/BosnellWKKACSGHJKBMMMMMPREa08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/KruseRGMFJE08,
author = {Scott A. Kruse and
Gregory H. Rose and
Kevin J. Glaser and
Armando Manduca and
Joel P. Felmlee and
Clifford R. Jack Jr. and
Richard L. Ehman},
title = {Magnetic resonance elastography of the brain},
journal = {NeuroImage},
volume = {39},
number = {1},
pages = {231--237},
year = {2008},
url = {https://doi.org/10.1016/j.neuroimage.2007.08.030},
doi = {10.1016/J.NEUROIMAGE.2007.08.030},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/KruseRGMFJE08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/VolkowWTFLCJMW08,
author = {Nora D. Volkow and
Gene{-}Jack Wang and
Frank Telang and
Joanna S. Fowler and
Jean Logan and
Anna Rose Childress and
Millard Jayne and
Yeming Ma and
Christopher Wong},
title = {Dopamine increases in striatum do not elicit craving in cocaine abusers
unless they are coupled with cocaine cues},
journal = {NeuroImage},
volume = {39},
number = {3},
pages = {1266--1273},
year = {2008},
url = {https://doi.org/10.1016/j.neuroimage.2007.09.059},
doi = {10.1016/J.NEUROIMAGE.2007.09.059},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/VolkowWTFLCJMW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/McKechnieBRJPR08,
author = {Jacqueline McKechnie and
Kirrie J. Ballard and
Donald A. Robin and
Adam Jacks and
Sallyanne Palethorpe and
Kristin M. Rosen},
title = {An acoustic typology of apraxic speech - toward reliable diagnosis},
booktitle = {9th Annual Conference of the International Speech Communication Association,
{INTERSPEECH} 2008, Brisbane, Australia, September 22-26, 2008},
pages = {2213},
publisher = {{ISCA}},
year = {2008},
url = {https://www.isca-speech.org/archive/interspeech\_2008/mckechnie08\_interspeech.html},
timestamp = {Tue, 11 Jun 2024 16:45:43 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/McKechnieBRJPR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cogsci/VanLehnGJJOR07,
author = {Kurt VanLehn and
Arthur C. Graesser and
G. Tanner Jackson and
Pamela W. Jordan and
Andrew Olney and
Carolyn P. Ros{\'{e}}},
title = {When Are Tutorial Dialogues More Effective Than Reading?},
journal = {Cogn. Sci.},
volume = {31},
number = {1},
pages = {3--62},
year = {2007},
url = {https://doi.org/10.1080/03640210709336984},
doi = {10.1080/03640210709336984},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cogsci/VanLehnGJJOR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/ThomasRCHTRKBHHKRSTZHK07,
author = {Daryl J. Thomas and
Kate R. Rosenbloom and
Hiram Clawson and
Angie S. Hinrichs and
Heather Trumbower and
Brian J. Raney and
Donna Karolchik and
Galt P. Barber and
Rachel A. Harte and
Jennifer Hillman{-}Jackson and
Robert M. Kuhn and
Brooke L. Rhead and
Kayla E. Smith and
Archana Thakkapallayil and
Ann S. Zweig and
David Haussler and
W. James Kent},
title = {The {ENCODE} Project at {UC} Santa Cruz},
journal = {Nucleic Acids Res.},
volume = {35},
number = {Database-Issue},
pages = {663--667},
year = {2007},
url = {https://doi.org/10.1093/nar/gkl1017},
doi = {10.1093/NAR/GKL1017},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/ThomasRCHTRKBHHKRSTZHK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/plq/BeirigerJ07,
author = {Angie Beiriger and
Rose M. Jackson},
title = {An Assessment of the Information Needs of Transgender Communities
in Portland, Oregon},
journal = {Public Libr. Q.},
volume = {26},
number = {1-2},
pages = {45--60},
year = {2007},
url = {https://doi.org/10.1300/J118v26n01\_03},
doi = {10.1300/J118V26N01\_03},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/plq/BeirigerJ07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asiams/SohARDJ07,
author = {Ping Jack Soh and
Abdullah Al{-}Hadi Azremi and
Rosemizi Abd Rahim and
H. Dayang and
M. T. Jusoh},
title = {Simplified Modeling, Simulation and Performance Analysis Using Circuit
Model for a Corporate Feed Microstrip Patch Array},
booktitle = {First Asia International Conference on Modelling and Simulation, {AMS}
2007, Phuket, Thailand, March 27-30, 2007},
pages = {253--257},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/AMS.2007.91},
doi = {10.1109/AMS.2007.91},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/asiams/SohARDJ07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/miccai/RoseMOBRWWJJP07,
author = {C. J. Rose and
Samantha J. Mills and
J. P. B. O'Connor and
Giovanni A. Buonaccorsi and
Caleb Roberts and
Yvonne Watson and
Brandon J. Whitcher and
Gordon C. Jayson and
Alan Jackson and
Geoffrey J. M. Parker},
editor = {Nicholas Ayache and
S{\'{e}}bastien Ourselin and
Anthony J. Maeder},
title = {Quantifying Heterogeneity in Dynamic Contrast-Enhanced {MRI} Parameter
Maps},
booktitle = {Medical Image Computing and Computer-Assisted Intervention - {MICCAI}
2007, 10th International Conference, Brisbane, Australia, October
29 - November 2, 2007, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {4792},
pages = {376--384},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-75759-7\_46},
doi = {10.1007/978-3-540-75759-7\_46},
timestamp = {Thu, 13 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/miccai/RoseMOBRWWJJP07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cor/Abbiw-JacksonGRW06,
author = {Roselyn Abbiw{-}Jackson and
Bruce L. Golden and
S. Raghavan and
Edward A. Wasil},
title = {A divide-and-conquer local search heuristic for data visualization},
journal = {Comput. Oper. Res.},
volume = {33},
number = {11},
pages = {3070--3087},
year = {2006},
url = {https://doi.org/10.1016/j.cor.2005.01.020},
doi = {10.1016/J.COR.2005.01.020},
timestamp = {Tue, 18 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cor/Abbiw-JacksonGRW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mia/SalamonFHLRT06,
author = {Peter Salamon and
Ben Felts and
Carol Hand and
Alfonso Limon and
Jack Rose and
Jose de la Torre{-}Bueno},
title = {A diffusion approach to labeling rows and columns in an irregular
array},
journal = {Medical Image Anal.},
volume = {10},
number = {2},
pages = {150--161},
year = {2006},
url = {https://doi.org/10.1016/j.media.2005.08.002},
doi = {10.1016/J.MEDIA.2005.08.002},
timestamp = {Mon, 24 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mia/SalamonFHLRT06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/HinrichsKBBBCDFHHHKPPRRSSSSTTWWZHK06,
author = {Angela S. Hinrichs and
Donna Karolchik and
Robert Baertsch and
Galt P. Barber and
Gill Bejerano and
Hiram Clawson and
Mark Diekhans and
Terrence S. Furey and
Rachel A. Harte and
Fan Hsu and
Jennifer Hillman{-}Jackson and
Robert M. Kuhn and
Jakob Skou Pedersen and
Andy Pohl and
Brian J. Raney and
Kate R. Rosenbloom and
Adam C. Siepel and
Kayla E. Smith and
Charles W. Sugnet and
A. Sultan{-}Qurraie and
Daryl J. Thomas and
Heather Trumbower and
Ryan J. Weber and
M. Weirauch and
Ann S. Zweig and
David Haussler and
W. James Kent},
title = {The {UCSC} Genome Browser Database: update 2006},
journal = {Nucleic Acids Res.},
volume = {34},
number = {Database-Issue},
pages = {590--598},
year = {2006},
url = {https://doi.org/10.1093/nar/gkj144},
doi = {10.1093/NAR/GKJ144},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/HinrichsKBBBCDFHHHKPPRRSSSSTTWWZHK06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isbi/HamiltonCBWGRD06,
author = {Theron J. Hamilton and
Guohua Cao and
Claude J. Bailat and
Jack Wands and
Stephan Gehring and
Christoph Rose{-}Petruck and
Gerald J. Diebold},
title = {Ultrasonically modulated X-ray phase contrast imaging},
booktitle = {Proceedings of the 2006 {IEEE} International Symposium on Biomedical
Imaging: From Nano to Macro, Arlington, VA, USA, 6-9 April 2006},
pages = {1108--1111},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/ISBI.2006.1625116},
doi = {10.1109/ISBI.2006.1625116},
timestamp = {Wed, 04 Oct 2023 17:01:25 +0200},
biburl = {https://dblp.org/rec/conf/isbi/HamiltonCBWGRD06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/metmbs/SalamonFHLRT05,
author = {Peter Salamon and
Ben Felts and
Carol Hand and
Alfonso Limon and
Jack Rose and
Jose de la Torre{-}Bueno},
editor = {Faramarz Valafar and
Homayoun Valafar},
title = {A Structural Diffusion Approach To Labeling Rows And Columns In An
Irregular Array},
booktitle = {Proceedings of The 2005 International Conference on Mathematics and
Engineering Techniques in Medicine and Biological Sciences, {METMBS}
2005, Las Vegas, Nevada, USA, June 20-23, 2005},
pages = {269--273},
publisher = {{CSREA} Press},
year = {2005},
timestamp = {Thu, 17 Feb 2011 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/metmbs/SalamonFHLRT05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/basesearch/AbbiwJackson04,
author = {Roselyn Abbiw{-}Jackson},
title = {discrete optimization models in data visualization},
school = {University of Maryland, College Park, MD, {USA}},
year = {2004},
url = {https://hdl.handle.net/1903/1987},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/basesearch/AbbiwJackson04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icse/2004,
editor = {Anthony Finkelstein and
Jacky Estublier and
David S. Rosenblum},
title = {26th International Conference on Software Engineering {(ICSE} 2004),
23-28 May 2004, Edinburgh, United Kingdom},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://ieeexplore.ieee.org/xpl/conhome/9201/proceeding},
isbn = {0-7695-2163-0},
timestamp = {Wed, 16 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icse/2004.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/CaoPYSYA03,
author = {Jack Cao and
Rosemarie Panetta and
Shiyi Yue and
Alain Steyaert and
Michele Young{-}Bellido and
Sultan Ahmad},
title = {A naive Bayes model to predict coupling between seven transmembrane
domain receptors, and G-proteins},
journal = {Bioinform.},
volume = {19},
number = {2},
pages = {234--240},
year = {2003},
url = {https://doi.org/10.1093/bioinformatics/19.2.234},
doi = {10.1093/BIOINFORMATICS/19.2.234},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/CaoPYSYA03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/GardnerTABBDFGGGHHHJJJKKMMMMRRRSSSSEWW03,
author = {Daniel Gardner and
Arthur W. Toga and
Giorgio A. Ascoli and
Jackson T. Beatty and
James F. Brinkley and
Anders M. Dale and
Peter T. Fox and
Esther P. Gardner and
John S. George and
Nigel H. Goddard and
Kristen M. Harris and
Edward Herskovits and
Michael L. Hines and
Gwen A. Jacobs and
Russell E. Jacobs and
Edward G. Jones and
David N. Kennedy and
Daniel Y. Kimberg and
John C. Mazziotta and
Perry L. Miller and
Susumu Mori and
David C. Mountain and
Allan L. Reiss and
Glenn D. Rosen and
David A. Rottenberg and
Gordon M. Shepherd and
Neil R. Smalheiser and
Kenneth P. Smith and
Tom Strachan and
David C. Van Essen and
Robert W. Williams and
Stephen T. C. Wong},
title = {Towards effective and rewarding data sharing},
journal = {Neuroinformatics},
volume = {1},
number = {3},
pages = {289--295},
year = {2003},
url = {https://doi.org/10.1385/NI:1:3:289},
doi = {10.1385/NI:1:3:289},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ni/GardnerTABBDFGGGHHHJJJKKMMMMRRRSSSSEWW03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acis/ThomasSJ03,
author = {Roseanne Thomas and
Wally Smith and
Paul Jackson},
title = {The Relationship between Process and Practice: The Case of a Sales
Order Office},
booktitle = {Australasian Conference on Information Systems, {ACIS} 2003, Perth,
Australia, November 26-28, 2003},
year = {2003},
url = {https://aisel.aisnet.org/acis2003/97},
timestamp = {Fri, 17 May 2024 16:58:38 +0200},
biburl = {https://dblp.org/rec/conf/acis/ThomasSJ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ivc/XuJGRBYDH99,
author = {Lang Xu and
Marcel Jackowski and
A. Ardeshir Goshtasby and
D. Roseman and
S. Bines and
Clement T. Yu and
Akshaya Dhawan and
Arthur C. Huntley},
title = {Segmentation of skin cancer images},
journal = {Image Vis. Comput.},
volume = {17},
number = {1},
pages = {65--74},
year = {1999},
url = {https://doi.org/10.1016/S0262-8856(98)00091-2},
doi = {10.1016/S0262-8856(98)00091-2},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ivc/XuJGRBYDH99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/JackowskiGBRY97,
author = {Marcel Jackowski and
A. Ardeshir Goshtasby and
S. Bines and
D. Roseman and
Clement T. Yu},
title = {Correcting the Geometry and Color of Digital Images},
journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
volume = {19},
number = {10},
pages = {1152--1158},
year = {1997},
url = {https://doi.org/10.1109/34.625125},
doi = {10.1109/34.625125},
timestamp = {Wed, 17 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pami/JackowskiGBRY97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/Jackson96,
author = {J. R. Jackson},
title = {The Internet Compendium: Subject Guides to Health and Science Resources,
by Louis Rosenfeld, Joseph Janes, and Martha Vander Kolk},
journal = {J. Am. Soc. Inf. Sci.},
volume = {47},
number = {12},
pages = {953},
year = {1996},
url = {https://doi.org/10.1002/(SICI)1097-4571(199612)47:12\<953::AID-ASI8\>3.0.CO;2-1},
doi = {10.1002/(SICI)1097-4571(199612)47:12\<953::AID-ASI8\>3.0.CO;2-1},
timestamp = {Wed, 13 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jasis/Jackson96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/adaEurope/BirusKKRT95,
author = {Tim Birus and
Paul Knueven and
Ed Kuzemchak and
Jack Rosenzweig and
Joyce L. Tokar},
editor = {Marcel Toussaint},
title = {Extending the Ada 95 Initial Conditions for Preelaboration for Use
in Real-Time Systems},
booktitle = {Ada in Europe, Second International Eurospace - Ada-Europe Symposium,
Frankfurt/Main, Germany, October 2-6, 1995, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1031},
pages = {164--169},
publisher = {Springer},
year = {1995},
url = {https://doi.org/10.1007/BFb0015491},
doi = {10.1007/BFB0015491},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/adaEurope/BirusKKRT95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isj/AvisonFEJRT93,
author = {David E. Avison and
Guy Fitzgerald and
Colin Eden and
Michael Jackson and
Jonathan Rosenhead and
Rolfe Tomlinson},
title = {Editorial},
journal = {Inf. Syst. J.},
volume = {3},
number = {1},
pages = {1--2},
year = {1993},
url = {https://doi.org/10.1111/j.1365-2575.1993.tb00110.x},
doi = {10.1111/J.1365-2575.1993.TB00110.X},
timestamp = {Mon, 05 Feb 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/isj/AvisonFEJRT93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/WiledenWRT91,
author = {Jack C. Wileden and
Alexander L. Wolf and
William R. Rosenblatt and
Peri L. Tarr},
title = {Specification-Level Interoperability},
journal = {Commun. {ACM}},
volume = {34},
number = {5},
pages = {72--87},
year = {1991},
url = {https://doi.org/10.1145/103167.103175},
doi = {10.1145/103167.103175},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/WiledenWRT91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icse/WiledenWRT90,
author = {Jack C. Wileden and
Alexander L. Wolf and
William R. Rosenblatt and
Peri L. Tarr},
editor = {Fran{\c{c}}ois{-}R{\'{e}}gis Valette and
Peter A. Freeman and
Marie{-}Claude Gaudel},
title = {Specification Level Interoperability},
booktitle = {Proceedings of the 12th International Conference on Software Engineering,
Nice, France, March 26-30, 1990},
pages = {74--85},
publisher = {{IEEE} Computer Society},
year = {1990},
url = {http://dl.acm.org/citation.cfm?id=100304},
timestamp = {Mon, 14 May 2012 18:17:13 +0200},
biburl = {https://dblp.org/rec/conf/icse/WiledenWRT90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nn/WintersR89,
author = {Jack H. Winters and
Christopher Rose},
title = {Minimum distance automata in parallel networks for optimum classification},
journal = {Neural Networks},
volume = {2},
number = {2},
pages = {127--132},
year = {1989},
url = {https://doi.org/10.1016/0893-6080(89)90029-4},
doi = {10.1016/0893-6080(89)90029-4},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nn/WintersR89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/oopsla/RosenblattWW89,
author = {William R. Rosenblatt and
Jack C. Wileden and
Alexander L. Wolf},
editor = {George Bosworth},
title = {{OROS:} Toward a Type Model for Software Development Environments},
booktitle = {Conference on Object-Oriented Programming: Systems, Languages, and
Applications, {OOPSLA} 1989, New Orleans, Louisiana, USA, October
1-6, 1989, Proceedings},
pages = {297--304},
publisher = {{ACM}},
year = {1989},
url = {https://doi.org/10.1145/74877.74908},
doi = {10.1145/74877.74908},
timestamp = {Wed, 30 Mar 2022 13:54:19 +0200},
biburl = {https://dblp.org/rec/conf/oopsla/RosenblattWW89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/el/89/RosenscheinB89,
author = {Jeffrey S. Rosenschein and
John S. Breese},
editor = {Les Gasser and
Michael N. Huhns},
title = {Communication-Free Interactions among Rational Agents: {A} Probabilistic
Approach},
booktitle = {Distributed Artificial Intelligence},
pages = {99--118},
publisher = {Elsevier},
year = {1989},
url = {https://doi.org/10.1016/b978-1-55860-092-8.50009-5},
doi = {10.1016/B978-1-55860-092-8.50009-5},
timestamp = {Thu, 28 Nov 2019 10:42:04 +0100},
biburl = {https://dblp.org/rec/books/el/89/RosenscheinB89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/robotica/Rose88g,
author = {J. A. Rose},
title = {\emph{Prolog, Children and Students} edited by Jon Nichol, Jonathan
Briggs and Jackie Dean, Kogan Page, London/Nichols Publishing Company,
New York, 1988 ({\textsterling}19.95)},
journal = {Robotica},
volume = {6},
number = {4},
pages = {344},
year = {1988},
url = {https://doi.org/10.1017/S0263574700004756},
doi = {10.1017/S0263574700004756},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/robotica/Rose88g.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/btw/DayalMBCGHOR87,
author = {Umeshwar Dayal and
Frank Manola and
Alejandro P. Buchmann and
Upen S. Chakravarthy and
David Goldhirsch and
Sandra Heiler and
Jack A. Orenstein and
Arnon Rosenthal},
editor = {Hans{-}J{\"{o}}rg Schek and
Gunter Schlageter},
title = {Simplifying Complex Objects: The {PROBE} Approach to Modelling and
Querying Them},
booktitle = {Datenbanksysteme in B{\"{u}}ro, Technik und Wissenschaft, GI-Fachtagung,
Darmstadt, 1.-3. April 1987, Proceedings},
series = {Informatik-Fachberichte},
volume = {136},
pages = {17--37},
publisher = {Springer},
year = {1987},
url = {https://doi.org/10.1007/978-3-642-72617-0\_2},
doi = {10.1007/978-3-642-72617-0\_2},
timestamp = {Thu, 25 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/btw/DayalMBCGHOR87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/RoseGH74,
author = {Lawrence L. Rose and
Malcolm H. Gotterer and
Jack C. Hayya},
editor = {Harold Joseph Highland and
Michael F. Morris and
Harold Steinberg and
Donald O. Walter and
Fred Silver and
Susan L. Solomon and
Joseph Annino and
Dennis M. Gilbert},
title = {A simulation model for Dynamic File Management},
booktitle = {Proceedings of the 7th conference on Winter simulation, {WSC} 1974,
Washington, DC, USA, January 14-16, 1974},
pages = {251--257},
publisher = {{ACM}},
year = {1974},
url = {https://doi.org/10.1145/800287.811186},
doi = {10.1145/800287.811186},
timestamp = {Wed, 04 May 2022 13:02:28 +0200},
biburl = {https://dblp.org/rec/conf/wsc/RoseGH74.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ifip/1974,
editor = {Jack L. Rosenfeld},
title = {Information Processing, Proceedings of the 6th {IFIP} Congress 1974,
Stockholm, Sweden, August 5-10, 1974},
publisher = {North-Holland},
year = {1974},
isbn = {0-7204-2803-3},
timestamp = {Fri, 26 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip/1974.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/RosenfeldV73,
author = {Jack L. Rosenfeld and
Raymond D. Villani},
title = {Micromultiprocessing: An Approach to Multiprocessing at the Level
of Very Small Tasks},
journal = {{IEEE} Trans. Computers},
volume = {22},
number = {2},
pages = {149--153},
year = {1973},
url = {https://doi.org/10.1109/T-C.1973.223676},
doi = {10.1109/T-C.1973.223676},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/RosenfeldV73.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ifip/1971-1,
editor = {Charles V. Freiman and
John E. Griffith and
Jack L. Rosenfeld},
title = {Information Processing, Proceedings of {IFIP} Congress 1971, Volume
1 - Foundations and Systems, Ljubljana, Yugoslavia, August 23-28,
1971},
publisher = {North-Holland},
year = {1972},
isbn = {0-7204-2063-6},
timestamp = {Fri, 26 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip/1971-1.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ifip/1971-2,
editor = {Charles V. Freiman and
John E. Griffith and
Jack L. Rosenfeld},
title = {Information Processing, Proceedings of {IFIP} Congress 1971, Volume
2 - Applications, Ljubljana, Yugoslavia, August 23-28, 1971},
publisher = {North-Holland},
year = {1972},
isbn = {0-7204-2063-6},
timestamp = {Fri, 26 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip/1971-2.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/MinkerR71,
author = {Jack Minker and
Sam Rosenfeld},
editor = {Jack Minker and
Sam Rosenfeld},
title = {Introduction and Perspectives for the 1971 {ACM} Information Storage
and Retrieval Symposium},
booktitle = {{ACM} {SIGIR} Information Storage and Retrieval Symposium, College
Park, Maryland, USA, April 1-2, 1971, Proceeding},
pages = {1--3},
publisher = {{ACM}},
year = {1971},
url = {https://doi.org/10.1145/511285.511286},
doi = {10.1145/511285.511286},
timestamp = {Tue, 06 Nov 2018 11:07:23 +0100},
biburl = {https://dblp.org/rec/conf/sigir/MinkerR71.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sigir/71,
editor = {Jack Minker and
Sam Rosenfeld},
title = {{ACM} {SIGIR} Information Storage and Retrieval Symposium, College
Park, Maryland, USA, April 1-2, 1971, Proceeding},
publisher = {{ACM}},
year = {1971},
url = {https://doi.org/10.1145/511285},
doi = {10.1145/511285},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/71.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/Rosenfeld69,
author = {Jack L. Rosenfeld},
title = {A case study in programming for parallel-processors},
journal = {Commun. {ACM}},
volume = {12},
number = {12},
pages = {645--655},
year = {1969},
url = {https://doi.org/10.1145/363626.363628},
doi = {10.1145/363626.363628},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/Rosenfeld69.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/afips/LehmanR68,
author = {Meir M. Lehman and
Jack L. Rosenfeld},
title = {Performance of a simulated multiprogramming system},
booktitle = {American Federation of Information Processing Societies: Proceedings
of the {AFIPS} '68 Fall Joint Computer Conference, December 9-11,
1968, San Francisco, California, {USA} - Part {II}},
series = {{AFIPS} Conference Proceedings},
volume = {33},
pages = {1431--1442},
publisher = {{AFIPS} / {ACM} / Thomson Book Company, Washington {D.C.}},
year = {1968},
url = {https://doi.org/10.1145/1476706.1476776},
doi = {10.1145/1476706.1476776},
timestamp = {Wed, 14 Apr 2021 16:50:07 +0200},
biburl = {https://dblp.org/rec/conf/afips/LehmanR68.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip/RosenfeldD68,
author = {Jack L. Rosenfeld and
Graham C. Driscoll},
editor = {A. J. H. Morrel},
title = {Solution of the Dirichlet problem on a simulated parallel processing
system},
booktitle = {Information Processing, Proceedings of {IFIP} Congress 1968, Edinburgh,
UK, 5-10 August 1968, Volume 1 - Mathematics, Software},
pages = {499--507},
year = {1968},
timestamp = {Fri, 26 Jul 2019 15:40:04 +0200},
biburl = {https://dblp.org/rec/conf/ifip/RosenfeldD68.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jacm/SteinR60,
author = {Marvin L. Stein and
Jack Rose},
title = {Changing from Analog to Digital Programming by Digital Techniques},
journal = {J. {ACM}},
volume = {7},
number = {1},
pages = {10--23},
year = {1960},
url = {https://doi.org/10.1145/321008.321010},
doi = {10.1145/321008.321010},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jacm/SteinR60.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aieeire/SteinRP59,
author = {Marvin L. Stein and
Jack Rose and
Donn B. Parker},
editor = {R. R. Johnson},
title = {A compiler with an analog-oriented input language},
booktitle = {Papers presented at the the 1959 western joint computer conference,
{IRE-AIEE-ACM} 1959 (Western), San Francisco, California, USA, March
3-5, 1959},
pages = {92--102},
publisher = {{ACM}},
year = {1959},
url = {https://doi.org/10.1145/1457838.1457855},
doi = {10.1145/1457838.1457855},
timestamp = {Thu, 22 Apr 2021 12:46:05 +0200},
biburl = {https://dblp.org/rec/conf/aieeire/SteinRP59.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tc/Rosenfeld58,
author = {Jack L. Rosenfeld},
title = {Magnetic Core Pulse-Switching Circuits for Standard Packages},
journal = {{IRE} Trans. Electron. Comput.},
volume = {7},
number = {3},
pages = {223--228},
year = {1958},
url = {https://doi.org/10.1109/TEC.1958.5222580},
doi = {10.1109/TEC.1958.5222580},
timestamp = {Mon, 25 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tc/Rosenfeld58.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aieeire/Rosenberg57,
author = {Jack Rosenberg},
editor = {Morton M. Astrahan},
title = {Logical organization of the {DIGIMATIC} computer},
booktitle = {Papers and discussions presented at the 1957 eastern joint computer
conference: Computers with deadlines to meet, {IRE-ACM-AIEE} 1957
(Eastern), Washington, D.C., USA, December 9-13, 1957},
pages = {25--29},
publisher = {{ACM}},
year = {1957},
url = {https://doi.org/10.1145/1457720.1457723},
doi = {10.1145/1457720.1457723},
timestamp = {Thu, 22 Apr 2021 12:03:17 +0200},
biburl = {https://dblp.org/rec/conf/aieeire/Rosenberg57.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-11-02 19:44 CET from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
