default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "Chris Larson"
download as .bib file
@article{DBLP:journals/nms/LarsonR24,
author = {Christine Larson and
Elspeth Ready},
title = {Networking down: Networks, innovation, and relational labor in digital
book publishing},
journal = {New Media Soc.},
volume = {26},
number = {5},
pages = {2659--2678},
year = {2024},
url = {https://doi.org/10.1177/14614448221090195},
doi = {10.1177/14614448221090195},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nms/LarsonR24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/NakamuraSDABDDFFGGHHJKLLMMOOPRS24,
author = {Nathan Nakamura and
Paul Szypryt and
Amber L. Dagel and
Bradley K. Alpert and
Douglas A. Bennett and
William Bertrand Doriese and
Malcolm Durkin and
Joseph W. Fowler and
Dylan T. Fox and
Johnathon D. Gard and
Ryan N. Goodner and
James Zachariah Harris and
Gene C. Hilton and
Edward S. Jimenez and
Burke L. Kernen and
Kurt W. Larson and
Zachary H. Levine and
Daniel McArthur and
Kelsey M. Morgan and
Galen C. O'Neil and
Nathan J. Ortiz and
Christine G. Pappas and
Carl D. Reintsema and
Daniel R. Schmidt and
Peter A. Schultz and
Kyle R. Thompson and
Joel N. Ullom and
Leila Vale and
Courtenay T. Vaughan and
Christopher Walker and
Joel C. Weber and
Jason W. Wheeler and
Daniel S. Swetz},
title = {Nanoscale Three-Dimensional Imaging of Integrated Circuits Using a
Scanning Electron Microscope and Transition-Edge Sensor Spectrometer},
journal = {Sensors},
volume = {24},
number = {9},
pages = {2890},
year = {2024},
url = {https://doi.org/10.3390/s24092890},
doi = {10.3390/S24092890},
timestamp = {Tue, 18 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/NakamuraSDABDDFFGGHHJKLLMMOOPRS24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/arsmc/BushawCGKLLMMSTWWWL23,
author = {Neal Bushaw and
Blake Conka and
Vinay Gupta and
Aidan Kierans and
Hudson Lafayette and
Craig E. Larson and
Kevin McCall and
Andriy Mulyar and
Christine Sullivan and
Scott Taylor and
Evan Wainright and
Evan Wilson and
Guanyu Wu and
Sarah Loeb},
title = {Bootstrap percolation via automated conjecturing},
journal = {Ars Math. Contemp.},
volume = {23},
number = {3},
year = {2023},
url = {https://doi.org/10.26493/1855-3974.2340.a61},
doi = {10.26493/1855-3974.2340.A61},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/arsmc/BushawCGKLLMMSTWWWL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/BrandtKLPWHHLSWWCCLCKCDRWPWRSR23,
author = {Pascal S. Brandt and
Abel N. Kho and
Yuan Luo and
Jennifer A. Pacheco and
Theresa L. Walunas and
Hakon Hakonarson and
George Hripcsak and
Cong Liu and
Ning Shang and
Chunhua Weng and
Nephi Walton and
David S. Carrell and
Paul K. Crane and
Eric B. Larson and
Christopher G. Chute and
Iftikhar J. Kullo and
Robert J. Carroll and
Joshua C. Denny and
Andrea H. Ramirez and
Wei{-}Qi Wei and
Jyotishman Pathak and
Laura K. Wiley and
Rachel L. Richesson and
Justin B. Starren and
Luke V. Rasmussen},
title = {Characterizing variability of electronic health record-driven phenotype
definitions},
journal = {J. Am. Medical Informatics Assoc.},
volume = {30},
number = {3},
pages = {427--437},
year = {2023},
url = {https://doi.org/10.1093/jamia/ocac235},
doi = {10.1093/JAMIA/OCAC235},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/BrandtKLPWHHLSWWCCLCKCDRWPWRSR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/ChungKGCALHTSCVBLXLV23,
author = {Brian T. Chung and
Yaewon Kim and
Jeremy W. Gordon and
Hsin{-}Yu Chen and
Adam Autry and
Philip M. Lee and
Jasmine Y. Hu and
Chou T. Tan and
Chris Suszczynski and
Susan M. Chang and
Javier E. Villanueva{-}Meyer and
Robert Bok and
Peder E. Z. Larson and
Duan Xu and
Yan Li and
Daniel B. Vigneron},
title = {Hyperpolarized [2-\({}^{\mbox{13}}\)C]pyruvate {MR} molecular imaging
with whole brain coverage},
journal = {NeuroImage},
volume = {280},
pages = {120350},
year = {2023},
url = {https://doi.org/10.1016/j.neuroimage.2023.120350},
doi = {10.1016/J.NEUROIMAGE.2023.120350},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/ChungKGCALHTSCVBLXLV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/ZhuKRHSZLLAAABBBBBBCCCCDDDDD23,
author = {Xi Zhu and
Yoojean Kim and
Orren Ravid and
Xiaofu He and
Benjamin Suarez{-}Jimenez and
Sigal Zilcha{-}Mano and
Amit Lazarov and
Seonjoo Lee and
Chadi G. Abdallah and
Michael Angstadt and
Christopher L. Averill and
C. Lexi Baird and
Lee Baugh and
Jennifer Urbano Blackford and
Jessica Bomyea and
Steven E. Bruce and
Richard A. Bryant and
Zhihong Cao and
Kyle Choi and
Josh M. Cisler and
Andrew S. Cotton and
Judith K. Daniels and
Nicholas D. Davenport and
Richard J. Davidson and
Michael D. De Bellis and
Emily L. Dennis and
Maria Densmore and
Terri A. deRoon{-}Cassini and
Seth G. Disner and
Wissam El{-}Hage and
Amit Etkin and
Negar Fani and
Kelene A. Fercho and
Jacklynn M. Fitzgerald and
Gina L. Forster and
Jessie L. Frijling and
Elbert Geuze and
Atilla Gonenc and
Evan M. Gordon and
Staci Gruber and
Daniel W. Grupe and
Jeffrey P. Guenette and
Courtney C. Haswell and
Ryan J. Herringa and
Julia Herzog and
David Bernd Hofmann and
Bobak Hosseini and
Anna R. Hudson and
Ashley A. Huggins and
Jonathan C. Ipser and
Neda Jahanshad and
Meilin Jia{-}Richards and
Tanja Jovanovic and
Milissa L. Kaufman and
Mitzy Kennis and
Anthony King and
Philipp Kinzel and
Saskia B. J. Koch and
Inga Koerte and
Sheri{-}Michelle Koopowitz and
Mayuresh S. Korgaonkar and
John H. Krystal and
Ruth A. Lanius and
Christine L. Larson and
Lauren A. M. Lebois and
Gen Li and
Israel Liberzon and
Guang Ming Lu and
Yifeng Luo and
Vincent A. Magnotta and
Antje Manthey and
Adi Maron{-}Katz and
Geoffery May and
Katie A. McLaughlin and
Sven C. Mueller and
Laura Nawijn and
Steven M. Nelson and
Richard W. J. Neufeld and
Jack B. Nitschke and
Erin O'Leary and
Bunmi O. Olatunji and
Miranda Olff and
Matthew Peverill and
K. Luan Phan and
Rongfeng Qi and
Yann Quid{\'{e}} and
Ivan Rektor and
Kerry J. Ressler and
Pavel Riha and
Marisa Ross and
Isabelle M. Rosso and
Lauren E. Salminen and
Kelly A. Sambrook and
Christian Schmahl and
Martha Elizabeth Shenton and
Margaret A. Sheridan and
Chiahao Shih and
Maurizio Sicorello and
Anika Sierk and
Alan N. Simmons and
Raluca M. Simons and
Jeffrey S. Simons and
Scott R. Sponheim and
Murray B. Stein and
Dan J. Stein and
Jennifer S. Stevens and
Thomas Straube and
Delin Sun and
Jean Th{\'{e}}berge and
Paul M. Thompson and
Sophia I. Thomopoulos and
Nic J. A. van der Wee and
Steven J. A. van der Werff and
Theo G. M. van Erp and
Sanne J. H. van Rooij and
Mirjam van Zuiden and
Tim Varkevisser and
Dick J. Veltman and
Robert R. J. M. Vermeiren and
Henrik Walter and
Li Wang and
Xin Wang and
Carissa N. Weis and
Sherry Winternitz and
Hong Xie and
Ye Zhu and
Melanie Wall and
Yuval Neria and
Rajendra A. Morey},
title = {Neuroimaging-based classification of {PTSD} using data-driven computational
approaches: {A} multisite big data study from the {ENIGMA-PGC} {PTSD}
consortium},
journal = {NeuroImage},
volume = {283},
pages = {120412},
year = {2023},
url = {https://doi.org/10.1016/j.neuroimage.2023.120412},
doi = {10.1016/J.NEUROIMAGE.2023.120412},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/ZhuKRHSZLLAAABBBBBBCCCCDDDDD23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/HelmBAPVPWZCBLA23,
author = {Hayden S. Helm and
Amitabh Basu and
Avanti Athreya and
Youngser Park and
Joshua T. Vogelstein and
Carey E. Priebe and
Michael Winding and
Marta Zlatic and
Albert Cardona and
Patrick Bourke and
Jonathan Larson and
Marah Ihab Abdin and
Piali Choudhury and
Weiwei Yang and
Christopher W. White},
title = {Distance-based positive and unlabeled learning for ranking},
journal = {Pattern Recognit.},
volume = {134},
pages = {109085},
year = {2023},
url = {https://doi.org/10.1016/j.patcog.2022.109085},
doi = {10.1016/J.PATCOG.2022.109085},
timestamp = {Sat, 08 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pr/HelmBAPVPWZCBLA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/PerezRLNCHPOKKJ23,
author = {Ethan Perez and
Sam Ringer and
Kamile Lukosiute and
Karina Nguyen and
Edwin Chen and
Scott Heiner and
Craig Pettit and
Catherine Olsson and
Sandipan Kundu and
Saurav Kadavath and
Andy Jones and
Anna Chen and
Benjamin Mann and
Brian Israel and
Bryan Seethor and
Cameron McKinnon and
Christopher Olah and
Da Yan and
Daniela Amodei and
Dario Amodei and
Dawn Drain and
Dustin Li and
Eli Tran{-}Johnson and
Guro Khundadze and
Jackson Kernion and
James Landis and
Jamie Kerr and
Jared Mueller and
Jeeyoon Hyun and
Joshua Landau and
Kamal Ndousse and
Landon Goldberg and
Liane Lovitt and
Martin Lucas and
Michael Sellitto and
Miranda Zhang and
Neerav Kingsland and
Nelson Elhage and
Nicholas Joseph and
Noem{\'{\i}} Mercado and
Nova DasSarma and
Oliver Rausch and
Robin Larson and
Sam McCandlish and
Scott Johnston and
Shauna Kravec and
Sheer El Showk and
Tamera Lanham and
Timothy Telleen{-}Lawton and
Tom Brown and
Tom Henighan and
Tristan Hume and
Yuntao Bai and
Zac Hatfield{-}Dodds and
Jack Clark and
Samuel R. Bowman and
Amanda Askell and
Roger Grosse and
Danny Hernandez and
Deep Ganguli and
Evan Hubinger and
Nicholas Schiefer and
Jared Kaplan},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {Discovering Language Model Behaviors with Model-Written Evaluations},
booktitle = {Findings of the Association for Computational Linguistics: {ACL} 2023,
Toronto, Canada, July 9-14, 2023},
pages = {13387--13434},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.findings-acl.847},
doi = {10.18653/V1/2023.FINDINGS-ACL.847},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/PerezRLNCHPOKKJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggrapha/KaufmannL23,
author = {Christian Kaufmann and
Paulina Larson},
editor = {June Kim and
Herman Van Eyken and
Rob Coleman and
Stephen Spencer and
Michela Ledwidge},
title = {Town Hall Square},
booktitle = {{SIGGRAPH} Asia 2023 Computer Animation Festival, {SA} 2023, Sydney,
NSW, Australia, December 12-15, 2023},
pages = {30:1},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3626964.3626976},
doi = {10.1145/3626964.3626976},
timestamp = {Sun, 31 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/siggrapha/KaufmannL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/CornettBBABBDDFGJLMJSSSTYZDSB23,
author = {David Cornett III and
Joel Brogan and
Nell Barber and
Deniz Aykac and
Seth T. Baird and
Nick Burchfield and
Carl Dukes and
Andrew Duncan and
Regina Ferrell and
Jim Goddard and
Gavin Jager and
Matt Larson and
Bart Murphy and
Christi Johnson and
Ian Shelley and
Nisha Srinivas and
Brandon Stockwell and
Leanne Thompson and
Matt Yohe and
Robert Zhang and
Scott Dolvin and
Hector J. Santos{-}Villalobos and
David S. Bolme},
title = {Expanding Accurate Person Recognition to New Altitudes and Ranges:
The {BRIAR} Dataset},
booktitle = {{IEEE/CVF} Winter Conference on Applications of Computer Vision Workshops,
{WACV} 2023 - Workshops, Waikoloa, HI, USA, January 3-7, 2023},
pages = {593--602},
publisher = {{IEEE}},
year = {2023},
url = {https://doi.org/10.1109/WACVW58289.2023.00066},
doi = {10.1109/WACVW58289.2023.00066},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wacv/CornettBBABBDDFGJLMJSSSTYZDSB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/mmm/2023-1,
editor = {Duc{-}Tien Dang{-}Nguyen and
Cathal Gurrin and
Martha A. Larson and
Alan F. Smeaton and
Stevan Rudinac and
Minh{-}Son Dao and
Christoph Trattner and
Phoebe Chen},
title = {MultiMedia Modeling - 29th International Conference, {MMM} 2023, Bergen,
Norway, January 9-12, 2023, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {13833},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-27077-2},
doi = {10.1007/978-3-031-27077-2},
isbn = {978-3-031-27076-5},
timestamp = {Fri, 31 Mar 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mmm/2023-1.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/mmm/2023-2,
editor = {Duc{-}Tien Dang{-}Nguyen and
Cathal Gurrin and
Martha A. Larson and
Alan F. Smeaton and
Stevan Rudinac and
Minh{-}Son Dao and
Christoph Trattner and
Phoebe Chen},
title = {MultiMedia Modeling - 29th International Conference, {MMM} 2023, Bergen,
Norway, January 9-12, 2023, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {13834},
publisher = {Springer},
year = {2023},
url = {https://doi.org/10.1007/978-3-031-27818-1},
doi = {10.1007/978-3-031-27818-1},
isbn = {978-3-031-27817-4},
timestamp = {Thu, 06 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mmm/2023-2.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-07459,
author = {Deep Ganguli and
Amanda Askell and
Nicholas Schiefer and
Thomas I. Liao and
Kamile Lukosiute and
Anna Chen and
Anna Goldie and
Azalia Mirhoseini and
Catherine Olsson and
Danny Hernandez and
Dawn Drain and
Dustin Li and
Eli Tran{-}Johnson and
Ethan Perez and
Jackson Kernion and
Jamie Kerr and
Jared Mueller and
Joshua Landau and
Kamal Ndousse and
Karina Nguyen and
Liane Lovitt and
Michael Sellitto and
Nelson Elhage and
Noem{\'{\i}} Mercado and
Nova DasSarma and
Oliver Rausch and
Robert Lasenby and
Robin Larson and
Sam Ringer and
Sandipan Kundu and
Saurav Kadavath and
Scott Johnston and
Shauna Kravec and
Sheer El Showk and
Tamera Lanham and
Timothy Telleen{-}Lawton and
Tom Henighan and
Tristan Hume and
Yuntao Bai and
Zac Hatfield{-}Dodds and
Ben Mann and
Dario Amodei and
Nicholas Joseph and
Sam McCandlish and
Tom Brown and
Christopher Olah and
Jack Clark and
Samuel R. Bowman and
Jared Kaplan},
title = {The Capacity for Moral Self-Correction in Large Language Models},
journal = {CoRR},
volume = {abs/2302.07459},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.07459},
doi = {10.48550/ARXIV.2302.07459},
eprinttype = {arXiv},
eprint = {2302.07459},
timestamp = {Thu, 23 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-07459.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-16452,
author = {Harsha Nori and
Yin Tat Lee and
Sheng Zhang and
Dean Carignan and
Richard Edgar and
Nicol{\`{o}} Fusi and
Nicholas King and
Jonathan Larson and
Yuanzhi Li and
Weishung Liu and
Renqian Luo and
Scott Mayer McKinney and
Robert Osazuwa Ness and
Hoifung Poon and
Tao Qin and
Naoto Usuyama and
Chris White and
Eric Horvitz},
title = {Can Generalist Foundation Models Outcompete Special-Purpose Tuning?
Case Study in Medicine},
journal = {CoRR},
volume = {abs/2311.16452},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.16452},
doi = {10.48550/ARXIV.2311.16452},
eprinttype = {arXiv},
eprint = {2311.16452},
timestamp = {Wed, 19 Jun 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-16452.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jossw/KhannaLSMAKLDWW22,
author = {Ajay Khanna and
David E. Larson and
Srivatsan Sridhar and
Matthew Mosior and
Travis E. Abbott and
Susanna Kiwala and
Timothy J. Ley and
Eric J. Duncavage and
Matthew J. Walter and
Jason R. Walker and
Obi L. Griffith and
Malachi Griffith and
Christopher A. Miller},
title = {Bam-readcount - rapid generation of basepair-resolution sequence metrics},
journal = {J. Open Source Softw.},
volume = {7},
number = {69},
pages = {3722},
year = {2022},
url = {https://doi.org/10.21105/joss.03722},
doi = {10.21105/JOSS.03722},
timestamp = {Fri, 04 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jossw/KhannaLSMAKLDWW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/SunRHLBOCXTCDJS22,
author = {Delin Sun and
Gopalkumar Rakesh and
Courtney C. Haswell and
Mark W. Logue and
C. Lexi Baird and
Erin O'Leary and
Andrew S. Cotton and
Hong Xie and
Marijo B. Tamburrino and
Tian Chen and
Emily L. Dennis and
Neda Jahanshad and
Lauren E. Salminen and
Sophia I. Thomopoulos and
Faisal Rashid and
Christopher R. K. Ching and
Saskia B. J. Koch and
Jessie L. Frijling and
Laura Nawijn and
Mirjam van Zuiden and
Xi Zhu and
Benjamin Suarez{-}Jimenez and
Anika Sierk and
Henrik Walter and
Antje Manthey and
Jennifer S. Stevens and
Negar Fani and
Sanne J. H. van Rooij and
Murray B. Stein and
Jessica Bomyea and
Inga Koerte and
Kyle Choi and
Steven J. A. van der Werff and
Robert R. J. M. Vermeiren and
Julia Herzog and
Lauren A. M. Lebois and
Justin T. Baker and
Elizabeth A. Olson and
Thomas Straube and
Mayuresh S. Korgaonkar and
Elpiniki Andrew and
Ye Zhu and
Gen Li and
Jonathan Ipser and
Anna R. Hudson and
Matthew Peverill and
Kelly A. Sambrook and
Evan Gordon and
Lee Baugh and
Gina L. Forster and
Raluca M. Simons and
Jeffrey S. Simons and
Vincent Magnotta and
Adi Maron{-}Katz and
Stefan du Plessis and
Seth G. Disner and
Nicholas D. Davenport and
Daniel W. Grupe and
Jack B. Nitschke and
Terri A. deRoon{-}Cassini and
Jacklynn M. Fitzgerald and
John H. Krystal and
Ifat Levy and
Miranda Olff and
Dick J. Veltman and
Li Wang and
Yuval Neria and
Michael D. De Bellis and
Tanja Jovanovic and
Judith K. Daniels and
Martha Shenton and
Nic J. A. van der Wee and
Christian Schmahl and
Milissa L. Kaufman and
Isabelle M. Rosso and
Scott R. Sponheim and
David Bernd Hofmann and
Richard A. Bryant and
Kelene A. Fercho and
Dan J. Stein and
Sven C. Mueller and
Bobak Hosseini and
K. Luan Phan and
Katie A. McLaughlin and
Richard J. Davidson and
Christine L. Larson and
Geoffrey May and
Steven M. Nelson and
Chadi G. Abdallah and
Hassaan Gomaa and
Amit Etkin and
Zelekha A. Seedat and
Ilan Harpaz{-}Rotem and
Israel Liberzon and
Theo G. M. van Erp and
Yann Quid{\'{e}} and
Xin Wang and
Paul M. Thompson and
Rajendra A. Morey},
title = {A comparison of methods to harmonize cortical thickness measurements
across scanners and sites},
journal = {NeuroImage},
volume = {261},
pages = {119509},
year = {2022},
url = {https://doi.org/10.1016/j.neuroimage.2022.119509},
doi = {10.1016/J.NEUROIMAGE.2022.119509},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/SunRHLBOCXTCDJS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/DimopoulosCVWLFI22,
author = {Evangelos A. Dimopoulos and
Alberto Carmagnini and
Irina M. Velsko and
Christina Warinner and
Greger Larson and
Laurent A. F. Frantz and
Evan K. Irving{-}Pease},
title = {{HAYSTAC:} {A} Bayesian framework for robust and rapid species identification
in high-throughput sequencing data},
journal = {PLoS Comput. Biol.},
volume = {18},
number = {9},
pages = {1010493},
year = {2022},
url = {https://doi.org/10.1371/journal.pcbi.1010493},
doi = {10.1371/JOURNAL.PCBI.1010493},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/DimopoulosCVWLFI22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/siamjo/KirchesLLM22,
author = {Christian Kirches and
Jeffrey Larson and
Sven Leyffer and
Paul Manns},
title = {Sequential Linearization Method for Bound-Constrained Mathematical
Programs with Complementarity Constraints},
journal = {{SIAM} J. Optim.},
volume = {32},
number = {1},
pages = {75--99},
year = {2022},
url = {https://doi.org/10.1137/20m1370501},
doi = {10.1137/20M1370501},
timestamp = {Mon, 25 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/siamjo/KirchesLLM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/KolpukeSAARPLLT22,
author = {Shriniwas Kolpuke and
Christopher D. Simpson and
Feras Abushakra and
Abhishek Kumar Awasthi and
Omid Reyhanigalangashi and
Jacob Pierce and
Tuan Luong and
Jordan D. Larson and
Drew Taylor and
David Braaten and
Sivaprasad Gogineni},
title = {Airborne {UWB} {FMCW} Radar for Snow Depth Measurements},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {60},
pages = {1--15},
year = {2022},
url = {https://doi.org/10.1109/TGRS.2022.3223989},
doi = {10.1109/TGRS.2022.3223989},
timestamp = {Sun, 25 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tgrs/KolpukeSAARPLLT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/HauschildtGLSLM22,
author = {Jenny Hauschildt and
Rachel Gold and
Kristin Lyon{-}Scott and
Christina Sheppler and
Annie Larson and
Carmit McMullen and
David Boston and
Patrick J. O'Connor and
JoAnn M. Sperl{-}Hillen},
title = {Multi-level factors associated with use of an EHR-based shared-decision
making system for cardiovascular disease risk in community health
centers},
booktitle = {{AMIA} 2022, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 5-9, 2022},
publisher = {{AMIA}},
year = {2022},
url = {https://knowledge.amia.org/76677-amia-1.4637602/f007-1.4641746/f007-1.4641747/336-1.4642033/54-1.4642030},
timestamp = {Wed, 17 Apr 2024 11:46:45 +0200},
biburl = {https://dblp.org/rec/conf/amia/HauschildtGLSLM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/AbelPLOT22,
author = {Christie Abel and
Lucy Pei and
Ian Larson and
Benedict Salazar Olgado and
Benedict Turner},
title = {"Tinder Will Know You Are {A} 6": Users' Perceptions of Algorithms
on Tinder},
booktitle = {55th Hawaii International Conference on System Sciences, {HICSS} 2022,
Virtual Event / Maui, Hawaii, USA, January 4-7, 2022},
pages = {1--10},
publisher = {ScholarSpace},
year = {2022},
url = {http://hdl.handle.net/10125/79685},
timestamp = {Wed, 11 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hicss/AbelPLOT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iticse/GannonG0WSAG22,
author = {Ashley Gannon and
Mohsen Gavahi and
Xin Yuan and
David B. Whalley and
Sherry A. Southerland and
Christine Andrews{-}Larson and
Ellen Granger},
editor = {Brett A. Becker and
Keith Quille and
Mikko{-}Jussi Laakso and
Erik Barendsen and
Simon},
title = {Experience with Integrating Computer Science in Middle School Mathematics},
booktitle = {ITiCSE 2022: Innovation and Technology in Computer Science Education,
Dublin, Ireland, July 8 - 13, 2022, Volume 1},
pages = {40--46},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3502718.3524787},
doi = {10.1145/3502718.3524787},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iticse/GannonG0WSAG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/AppelhoffSBVQHCMTHWBRLL22,
author = {Stefan Appelhoff and
Matthew Sanderson and
Teon L. Brooks and
Marijn van Vliet and
Romain Quentin and
Chris Holdgraf and
Maximilien Chaumon and
Ezequiel Mikulan and
Kambiz Tavabi and
Richard H{\"{o}}chenberger and
Dominik Welke and
Clemens Brunner and
Alexander Rockhill and
Eric Larson and
Adam Li and
Alexandre Gramfort and
Mainak Jas},
title = {{MNE-BIDS:} Organizing electrophysiological data into the {BIDS} format
and facilitating their analysis (Version v0.10)},
publisher = {Zenodo},
year = {2022},
month = mar,
howpublished = {\url{https://doi.org/10.5281/zenodo.6359371}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.6359371},
doi = {10.5281/ZENODO.6359371},
timestamp = {Fri, 11 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/AppelhoffSBVQHCMTHWBRLL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-10836,
author = {Sarthak Pati and
Ujjwal Baid and
Brandon Edwards and
Micah J. Sheller and
Hans Shih{-}Han Wang and
G. Anthony Reina and
Patrick Foley and
Alexey Gruzdev and
Deepthi Karkada and
Christos Davatzikos and
Chiharu Sako and
Satyam Ghodasara and
Michel Bilello and
Suyash Mohan and
Philipp Vollmuth and
Gianluca Brugnara and
Chandrakanth J. Preetha and
Felix Sahm and
Klaus H. Maier{-}Hein and
Maximilian Zenk and
Martin Bendszus and
Wolfgang Wick and
Evan Calabrese and
Jeffrey D. Rudie and
Javier E. Villanueva{-}Meyer and
Soonmee Cha and
Madhura Ingalhalikar and
Manali Jadhav and
Umang Pandey and
Jitender Saini and
John Garrett and
Matthew Larson and
Robert Jeraj and
Stuart Currie and
Russell Frood and
Kavi Fatania and
Raymond Y. Huang and
Ken Chang and
Carmen Bala{\~{n}}a Quintero and
Jaume Capellades and
Josep Puig and
Johannes Trenkler and
Josef Pichler and
Georg Necker and
Andreas Haunschmidt and
Stephan Meckel and
Gaurav Shukla and
Spencer Liem and
Gregory S. Alexander and
et al.},
title = {Federated Learning Enables Big Data for Rare Cancer Boundary Detection},
journal = {CoRR},
volume = {abs/2204.10836},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2204.10836},
doi = {10.48550/ARXIV.2204.10836},
eprinttype = {arXiv},
eprint = {2204.10836},
timestamp = {Mon, 25 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2204-10836.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-01917,
author = {David Cornett III and
Joel Brogan and
Nell Barber and
Deniz Aykac and
Seth T. Baird and
Nick Burchfield and
Carl Dukes and
Andrew Duncan and
Regina Ferrell and
Jim Goddard and
Gavin Jager and
Matt Larson and
Bart Murphy and
Christi Johnson and
Ian Shelley and
Nisha Srinivas and
Brandon Stockwell and
Leanne Thompson and
Matt Yohe and
Robert Zhang and
Scott Dolvin and
Hector J. Santos{-}Villalobos and
David S. Bolme},
title = {Expanding Accurate Person Recognition to New Altitudes and Ranges:
The {BRIAR} Dataset},
journal = {CoRR},
volume = {abs/2211.01917},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.01917},
doi = {10.48550/ARXIV.2211.01917},
eprinttype = {arXiv},
eprint = {2211.01917},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-01917.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-03540,
author = {Samuel R. Bowman and
Jeeyoon Hyun and
Ethan Perez and
Edwin Chen and
Craig Pettit and
Scott Heiner and
Kamile Lukosiute and
Amanda Askell and
Andy Jones and
Anna Chen and
Anna Goldie and
Azalia Mirhoseini and
Cameron McKinnon and
Christopher Olah and
Daniela Amodei and
Dario Amodei and
Dawn Drain and
Dustin Li and
Eli Tran{-}Johnson and
Jackson Kernion and
Jamie Kerr and
Jared Mueller and
Jeffrey Ladish and
Joshua Landau and
Kamal Ndousse and
Liane Lovitt and
Nelson Elhage and
Nicholas Schiefer and
Nicholas Joseph and
Noem{\'{\i}} Mercado and
Nova DasSarma and
Robin Larson and
Sam McCandlish and
Sandipan Kundu and
Scott Johnston and
Shauna Kravec and
Sheer El Showk and
Stanislav Fort and
Timothy Telleen{-}Lawton and
Tom Brown and
Tom Henighan and
Tristan Hume and
Yuntao Bai and
Zac Hatfield{-}Dodds and
Ben Mann and
Jared Kaplan},
title = {Measuring Progress on Scalable Oversight for Large Language Models},
journal = {CoRR},
volume = {abs/2211.03540},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.03540},
doi = {10.48550/ARXIV.2211.03540},
eprinttype = {arXiv},
eprint = {2211.03540},
timestamp = {Tue, 15 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-03540.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-08073,
author = {Yuntao Bai and
Saurav Kadavath and
Sandipan Kundu and
Amanda Askell and
Jackson Kernion and
Andy Jones and
Anna Chen and
Anna Goldie and
Azalia Mirhoseini and
Cameron McKinnon and
Carol Chen and
Catherine Olsson and
Christopher Olah and
Danny Hernandez and
Dawn Drain and
Deep Ganguli and
Dustin Li and
Eli Tran{-}Johnson and
Ethan Perez and
Jamie Kerr and
Jared Mueller and
Jeffrey Ladish and
Joshua Landau and
Kamal Ndousse and
Kamile Lukosiute and
Liane Lovitt and
Michael Sellitto and
Nelson Elhage and
Nicholas Schiefer and
Noem{\'{\i}} Mercado and
Nova DasSarma and
Robert Lasenby and
Robin Larson and
Sam Ringer and
Scott Johnston and
Shauna Kravec and
Sheer El Showk and
Stanislav Fort and
Tamera Lanham and
Timothy Telleen{-}Lawton and
Tom Conerly and
Tom Henighan and
Tristan Hume and
Samuel R. Bowman and
Zac Hatfield{-}Dodds and
Ben Mann and
Dario Amodei and
Nicholas Joseph and
Sam McCandlish and
Tom Brown and
Jared Kaplan},
title = {Constitutional {AI:} Harmlessness from {AI} Feedback},
journal = {CoRR},
volume = {abs/2212.08073},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.08073},
doi = {10.48550/ARXIV.2212.08073},
eprinttype = {arXiv},
eprint = {2212.08073},
timestamp = {Mon, 02 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-08073.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-09251,
author = {Ethan Perez and
Sam Ringer and
Kamile Lukosiute and
Karina Nguyen and
Edwin Chen and
Scott Heiner and
Craig Pettit and
Catherine Olsson and
Sandipan Kundu and
Saurav Kadavath and
Andy Jones and
Anna Chen and
Ben Mann and
Brian Israel and
Bryan Seethor and
Cameron McKinnon and
Christopher Olah and
Da Yan and
Daniela Amodei and
Dario Amodei and
Dawn Drain and
Dustin Li and
Eli Tran{-}Johnson and
Guro Khundadze and
Jackson Kernion and
James Landis and
Jamie Kerr and
Jared Mueller and
Jeeyoon Hyun and
Joshua Landau and
Kamal Ndousse and
Landon Goldberg and
Liane Lovitt and
Martin Lucas and
Michael Sellitto and
Miranda Zhang and
Neerav Kingsland and
Nelson Elhage and
Nicholas Joseph and
Noem{\'{\i}} Mercado and
Nova DasSarma and
Oliver Rausch and
Robin Larson and
Sam McCandlish and
Scott Johnston and
Shauna Kravec and
Sheer El Showk and
Tamera Lanham and
Timothy Telleen{-}Lawton and
Tom Brown and
Tom Henighan and
Tristan Hume and
Yuntao Bai and
Zac Hatfield{-}Dodds and
Jack Clark and
Samuel R. Bowman and
Amanda Askell and
Roger Grosse and
Danny Hernandez and
Deep Ganguli and
Evan Hubinger and
Nicholas Schiefer and
Jared Kaplan},
title = {Discovering Language Model Behaviors with Model-Written Evaluations},
journal = {CoRR},
volume = {abs/2212.09251},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.09251},
doi = {10.48550/ARXIV.2212.09251},
eprinttype = {arXiv},
eprint = {2212.09251},
timestamp = {Mon, 02 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-09251.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/RichessonMDSHDB21,
author = {Rachel L. Richesson and
Keith A. Marsolo and
Brian J. Douthit and
Karen L. Staman and
P. Michael Ho and
Dana L. Dailey and
Andrew D. Boyd and
Kathleen McTigue and
Miriam O. Ezenwa and
Judith M. Schlaeger and
Crystal L. Patil and
Keturah R. Faurot and
Leah Tuzzio and
Eric B. Larson and
Emily C. O'Brien and
Christina K. Zigler and
Joshua R. Lakin and
Alice R. Pressman and
Jordan M. Braciszewski and
Corita R. Grudzen and
Guilherme Del Fiol},
title = {Enhancing the use of {EHR} systems for pragmatic embedded research:
lessons from the {NIH} Health Care Systems Research Collaboratory},
journal = {J. Am. Medical Informatics Assoc.},
volume = {28},
number = {12},
pages = {2626--2640},
year = {2021},
url = {https://doi.org/10.1093/jamia/ocab202},
doi = {10.1093/JAMIA/OCAB202},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/RichessonMDSHDB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/JohnsonCDSWAHMW21,
author = {Sarah Charlotte Johnson and
Matthew Cunningham and
Ilse N. Dippenaar and
Fablina Sharara and
Eve E. Wool and
Kareha M. Agesa and
Chieh Han and
Molly K. Miller{-}Petrie and
Shadrach Wilson and
John E. Fuller and
Shelly Balassyano and
Gregory J. Bertolacci and
Nicole Davis Weaver and
Jalal Arabloo and
Alaa Badawi and
Akshaya Srikanth Bhagavathula and
Katrin Burkart and
Luis Alberto C{\'{a}}mera and
Felix Carvalho and
Carlos A. Casta{\~{n}}eda{-}Orjuela and
Jee{-}Young Jasmine Choi and
Dinh{-}Toi Chu and
Xiaochen Dai and
Mostafa Dianatinasab and
Sophia Emmons{-}Bell and
Eduarda Fernandes and
Florian Fischer and
Ahmad Ghashghaee and
Mahaveer Golechha and
Simon I. Hay and
Khezar Hayat and
Nathaniel J. Henry and
Ramesh Holla and
Mowafa S. Househ and
Segun Emmanuel Ibitoye and
Maryam Keramati and
Ejaz Ahmad Khan and
Yun Jin Kim and
Adnan Kisa and
Hamidreza Komaki and
Ai Koyanagi and
Samantha Leigh Larson and
Kate E. LeGrand and
Xuefeng Liu and
Azeem Majeed and
Reza Malekzadeh and
Bahram Mohajer and
Abdollah Mohammadian{-}Hafshejani and
Reza Mohammadpourhodki and
Shafiu Mohammed and
Farnam Mohebi and
Ali H. Mokdad and
Mariam Molokhia and
Lorenzo Monasta and
Mohammad Ali Moni and
Muhammad Naveed and
Thi Lan Huong Nguyen and
Andrew T. Olagunju and
Samuel M. Ostroff and
Fatemeh Pashazadeh Kan and
David M. Pereira and
Quang Pham Hai and
Salman Rawaf and
David Laith Rawaf and
Andre M. N. Renzaho and
Luca Ronfani and
Abdallah M. Samy and
Subramanian Senthilkumaran and
Sadaf G. Sepanlou and
Masood Ali Shaikh and
David H. Shaw and
Kenji Shibuya and
Jasvinder A. Singh and
Valentin Yurievich Skryabin and
Anna Aleksandrovna Skryabina and
Emma Elizabeth Spurlock and
Eyayou Girma Tadesse and
Mohamad{-}Hani Temsah and
Marcos Roberto Tovani{-}Palone and
Tran Xuan Bach and
Gebiyaw Wudie Tsegaye and
Pascual R. Valdez and
Prashant M. Vishwanath and
Giang Thu Vu and
Yasir Waheed and
Naohiro Yonemoto and
Rafael Lozano and
Alan D. Lopez and
Christopher J. L. Murray and
Mohsen Naghavi},
title = {Public health utility of cause of death data: applying empirical algorithms
to improve data quality},
journal = {{BMC} Medical Informatics Decis. Mak.},
volume = {21},
number = {1},
pages = {175},
year = {2021},
url = {https://doi.org/10.1186/s12911-021-01501-1},
doi = {10.1186/S12911-021-01501-1},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/midm/JohnsonCDSWAHMW21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/BaileyMBCCMLML21,
author = {Bruce W. Bailey and
Alexandra M. Muir and
Ciera L. Bartholomew and
William F. Christensen and
Kaylie A. Carbine and
Harrison Marsh and
Hunter LaCouture and
Chance McCutcheon and
Michael J. Larson},
title = {The impact of exercise intensity on neurophysiological indices of
food-related inhibitory control and cognitive control: {A} randomized
crossover event-related potential {(ERP)} study},
journal = {NeuroImage},
volume = {237},
pages = {118162},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2021.118162},
doi = {10.1016/J.NEUROIMAGE.2021.118162},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/BaileyMBCCMLML21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/HugginsWPBML21,
author = {Ashley A. Huggins and
Carissa N. Weis and
Elizabeth A. Parisi and
Kenneth P. Bennett and
Vladimir Miskovic and
Christine L. Larson},
title = {Neural substrates of human fear generalization: {A} 7T-fMRI investigation},
journal = {NeuroImage},
volume = {239},
pages = {118308},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2021.118308},
doi = {10.1016/J.NEUROIMAGE.2021.118308},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/HugginsWPBML21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/OReillyLRE21,
author = {Christian O'Reilly and
Eric Larson and
John E. Richards and
Mayada Elsabbagh},
title = {Structural templates for imaging {EEG} cortical sources in infants},
journal = {NeuroImage},
volume = {227},
pages = {117682},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2020.117682},
doi = {10.1016/J.NEUROIMAGE.2020.117682},
timestamp = {Tue, 01 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/OReillyLRE21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/WeisWHKMFBKdL21,
author = {Carissa N. Weis and
Elisabeth K. Webb and
Ashley A. Huggins and
Madeline Kallenbach and
T. A. Miskovich and
Jacklynn M. Fitzgerald and
Kenneth P. Bennett and
Jessica L. Krukowski and
Terri A. deRoon{-}Cassini and
Christine L. Larson},
title = {Stability of hippocampal subfield volumes after trauma and relationship
to development of {PTSD} symptoms},
journal = {NeuroImage},
volume = {236},
pages = {118076},
year = {2021},
url = {https://doi.org/10.1016/j.neuroimage.2021.118076},
doi = {10.1016/J.NEUROIMAGE.2021.118076},
timestamp = {Wed, 31 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/neuroimage/WeisWHKMFBKdL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/ZuidemaSACLSZGS21,
author = {Christopher Zuidema and
Cooper S. Schumacher and
Elena Austin and
Graeme Carvlin and
Timothy V. Larson and
Elizabeth W. Spalt and
Marina Zusman and
Amanda J. Gassett and
Edmund Y. W. Seto and
Joel D. Kaufman and
Lianne Sheppard},
title = {Deployment, Calibration, and Cross-Validation of Low-Cost Electrochemical
Sensors for Carbon Monoxide, Nitrogen Oxides, and Ozone for an Epidemiological
Study},
journal = {Sensors},
volume = {21},
number = {12},
pages = {4214},
year = {2021},
url = {https://doi.org/10.3390/s21124214},
doi = {10.3390/S21124214},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/ZuidemaSACLSZGS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/GoldOLSBCSMRHA21,
author = {Rachel Gold and
Patrick J. O'Connor and
Annie Larson and
JoAnn M. Sperl{-}Hillen and
Dave Boston and
A. Lauren Crain and
Christina Sheppler and
Mary Middendorf and
Ann Romer and
John Heintzman and
Deepika Appana},
title = {Impact of a Clinical Decision Support Tool for Cardiovascular Preventive
Care in Community Health Centers: Randomized Trial Results},
booktitle = {{AMIA} 2021, American Medical Informatics Association Annual Symposium,
San Diego, CA, USA, October 30, 2021 - November 3, 2021},
publisher = {{AMIA}},
year = {2021},
url = {https://knowledge.amia.org/74229-amia-1.4622266/t004-1.4626008/t004-1.4626009/3632475-1.4626331/3576203-1.4626328},
timestamp = {Wed, 17 Apr 2024 11:46:53 +0200},
biburl = {https://dblp.org/rec/conf/amia/GoldOLSBCSMRHA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/JaskieLJTOCRS21,
author = {Kristen Jaskie and
Jean S. Larson and
Milton Johnson and
Kathy Turner and
Megan O'Donnell and
Jennifer Blain Christen and
Sunil Rao and
Andreas Spanias},
title = {Research Experiences for Teachers in Machine Learning},
booktitle = {{IEEE} Frontiers in Education Conference, {FIE} 2021, Lincoln, NE,
USA, October 13-16, 2021},
pages = {1--5},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/FIE49875.2021.9637132},
doi = {10.1109/FIE49875.2021.9637132},
timestamp = {Wed, 29 Dec 2021 09:45:46 +0100},
biburl = {https://dblp.org/rec/conf/fie/JaskieLJTOCRS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/AppelhoffSBVQHCMTHWBRLL21,
author = {Stefan Appelhoff and
Matthew Sanderson and
Teon Brooks and
Marijn van Vliet and
Romain Quentin and
Chris Holdgraf and
Maximilien Chaumon and
Ezequiel Mikulan and
Kambiz Tavabi and
Richard H{\"{o}}chenberger and
Dominik Welke and
Clemens Brunner and
Alexander Rockhill and
Eric Larson and
Adam Li and
Alexandre Gramfort and
Mainak Jas},
title = {{MNE-BIDS:} Organizing electrophysiological data into the {BIDS} format
and facilitating their analysis (Version v0.7)},
publisher = {Zenodo},
year = {2021},
month = mar,
howpublished = {\url{https://doi.org/10.5281/zenodo.4626781}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.4626781},
doi = {10.5281/ZENODO.4626781},
timestamp = {Mon, 30 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/AppelhoffSBVQHCMTHWBRLL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/AppelhoffSBVQHCMTHWBRLL21a,
author = {Stefan Appelhoff and
Matthew Sanderson and
Teon L. Brooks and
Marijn van Vliet and
Romain Quentin and
Chris Holdgraf and
Maximilien Chaumon and
Ezequiel Mikulan and
Kambiz Tavabi and
Richard H{\"{o}}chenberger and
Dominik Welke and
Clemens Brunner and
Alexander Rockhill and
Eric Larson and
Adam Li and
Alexandre Gramfort and
Mainak Jas},
title = {{MNE-BIDS:} Organizing electrophysiological data into the {BIDS} format
and facilitating their analysis (Version v0.8)},
publisher = {Zenodo},
year = {2021},
month = jul,
howpublished = {\url{https://doi.org/10.5281/zenodo.5105671}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.5105671},
doi = {10.5281/ZENODO.5105671},
timestamp = {Tue, 01 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/AppelhoffSBVQHCMTHWBRLL21a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/AppelhoffSBVQHCMTHWBRLL21b,
author = {Stefan Appelhoff and
Matthew Sanderson and
Teon L. Brooks and
Marijn van Vliet and
Romain Quentin and
Chris Holdgraf and
Maximilien Chaumon and
Ezequiel Mikulan and
Kambiz Tavabi and
Richard H{\"{o}}chenberger and
Dominik Welke and
Clemens Brunner and
Alexander Rockhill and
Eric Larson and
Adam Li and
Alexandre Gramfort and
Mainak Jas},
title = {{MNE-BIDS:} Organizing electrophysiological data into the {BIDS} format
and facilitating their analysis (Version v0.9)},
publisher = {Zenodo},
year = {2021},
month = nov,
howpublished = {\url{https://doi.org/10.5281/zenodo.5720702}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.5720702},
doi = {10.5281/ZENODO.5720702},
timestamp = {Tue, 08 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/AppelhoffSBVQHCMTHWBRLL21b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-13243,
author = {Brennan Saeta and
Denys Shabalin and
Marc Rasi and
Brad Larson and
Xihui Wu and
Parker Schuh and
Michelle Casbon and
Daniel Zheng and
Saleem Abdulrasool and
Aleksandr Efremov and
Dave Abrahams and
Chris Lattner and
Richard Wei},
title = {Swift for TensorFlow: {A} portable, flexible platform for deep learning},
journal = {CoRR},
volume = {abs/2102.13243},
year = {2021},
url = {https://arxiv.org/abs/2102.13243},
eprinttype = {arXiv},
eprint = {2102.13243},
timestamp = {Tue, 02 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2102-13243.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-08878,
author = {Vivek Kurien George and
Vikash Morar and
Weiwei Yang and
Jonathan Larson and
Bryan Tower and
Shweti Mahajan and
Arkin Gupta and
Christopher M. White and
Gabriel A. Silva},
title = {Learning without gradient descent encoded by the dynamics of a neurobiological
model},
journal = {CoRR},
volume = {abs/2103.08878},
year = {2021},
url = {https://arxiv.org/abs/2103.08878},
eprinttype = {arXiv},
eprint = {2103.08878},
timestamp = {Tue, 23 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2103-08878.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2104-00641,
author = {Jonathan Larson and
Tiona Zuzul and
Emily Cox Pahnke and
Neha Parikh Shah and
Patrick Bourke and
Nicholas Caurvina and
Fereshteh Amini and
Youngser Park and
Joshua T. Vogelstein and
Jeffrey Weston and
Christopher M. White and
Carey E. Priebe},
title = {Dynamic Silos: Modularity in intra-organizational communication networks
before and during the Covid-19 pandemic},
journal = {CoRR},
volume = {abs/2104.00641},
year = {2021},
url = {https://arxiv.org/abs/2104.00641},
eprinttype = {arXiv},
eprint = {2104.00641},
timestamp = {Tue, 13 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2104-00641.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/ClarkVBBYBGLSSM20,
author = {Lara P. Clark and
Sreekanth Vakacherla and
Bujin Bekbulat and
Michael Baum and
Songlin Yang and
Pao Baylon and
Timothy R. Gould and
Timothy V. Larson and
Edmund Y. W. Seto and
Chris D. Space and
Julian D. Marshall},
title = {Developing a Low-Cost Passive Method for Long-Term Average Levels
of Light-Absorbing Carbon Air Pollution in Polluted Indoor Environments},
journal = {Sensors},
volume = {20},
number = {12},
pages = {3417},
year = {2020},
url = {https://doi.org/10.3390/s20123417},
doi = {10.3390/S20123417},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sensors/ClarkVBBYBGLSSM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/LarsonIFTDBKMNS20,
author = {Jonathan Larson and
Paul Isihara and
Gabriel Flores and
Edwin Townsend and
Danilo R. Diedrichs and
Christy Baars and
Steven Kwon and
Will McKinnon and
Joseph Nussbaum and
Carrie Steggerda and
Joyce Yan},
title = {A priori assessment of a smart-navigated unmanned aerial vehicle disaster
cargo fleet},
journal = {Simul.},
volume = {96},
number = {8},
year = {2020},
url = {https://doi.org/10.1177/0037549720921447},
doi = {10.1177/0037549720921447},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/simulation/LarsonIFTDBKMNS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/EvansELW20,
author = {Nathan Evans and
Darren Edge and
Jonathan Larson and
Christopher M. White},
editor = {Regina Bernhaupt and
Florian 'Floyd' Mueller and
David Verweij and
Josh Andres and
Joanna McGrenere and
Andy Cockburn and
Ignacio Avellino and
Alix Goguey and
Pernille Bj{\o}n and
Shengdong Zhao and
Briane Paul Samson and
Rafal Kocielnik},
title = {News Provenance: Revealing News Text Reuse at Web-Scale in an Augmented
News Search Experience},
booktitle = {Extended Abstracts of the 2020 {CHI} Conference on Human Factors in
Computing Systems, {CHI} 2020, Honolulu, HI, USA, April 25-30, 2020},
pages = {1--8},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3334480.3375225},
doi = {10.1145/3334480.3375225},
timestamp = {Wed, 12 Jun 2024 07:39:18 +0200},
biburl = {https://dblp.org/rec/conf/chi/EvansELW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/LarsonEEW20,
author = {Jonathan Larson and
Darren Edge and
Nathan Evans and
Christopher M. White},
editor = {Regina Bernhaupt and
Florian 'Floyd' Mueller and
David Verweij and
Josh Andres and
Joanna McGrenere and
Andy Cockburn and
Ignacio Avellino and
Alix Goguey and
Pernille Bj{\o}n and
Shengdong Zhao and
Briane Paul Samson and
Rafal Kocielnik},
title = {Making Sense of Search: Using Graph Embedding and Visualization to
Transform Query Understanding},
booktitle = {Extended Abstracts of the 2020 {CHI} Conference on Human Factors in
Computing Systems, {CHI} 2020, Honolulu, HI, USA, April 25-30, 2020},
pages = {1--8},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3334480.3375233},
doi = {10.1145/3334480.3375233},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/chi/LarsonEEW20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/TaylorYOGGALEKL20,
author = {Drew Taylor and
Stephen Yan and
Charles R. O'Neill and
Prasad Gogineni and
Sevgi Zubeyde Gurbuz and
Barbaros Aslan and
Jordan D. Larson and
Deepak Elluru and
Shriniwas Kolpuke and
Linfeng Li and
Farin Mahjabeen and
Joshua Nunn and
Mahbubur Rahman and
Omid Reyhani and
Christopher D. Simpson and
Ryan Thomas and
Shashank Wattal and
Jonathan Blake and
Carter Boyle and
John Glidden and
MacKenzie Higgs},
title = {Airborne Dual-Band Microwave Radar System for Snow Thickness Measurement},
booktitle = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
2020, Waikoloa, HI, USA, September 26 - October 2, 2020},
pages = {2934--2937},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/IGARSS39084.2020.9323958},
doi = {10.1109/IGARSS39084.2020.9323958},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/igarss/TaylorYOGGALEKL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/AppelhoffSBVQHCMTHWBRLG20,
author = {Stefan Appelhoff and
Matthew Sanderson and
Teon Brooks and
Marijn van Vliet and
Romain Quentin and
Chris Holdgraf and
Maximilien Chaumon and
Ezequiel Mikulan and
Kambiz Tavabi and
Richard H{\"{o}}chenberger and
Dominik Welke and
Clemens Brunner and
Alexander Rockhill and
Eric Larson and
Alexandre Gramfort and
Mainak Jas},
title = {{MNE-BIDS:} Organizing electrophysiological data into the {BIDS} format
and facilitating their analysis (Version v0.4)},
publisher = {Zenodo},
year = {2020},
month = apr,
howpublished = {\url{https://doi.org/10.5281/zenodo.3739558}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.3739558},
doi = {10.5281/ZENODO.3739558},
timestamp = {Tue, 17 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/AppelhoffSBVQHCMTHWBRLG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/AppelhoffSBVQHCMTHWBRLL20,
author = {Stefan Appelhoff and
Matthew Sanderson and
Teon Brooks and
Marijn van Vliet and
Romain Quentin and
Chris Holdgraf and
Maximilien Chaumon and
Ezequiel Mikulan and
Kambiz Tavabi and
Richard H{\"{o}}chenberger and
Dominik Welke and
Clemens Brunner and
Alexander Rockhill and
Eric Larson and
Adam Li and
Alexandre Gramfort and
Mainak Jas},
title = {{MNE-BIDS:} Organizing electrophysiological data into the {BIDS} format
and facilitating their analysis (Version v0.5)},
publisher = {Zenodo},
year = {2020},
month = oct,
howpublished = {\url{https://doi.org/10.5281/zenodo.4117895}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.4117895},
doi = {10.5281/ZENODO.4117895},
timestamp = {Fri, 27 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/AppelhoffSBVQHCMTHWBRLL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/AppelhoffSBVQHCMTHWBRLL20a,
author = {Stefan Appelhoff and
Matthew Sanderson and
Teon Brooks and
Marijn van Vliet and
Romain Quentin and
Chris Holdgraf and
Maximilien Chaumon and
Ezequiel Mikulan and
Kambiz Tavabi and
Richard H{\"{o}}chenberger and
Dominik Welke and
Clemens Brunner and
Alexander Rockhill and
Eric Larson and
Adam Li and
Alexandre Gramfort and
Mainak Jas},
title = {{MNE-BIDS:} Organizing electrophysiological data into the {BIDS} format
and facilitating their analysis (Version v0.6)},
publisher = {Zenodo},
year = {2020},
month = dec,
howpublished = {\url{https://doi.org/10.5281/zenodo.4328374}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.4328374},
doi = {10.5281/ZENODO.4328374},
timestamp = {Fri, 27 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/AppelhoffSBVQHCMTHWBRLL20a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/BrettMHCCMCHCGLWGLKRMMM20,
author = {Matthew Brett and
Christopher J. Markiewicz and
Michael Hanke and
Marc{-}Alexandre C{\^{o}}t{\'{e}} and
Ben Cipollini and
Paul McCarthy and
Christopher P. Cheng and
Yaroslav O. Halchenko and
Michiel Cottaar and
Satrajit S. Ghosh and
Eric Larson and
Demian Wassermann and
Stephan Gerhard and
Gregory R. Lee and
Erik K. Kastman and
Ariel Rokem and
Cindee Madison and
F{\'{e}}lix C. Morency and
Brendan Moloney and
Mathias Goncalves and
Christopher Burns and
Jarrod Millman and
Alexandre Gramfort and
Jaakko Lepp{\"{a}}kangas and
Ross Markello and
Jasper J. F. van den Bosch and
Robert D. Vincent and
Krish Subramaniam and
Pradeep Reddy Raamana and
B. Nolan Nichols and
Eric M. Baker and
Soichi Hayashi and
Basile Pinsard and
Christian Haselgrove and
Mark Hymers and
Serge Koudoro and
Nikolaas N. Oosterhof and
Bago Amirbekian and
Ian Nimmo{-}Smith and
Ly Nguyen and
Samir Reddigari and
Samuel St{-}Jean and
Eleftherios Garyfallidis and
Ga{\"{e}}l Varoquaux and
Jakub Kaczmarzyk and
Jon Haitz Legarreta and
Kevin S. Hahn and
Oliver Hinds and
Bennet Fauber and
Egor Panfilov and
Henry Braun and
Jean{-}Baptiste Poline and
Jon Stutters and
Kesshi Jordan and
Matthew Cieslak and
Miguel Estevan Moreno and
Valentin Haenel and
Yannick Schwartz and
Bertrand Thirion and
Dimitri Papadopoulos Orfanos and
Fernando P{\'{e}}rez{-}Garc{\'{\i}}a and
Igor Solovey and
Ivan Gonzalez and
Jath Palasubramaniam and
Justin Lecher and
Katrin Leinweber and
Konstantinos Raktivan and
Peter Fischer and
Philippe Gervais and
Syam Gadde and
Thomas Ballinger and
Thomas Roos and
Venkateswara Reddy Reddam and
freec84},
title = {nipy/nibabel: 2.5.2 (Version 2.5.2)},
publisher = {Zenodo},
year = {2020},
month = apr,
howpublished = {\url{https://doi.org/10.5281/zenodo.3745545}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.3745545},
doi = {10.5281/ZENODO.3745545},
timestamp = {Tue, 01 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/BrettMHCCMCHCGLWGLKRMMM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/BrettMHCCMCHCGLWGLWKRMM20,
author = {Matthew Brett and
Christopher J. Markiewicz and
Michael Hanke and
Marc{-}Alexandre C{\^{o}}t{\'{e}} and
Ben Cipollini and
Paul McCarthy and
Christopher P. Cheng and
Yaroslav O. Halchenko and
Michiel Cottaar and
Satrajit S. Ghosh and
Eric Larson and
Demian Wassermann and
Stephan Gerhard and
Gregory R. Lee and
Hao{-}Ting Wang and
Erik K. Kastman and
Ariel Rokem and
Cindee M. Madison and
F{\'{e}}lix C. Morency and
Brendan Moloney and
Mathias Goncalves and
Cameron Riddell and
Christopher Burns and
Jarrod Millman and
Alexandre Gramfort and
Jaakko Lepp{\"{a}}kangas and
Ross D. Markello and
Jasper J. F. van den Bosch and
Robert D. Vincent and
Henry Braun and
Krish Subramaniam and
Dorota Jarecka and
Krzysztof J. Gorgolewski and
Pradeep Reddy Raamana and
B. Nolan Nichols and
Eric M. Baker and
Soichi Hayashi and
Basile Pinsard and
Christian Haselgrove and
Mark Hymers and
Oscar Esteban and
Serge Koudoro and
Nikolaas N. Oosterhof and
Bago Amirbekian and
Ian Nimmo{-}Smith and
Ly Nguyen and
Samir Reddigari and
Samuel St{-}Jean and
Egor Panfilov and
Eleftherios Garyfallidis and
Ga{\"{e}}l Varoquaux and
Jakub Kaczmarzyk and
Jon Haitz Legarreta and
Kevin S. Hahn and
Oliver P. Hinds and
Bennet Fauber and
Jean{-}Baptiste Poline and
Jonathan Stutters and
Kesshi Jordan and
Matt Cieslak and
Miguel Estevan Moreno and
Valentin Haenel and
Yannick Schwartz and
Benjamin C. Darwin and
Bertrand Thirion and
Dimitri Papadopoulos Orfanos and
Fernando P{\'{e}}rez{-}Garc{\'{\i}}a and
Igor Solovey and
Ivan Gonzalez and
Jath Palasubramaniam and
Justin Lecher and
Katrin Leinweber and
Konstantinos Raktivan and
Peter Fischer and
Philippe Gervais and
Syam Gadde and
Thomas Ballinger and
Thomas Roos and
Venkateswara Reddy Reddam and
freec84},
title = {nipy/nibabel: 3.0.1 (Version 3.0.1)},
publisher = {Zenodo},
year = {2020},
month = jan,
howpublished = {\url{https://doi.org/10.5281/zenodo.3628482}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.3628482},
doi = {10.5281/ZENODO.3628482},
timestamp = {Mon, 30 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/BrettMHCCMCHCGLWGLWKRMM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/BrettMHCCMCHCGLWGLWKRMM20a,
author = {Matthew Brett and
Christopher J. Markiewicz and
Michael Hanke and
Marc{-}Alexandre C{\^{o}}t{\'{e}} and
Ben Cipollini and
Paul McCarthy and
Christopher P. Cheng and
Yaroslav O. Halchenko and
Michiel Cottaar and
Satrajit S. Ghosh and
Eric Larson and
Demian Wassermann and
Stephan Gerhard and
Gregory R. Lee and
Hao{-}Ting Wang and
Erik K. Kastman and
Ariel Rokem and
Cindee Madison and
F{\'{e}}lix C. Morency and
Brendan Moloney and
Mathias Goncalves and
Cameron Riddell and
Christopher Burns and
Jarrod Millman and
Alexandre Gramfort and
Jaakko Lepp{\"{a}}kangas and
Ross Markello and
Jasper J. F. van den Bosch and
Robert D. Vincent and
Henry Braun and
Krish Subramaniam and
Dorota Jarecka and
Krzysztof J. Gorgolewski and
Pradeep Reddy Raamana and
B. Nolan Nichols and
Eric M. Baker and
Soichi Hayashi and
Basile Pinsard and
Christian Haselgrove and
Mark Hymers and
Oscar Esteban and
Serge Koudoro and
Nikolaas N. Oosterhof and
Bago Amirbekian and
Ian Nimmo{-}Smith and
Ly Nguyen and
Samir Reddigari and
Samuel St{-}Jean and
Egor Panfilov and
Eleftherios Garyfallidis and
Ga{\"{e}}l Varoquaux and
Jakub Kaczmarzyk and
Jon Haitz Legarreta and
Kevin S. Hahn and
Oliver Hinds and
Bennet Fauber and
Jean{-}Baptiste Poline and
Jon Stutters and
Kesshi Jordan and
Matthew Cieslak and
Miguel Estevan Moreno and
Valentin Haenel and
Yannick Schwartz and
Benjamin C. Darwin and
Bertrand Thirion and
Dimitri Papadopoulos Orfanos and
Fernando P{\'{e}}rez{-}Garc{\'{\i}}a and
Igor Solovey and
Ivan Gonzalez and
Jath Palasubramaniam and
Justin Lecher and
Katrin Leinweber and
Konstantinos Raktivan and
Peter Fischer and
Philippe Gervais and
Syam Gadde and
Thomas Ballinger and
Thomas Roos and
Venkateswara Reddy Reddam and
Zvi Baratz and
freec84},
title = {nipy/nibabel: 3.0.2 (Version 3.0.2)},
publisher = {Zenodo},
year = {2020},
month = mar,
howpublished = {\url{https://doi.org/10.5281/zenodo.3701467}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.3701467},
doi = {10.5281/ZENODO.3701467},
timestamp = {Tue, 01 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/BrettMHCCMCHCGLWGLWKRMM20a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/BrettMHCCMJCHCGLWGLWKKG20,
author = {Matthew Brett and
Christopher J. Markiewicz and
Michael Hanke and
Marc{-}Alexandre C{\^{o}}t{\'{e}} and
Ben Cipollini and
Paul McCarthy and
Dorota Jarecka and
Christopher P. Cheng and
Yaroslav O. Halchenko and
Michiel Cottaar and
Satrajit S. Ghosh and
Eric Larson and
Demian Wassermann and
Stephan Gerhard and
Gregory R. Lee and
Hao{-}Ting Wang and
Erik K. Kastman and
Jakub Kaczmarzyk and
Roberto Guidotti and
Or Duek and
Ariel Rokem and
Cindee Madison and
F{\'{e}}lix C. Morency and
Brendan Moloney and
Mathias Goncalves and
Ross Markello and
Cameron Riddell and
Christopher Burns and
Jarrod Millman and
Alexandre Gramfort and
Jaakko Lepp{\"{a}}kangas and
Anibal S{\'{o}}lon and
Jasper J. F. van den Bosch and
Robert D. Vincent and
Henry Braun and
Krish Subramaniam and
Krzysztof J. Gorgolewski and
Pradeep Reddy Raamana and
B. Nolan Nichols and
Eric M. Baker and
Soichi Hayashi and
Basile Pinsard and
Christian Haselgrove and
Mark Hymers and
Oscar Esteban and
Serge Koudoro and
Nikolaas N. Oosterhof and
Bago Amirbekian and
Ian Nimmo{-}Smith and
Ly Nguyen and
Samir Reddigari and
Samuel St{-}Jean and
Egor Panfilov and
Eleftherios Garyfallidis and
Ga{\"{e}}l Varoquaux and
Jon Haitz Legarreta and
Kevin S. Hahn and
Oliver Hinds and
Bennet Fauber and
Jean{-}Baptiste Poline and
Jon Stutters and
Kesshi Jordan and
Matthew Cieslak and
Miguel Estevan Moreno and
Valentin Haenel and
Yannick Schwartz and
Zvi Baratz and
Benjamin C. Darwin and
Bertrand Thirion and
Dimitri Papadopoulos Orfanos and
Fernando P{\'{e}}rez{-}Garc{\'{\i}}a and
Igor Solovey and
Ivan Gonzalez and
Jath Palasubramaniam and
Justin Lecher and
Katrin Leinweber and
Konstantinos Raktivan and
Peter Fischer and
Philippe Gervais and
Syam Gadde and
Thomas Ballinger and
Thomas Roos and
Venkateswara Reddy Reddam and
freec84},
title = {nipy/nibabel: 3.1.0 (Version 3.1.0)},
publisher = {Zenodo},
year = {2020},
month = apr,
howpublished = {\url{https://doi.org/10.5281/zenodo.3757992}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.3757992},
doi = {10.5281/ZENODO.3757992},
timestamp = {Tue, 01 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/BrettMHCCMJCHCGLWGLWKKG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/BrettMHCCMJCHCGLWGLWKKG20a,
author = {Matthew Brett and
Christopher J. Markiewicz and
Michael Hanke and
Marc{-}Alexandre C{\^{o}}t{\'{e}} and
Ben Cipollini and
Paul McCarthy and
Dorota Jarecka and
Christopher P. Cheng and
Yaroslav O. Halchenko and
Michiel Cottaar and
Satrajit S. Ghosh and
Eric Larson and
Demian Wassermann and
Stephan Gerhard and
Gregory R. Lee and
Hao{-}Ting Wang and
Erik Kastman and
Jakub Kaczmarzyk and
Roberto Guidotti and
Or Duek and
Ariel Rokem and
Cindee Madison and
F{\'{e}}lix C. Morency and
Brendan Moloney and
Mathias Goncalves and
Ross D. Markello and
Cameron Riddell and
Christopher Burns and
Jarrod Millman and
Alexandre Gramfort and
Jaakko Lepp{\"{a}}kangas and
Anibal S{\'{o}}lon and
Jasper J. F. van den Bosch and
Robert D. Vincent and
Henry Braun and
Krish Subramaniam and
Krzysztof J. Gorgolewski and
Pradeep Reddy Raamana and
B. Nolan Nichols and
Eric M. Baker and
Soichi Hayashi and
Basile Pinsard and
Christian Haselgrove and
Mark Hymers and
Oscar Esteban and
Serge Koudoro and
Nikolaas N. Oosterhof and
Bago Amirbekian and
Ian Nimmo{-}Smith and
Ly Nguyen and
Samir Reddigari and
Samuel St{-}Jean and
Egor Panfilov and
Eleftherios Garyfallidis and
Ga{\"{e}}l Varoquaux and
Jon Haitz Legarreta and
Kevin S. Hahn and
Oliver P. Hinds and
Bennet Fauber and
Jean{-}Baptiste Poline and
Jon Stutters and
Kesshi Jordan and
Matthew Cieslak and
Miguel Estevan Moreno and
Valentin Haenel and
Yannick Schwartz and
Zvi Baratz and
Benjamin C. Darwin and
Bertrand Thirion and
Dimitri Papadopoulos Orfanos and
Fernando P{\'{e}}rez{-}Garc{\'{\i}}a and
Igor Solovey and
Ivan Gonzalez and
Jath Palasubramaniam and
Justin Lecher and
Katrin Leinweber and
Konstantinos Raktivan and
Peter Fischer and
Philippe Gervais and
Syam Gadde and
Thomas Ballinger and
Thomas Roos and
Venkateswara Reddy Reddam and
freec84},
title = {nipy/nibabel: 3.1.1 (Version 3.1.1)},
publisher = {Zenodo},
year = {2020},
month = jun,
howpublished = {\url{https://doi.org/10.5281/zenodo.3924343}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.3924343},
doi = {10.5281/ZENODO.3924343},
timestamp = {Thu, 19 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/BrettMHCCMJCHCGLWGLWKKG20a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/BrettMHCCMJCHCLGWGLWKKG20,
author = {Matthew Brett and
Christopher J. Markiewicz and
Michael Hanke and
Marc{-}Alexandre C{\^{o}}t{\'{e}} and
Ben Cipollini and
Paul McCarthy and
Dorota Jarecka and
Christopher P. Cheng and
Yaroslav O. Halchenko and
Michiel Cottaar and
Eric Larson and
Satrajit S. Ghosh and
Demian Wassermann and
Stephan Gerhard and
Gregory R. Lee and
Hao{-}Ting Wang and
Erik K. Kastman and
Jakub Kaczmarzyk and
Roberto Guidotti and
Or Duek and
Jonathan Daniel and
Ariel Rokem and
Cindee Madison and
Brendan Moloney and
F{\'{e}}lix C. Morency and
Mathias Goncalves and
Ross D. Markello and
Cameron Riddell and
Christopher Burns and
K. Jarrod Millman and
Alexandre Gramfort and
Jaakko Lepp{\"{a}}kangas and
Anibal S{\'{o}}lon and
Jasper J. F. van den Bosch and
Robert D. Vincent and
Henry Braun and
Krish Subramaniam and
Krzysztof J. Gorgolewski and
Pradeep Reddy Raamana and
Julian Klug and
B. Nolan Nichols and
Eric M. Baker and
Soichi Hayashi and
Basile Pinsard and
Christian Haselgrove and
Mark Hymers and
Oscar Esteban and
Serge Koudoro and
Fernando P{\'{e}}rez{-}Garc{\'{\i}}a and
Nikolaas N. Oosterhof and
Bago Amirbekian and
Ian Nimmo{-}Smith and
Ly Nguyen and
Samir Reddigari and
Samuel St{-}Jean and
Egor Panfilov and
Eleftherios Garyfallidis and
Ga{\"{e}}l Varoquaux and
Jon Haitz Legarreta and
Kevin S. Hahn and
Oliver P. Hinds and
Bennet Fauber and
Jean{-}Baptiste Poline and
Jon Stutters and
Kesshi Jordan and
Matthew Cieslak and
Miguel Estevan Moreno and
Valentin Haenel and
Yannick Schwartz and
Zvi Baratz and
Benjamin C. Darwin and
Bertrand Thirion and
Carl Gauthier and
Dimitri Papadopoulos Orfanos and
Igor Solovey and
Ivan Gonzalez and
Jath Palasubramaniam and
Justin Lecher and
Katrin Leinweber and
Konstantinos Raktivan and
Mark{\'{e}}ta Cal{\'{a}}bkov{\'{a}} and
Peter Fischer and
Philippe Gervais and
Syam Gadde and
Thomas Ballinger and
Thomas Roos and
Venkateswara Reddy Reddam and
freec84},
title = {nipy/nibabel: 3.2.0 (Version 3.2.0)},
publisher = {Zenodo},
year = {2020},
month = oct,
howpublished = {\url{https://doi.org/10.5281/zenodo.4109791}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.4109791},
doi = {10.5281/ZENODO.4109791},
timestamp = {Fri, 27 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/BrettMHCCMJCHCLGWGLWKKG20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/BrettMHCCMJCHCLGWGLWKKG20a,
author = {Matthew Brett and
Christopher J. Markiewicz and
Michael Hanke and
Marc{-}Alexandre C{\^{o}}t{\'{e}} and
Ben Cipollini and
Paul McCarthy and
Dorota Jarecka and
Christopher P. Cheng and
Yaroslav O. Halchenko and
Michiel Cottaar and
Eric Larson and
Satrajit S. Ghosh and
Demian Wassermann and
Stephan Gerhard and
Gregory R. Lee and
Hao{-}Ting Wang and
Erik K. Kastman and
Jakub Kaczmarzyk and
Roberto Guidotti and
Or Duek and
Jonathan Daniel and
Ariel Rokem and
Cindee Madison and
Brendan Moloney and
F{\'{e}}lix C. Morency and
Mathias Goncalves and
Ross D. Markello and
Cameron Riddell and
Christopher Burns and
K. Jarrod Millman and
Alexandre Gramfort and
Jaakko Lepp{\"{a}}kangas and
Anibal S{\'{o}}lon and
Jasper J. F. van den Bosch and
Robert D. Vincent and
Henry Braun and
Krish Subramaniam and
Krzysztof J. Gorgolewski and
Pradeep Reddy Raamana and
Julian Klug and
B. Nolan Nichols and
Eric M. Baker and
Soichi Hayashi and
Basile Pinsard and
Christian Haselgrove and
Mark Hymers and
Oscar Esteban and
Serge Koudoro and
Fernando P{\'{e}}rez{-}Garc{\'{\i}}a and
Nikolaas N. Oosterhof and
Bago Amirbekian and
Ian Nimmo{-}Smith and
Ly Nguyen and
Samir Reddigari and
Samuel St{-}Jean and
Egor Panfilov and
Eleftherios Garyfallidis and
Ga{\"{e}}l Varoquaux and
Jon Haitz Legarreta and
Kevin S. Hahn and
Oliver P. Hinds and
Bennet Fauber and
Jean{-}Baptiste Poline and
Jon Stutters and
Kesshi Jordan and
Matthew Cieslak and
Miguel Estevan Moreno and
Valentin Haenel and
Yannick Schwartz and
Zvi Baratz and
Benjamin C. Darwin and
Bertrand Thirion and
Carl Gauthier and
Dimitri Papadopoulos Orfanos and
Igor Solovey and
Ivan Gonzalez and
Jath Palasubramaniam and
Justin Lecher and
Katrin Leinweber and
Konstantinos Raktivan and
Mark{\'{e}}ta Cal{\'{a}}bkov{\'{a}} and
Peter Fischer and
Philippe Gervais and
Syam Gadde and
Thomas Ballinger and
Thomas Roos and
Venkateswara Reddy Reddam and
freec84},
title = {nipy/nibabel: 3.2.1 (Version 3.2.1)},
publisher = {Zenodo},
year = {2020},
month = nov,
howpublished = {\url{https://doi.org/10.5281/zenodo.4295521}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.4295521},
doi = {10.5281/ZENODO.4295521},
timestamp = {Fri, 27 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/BrettMHCCMJCHCLGWGLWKKG20a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-12908,
author = {Joshua T. Vogelstein and
Hayden S. Helm and
Ronak D. Mehta and
Jayanta Dey and
Weiwei Yang and
Bryan Tower and
Will LeVine and
Jonathan Larson and
Christopher M. White and
Carey E. Priebe},
title = {A general approach to progressive intelligence},
journal = {CoRR},
volume = {abs/2004.12908},
year = {2020},
url = {https://arxiv.org/abs/2004.12908},
eprinttype = {arXiv},
eprint = {2004.12908},
timestamp = {Wed, 17 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2004-12908.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-00402,
author = {Darren Edge and
Jonathan Larson and
Nikolay Trandev and
Neha Parikh Shah and
Carolyn Buractaon and
Nicholas Caurvina and
Nathan Evans and
Christopher M. White},
title = {Workgroup Mapping: Visual Analysis of Collaboration Culture},
journal = {CoRR},
volume = {abs/2005.00402},
year = {2020},
url = {https://arxiv.org/abs/2005.00402},
eprinttype = {arXiv},
eprint = {2005.00402},
timestamp = {Fri, 08 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-00402.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-10700,
author = {Hayden S. Helm and
Amitabh Basu and
Avanti Athreya and
Youngser Park and
Joshua T. Vogelstein and
Michael Winding and
Marta Zlatic and
Albert Cardona and
Patrick Bourke and
Jonathan Larson and
Christopher M. White and
Carey E. Priebe},
title = {Learning to rank via combining representations},
journal = {CoRR},
volume = {abs/2005.10700},
year = {2020},
url = {https://arxiv.org/abs/2005.10700},
eprinttype = {arXiv},
eprint = {2005.10700},
timestamp = {Fri, 22 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-10700.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/brain/WeisHBPL19,
author = {Carissa N. Weis and
Ashley A. Huggins and
Kenneth P. Bennett and
Elizabeth A. Parisi and
Christine L. Larson},
title = {High-Resolution Resting-State Functional Connectivity of the Extended
Amygdala},
journal = {Brain Connect.},
volume = {9},
number = {8},
pages = {627--637},
year = {2019},
url = {https://doi.org/10.1089/brain.2019.0688},
doi = {10.1089/BRAIN.2019.0688},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/brain/WeisHBPL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/hf/PattersonLLC19,
author = {Robert Earl Patterson and
Darrell F. Lochtefeld and
Kathleen G. Larson and
Amanda Christensen{-}Salem},
title = {Computational Modeling of the Effects of Sleep Deprivation on the
Vigilance Decrement},
journal = {Hum. Factors},
volume = {61},
number = {7},
year = {2019},
url = {https://doi.org/10.1177/0018720819829949},
doi = {10.1177/0018720819829949},
timestamp = {Thu, 04 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/hf/PattersonLLC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jossw/AppelhoffSBVQHC19,
author = {Stefan Appelhoff and
Matthew Sanderson and
Teon Brooks and
Marijn van Vliet and
Romain Quentin and
Chris Holdgraf and
Maximilien Chaumon and
Ezequiel Mikulan and
Kambiz Tavabi and
Richard H{\"{o}}chenberger and
Dominik Welke and
Clemens Brunner and
Alexander Rockhill and
Eric Larson and
Alexandre Gramfort and
Mainak Jas},
title = {{MNE-BIDS:} Organizing electrophysiological data into the {BIDS} format
and facilitating their analysis},
journal = {J. Open Source Softw.},
volume = {4},
number = {44},
pages = {1896},
year = {2019},
url = {https://doi.org/10.21105/joss.01896},
doi = {10.21105/JOSS.01896},
timestamp = {Tue, 06 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jossw/AppelhoffSBVQHC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/BellLKBLH19,
author = {Jimmy Bell and
Maureen Larson and
Michelle Kutzler and
Massimo Bionaz and
Christiane V. L{\"{o}}hr and
David A. Hendrix},
title = {miRWoods: Enhanced precursor detection and stacked random forests
for the sensitive detection of microRNAs},
journal = {PLoS Comput. Biol.},
volume = {15},
number = {10},
year = {2019},
url = {https://doi.org/10.1371/journal.pcbi.1007309},
doi = {10.1371/JOURNAL.PCBI.1007309},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/BellLKBLH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/IrvinRKYCCMHBSS19,
author = {Jeremy Irvin and
Pranav Rajpurkar and
Michael Ko and
Yifan Yu and
Silviana Ciurea{-}Ilcus and
Christopher Chute and
Henrik Marklund and
Behzad Haghgoo and
Robyn L. Ball and
Katie S. Shpanskaya and
Jayne Seekins and
David A. Mong and
Safwan S. Halabi and
Jesse K. Sandberg and
Ricky Jones and
David B. Larson and
Curtis P. Langlotz and
Bhavik N. Patel and
Matthew P. Lungren and
Andrew Y. Ng},
title = {CheXpert: {A} Large Chest Radiograph Dataset with Uncertainty Labels
and Expert Comparison},
booktitle = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI}
2019, The Thirty-First Innovative Applications of Artificial Intelligence
Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational
Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii,
USA, January 27 - February 1, 2019},
pages = {590--597},
publisher = {{AAAI} Press},
year = {2019},
url = {https://doi.org/10.1609/aaai.v33i01.3301590},
doi = {10.1609/AAAI.V33I01.3301590},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/IrvinRKYCCMHBSS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LarsonMPCLHKLLT19,
author = {Stefan Larson and
Anish Mahendran and
Joseph J. Peper and
Christopher Clarke and
Andrew Lee and
Parker Hill and
Jonathan K. Kummerfeld and
Kevin Leach and
Michael A. Laurenzano and
Lingjia Tang and
Jason Mars},
editor = {Kentaro Inui and
Jing Jiang and
Vincent Ng and
Xiaojun Wan},
title = {An Evaluation Dataset for Intent Classification and Out-of-Scope Prediction},
booktitle = {Proceedings of the 2019 Conference on Empirical Methods in Natural
Language Processing and the 9th International Joint Conference on
Natural Language Processing, {EMNLP-IJCNLP} 2019, Hong Kong, China,
November 3-7, 2019},
pages = {1311--1316},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/D19-1131},
doi = {10.18653/V1/D19-1131},
timestamp = {Thu, 07 Apr 2022 09:14:07 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/LarsonMPCLHKLLT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/recsys/StrucksSL19,
author = {Christopher Strucks and
Manel Slokom and
Martha A. Larson},
editor = {Robin Burke and
Himan Abdollahpouri and
Edward C. Malthouse and
K. P. Thai and
Yongfeng Zhang},
title = {BlurM(or)e: Revisiting Gender Obfuscation in the User-Item Matrix},
booktitle = {Proceedings of the Workshop on Recommendation in Multi-stakeholder
Environments co-located with the 13th {ACM} Conference on Recommender
Systems (RecSys 2019), Copenhagen, Denmark, September 20, 2019},
series = {{CEUR} Workshop Proceedings},
volume = {2440},
publisher = {CEUR-WS.org},
year = {2019},
url = {https://ceur-ws.org/Vol-2440/short2.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:14 +0100},
biburl = {https://dblp.org/rec/conf/recsys/StrucksSL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/AppelhoffSBVQHCMTHWBRLG19,
author = {Stefan Appelhoff and
Matthew Sanderson and
Teon Brooks and
Marijn van Vliet and
Romain Quentin and
Chris Holdgraf and
Maximilien Chaumon and
Ezequiel Mikulan and
Kambiz Tavabi and
Richard H{\"{o}}chenberger and
Dominik Welke and
Clemens Brunner and
Alexander Rockhill and
Eric Larson and
Alexandre Gramfort and
Mainak Jas},
title = {{MNE-BIDS:} Organizing electrophysiological data into the {BIDS} format
and facilitating their analysis (Version v0.3.1)},
publisher = {Zenodo},
year = {2019},
month = dec,
howpublished = {\url{https://doi.org/10.5281/zenodo.3580273}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.3580273},
doi = {10.5281/ZENODO.3580273},
timestamp = {Wed, 11 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/AppelhoffSBVQHCMTHWBRLG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/BrettMHCCMCHCGLWGLKRMMM19,
author = {Matthew Brett and
Christopher J. Markiewicz and
Michael Hanke and
Marc{-}Alexandre C{\^{o}}t{\'{e}} and
Ben Cipollini and
Paul McCarthy and
Christopher P. Cheng and
Yaroslav O. Halchenko and
Michiel Cottaar and
Satrajit S. Ghosh and
Eric Larson and
Demian Wassermann and
Stephan Gerhard and
Gregory R. Lee and
Erik K. Kastman and
Ariel Rokem and
Cindee M. Madison and
F{\'{e}}lix C. Morency and
Brendan Moloney and
Christopher Burns and
Jarrod Millman and
Alexandre Gramfort and
Jaakko Lepp{\"{a}}kangas and
Ross D. Markello and
Jasper J. F. van den Bosch and
Robert D. Vincent and
Krish Subramaniam and
Pradeep Reddy Raamana and
B. Nolan Nichols and
Eric M. Baker and
Mathias Goncalves and
Soichi Hayashi and
Basile Pinsard and
Christian Haselgrove and
Mark Hymers and
Serge Koudoro and
Nikolaas N. Oosterhof and
Bago Amirbekian and
Ian Nimmo{-}Smith and
Ly Nguyen and
Samir Reddigari and
Samuel St{-}Jean and
Eleftherios Garyfallidis and
Ga{\"{e}}l Varoquaux and
Jakub Kaczmarzyk and
Jon Haitz Legarreta and
Kevin S. Hahn and
Oliver Hinds and
Bennet Fauber and
Jean{-}Baptiste Poline and
Jon Stutters and
Kesshi Jordan and
Matt Cieslak and
Miguel Estevan Moreno and
Valentin Haenel and
Yannick Schwartz and
Bertrand Thirion and
Dimitri Papadopoulos Orfanos and
Fernando P{\'{e}}rez{-}Garc{\'{\i}}a and
Igor Solovey and
Ivan Gonzalez and
Justin Lecher and
Katrin Leinweber and
Konstantinos Raktivan and
Peter Fischer and
Philippe Gervais and
Syam Gadde and
Thomas Ballinger and
Thomas Roos and
Venkateswara Reddy Reddam and
freec84},
title = {nipy/nibabel: 2.4.0 (Version 2.4.0)},
publisher = {Zenodo},
year = {2019},
month = apr,
howpublished = {\url{https://doi.org/10.5281/zenodo.2620614}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.2620614},
doi = {10.5281/ZENODO.2620614},
timestamp = {Tue, 01 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/BrettMHCCMCHCGLWGLKRMMM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/BrettMHCCMCHCGLWGLKRMMM19a,
author = {Matthew Brett and
Christopher J. Markiewicz and
Michael Hanke and
Marc{-}Alexandre C{\^{o}}t{\'{e}} and
Ben Cipollini and
Paul McCarthy and
Christopher P. Cheng and
Yaroslav O. Halchenko and
Michiel Cottaar and
Satrajit S. Ghosh and
Eric Larson and
Demian Wassermann and
Stephan Gerhard and
Gregory R. Lee and
Erik K. Kastman and
Ariel Rokem and
Cindee M. Madison and
F{\'{e}}lix C. Morency and
Brendan Moloney and
Christopher Burns and
Jarrod Millman and
Alexandre Gramfort and
Jaakko Lepp{\"{a}}kangas and
Ross D. Markello and
Jasper J. F. van den Bosch and
Robert D. Vincent and
Krish Subramaniam and
Pradeep Reddy Raamana and
B. Nolan Nichols and
Eric M. Baker and
Mathias Goncalves and
Soichi Hayashi and
Basile Pinsard and
Christian Haselgrove and
Mark Hymers and
Serge Koudoro and
Nikolaas N. Oosterhof and
Bago Amirbekian and
Ian Nimmo{-}Smith and
Ly Nguyen and
Samir Reddigari and
Samuel St{-}Jean and
Eleftherios Garyfallidis and
Ga{\"{e}}l Varoquaux and
Jakub Kaczmarzyk and
Jon Haitz Legarreta and
Kevin S. Hahn and
Oliver Hinds and
Bennet Fauber and
Jean{-}Baptiste Poline and
Jon Stutters and
Kesshi Jordan and
Matthew Cieslak and
Miguel Estevan Moreno and
Valentin Haenel and
Yannick Schwartz and
Bertrand Thirion and
Dimitri Papadopoulos Orfanos and
Fernando P{\'{e}}rez{-}Garc{\'{\i}}a and
Igor Solovey and
Ivan Gonzalez and
Justin Lecher and
Katrin Leinweber and
Konstantinos Raktivan and
Peter Fischer and
Philippe Gervais and
Syam Gadde and
Thomas Ballinger and
Thomas Roos and
Venkateswara Reddy Reddam and
freec84},
title = {nipy/nibabel: 2.4.1 (Version 2.4.1)},
publisher = {Zenodo},
year = {2019},
month = may,
howpublished = {\url{https://doi.org/10.5281/zenodo.3233118}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.3233118},
doi = {10.5281/ZENODO.3233118},
timestamp = {Tue, 01 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/BrettMHCCMCHCGLWGLKRMMM19a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/BrettMHCCMCHCGLWGLKRMMM19b,
author = {Matthew Brett and
Christopher J. Markiewicz and
Michael Hanke and
Marc{-}Alexandre C{\^{o}}t{\'{e}} and
Ben Cipollini and
Paul McCarthy and
Christopher P. Cheng and
Yaroslav O. Halchenko and
Michiel Cottaar and
Satrajit S. Ghosh and
Eric Larson and
Demian Wassermann and
Stephan Gerhard and
Gregory R. Lee and
Erik K. Kastman and
Ariel Rokem and
Cindee M. Madison and
F{\'{e}}lix C. Morency and
Brendan Moloney and
Christopher Burns and
Jarrod Millman and
Alexandre Gramfort and
Jaakko Lepp{\"{a}}kangas and
Ross D. Markello and
Jasper J. F. van den Bosch and
Robert D. Vincent and
Krish Subramaniam and
Pradeep Reddy Raamana and
B. Nolan Nichols and
Eric M. Baker and
Mathias Goncalves and
Soichi Hayashi and
Basile Pinsard and
Christian Haselgrove and
Mark Hymers and
Serge Koudoro and
Nikolaas N. Oosterhof and
Bago Amirbekian and
Ian Nimmo{-}Smith and
Ly Nguyen and
Samir Reddigari and
Samuel St{-}Jean and
Eleftherios Garyfallidis and
Ga{\"{e}}l Varoquaux and
Jakub Kaczmarzyk and
Jon Haitz Legarreta and
Kevin S. Hahn and
Oliver Hinds and
Bennet Fauber and
Egor Panfilov and
Jean{-}Baptiste Poline and
Jon Stutters and
Kesshi Jordan and
Matthew Cieslak and
Miguel Estevan Moreno and
Valentin Haenel and
Yannick Schwartz and
Bertrand Thirion and
Dimitri Papadopoulos Orfanos and
Fernando P{\'{e}}rez{-}Garc{\'{\i}}a and
Igor Solovey and
Ivan Gonzalez and
Jath Palasubramaniam and
Justin Lecher and
Katrin Leinweber and
Konstantinos Raktivan and
Peter Fischer and
Philippe Gervais and
Syam Gadde and
Thomas Ballinger and
Thomas Roos and
Venkateswara Reddy Reddam and
freec84},
title = {nipy/nibabel: 2.5.0 (Version 2.5.0)},
publisher = {Zenodo},
year = {2019},
month = aug,
howpublished = {\url{https://doi.org/10.5281/zenodo.3360650}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.3360650},
doi = {10.5281/ZENODO.3360650},
timestamp = {Tue, 01 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/BrettMHCCMCHCGLWGLKRMMM19b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/BrettMHCCMCHCGLWGLKRMMM19c,
author = {Matthew Brett and
Christopher J. Markiewicz and
Michael Hanke and
Marc{-}Alexandre C{\^{o}}t{\'{e}} and
Ben Cipollini and
Paul McCarthy and
Christopher P. Cheng and
Yaroslav O. Halchenko and
Michiel Cottaar and
Satrajit S. Ghosh and
Eric Larson and
Demian Wassermann and
Stephan Gerhard and
Gregory R. Lee and
Erik K. Kastman and
Ariel Rokem and
Cindee M. Madison and
F{\'{e}}lix C. Morency and
Brendan Moloney and
Mathias Goncalves and
Christopher Burns and
Jarrod Millman and
Alexandre Gramfort and
Jaakko Lepp{\"{a}}kangas and
Ross D. Markello and
Jasper J. F. van den Bosch and
Robert D. Vincent and
Krish Subramaniam and
Pradeep Reddy Raamana and
B. Nolan Nichols and
Eric M. Baker and
Soichi Hayashi and
Basile Pinsard and
Christian Haselgrove and
Mark Hymers and
Serge Koudoro and
Nikolaas N. Oosterhof and
Bago Amirbekian and
Ian Nimmo{-}Smith and
Ly Nguyen and
Samir Reddigari and
Samuel St{-}Jean and
Eleftherios Garyfallidis and
Ga{\"{e}}l Varoquaux and
Jakub Kaczmarzyk and
Jon Haitz Legarreta and
Kevin S. Hahn and
Oliver P. Hinds and
Bennet Fauber and
Egor Panfilov and
Jean{-}Baptiste Poline and
Jon Stutters and
Kesshi Jordan and
Matthew Cieslak and
Miguel Estevan Moreno and
Valentin Haenel and
Yannick Schwartz and
Bertrand Thirion and
Dimitri Papadopoulos Orfanos and
Fernando P{\'{e}}rez{-}Garc{\'{\i}}a and
Henry Braun and
Igor Solovey and
Ivan Gonzalez and
Jath Palasubramaniam and
Justin Lecher and
Katrin Leinweber and
Konstantinos Raktivan and
Peter Fischer and
Philippe Gervais and
Syam Gadde and
Thomas Ballinger and
Thomas Roos and
Venkateswara Reddy Reddam and
freec84},
title = {nipy/nibabel: 2.5.1 (Version 2.5.1)},
publisher = {Zenodo},
year = {2019},
month = sep,
howpublished = {\url{https://doi.org/10.5281/zenodo.3458246}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.3458246},
doi = {10.5281/ZENODO.3458246},
timestamp = {Mon, 30 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/BrettMHCCMCHCGLWGLKRMMM19c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/BrettMHCCMCHCGLWGLWKRMM19,
author = {Matthew Brett and
Christopher J. Markiewicz and
Michael Hanke and
Marc{-}Alexandre C{\^{o}}t{\'{e}} and
Ben Cipollini and
Paul McCarthy and
Christopher P. Cheng and
Yaroslav O. Halchenko and
Michiel Cottaar and
Satrajit S. Ghosh and
Eric Larson and
Demian Wassermann and
Stephan Gerhard and
Gregory R. Lee and
Hao{-}Ting Wang and
Erik K. Kastman and
Ariel Rokem and
Cindee M. Madison and
F{\'{e}}lix C. Morency and
Brendan Moloney and
Mathias Goncalves and
Cameron Riddell and
Christopher Burns and
Jarrod Millman and
Alexandre Gramfort and
Jaakko Lepp{\"{a}}kangas and
Ross D. Markello and
Jasper J. F. van den Bosch and
Robert D. Vincent and
Henry Braun and
Krish Subramaniam and
Dorota Jarecka and
Krzysztof J. Gorgolewski and
Pradeep Reddy Raamana and
B. Nolan Nichols and
Eric M. Baker and
Soichi Hayashi and
Basile Pinsard and
Christian Haselgrove and
Mark Hymers and
Oscar Esteban and
Serge Koudoro and
Nikolaas N. Oosterhof and
Bago Amirbekian and
Ian Nimmo{-}Smith and
Ly Nguyen and
Samir Reddigari and
Samuel St{-}Jean and
Egor Panfilov and
Eleftherios Garyfallidis and
Ga{\"{e}}l Varoquaux and
Jakub Kaczmarzyk and
Jon Haitz Legarreta and
Kevin S. Hahn and
Oliver P. Hinds and
Bennet Fauber and
Jean{-}Baptiste Poline and
Jonathan Stutters and
Kesshi Jordan and
Matthew Cieslak and
Miguel Estevan Moreno and
Valentin Haenel and
Yannick Schwartz and
Bertrand Thirion and
Dimitri Papadopoulos Orfanos and
Fernando P{\'{e}}rez{-}Garc{\'{\i}}a and
Igor Solovey and
Ivan Gonzalez and
Jath Palasubramaniam and
Justin Lecher and
Katrin Leinweber and
Konstantinos Raktivan and
Peter Fischer and
Philippe Gervais and
Syam Gadde and
Thomas Ballinger and
Thomas Roos and
Venkateswara Reddy Reddam and
freec84},
title = {nipy/nibabel: 3.0.0rc1 (Version 3.0.0rc1)},
publisher = {Zenodo},
year = {2019},
month = nov,
howpublished = {\url{https://doi.org/10.5281/zenodo.3544468}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.3544468},
doi = {10.5281/ZENODO.3544468},
timestamp = {Mon, 30 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/BrettMHCCMCHCGLWGLWKRMM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/BrettMHCCMCHCGLWGLWKRMM19a,
author = {Matthew Brett and
Christopher J. Markiewicz and
Michael Hanke and
Marc{-}Alexandre C{\^{o}}t{\'{e}} and
Ben Cipollini and
Paul McCarthy and
Christopher P. Cheng and
Yaroslav O. Halchenko and
Michiel Cottaar and
Satrajit S. Ghosh and
Eric Larson and
Demian Wassermann and
Stephan Gerhard and
Gregory R. Lee and
Hao{-}Ting Wang and
Erik K. Kastman and
Ariel Rokem and
Cindee M. Madison and
F{\'{e}}lix C. Morency and
Brendan Moloney and
Mathias Goncalves and
Cameron Riddell and
Christopher Burns and
Jarrod Millman and
Alexandre Gramfort and
Jaakko Lepp{\"{a}}kangas and
Ross D. Markello and
Jasper J. F. van den Bosch and
Robert D. Vincent and
Henry Braun and
Krish Subramaniam and
Dorota Jarecka and
Krzysztof J. Gorgolewski and
Pradeep Reddy Raamana and
B. Nolan Nichols and
Eric M. Baker and
Soichi Hayashi and
Basile Pinsard and
Christian Haselgrove and
Mark Hymers and
Oscar Esteban and
Serge Koudoro and
Nikolaas N. Oosterhof and
Bago Amirbekian and
Ian Nimmo{-}Smith and
Ly Nguyen and
Samir Reddigari and
Samuel St{-}Jean and
Egor Panfilov and
Eleftherios Garyfallidis and
Ga{\"{e}}l Varoquaux and
Jakub Kaczmarzyk and
Jon Haitz Legarreta and
Kevin S. Hahn and
Oliver P. Hinds and
Bennet Fauber and
Jean{-}Baptiste Poline and
Jonathan Stutters and
Kesshi Jordan and
Matthew Cieslak and
Miguel Estevan Moreno and
Valentin Haenel and
Yannick Schwartz and
Bertrand Thirion and
Dimitri Papadopoulos Orfanos and
Fernando P{\'{e}}rez{-}Garc{\'{\i}}a and
Igor Solovey and
Ivan Gonzalez and
Jath Palasubramaniam and
Justin Lecher and
Katrin Leinweber and
Konstantinos Raktivan and
Peter Fischer and
Philippe Gervais and
Syam Gadde and
Thomas Ballinger and
Thomas Roos and
Venkateswara Reddy Reddam and
freec84},
title = {nipy/nibabel: 3.0.0rc2 (Version 3.0.0rc2)},
publisher = {Zenodo},
year = {2019},
month = dec,
howpublished = {\url{https://doi.org/10.5281/zenodo.3571470}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.3571470},
doi = {10.5281/ZENODO.3571470},
timestamp = {Mon, 30 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/BrettMHCCMCHCGLWGLWKRMM19a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@misc{DBLP:data/10/BrettMHCCMCHCGLWGLWKRMM19b,
author = {Matthew Brett and
Christopher J. Markiewicz and
Michael Hanke and
Marc{-}Alexandre C{\^{o}}t{\'{e}} and
Ben Cipollini and
Paul McCarthy and
Christopher P. Cheng and
Yaroslav O. Halchenko and
Michiel Cottaar and
Satrajit S. Ghosh and
Eric Larson and
Demian Wassermann and
Stephan Gerhard and
Gregory R. Lee and
Hao{-}Ting Wang and
Erik K. Kastman and
Ariel Rokem and
Cindee M. Madison and
F{\'{e}}lix C. Morency and
Brendan Moloney and
Mathias Goncalves and
Cameron Riddell and
Christopher Burns and
Jarrod Millman and
Alexandre Gramfort and
Jaakko Lepp{\"{a}}kangas and
Ross D. Markello and
Jasper J. F. van den Bosch and
Robert D. Vincent and
Henry Braun and
Krish Subramaniam and
Dorota Jarecka and
Krzysztof J. Gorgolewski and
Pradeep Reddy Raamana and
B. Nolan Nichols and
Eric M. Baker and
Soichi Hayashi and
Basile Pinsard and
Christian Haselgrove and
Mark Hymers and
Oscar Esteban and
Serge Koudoro and
Nikolaas N. Oosterhof and
Bago Amirbekian and
Ian Nimmo{-}Smith and
Ly Nguyen and
Samir Reddigari and
Samuel St{-}Jean and
Egor Panfilov and
Eleftherios Garyfallidis and
Ga{\"{e}}l Varoquaux and
Jakub Kaczmarzyk and
Jon Haitz Legarreta and
Kevin S. Hahn and
Oliver P. Hinds and
Bennet Fauber and
Jean{-}Baptiste Poline and
Jonathan Stutters and
Kesshi Jordan and
Matthew Cieslak and
Miguel Estevan Moreno and
Valentin Haenel and
Yannick Schwartz and
Bertrand Thirion and
Dimitri Papadopoulos Orfanos and
Fernando P{\'{e}}rez{-}Garc{\'{\i}}a and
Igor Solovey and
Ivan Gonzalez and
Jath Palasubramaniam and
Justin Lecher and
Katrin Leinweber and
Konstantinos Raktivan and
Peter Fischer and
Philippe Gervais and
Syam Gadde and
Thomas Ballinger and
Thomas Roos and
Venkateswara Reddy Reddam and
freec84},
title = {nipy/nibabel: 3.0.0 (Version 3.0.0)},
publisher = {Zenodo},
year = {2019},
month = dec,
howpublished = {\url{https://doi.org/10.5281/zenodo.3583002}},
note = {Accessed on YYYY-MM-DD.},
url = {https://doi.org/10.5281/zenodo.3583002},
doi = {10.5281/ZENODO.3583002},
timestamp = {Mon, 30 Sep 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/data/10/BrettMHCCMCHCGLWGLWKRMM19b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1901-07031,
author = {Jeremy Irvin and
Pranav Rajpurkar and
Michael Ko and
Yifan Yu and
Silviana Ciurea{-}Ilcus and
Christopher Chute and
Henrik Marklund and
Behzad Haghgoo and
Robyn L. Ball and
Katie S. Shpanskaya and
Jayne Seekins and
David A. Mong and
Safwan S. Halabi and
Jesse K. Sandberg and
Ricky Jones and
David B. Larson and
Curtis P. Langlotz and
Bhavik N. Patel and
Matthew P. Lungren and
Andrew Y. Ng},
title = {CheXpert: {A} Large Chest Radiograph Dataset with Uncertainty Labels
and Expert Comparison},
journal = {CoRR},
volume = {abs/1901.07031},
year = {2019},
url = {http://arxiv.org/abs/1901.07031},
eprinttype = {arXiv},
eprint = {1901.07031},
timestamp = {Fri, 23 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1901-07031.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1905-01776,
author = {Joshua Agterberg and
Youngser Park and
Jonathan Larson and
Christopher M. White and
Carey E. Priebe and
Vince Lyzinski},
title = {Vertex Nomination, Consistent Estimation, and Adversarial Modification},
journal = {CoRR},
volume = {abs/1905.01776},
year = {2019},
url = {http://arxiv.org/abs/1905.01776},
eprinttype = {arXiv},
eprint = {1905.01776},
timestamp = {Fri, 08 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1905-01776.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1906-05678,
author = {Christopher Larson and
Tarek Lahlou and
Diana Mingels and
Zachary Kulis and
Erik T. Mueller},
title = {Telephonetic: Making Neural Language Models Robust to {ASR} and Semantic
Noise},
journal = {CoRR},
volume = {abs/1906.05678},
year = {2019},
url = {http://arxiv.org/abs/1906.05678},
eprinttype = {arXiv},
eprint = {1906.05678},
timestamp = {Mon, 03 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1906-05678.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-00925,
author = {Oluwatobi Olabiyi and
Erik T. Mueller and
Christopher Larson and
Tarek Lahlou},
title = {Adversarial Bootstrapping for Dialogue Model Training},
journal = {CoRR},
volume = {abs/1909.00925},
year = {2019},
url = {http://arxiv.org/abs/1909.00925},
eprinttype = {arXiv},
eprint = {1909.00925},
timestamp = {Mon, 16 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-00925.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-02027,
author = {Stefan Larson and
Anish Mahendran and
Joseph J. Peper and
Christopher Clarke and
Andrew Lee and
Parker Hill and
Jonathan K. Kummerfeld and
Kevin Leach and
Michael A. Laurenzano and
Lingjia Tang and
Jason Mars},
title = {An Evaluation Dataset for Intent Classification and Out-of-Scope Prediction},
journal = {CoRR},
volume = {abs/1909.02027},
year = {2019},
url = {http://arxiv.org/abs/1909.02027},
eprinttype = {arXiv},
eprint = {1909.02027},
timestamp = {Mon, 16 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-02027.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/EdgeRLW18,
author = {Darren Edge and
Nathalie Henry Riche and
Jonathan Larson and
Christopher M. White},
title = {Beyond Tasks: An Activity Typology for Visual Analytics},
journal = {{IEEE} Trans. Vis. Comput. Graph.},
volume = {24},
number = {1},
pages = {267--277},
year = {2018},
url = {https://doi.org/10.1109/TVCG.2017.2745180},
doi = {10.1109/TVCG.2017.2745180},
timestamp = {Fri, 08 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvcg/EdgeRLW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigdataconf/EdgeLMW18,
author = {Darren Edge and
Jonathan Larson and
Markus Mobius and
Christopher M. White},
editor = {Naoki Abe and
Huan Liu and
Calton Pu and
Xiaohua Hu and
Nesreen K. Ahmed and
Mu Qiao and
Yang Song and
Donald Kossmann and
Bing Liu and
Kisung Lee and
Jiliang Tang and
Jingrui He and
Jeffrey S. Saltz},
title = {Trimming the Hairball: Edge Cutting Strategies for Making Dense Graphs
Usable},
booktitle = {{IEEE} International Conference on Big Data {(IEEE} BigData 2018),
Seattle, WA, USA, December 10-13, 2018},
pages = {3951--3958},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/BigData.2018.8622521},
doi = {10.1109/BIGDATA.2018.8622521},
timestamp = {Fri, 19 Nov 2021 16:08:20 +0100},
biburl = {https://dblp.org/rec/conf/bigdataconf/EdgeLMW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigdataconf/LarsonTHEW18,
author = {Jonathan Larson and
Bryan Tower and
Duane Hadfield and
Darren Edge and
Christopher M. White},
editor = {Naoki Abe and
Huan Liu and
Calton Pu and
Xiaohua Hu and
Nesreen K. Ahmed and
Mu Qiao and
Yang Song and
Donald Kossmann and
Bing Liu and
Kisung Lee and
Jiliang Tang and
Jingrui He and
Jeffrey S. Saltz},
title = {Using Web-Scale Graph Analytics to Counter Technical Support Scams},
booktitle = {{IEEE} International Conference on Big Data {(IEEE} BigData 2018),
Seattle, WA, USA, December 10-13, 2018},
pages = {3968--3971},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/BigData.2018.8621871},
doi = {10.1109/BIGDATA.2018.8621871},
timestamp = {Wed, 31 Mar 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bigdataconf/LarsonTHEW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/EdgeLW18,
author = {Darren Edge and
Jonathan Larson and
Christopher M. White},
editor = {Regan L. Mandryk and
Mark Hancock and
Mark Perry and
Anna L. Cox},
title = {Bringing {AI} to {BI:} Enabling Visual Analytics of Unstructured Data
in a Modern Business Intelligence Platform},
booktitle = {Extended Abstracts of the 2018 {CHI} Conference on Human Factors in
Computing Systems, {CHI} 2018, Montreal, QC, Canada, April 21-26,
2018},
publisher = {{ACM}},
year = {2018},
url = {https://doi.org/10.1145/3170427.3174367},
doi = {10.1145/3170427.3174367},
timestamp = {Fri, 12 Mar 2021 15:27:48 +0100},
biburl = {https://dblp.org/rec/conf/chi/EdgeLW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rtsi/CiprianiCDDBLCC18,
author = {Giovanni Cipriani and
Giuseppina Ciulla and
Vincenzo Di Dio and
V. DiMaria and
Valerio Lo Brano and
Gunnar Larson and
Christian Chiaruzzi and
Agostino Costantino and
I. Manduca},
title = {Realization of an Energetic Hub Based on a High-Performance Dish Stirling
Plant},
booktitle = {4th {IEEE} International Forum on Research and Technology for Society
and Industry, {RTSI} 2018, Palermo, Italy, September 10-13, 2018},
pages = {1--5},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/RTSI.2018.8548413},
doi = {10.1109/RTSI.2018.8548413},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/rtsi/CiprianiCDDBLCC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/PedersenML17,
author = {Walker S. Pedersen and
Lutfi Tugan Muftuler and
Christine L. Larson},
title = {Disentangling the effects of novelty, valence and trait anxiety in
the bed nucleus of the stria terminalis, amygdala and hippocampus
with high resolution 7T fMRI},
journal = {NeuroImage},
volume = {156},
pages = {293--301},
year = {2017},
url = {https://doi.org/10.1016/j.neuroimage.2017.05.009},
doi = {10.1016/J.NEUROIMAGE.2017.05.009},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/PedersenML17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LarsonSKS17,
author = {Chris Larson and
Josef B. Spjut and
Ross A. Knepper and
Robert F. Shepherd},
title = {OrbTouch: Recognizing Human Touch in Deformable Interfaces with Deep
Neural Networks},
journal = {CoRR},
volume = {abs/1706.02542},
year = {2017},
url = {http://arxiv.org/abs/1706.02542},
eprinttype = {arXiv},
eprint = {1706.02542},
timestamp = {Tue, 07 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/LarsonSKS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csedu/CetinA16,
author = {Ibrahim {\c{C}}etin and
Christine Andrews{-}Larson},
title = {Learning sorting algorithms through visualization construction},
journal = {Comput. Sci. Educ.},
volume = {26},
number = {1},
pages = {27--43},
year = {2016},
url = {https://doi.org/10.1080/08993408.2016.1160664},
doi = {10.1080/08993408.2016.1160664},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csedu/CetinA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csur/KoflerLH16,
author = {Christoph Kofler and
Martha A. Larson and
Alan Hanjalic},
title = {User Intent in Multimedia Search: {A} Survey of the State of the Art
and Future Challenges},
journal = {{ACM} Comput. Surv.},
volume = {49},
number = {2},
pages = {36:1--36:37},
year = {2016},
url = {https://doi.org/10.1145/2954930},
doi = {10.1145/2954930},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csur/KoflerLH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/KimJTHLC16,
author = {Chul Kim and
Siddharth Joshi and
Chris M. Thomas and
Sohmyung Ha and
Lawrence E. Larson and
Gert Cauwenberghs},
title = {A 1.3 mW 48 MHz 4 Channel {MIMO} Baseband Receiver With 65 dB Harmonic
Rejection and 48.5 dB Spatial Signal Separation},
journal = {{IEEE} J. Solid State Circuits},
volume = {51},
number = {4},
pages = {832--844},
year = {2016},
url = {https://doi.org/10.1109/JSSC.2016.2519398},
doi = {10.1109/JSSC.2016.2519398},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jssc/KimJTHLC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/mediaeval/2016,
editor = {Guillaume Gravier and
Claire{-}H{\'{e}}l{\`{e}}ne Demarty and
Herv{\'{e}} Bredin and
Bogdan Ionescu and
Christina Boididou and
Emmanuel Dellandr{\'{e}}a and
Jaeyoung Choi and
Michael Riegler and
Richard F. E. Sutcliffe and
Igor Sz{\"{o}}ke and
Gareth J. F. Jones and
Martha A. Larson},
title = {Working Notes Proceedings of the MediaEval 2016 Workshop, Hilversum,
The Netherlands, October 20-21, 2016},
series = {{CEUR} Workshop Proceedings},
volume = {1739},
publisher = {CEUR-WS.org},
year = {2016},
url = {https://ceur-ws.org/Vol-1739},
urn = {urn:nbn:de:0074-1739-9},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mediaeval/2016.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/MoTRPJKZXMCLMNW15,
author = {Huan Mo and
William K. Thompson and
Luke V. Rasmussen and
Jennifer A. Pacheco and
Guoqian Jiang and
Richard C. Kiefer and
Qian Zhu and
Jie Xu and
Enid N. H. Montague and
David S. Carrell and
Todd Lingren and
Frank D. Mentch and
Yizhao Ni and
Firas H. Wehbe and
Peggy L. Peissig and
Gerard Tromp and
Eric B. Larson and
Christopher G. Chute and
Jyotishman Pathak and
Joshua C. Denny and
Peter Speltz and
Abel N. Kho and
Gail P. Jarvik and
Cosmin Adrian Bejan and
Marc S. Williams and
Kenneth Borthwick and
Terrie E. Kitchner and
Dan M. Roden and
Paul A. Harris},
title = {Desiderata for computable representations of electronic health records-driven
phenotype algorithms},
journal = {J. Am. Medical Informatics Assoc.},
volume = {22},
number = {6},
pages = {1220--1230},
year = {2015},
url = {https://doi.org/10.1093/jamia/ocv112},
doi = {10.1093/JAMIA/OCV112},
timestamp = {Sun, 04 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jamia/MoTRPJKZXMCLMNW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcphy/LarsonY15,
author = {David J. Larson and
Christopher V. Young},
title = {A finite mass based method for Vlasov-Poisson simulations},
journal = {J. Comput. Phys.},
volume = {284},
pages = {171--185},
year = {2015},
url = {https://doi.org/10.1016/j.jcp.2014.12.022},
doi = {10.1016/J.JCP.2014.12.022},
timestamp = {Wed, 19 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcphy/LarsonY15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocn/YoonLGLCCM15,
author = {Jong H. Yoon and
Paul S. Larson and
Anthony Grandelis and
Christian La and
Edward Cui and
Cameron S. Carter and
Michael J. Minzenberg},
title = {Delay Period Activity of the Substantia Nigra during Proactive Control
of Response Selection as Determined by a Novel fMRI Localization Method},
journal = {J. Cogn. Neurosci.},
volume = {27},
number = {6},
pages = {1238--1248},
year = {2015},
url = {https://doi.org/10.1162/jocn\_a\_00775},
doi = {10.1162/JOCN\_A\_00775},
timestamp = {Tue, 23 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jocn/YoonLGLCCM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/Aartsen15,
author = {Mark G. Aartsen and
Rasha U. Abbasi and
Markus Ackermann and
Jenni Adams and
Juan Antonio Aguilar S{\'{a}}nchez and
Markus Ahlers and
David Altmann and
Carlos A. Arg{\"{u}}elles Delgado and
Jan Auffenberg and
Xinhua Bai and
Michael F. Baker and
Steven W. Barwick and
Volker Baum and
Ryan Bay and
James J. Beatty and
Julia K. Becker Tjus and
Karl{-}Heinz Becker and
Segev BenZvi and
Patrick Berghaus and
David Berley and
Elisa Bernardini and
Anna Bernhard and
David Z. Besson and
G. Binder and
Daniel Bindig and
Martin Bissok and
Erik Blaufuss and
Jan Blumenthal and
David J. Boersma and
Christian Bohm and
Debanjan Bose and
Sebastian B{\"{o}}ser and
Olga Botner and
Lionel Brayeur and
Hans{-}Peter Bretz and
Anthony M. Brown and
Ronald Bruijn and
James Casey and
Martin Casier and
Dmitry Chirkin and
Asen Christov and
Brian John Christy and
Ken Clark and
Lew Classen and
Fabian Clevermann and
Stefan Coenders and
Shirit Cohen and
Doug F. Cowen and
Angel H. Cruz Silva and
Matthias Danninger and
Jacob Daughhetee and
James C. Davis and
Melanie Day and
Catherine De Clercq and
Sam De Ridder and
Paolo Desiati and
Krijn D. de Vries and
Meike de With and
Tyce DeYoung and
Juan Carlos D{\'{\i}}az{-}V{\'{e}}lez and
Matthew Dunkman and
Ryan Eagan and
Benjamin Eberhardt and
Bj{\"{o}}rn Eichmann and
Jonathan Eisch and
Sebastian Euler and
Paul A. Evenson and
Oladipo O. Fadiran and
Ali R. Fazely and
Anatoli Fedynitch and
Jacob Feintzeig and
Tom Feusels and
Kirill Filimonov and
Chad Finley and
Tobias Fischer{-}Wasels and
Samuel Flis and
Anna Franckowiak and
Katharina Frantzen and
Tomasz Fuchs and
Thomas K. Gaisser and
Joseph S. Gallagher and
Lisa Marie Gerhardt and
Laura E. Gladstone and
Thorsten Gl{\"{u}}senkamp and
Azriel Goldschmidt and
Geraldina Golup and
Javier G. Gonz{\'{a}}lez and
Jordan A. Goodman and
Dariusz G{\'{o}}ra and
Dylan T. Grandmont and
Darren Grant and
Pavel Gretskov and
John C. Groh and
Andreas Gro{\ss} and
Chang Hyon Ha and
Abd Al Karim Haj Ismail and
Patrick Hallen and
Allan Hallgren and
Francis Halzen and
Kael D. Hanson and
Dustin Hebecker and
David Heereman and
Dirk Heinen and
Klaus Helbing and
Robert Eugene Hellauer III and
Stephanie Virginia Hickford and
Gary C. Hill and
Kara D. Hoffman and
Ruth Hoffmann and
Andreas Homeier and
Kotoyo Hoshina and
Feifei Huang and
Warren Huelsnitz and
Per Olof Hulth and
Klas Hultqvist and
Shahid Hussain and
Aya Ishihara and
Emanuel Jacobi and
John E. Jacobsen and
Kai Jagielski and
George S. Japaridze and
Kyle Jero and
Ola Jlelati and
Basho Kaminsky and
Alexander Kappes and
Timo Karg and
Albrecht Karle and
Matthew Kauer and
John Lawrence Kelley and
Joanna Kiryluk and
J. Kl{\"{a}}s and
Spencer R. Klein and
Jan{-}Hendrik K{\"{o}}hne and
Georges Kohnen and
Hermann Kolanoski and
Lutz K{\"{o}}pke and
Claudio Kopper and
Sandro Kopper and
D. Jason Koskinen and
Marek Kowalski and
Mark Krasberg and
Anna Kriesten and
Kai Michael Krings and
G{\"{o}}sta Kroll and
Jan Kunnen and
Naoko Kurahashi and
Takao Kuwabara and
Mathieu L. M. Labare and
Hagar Landsman and
Michael James Larson and
Mariola Lesiak{-}Bzdak and
Martin Leuermann and
Julia Leute and
Jan L{\"{u}}nemann and
Oscar A. Mac{\'{\i}}as{-}Ram{\'{\i}}rez and
James Madsen and
Giuliano Maggi and
Reina Maruyama and
Keiichi Mase and
Howard S. Matis and
Frank McNally and
Kevin James Meagher and
Martin Merck and
Gonzalo Merino Ar{\'{e}}valo and
Thomas Meures and
Sandra Miarecki and
Eike Middell and
Natalie Milke and
John Lester Miller and
Lars Mohrmann and
Teresa Montaruli and
Robert M. Morse and
Rolf Nahnhauer and
Uwe Naumann and
Hans Niederhausen and
Sarah C. Nowicki and
David R. Nygren and
Anna Obertacke and
Sirin Odrowski and
Alex Olivas and
Ahmad Omairat and
Aongus Starbuck {\'{O}} Murchadha and
Larissa Paul and
Joshua A. Pepper and
Carlos P{\'{e}}rez de los Heros and
Carl Pfendner and
Damian Pieloth and
Elisa Pinat and
Jonas Posselt and
P. Buford Price and
Gerald T. Przybylski and
Melissa Quinnan and
Leif R{\"{a}}del and
Ian Rae and
Mohamed Rameez and
Katherine Rawlins and
Peter Christian Redl and
Ren{\'{e}} Reimann and
Elisa Resconi and
Wolfgang Rhode and
Mathieu Ribordy and
Michael Richman and
Benedikt Riedel and
J. P. Rodrigues and
Carsten Rott and
Tim Ruhe and
Bakhtiyar Ruzybayev and
Dirk Ryckbosch and
Sabine M. Saba and
Heinz{-}Georg Sander and
Juan Marcos Santander and
Subir Sarkar and
Kai Schatto and
Florian Scheriau and
Torsten Schmidt and
Martin Schmitz and
Sebastian Schoenen and
Sebastian Sch{\"{o}}neberg and
Arne Sch{\"{o}}nwald and
Anne Schukraft and
Lukas Schulte and
David Schultz and
Olaf Schulz and
David Seckel and
Yolanda Sestayo de la Cerra and
Surujhdeo Seunarine and
Rezo Shanidze and
Chris Sheremata and
Miles W. E. Smith and
Dennis Soldin and
Glenn M. Spiczak and
Christian Spiering and
Michael Stamatikos and
Todor Stanev and
Nick A. Stanisha and
Alexander Stasik and
Thorsten Stezelberger and
Robert G. Stokstad and
Achim St{\"{o}}{\ss}l and
Erik A. Strahler and
Rickard Str{\"{o}}m and
Nora Linn Strotjohann and
Gregory W. Sullivan and
Henric Taavola and
Ignacio J. Taboada and
Alessio Tamburro and
Andreas Tepe and
Samvel Ter{-}Antonyan and
Gordana Tesic and
Serap Tilav and
Patrick A. Toale and
Moriah Natasha Tobin and
Simona Toscano and
Maria Tselengidou and
Elisabeth Unger and
Marcel Usner and
Sofia Vallecorsa and
Nick van Eijndhoven and
Arne Van Overloop and
Jakob van Santen and
Markus Vehring and
Markus Voge and
Matthias Vraeghe and
Christian Walck and
Tilo Waldenmaier and
Marius Wallraff and
Christopher N. Weaver and
Mark T. Wellons and
Christopher H. Wendt and
Stefan Westerhoff and
Nathan Whitehorn and
Klaus Wiebe and
Christopher Wiebusch and
Dawn R. Williams and
Henrike Wissing and
Martin Wolf and
Terri R. Wood and
Kurt Woschnagg and
Donglian Xu and
Xianwu Xu and
Juan Pablo Y{\'{a}}{\~{n}}ez Garza and
Gaurang B. Yodh and
Shigeru Yoshida and
Pavel Zarzhitsky and
Jan Ziemann and
Simon Zierke and
Marcel Zoll},
title = {The IceProd framework: Distributed data processing for the IceCube
neutrino observatory},
journal = {J. Parallel Distributed Comput.},
volume = {75},
pages = {198--211},
year = {2015},
url = {https://doi.org/10.1016/j.jpdc.2014.08.001},
doi = {10.1016/J.JPDC.2014.08.001},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jpdc/Aartsen15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/GriffithGSRCBKC15,
author = {Malachi Griffith and
Obi L. Griffith and
Scott M. Smith and
Avinash Ramu and
Matthew B. Callaway and
Anthony M. Brummett and
Michael J. Kiwala and
Adam C. Coffman and
Allison A. Regier and
Benjamin J. Oberkfell and
Gabriel E. Sanderson and
Thomas P. Mooney and
Nathaniel G. Nutter and
Edward A. Belter and
Feiyu Du and
Robert L. Long and
Travis E. Abbott and
Ian T. Ferguson and
David L. Morton and
Mark M. Burnett and
James V. Weible and
Joshua B. Peck and
Adam Dukes and
Joshua F. McMichael and
Justin T. Lolofie and
Brian R. Derickson and
Jasreet Hundal and
Zachary L. Skidmore and
Benjamin J. Ainscough and
Nathan D. Dees and
William S. Schierding and
Cyriac Kandoth and
Kyung H. Kim and
Charles Lu and
Christopher C. Harris and
Nicole Maher and
Christopher A. Maher and
Vincent J. Magrini and
Benjamin S. Abbott and
Ken Chen and
Eric Clark and
Indraniel Das and
Xian Fan and
Amy E. Hawkins and
Todd G. Hepler and
Todd N. Wylie and
Shawn M. Leonard and
William E. Schroeder and
Xiaoqi Shi and
Lynn K. Carmichael and
Matthew R. Weil and
Richard W. Wohlstadter and
Gary Stiehr and
Michael D. McLellan and
Craig S. Pohl and
Christopher A. Miller and
Daniel C. Koboldt and
Jason R. Walker and
James M. Eldred and
David E. Larson and
David J. Dooling and
Li Ding and
Elaine R. Mardis and
Richard K. Wilson},
title = {Genome Modeling System: {A} Knowledge Management Platform for Genomics},
journal = {PLoS Comput. Biol.},
volume = {11},
number = {7},
year = {2015},
url = {https://doi.org/10.1371/journal.pcbi.1004274},
doi = {10.1371/JOURNAL.PCBI.1004274},
timestamp = {Fri, 23 Aug 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/GriffithGSRCBKC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/HelikarCDHLR15,
author = {Tom{\'{a}}s Helikar and
Christine E. Cutucache and
Lauren M. Dahlquist and
Tyler A. Herek and
Joshua J. Larson and
Jim A. Rogers},
title = {Integrating Interactive Computational Modeling in Biology Curricula},
journal = {PLoS Comput. Biol.},
volume = {11},
number = {3},
year = {2015},
url = {https://doi.org/10.1371/journal.pcbi.1004131},
doi = {10.1371/JOURNAL.PCBI.1004131},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/HelikarCDHLR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/KoflerBLCHC15,
author = {Christoph Kofler and
Subhabrata Bhattacharya and
Martha A. Larson and
Tao Chen and
Alan Hanjalic and
Shih{-}Fu Chang},
title = {Uploader Intent for Online Video: Typology, Inference, and Applications},
journal = {{IEEE} Trans. Multim.},
volume = {17},
number = {8},
pages = {1200--1212},
year = {2015},
url = {https://doi.org/10.1109/TMM.2015.2445573},
doi = {10.1109/TMM.2015.2445573},
timestamp = {Mon, 25 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmm/KoflerBLCHC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rws/ThomasL15,
author = {Chris M. Thomas and
Lawrence E. Larson},
title = {A GaN {HEMT} N-path filter with +17 dBm jammer tolerance},
booktitle = {2015 {IEEE} Radio and Wireless Symposium, {RWS} 2015, San Diego, CA,
USA, January 25-28, 2015},
pages = {71--73},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/RWS.2015.7129742},
doi = {10.1109/RWS.2015.7129742},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/rws/ThomasL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rws/ThomasLL15,
author = {Chris M. Thomas and
Vincent W. Leung and
Lawrence E. Larson},
title = {A pseudorandom clocking scheme for a {CMOS} N-path bandpass filter
with 10-to-15 dB spurious leakage improvement},
booktitle = {2015 {IEEE} Radio and Wireless Symposium, {RWS} 2015, San Diego, CA,
USA, January 25-28, 2015},
pages = {105--107},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/RWS.2015.7129715},
doi = {10.1109/RWS.2015.7129715},
timestamp = {Fri, 30 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/rws/ThomasLL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vlsic/KimJTHALC15,
author = {Chul Kim and
Siddharth Joshi and
Chris M. Thomas and
Sohmyung Ha and
Abraham Akinin and
Lawrence E. Larson and
Gert Cauwenberghs},
title = {A {CMOS} 4-channel {MIMO} baseband receiver with 65dB harmonic rejection
over 48MHz and 50dB spatial signal separation over 3MHz at 1.3mW},
booktitle = {Symposium on {VLSI} Circuits, {VLSIC} 2015, Kyoto, Japan, June 17-19,
2015},
pages = {304},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/VLSIC.2015.7231300},
doi = {10.1109/VLSIC.2015.7231300},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/vlsic/KimJTHALC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bsl/Dobrinen14,
author = {Natasha Dobrinen},
title = {James Cummings and Ernest Schimmerling, editors. Lecture Note Series
of the London Mathematical Society, vol. 406. Cambridge University
Press, New York, xi + 419 pp. - Paul B. Larson, Peter Lumsdaine, and
Yimu Yin. An introduction to Pmax forcing. pp. 5-23. - Simon Thomas
and Scott Schneider. Countable Borel equivalence relations. pp. 25-62.
- Ilijas Farah and Eric Wofsey. Set theory and operator algebras.
pp. 63-119. - Justin Moore and David Milovich. {A} tutorial on set
mapping reflection. pp. 121-144. - Vladimir G. Pestov and Aleksandra
Kwiatkowska. An introduction to hyperlinear and sofic groups. pp.
145-185. - Itay Neeman and Spencer Unger. Aronszajn trees and the
{SCH.} pp. 187-206. - Todd Eisworth, Justin Tatch Moore, and David
Milovich. Iterated forcing and the Continuum Hypothesis. pp. 207-244.
- Moti Gitik and Spencer Unger. Short extender forcing. pp. 245-263.
- Alexander S. Kechris and Robin D. Tucker-Drob. The complexity of
classification problems in ergodic theory. pp. 265-299. - Menachem
Magidor and Chris Lambie-Hanson. On the strengths and weaknesses of
weak squares. pp. 301-330. - Boban Veli{\v{c}}kovi{\'{c}} and
Giorgio Venturi. Proper forcing remastered. pp. 331-362. - Asger To{\"{O}}rnquist
and Martino Lupini. Set theory and von Neumann algebras. pp. 363-396.
- W. Hugh Woodin, Jacob Davis, and Daniel Rodr{\'{I}}guez. The
{HOD} dichotomy. pp. 397-419},
journal = {Bull. Symb. Log.},
volume = {20},
number = {1},
pages = {94--97},
year = {2014},
url = {https://doi.org/10.1017/bsl.2014.1},
doi = {10.1017/BSL.2014.1},
timestamp = {Fri, 03 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/bsl/Dobrinen14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cars/MaNHWPVHABSLS14,
author = {Lijun Ma and
Alan Nichol and
Sabbir Hossain and
Brian Wang and
Paula Petti and
Rosemin Vellani and
Chris Higby and
Salahuddin Ahmad and
Igor Barani and
Dennis C. Shrieve and
David A. Larson and
Arjun Sahgal},
title = {Variable dose interplay effects across radiosurgical apparatus in
treating multiple brain metastases},
journal = {Int. J. Comput. Assist. Radiol. Surg.},
volume = {9},
number = {6},
pages = {1079--1086},
year = {2014},
url = {https://doi.org/10.1007/s11548-014-1001-4},
doi = {10.1007/S11548-014-1001-4},
timestamp = {Tue, 04 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cars/MaNHWPVHABSLS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iando/BoudreauSL14,
author = {Marie{-}Claude Boudreau and
Christina Serrano and
Keri Larson},
title = {IT-driven identity work: Creating a group identity in a digital environment},
journal = {Inf. Organ.},
volume = {24},
number = {1},
pages = {1--24},
year = {2014},
url = {https://doi.org/10.1016/j.infoandorg.2013.11.001},
doi = {10.1016/J.INFOANDORG.2013.11.001},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iando/BoudreauSL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/GramfortLLESBPH14,
author = {Alexandre Gramfort and
Martin Luessi and
Eric Larson and
Denis A. Engemann and
Daniel Strohmeier and
Christian Brodbeck and
Lauri Parkkonen and
Matti S. H{\"{a}}m{\"{a}}l{\"{a}}inen},
title = {{MNE} software for processing {MEG} and {EEG} data},
journal = {NeuroImage},
volume = {86},
pages = {446--460},
year = {2014},
url = {https://doi.org/10.1016/j.neuroimage.2013.10.027},
doi = {10.1016/J.NEUROIMAGE.2013.10.027},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/neuroimage/GramfortLLESBPH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/KoflerLH14,
author = {Christoph Kofler and
Martha A. Larson and
Alan Hanjalic},
title = {Intent-Aware Video Search Result Optimization},
journal = {{IEEE} Trans. Multim.},
volume = {16},
number = {5},
pages = {1421--1433},
year = {2014},
url = {https://doi.org/10.1109/TMM.2014.2315777},
doi = {10.1109/TMM.2014.2315777},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmm/KoflerLH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/KoflerYLMHL14,
author = {Christoph Kofler and
Linjun Yang and
Martha A. Larson and
Tao Mei and
Alan Hanjalic and
Shipeng Li},
title = {Predicting Failing Queries in Video Search},
journal = {{IEEE} Trans. Multim.},
volume = {16},
number = {7},
pages = {1973--1985},
year = {2014},
url = {https://doi.org/10.1109/TMM.2014.2347937},
doi = {10.1109/TMM.2014.2347937},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tmm/KoflerYLMHL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/OverbyRHCPHFSDL14,
author = {Casey L. Overby and
Luke V. Rasmussen and
Andrea L. Hartzler and
John J. Connolly and
Josh F. Peterson and
RoseMary Hedberg and
Robert R. Freimuth and
Brian H. Shirts and
Joshua C. Denny and
Eric B. Larson and
Christopher G. Chute and
Gail P. Jarvik and
James D. Ralston and
Alan R. Shuldiner and
Iftikhar J. Kullo and
Peter Tarczy{-}Hornoch and
Marc S. Williams},
title = {A Template for Authoring and Adapting Genomic Medicine Content in
the eMERGE Infobutton Project},
booktitle = {{AMIA} 2014, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 15-19, 2014},
publisher = {{AMIA}},
year = {2014},
url = {https://knowledge.amia.org/56638-amia-1.1540970/t-004-1.1544972/f-004-1.1544973/a-193-1.1545094/a-194-1.1545091},
timestamp = {Wed, 17 Apr 2024 11:47:48 +0200},
biburl = {https://dblp.org/rec/conf/amia/OverbyRHCPHFSDL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicc/ThomasL14,
author = {Chris M. Thomas and
Lawrence E. Larson},
title = {A 65 nm {CMOS} tunable 0.1-to-1.6 GHz distributed transmission line
N-path filter with +10 dBm blocker tolerance},
booktitle = {Proceedings of the {IEEE} 2014 Custom Integrated Circuits Conference,
{CICC} 2014, San Jose, CA, USA, September 15-17, 2014},
pages = {1--4},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/CICC.2014.6946127},
doi = {10.1109/CICC.2014.6946127},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/cicc/ThomasL14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esscirc/KimHTJPLC14,
author = {Chul Kim and
Sohmyung Ha and
Chris M. Thomas and
Siddharth Joshi and
Jongkil Park and
Lawrence E. Larson and
Gert Cauwenberghs},
title = {A 7.86 mW +12.5 dBm in-band {IIP3} 8-to-320 MHz capacitive harmonic
rejection mixer in 65nm {CMOS}},
booktitle = {{ESSCIRC} 2014 - 40th European Solid State Circuits Conference, Venice
Lido, Italy, September 22-26, 2014},
pages = {227--230},
publisher = {{IEEE}},
year = {2014},
url = {https://doi.org/10.1109/ESSCIRC.2014.6942063},
doi = {10.1109/ESSCIRC.2014.6942063},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/esscirc/KimHTJPLC14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mir/KordumovaKKHFKRDLS14,
author = {Svetlana Kordumova and
Christoph Kofler and
Dennis C. Koelma and
Bouke Huurnink and
Bauke Freiburg and
Joris Kleinveld and
Manuel van Rijn and
Marco van Deursen and
Martha A. Larson and
Cees G. M. Snoek},
editor = {Mohan S. Kankanhalli and
Stefan M. R{\"{u}}ger and
R. Manmatha and
Joemon M. Jose and
Keith van Rijsbergen},
title = {SocialZap: Catch-up on Interesting Television Fragments Discovered
from Social Media},
booktitle = {International Conference on Multimedia Retrieval, {ICMR} '14, Glasgow,
United Kingdom - April 01 - 04, 2014},
pages = {538},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2578726.2582622},
doi = {10.1145/2578726.2582622},
timestamp = {Thu, 15 Jul 2021 17:18:30 +0200},
biburl = {https://dblp.org/rec/conf/mir/KordumovaKKHFKRDLS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/RieglerLLK14,
author = {Michael Riegler and
Martha A. Larson and
Mathias Lux and
Christoph Kofler},
editor = {Kien A. Hua and
Yong Rui and
Ralf Steinmetz and
Alan Hanjalic and
Apostol Natsev and
Wenwu Zhu},
title = {How 'How' Reflects What's What: Content-based Exploitation of How
Users Frame Social Images},
booktitle = {Proceedings of the {ACM} International Conference on Multimedia, {MM}
'14, Orlando, FL, USA, November 03 - 07, 2014},
pages = {397--406},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2647868.2654894},
doi = {10.1145/2647868.2654894},
timestamp = {Wed, 08 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mm/RieglerLLK14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShawGBBBCDDEFFGGGHIIKLLLLLKMMMMNPQRSSSSSSTTTTVWY14,
author = {David E. Shaw and
J. P. Grossman and
Joseph A. Bank and
Brannon Batson and
J. Adam Butts and
Jack C. Chao and
Martin M. Deneroff and
Ron O. Dror and
Amos Even and
Christopher H. Fenton and
Anthony Forte and
Joseph Gagliardo and
Gennette Gill and
Brian Greskamp and
C. Richard Ho and
Douglas J. Ierardi and
Lev Iserovich and
Jeffrey Kuskin and
Richard H. Larson and
Timothy Layman and
Li{-}Siang Lee and
Adam K. Lerer and
Chester Li and
Daniel Killebrew and
Kenneth M. Mackenzie and
Shark Yeuk{-}Hai Mok and
Mark A. Moraes and
Rolf Mueller and
Lawrence J. Nociolo and
Jon L. Peticolas and
Terry Quan and
Daniel Ramot and
John K. Salmon and
Daniele Paolo Scarpazza and
U. Ben Schafer and
Naseer Siddique and
Christopher W. Snyder and
Jochen Spengler and
Ping Tak Peter Tang and
Michael Theobald and
Horia Toma and
Brian Towles and
Benjamin Vitale and
Stanley C. Wang and
Cliff Young},
editor = {Trish Damkroger and
Jack J. Dongarra},
title = {Anton 2: Raising the Bar for Performance and Programmability in a
Special-Purpose Molecular Dynamics Supercomputer},
booktitle = {International Conference for High Performance Computing, Networking,
Storage and Analysis, {SC} 2014, New Orleans, LA, USA, November 16-21,
2014},
pages = {41--53},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/SC.2014.9},
doi = {10.1109/SC.2014.9},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/ShawGBBBCDDEFFGGGHIIKLLLLLKMMMMNPQRSSSSSSTTTTVWY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/HuntleyLCBLHK13,
author = {Melanie A. Huntley and
Jessica L. Larson and
Christina Chaivorapol and
Gabriel Becker and
Michael Lawrence and
Jason A. Hackney and
Joshua S. Kaminker},
title = {ReportingTools: an automated result processing and presentation toolkit
for high-throughput genomic analyses},
journal = {Bioinform.},
volume = {29},
number = {24},
pages = {3220--3221},
year = {2013},
url = {https://doi.org/10.1093/bioinformatics/btt551},
doi = {10.1093/BIOINFORMATICS/BTT551},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/HuntleyLCBLHK13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/YinLBBALN13,
author = {Ming Yin and
Hao Li and
Christopher W. Bull and
David A. Borton and
Juan Aceros and
Lawrence E. Larson and
Arto V. Nurmikko},
title = {An externally head-mounted wireless neural recording device for laboratory
animal research and possible human clinical use},
booktitle = {35th Annual International Conference of the {IEEE} Engineering in
Medicine and Biology Society, {EMBC} 2013, Osaka, Japan, July 3-7,
2013},
pages = {3109--3114},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/EMBC.2013.6610199},
doi = {10.1109/EMBC.2013.6610199},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/embc/YinLBBALN13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/LarsonHHRSRSAKNSWLO13,
author = {Jay Walter Larson and
Markus Hegland and
Brendan Harding and
Stephen G. Roberts and
Linda Stals and
Alistair P. Rendell and
Peter E. Strazdins and
Md. Mohsin Ali and
Christoph Kowitz and
Ross H. Nobes and
James Southern and
Nicholas Wilson and
M. Li and
Y. Oishi},
editor = {Vassil Alexandrov and
Michael Lees and
Valeria V. Krzhizhanovskaya and
Jack J. Dongarra and
Peter M. A. Sloot},
title = {Fault-Tolerant Grid-Based Solvers: Combining Concepts from Sparse
Grids and MapReduce},
booktitle = {Proceedings of the International Conference on Computational Science,
{ICCS} 2013, Barcelona, Spain, 5-7 June, 2013},
series = {Procedia Computer Science},
volume = {18},
pages = {130--139},
publisher = {Elsevier},
year = {2013},
url = {https://doi.org/10.1016/j.procs.2013.05.176},
doi = {10.1016/J.PROCS.2013.05.176},
timestamp = {Tue, 19 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iccS/LarsonHHRSRSAKNSWLO13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itsc/LarsonKLJ13,
author = {Jeffrey Larson and
Christoph Kammer and
Kuo{-}Yun Liang and
Karl Henrik Johansson},
title = {Coordinated route optimization for heavy-duty vehicle platoons},
booktitle = {16th International {IEEE} Conference on Intelligent Transportation
Systems, {ITSC} 2013, The Hague, The Netherlands, October 6-9, 2013},
pages = {1196--1202},
publisher = {{IEEE}},
year = {2013},
url = {https://doi.org/10.1109/ITSC.2013.6728395},
doi = {10.1109/ITSC.2013.6728395},
timestamp = {Wed, 20 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/itsc/LarsonKLJ13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mmsys/SchmiedekeXFEKLELJS13,
author = {Sebastian Schmiedeke and
Peng Xu and
Isabelle Ferran{\'{e}} and
Maria Eskevich and
Christoph Kofler and
Martha A. Larson and
Yannick Est{\`{e}}ve and
Lori Lamel and
Gareth J. F. Jones and
Thomas Sikora},
editor = {Carsten Griwodz},
title = {Blip10000: a social video dataset containing {SPUG} content for tagging
and retrieval},
booktitle = {Multimedia Systems Conference 2013, MMSys '13, Oslo, Norway, February
27 - March 01, 2013},
pages = {96--101},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2483977.2483988},
doi = {10.1145/2483977.2483988},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mmsys/SchmiedekeXFEKLELJS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/AartsenA13,
author = {Mark G. Aartsen and
Rasha U. Abbasi and
Markus Ackermann and
Jenni Adams and
Juan Antonio Aguilar S{\'{a}}nchez and
Markus Ahlers and
David Altmann and
Carlos A. Arg{\"{u}}elles Delgado and
Jan Auffenberg and
Xinhua Bai and
Michael F. Baker and
Steven W. Barwick and
Volker Baum and
Ryan Bay and
James J. Beatty and
Julia K. Becker Tjus and
Karl{-}Heinz Becker and
Segev BenZvi and
Patrick Berghaus and
David Berley and
Elisa Bernardini and
Anna Bernhard and
David Z. Besson and
G. Binder and
Daniel Bindig and
Martin Bissok and
Erik Blaufuss and
Jan Blumenthal and
David J. Boersma and
Christian Bohm and
Debanjan Bose and
Sebastian B{\"{o}}ser and
Olga Botner and
Lionel Brayeur and
Hans{-}Peter Bretz and
Anthony M. Brown and
Ronald Bruijn and
James Casey and
Martin Casier and
Dmitry Chirkin and
Asen Christov and
Brian John Christy and
Ken Clark and
Lew Classen and
Fabian Clevermann and
Stefan Coenders and
Shirit Cohen and
Doug F. Cowen and
Angel H. Cruz Silva and
Matthias Danninger and
Jacob Daughhetee and
James C. Davis and
Melanie Day and
Catherine De Clercq and
Sam De Ridder and
Paolo Desiati and
Krijn D. de Vries and
Meike de With and
Tyce DeYoung and
Juan Carlos D{\'{\i}}az{-}V{\'{e}}lez and
Matthew Dunkman and
Ryan Eagan and
Benjamin Eberhardt and
Bj{\"{o}}rn Eichmann and
Jonathan Eisch and
Sebastian Euler and
Paul A. Evenson and
Oladipo O. Fadiran and
Ali R. Fazely and
Anatoli Fedynitch and
Jacob Feintzeig and
Tom Feusels and
Kirill Filimonov and
Chad Finley and
Tobias Fischer{-}Wasels and
Samuel Flis and
Anna Franckowiak and
Katharina Frantzen and
Tomasz Fuchs and
Thomas K. Gaisser and
Joseph S. Gallagher and
Lisa Marie Gerhardt and
Laura E. Gladstone and
Thorsten Gl{\"{u}}senkamp and
Azriel Goldschmidt and
Geraldina Golup and
Javier G. Gonz{\'{a}}lez and
Jordan A. Goodman and
Dariusz G{\'{o}}ra and
Dylan T. Grandmont and
Darren Grant and
Pavel Gretskov and
John C. Groh and
Andreas Gro{\ss} and
Chang Hyon Ha and
Abd Al Karim Haj Ismail and
Patrick Hallen and
Allan Hallgren and
Francis Halzen and
Kael D. Hanson and
Dustin Hebecker and
David Heereman and
Dirk Heinen and
Klaus Helbing and
Robert Eugene Hellauer III and
Stephanie Virginia Hickford and
Gary C. Hill and
Kara D. Hoffman and
Ruth Hoffmann and
Andreas Homeier and
Kotoyo Hoshina and
Feifei Huang and
Warren Huelsnitz and
Per Olof Hulth and
Klas Hultqvist and
Shahid Hussain and
Aya Ishihara and
Emanuel Jacobi and
John E. Jacobsen and
Kai Jagielski and
George S. Japaridze and
Kyle Jero and
Ola Jlelati and
Basho Kaminsky and
Alexander Kappes and
Timo Karg and
Albrecht Karle and
Matthew Kauer and
John Lawrence Kelley and
Joanna Kiryluk and
J. Kl{\"{a}}s and
Spencer R. Klein and
Jan{-}Hendrik K{\"{o}}hne and
Georges Kohnen and
Hermann Kolanoski and
Lutz K{\"{o}}pke and
Claudio Kopper and
Sandro Kopper and
D. Jason Koskinen and
Marek Kowalski and
Mark Krasberg and
Anna Kriesten and
Kai Michael Krings and
G{\"{o}}sta Kroll and
Jan Kunnen and
Naoko Kurahashi and
Takao Kuwabara and
Mathieu L. M. Labare and
Hagar Landsman and
Michael James Larson and
Mariola Lesiak{-}Bzdak and
Martin Leuermann and
Julia Leute and
Jan L{\"{u}}nemann and
Oscar A. Mac{\'{\i}}as{-}Ram{\'{\i}}rez and
James Madsen and
Giuliano Maggi and
Reina Maruyama and
Keiichi Mase and
Howard S. Matis and
Frank McNally and
Kevin James Meagher and
Martin Merck and
Gonzalo Merino Ar{\'{e}}valo and
Thomas Meures and
Sandra Miarecki and
Eike Middell and
Natalie Milke and
John Lester Miller and
Lars Mohrmann and
Teresa Montaruli and
Robert M. Morse and
Rolf Nahnhauer and
Uwe Naumann and
Hans Niederhausen and
Sarah C. Nowicki and
David R. Nygren and
Anna Obertacke and
Sirin Odrowski and
Alex Olivas and
Ahmad Omairat and
Aongus Starbuck {\'{O}} Murchadha and
Larissa Paul and
Joshua A. Pepper and
Carlos P{\'{e}}rez de los Heros and
Carl Pfendner and
Damian Pieloth and
Elisa Pinat and
Jonas Posselt and
P. Buford Price and
Gerald T. Przybylski and
Melissa Quinnan and
Leif R{\"{a}}del and
Ian Rae and
Mohamed Rameez and
Katherine Rawlins and
Peter Christian Redl and
Ren{\'{e}} Reimann and
Elisa Resconi and
Wolfgang Rhode and
Mathieu Ribordy and
Michael Richman and
Benedikt Riedel and
J. P. Rodrigues and
Carsten Rott and
Tim Ruhe and
Bakhtiyar Ruzybayev and
Dirk Ryckbosch and
Sabine M. Saba and
Heinz{-}Georg Sander and
Juan Marcos Santander and
Subir Sarkar and
Kai Schatto and
Florian Scheriau and
Torsten Schmidt and
Martin Schmitz and
Sebastian Schoenen and
Sebastian Sch{\"{o}}neberg and
Arne Sch{\"{o}}nwald and
Anne Schukraft and
Lukas Schulte and
David Schultz and
Olaf Schulz and
David Seckel and
Yolanda Sestayo de la Cerra and
Surujhdeo Seunarine and
Rezo Shanidze and
Chris Sheremata and
Miles W. E. Smith and
Dennis Soldin and
Glenn M. Spiczak and
Christian Spiering and
Michael Stamatikos and
Todor Stanev and
Nick A. Stanisha and
Alexander Stasik and
Thorsten Stezelberger and
Robert G. Stokstad and
Achim St{\"{o}}{\ss}l and
Erik A. Strahler and
Rickard Str{\"{o}}m and
Nora Linn Strotjohann and
Gregory W. Sullivan and
Henric Taavola and
Ignacio J. Taboada and
Alessio Tamburro and
Andreas Tepe and
Samvel Ter{-}Antonyan and
Gordana Tesic and
Serap Tilav and
Patrick A. Toale and
Moriah Natasha Tobin and
Simona Toscano and
Maria Tselengidou and
Elisabeth Unger and
Marcel Usner and
Sofia Vallecorsa and
Nick van Eijndhoven and
Arne Van Overloop and
Jakob van Santen and
Markus Vehring and
Markus Voge and
Matthias Vraeghe and
Christian Walck and
Tilo Waldenmaier and
Marius Wallraff and
Christopher N. Weaver and
Mark T. Wellons and
Christopher H. Wendt and
Stefan Westerhoff and
Nathan Whitehorn and
Klaus Wiebe and
Christopher Wiebusch and
Dawn R. Williams and
Henrike Wissing and
Martin Wolf and
Terri R. Wood and
Kurt Woschnagg and
Donglian Xu and
Xianwu Xu and
Juan Pablo Y{\'{a}}{\~{n}}ez Garza and
Gaurang B. Yodh and
Shigeru Yoshida and
Pavel Zarzhitsky and
Jan Ziemann and
Simon Zierke and
Marcel Zoll},
title = {The IceProd Framework: Distributed Data Processing for the IceCube
Neutrino Observatory},
journal = {CoRR},
volume = {abs/1311.5904},
year = {2013},
url = {http://arxiv.org/abs/1311.5904},
eprinttype = {arXiv},
eprint = {1311.5904},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/AartsenA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/LarsonHCKADLMWD12,
author = {David E. Larson and
Christopher C. Harris and
Ken Chen and
Daniel C. Koboldt and
Travis E. Abbott and
David J. Dooling and
Timothy J. Ley and
Elaine R. Mardis and
Richard K. Wilson and
Li Ding},
title = {SomaticSniper: identification of somatic point mutations in whole
genome sequencing data},
journal = {Bioinform.},
volume = {28},
number = {3},
pages = {311--317},
year = {2012},
url = {https://doi.org/10.1093/bioinformatics/btr665},
doi = {10.1093/BIOINFORMATICS/BTR665},
timestamp = {Wed, 21 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bioinformatics/LarsonHCKADLMWD12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/CarrollLEBCPPCKLMJCCLMK12,
author = {Robert J. Carroll and
Katherine P. Liao and
Anne E. Eyler and
Lisa Bastarache and
Dana C. Crawford and
Peggy L. Peissig and
Jyotishman Pathak and
David Carrell and
Abel N. Kho and
Rongling Li and
Daniel R. Masys and
Gail P. Jarvik and
Christopher G. Chute and
Rex L. Chisholm and
Eric B. Larson and
Catherine A. McCarty and
Iftikhar J. Kullo},
title = {Using PheWAS to Assess Pleiotropy of Genetic Risk Scores for Rheumatoid
Arthritis and Coronary Artery Disease in the eMERGE Network},
booktitle = {{AMIA} 2012, American Medical Informatics Association Annual Symposium,
Chicago, Illinois, USA, November 3-7, 2012},
publisher = {{AMIA}},
year = {2012},
url = {https://knowledge.amia.org/amia-55142-a2012a-1.636547/t-006-1.640361/f-001-1.640362/a-224-1.640544/a-225-1.640540},
timestamp = {Wed, 17 Apr 2024 11:48:03 +0200},
biburl = {https://dblp.org/rec/conf/amia/CarrollLEBCPPCKLMJCCLMK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/HassolWBICHLYYCLW12,
author = {Andrea Hassol and
Meghan Woo and
Sarah Ball and
David Izrael and
Pascale Carayon and
Peter Hoonakker and
Ilene Ladd and
Christina Yule and
James Younkin and
Kimberly Chaundy and
Sharon Larson and
James M. Walker},
title = {Chronic Care Patients' Attitudes Regarding Electronic Health Information
Exchange},
booktitle = {{AMIA} 2012, American Medical Informatics Association Annual Symposium,
Chicago, Illinois, USA, November 3-7, 2012},
publisher = {{AMIA}},
year = {2012},
url = {https://knowledge.amia.org/amia-55142-a2012a-1.636547/t-007-1.639272/f-001-1.639273/a-378-1.640067/a-379-1.640064},
timestamp = {Wed, 17 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amia/HassolWBICHLYYCLW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbmi/EskevichJWLAVO12,
author = {Maria Eskevich and
Gareth J. F. Jones and
Christian Wartena and
Martha A. Larson and
Robin Aly and
Thijs Verschoor and
Roeland Ordelman},
editor = {Patrick Lambert},
title = {Comparing retrieval effectiveness of alternative content segmentation
methods for Internet video search},
booktitle = {10th International Workshop on Content-Based Multimedia Indexing,
{CBMI} 2012, Annecy, France, June 27-29, 2012},
pages = {1--6},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/CBMI.2012.6269810},
doi = {10.1109/CBMI.2012.6269810},
timestamp = {Fri, 06 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cbmi/EskevichJWLAVO12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/HanjalicKL12,
author = {Alan Hanjalic and
Christoph Kofler and
Martha A. Larson},
editor = {Noboru Babaguchi and
Kiyoharu Aizawa and
John R. Smith and
Shin'ichi Satoh and
Thomas Plagemann and
Xian{-}Sheng Hua and
Rong Yan},
title = {Intent and its discontents: the user at the wheel of the online video
search engine},
booktitle = {Proceedings of the 20th {ACM} Multimedia Conference, {MM} '12, Nara,
Japan, October 29 - November 02, 2012},
pages = {1239--1248},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2393347.2396424},
doi = {10.1145/2393347.2396424},
timestamp = {Tue, 20 Jul 2021 15:36:10 +0200},
biburl = {https://dblp.org/rec/conf/mm/HanjalicKL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/KoflerYLMHL12,
author = {Christoph Kofler and
Linjun Yang and
Martha A. Larson and
Tao Mei and
Alan Hanjalic and
Shipeng Li},
editor = {Noboru Babaguchi and
Kiyoharu Aizawa and
John R. Smith and
Shin'ichi Satoh and
Thomas Plagemann and
Xian{-}Sheng Hua and
Rong Yan},
title = {When video search goes wrong: predicting query failure using search
engine logs and visual search results},
booktitle = {Proceedings of the 20th {ACM} Multimedia Conference, {MM} '12, Nara,
Japan, October 29 - November 02, 2012},
pages = {319--328},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2393347.2393395},
doi = {10.1145/2393347.2393395},
timestamp = {Fri, 20 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mm/KoflerYLMHL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1207-1411,
author = {Finnegan Southey and
Michael Bowling and
Bryce Larson and
Carmelo Piccione and
Neil Burch and
Darse Billings and
D. Chris Rayner},
title = {Bayes' Bluff: Opponent Modelling in Poker},
journal = {CoRR},
volume = {abs/1207.1411},
year = {2012},
url = {http://arxiv.org/abs/1207.1411},
eprinttype = {arXiv},
eprint = {1207.1411},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1207-1411.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/HawrylyczBBHJMNLLNPRVZB11,
author = {Michael Hawrylycz and
Richard A. Baldock and
Albert Burger and
Tsutomu Hashikawa and
G. Allan Johnson and
Maryann E. Martone and
Lydia Ng and
Christopher Lau and
Stephen D. Larson and
Jonathan Nissanov and
Luis Puelles and
Seth Ruffins and
Fons J. Verbeek and
Ilya Zaslavsky and
Jyl Boline},
title = {Digital Atlasing and Standardization in the Mouse Brain},
journal = {PLoS Comput. Biol.},
volume = {7},
number = {2},
year = {2011},
url = {https://doi.org/10.1371/journal.pcbi.1001065},
doi = {10.1371/JOURNAL.PCBI.1001065},
timestamp = {Thu, 10 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ploscb/HawrylyczBBHJMNLLNPRVZB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cidr/BakerBCFKLLLLY11,
author = {Jason Baker and
Chris Bond and
James C. Corbett and
J. J. Furman and
Andrey Khorlin and
James Larson and
Jean{-}Michel Leon and
Yawei Li and
Alexander Lloyd and
Vadim Yushprakh},
title = {Megastore: Providing Scalable, Highly Available Storage for Interactive
Services},
booktitle = {Fifth Biennial Conference on Innovative Data Systems Research, {CIDR}
2011, Asilomar, CA, USA, January 9-12, 2011, Online Proceedings},
pages = {223--234},
publisher = {www.cidrdb.org},
year = {2011},
url = {http://cidrdb.org/cidr2011/Papers/CIDR11\_Paper32.pdf},
timestamp = {Mon, 18 Jul 2022 17:13:00 +0200},
biburl = {https://dblp.org/rec/conf/cidr/BakerBCFKLLLLY11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/VliegendhartLKP11,
author = {Raynor Vliegendhart and
Martha A. Larson and
Christoph Kofler and
Johan A. Pouwelse},
editor = {Craig Macdonald and
Iadh Ounis and
Ian Ruthven},
title = {A peer's-eye view: network term clouds in a peer-to-peer system},
booktitle = {Proceedings of the 20th {ACM} Conference on Information and Knowledge
Management, {CIKM} 2011, Glasgow, United Kingdom, October 24-28, 2011},
pages = {1909--1912},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2063576.2063852},
doi = {10.1145/2063576.2063852},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/cikm/VliegendhartLKP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/KoflerLH11,
author = {Christoph Kofler and
Martha A. Larson and
Alan Hanjalic},
editor = {Paul D. Clough and
Colum Foley and
Cathal Gurrin and
Gareth J. F. Jones and
Wessel Kraaij and
Hyowon Lee and
Vanessa Murdock},
title = {To Seek, Perchance to Fail: Expressions of User Needs in Internet
Video Search},
booktitle = {Advances in Information Retrieval - 33rd European Conference on {IR}
Research, {ECIR} 2011, Dublin, Ireland, April 18-21, 2011. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6611},
pages = {611--616},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-20161-5\_61},
doi = {10.1007/978-3-642-20161-5\_61},
timestamp = {Mon, 26 Apr 2021 09:26:56 +0200},
biburl = {https://dblp.org/rec/conf/ecir/KoflerLH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icbo/MungallABCCCCDEEGKILMMTTTTWH11,
author = {Chris Mungall and
David Anderson and
Anita E. Bandrowski and
Brian A. Canada and
Andrew Chatr{-}aryamontri and
Keith C. Cheng and
P. Michael Conn and
Kara Dolinski and
Mark H. Ellisman and
Janan T. Eppig and
Jeffrey S. Grethe and
Joseph W. Kemnitz and
Shawn Iadonato and
Stephen D. Larson and
Charles Magness and
Maryann E. Martone and
Mike Tyers and
Carlo Torniai and
Olga G. Troyanskaya and
Judith Turner and
Monte Westerfield and
Melissa A. Haendel},
editor = {Olivier Bodenreider and
Maryann E. Martone and
Alan Ruttenberg},
title = {An Ontology-Based Approach to Linking Model Organisms and Resources
to Human Diseases},
booktitle = {Proceedings of the 2nd International Conference on Biomedical Ontology,
Buffalo, NY, USA, July 26-30, 2011},
series = {{CEUR} Workshop Proceedings},
volume = {833},
publisher = {CEUR-WS.org},
year = {2011},
url = {https://ceur-ws.org/Vol-833/paper43.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:24 +0100},
biburl = {https://dblp.org/rec/conf/icbo/MungallABCCCCDEEGKILMMTTTTWH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icis/BoudreauSL11,
author = {Marie{-}Claude Boudreau and
Christina Serrano and
Keri Larson},
editor = {Dennis F. Galletta and
Ting{-}Peng Liang},
title = {IT-Driven Organizational Identity Change: {A} Longitudinal Inquiry},
booktitle = {Proceedings of the International Conference on Information Systems,
{ICIS} 2011, Shanghai, China, December 4-7, 2011},
publisher = {Association for Information Systems},
year = {2011},
url = {http://aisel.aisnet.org/icis2011/proceedings/organization/15},
timestamp = {Mon, 16 Jan 2012 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icis/BoudreauSL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mediaeval/LarsonEOKSJ11,
author = {Martha A. Larson and
Maria Eskevich and
Roeland Ordelman and
Christoph Kofler and
Sebastian Schmiedeke and
Gareth J. F. Jones},
editor = {Martha A. Larson and
Adam Rae and
Claire{-}H{\'{e}}l{\`{e}}ne Demarty and
Christoph Kofler and
Florian Metze and
Rapha{\"{e}}l Troncy and
Vasileios Mezaris and
Gareth J. F. Jones},
title = {Overview of MediaEval 2011 Rich Speech Retrieval Task and Genre Tagging
Task},
booktitle = {Working Notes Proceedings of the MediaEval 2011 Workshop, Santa Croce
in Fossabanda, Pisa, Italy, September 1-2, 2011},
series = {{CEUR} Workshop Proceedings},
volume = {807},
publisher = {CEUR-WS.org},
year = {2011},
url = {https://ceur-ws.org/Vol-807/Larson\_RSR\_and\_Genre\_me11overview.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:12 +0100},
biburl = {https://dblp.org/rec/conf/mediaeval/LarsonEOKSJ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mediaeval/WartenaL11,
author = {Christian Wartena and
Martha A. Larson},
editor = {Martha A. Larson and
Adam Rae and
Claire{-}H{\'{e}}l{\`{e}}ne Demarty and
Christoph Kofler and
Florian Metze and
Rapha{\"{e}}l Troncy and
Vasileios Mezaris and
Gareth J. F. Jones},
title = {Rich Speech Retrieval Using Query Word Filter},
booktitle = {Working Notes Proceedings of the MediaEval 2011 Workshop, Santa Croce
in Fossabanda, Pisa, Italy, September 1-2, 2011},
series = {{CEUR} Workshop Proceedings},
volume = {807},
publisher = {CEUR-WS.org},
year = {2011},
url = {https://ceur-ws.org/Vol-807/wartena\_NOVAY-TUD\_RSR\_me11wn.pdf},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mediaeval/WartenaL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mir/LarsonSS11,
author = {Martha A. Larson and
Mohammad Soleymani and
Pavel Serdyukov and
Stevan Rudinac and
Christian Wartena and
Vanessa Murdock and
Gerald Friedland and
Roeland Ordelman and
Gareth J. F. Jones},
editor = {Francesco G. B. De Natale and
Alberto Del Bimbo and
Alan Hanjalic and
B. S. Manjunath and
Shin'ichi Satoh},
title = {Automatic tagging and geotagging in video collections and communities},
booktitle = {Proceedings of the 1st International Conference on Multimedia Retrieval,
{ICMR} 2011, Trento, Italy, April 18 - 20, 2011},
pages = {51},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/1991996.1992047},
doi = {10.1145/1991996.1992047},
timestamp = {Sun, 06 Oct 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mir/LarsonSS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/KoflerLH11,
author = {Christoph Kofler and
Martha A. Larson and
Alan Hanjalic},
editor = {K. Sel{\c{c}}uk Candan and
Sethuraman Panchanathan and
Balakrishnan Prabhakaran and
Hari Sundaram and
Wu{-}chi Feng and
Nicu Sebe},
title = {Alice's worlds of wonder: exploiting tags to understand images in
terms of size and scale},
booktitle = {Proceedings of the 19th International Conference on Multimedia 2011,
Scottsdale, AZ, USA, November 28 - December 1, 2011},
pages = {643--646},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2072298.2072408},
doi = {10.1145/2072298.2072408},
timestamp = {Mon, 22 Apr 2024 21:24:20 +0200},
biburl = {https://dblp.org/rec/conf/mm/KoflerLH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/LarsonKH11,
author = {Martha A. Larson and
Christoph Kofler and
Alan Hanjalic},
editor = {K. Sel{\c{c}}uk Candan and
Sethuraman Panchanathan and
Balakrishnan Prabhakaran and
Hari Sundaram and
Wu{-}chi Feng and
Nicu Sebe},
title = {Reading between the tags to predict real-world size-class for visually
depicted objects in images},
booktitle = {Proceedings of the 19th International Conference on Multimedia 2011,
Scottsdale, AZ, USA, November 28 - December 1, 2011},
pages = {273--282},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2072298.2072335},
doi = {10.1145/2072298.2072335},
timestamp = {Fri, 06 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mm/LarsonKH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/mediaeval/2011,
editor = {Martha A. Larson and
Adam Rae and
Claire{-}H{\'{e}}l{\`{e}}ne Demarty and
Christoph Kofler and
Florian Metze and
Rapha{\"{e}}l Troncy and
Vasileios Mezaris and
Gareth J. F. Jones},
title = {Working Notes Proceedings of the MediaEval 2011 Workshop, Santa Croce
in Fossabanda, Pisa, Italy, September 1-2, 2011},
series = {{CEUR} Workshop Proceedings},
volume = {807},
publisher = {CEUR-WS.org},
year = {2011},
url = {https://ceur-ws.org/Vol-807},
urn = {urn:nbn:de:0074-807-1},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mediaeval/2011.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/BiasLHAM10,
author = {Randolph G. Bias and
Kevin Larson and
Sheng{-}Cheng Huang and
Paul R. Aumer{-}Ryan and
Chris Montesclaros},
title = {An exploratory study of visual and psychological correlates of preference
for onscreen subpixel-rendered text},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {61},
number = {4},
pages = {745--757},
year = {2010},
url = {https://doi.org/10.1002/asi.21273},
doi = {10.1002/ASI.21273},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasis/BiasLHAM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocn/LarsonASZ09,
author = {Christine L. Larson and
Joel Aronoff and
Issidoros C. Sarinopoulos and
David C. Zhu},
title = {Recognizing Threat: {A} Simple Geometric Shape Activates Neural Circuitry
for Threat Detection},
journal = {J. Cogn. Neurosci.},
volume = {21},
number = {8},
pages = {1523--1535},
year = {2009},
url = {https://doi.org/10.1162/jocn.2009.21111},
doi = {10.1162/JOCN.2009.21111},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jocn/LarsonASZ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/ReddyRWMDEGHJJKLMNSSWWZSGBS09,
author = {T. B. K. Reddy and
Robert Riley and
Farrell Wymore and
Phillip Montgomery and
David DeCaprio and
Reinhard Engels and
Marcel Gellesch and
Jeremy Hubble and
Dennis Jen and
Heng Jin and
Michael Koehrsen and
Lisa Larson and
Maria Mao and
Michael Nitzberg and
Peter Sisk and
Christian Stolte and
Brian Weiner and
Jared White and
Zachariah K. Zachariah and
Gavin Sherlock and
James E. Galagan and
Catherine A. Ball and
Gary K. Schoolnik},
title = {{TB} database: an integrated platform for tuberculosis research},
journal = {Nucleic Acids Res.},
volume = {37},
number = {Database-Issue},
pages = {499--508},
year = {2009},
url = {https://doi.org/10.1093/nar/gkn652},
doi = {10.1093/NAR/GKN652},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nar/ReddyRWMDEGHJJKLMNSSWWZSGBS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW08,
author = {David E. Shaw and
Martin M. Deneroff and
Ron O. Dror and
Jeffrey Kuskin and
Richard H. Larson and
John K. Salmon and
Cliff Young and
Brannon Batson and
Kevin J. Bowers and
Jack C. Chao and
Michael P. Eastwood and
Joseph Gagliardo and
J. P. Grossman and
C. Richard Ho and
Doug Ierardi and
Istv{\'{a}}n Kolossv{\'{a}}ry and
John L. Klepeis and
Timothy Layman and
Christine McLeavey and
Mark A. Moraes and
Rolf Mueller and
Edward C. Priest and
Yibing Shan and
Jochen Spengler and
Michael Theobald and
Brian Towles and
Stanley C. Wang},
title = {Anton, a special-purpose machine for molecular dynamics simulation},
journal = {Commun. {ACM}},
volume = {51},
number = {7},
pages = {91--97},
year = {2008},
url = {https://doi.org/10.1145/1364782.1364802},
doi = {10.1145/1364782.1364802},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cacm/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ni/BugAGGFLLRSTM08,
author = {William J. Bug and
Giorgio A. Ascoli and
Jeffrey S. Grethe and
Amarnath Gupta and
Christine Fennema{-}Notestine and
Angela R. Laird and
Stephen D. Larson and
Daniel L. Rubin and
Gordon M. Shepherd and
Jessica A. Turner and
Maryann E. Martone},
title = {The {NIFSTD} and BIRNLex Vocabularies: Building Comprehensive Ontologies
for Neuroscience},
journal = {Neuroinformatics},
volume = {6},
number = {3},
pages = {175--194},
year = {2008},
url = {https://doi.org/10.1007/s12021-008-9032-z},
doi = {10.1007/S12021-008-9032-Z},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ni/BugAGGFLLRSTM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/MandlCGLSW08,
author = {Thomas Mandl and
Paula Carvalho and
Fredric C. Gey and
Ray R. Larson and
Diana Santos and
Christa Womser{-}Hacker},
editor = {Carol Peters and
Nicola Ferro},
title = {GeoCLEF 2008: the {CLEF} 2008 Cross-Language Geographic Information
Retrieval Track Overview},
booktitle = {Working Notes for {CLEF} 2008 Workshop co-located with the 12th European
Conference on Digital Libraries {(ECDL} 2008) , Aarhus, Denmark, September
17-19, 2008},
series = {{CEUR} Workshop Proceedings},
volume = {1174},
publisher = {CEUR-WS.org},
year = {2008},
url = {https://ceur-ws.org/Vol-1174/CLEF2008wn-GeoCLEF-MandlEt2008.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:42 +0100},
biburl = {https://dblp.org/rec/conf/clef/MandlCGLSW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/MandlCNGLSW08,
author = {Thomas Mandl and
Paula Carvalho and
Giorgio Maria Di Nunzio and
Fredric C. Gey and
Ray R. Larson and
Diana Santos and
Christa Womser{-}Hacker},
editor = {Carol Peters and
Thomas Deselaers and
Nicola Ferro and
Julio Gonzalo and
Gareth J. F. Jones and
Mikko Kurimo and
Thomas Mandl and
Anselmo Pe{\~{n}}as and
Vivien Petras},
title = {GeoCLEF 2008: The {CLEF} 2008 Cross-Language Geographic Information
Retrieval Track Overview},
booktitle = {Evaluating Systems for Multilingual and Multimodal Information Access,
9th Workshop of the Cross-Language Evaluation Forum, {CLEF} 2008,
Aarhus, Denmark, September 17-19, 2008, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {5706},
pages = {808--821},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-642-04447-2\_106},
doi = {10.1007/978-3-642-04447-2\_106},
timestamp = {Tue, 01 Jun 2021 15:22:41 +0200},
biburl = {https://dblp.org/rec/conf/clef/MandlCNGLSW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fini/LarsonFGCBM07,
author = {Stephen D. Larson and
Lisa Fong and
Amarnath Gupta and
Christopher Condit and
William J. Bug and
Maryann E. Martone},
title = {A formal ontology of subcellular neuroanatomy},
journal = {Frontiers Neuroinformatics},
volume = {1},
pages = {3},
year = {2007},
url = {https://doi.org/10.3389/neuro.11.003.2007},
doi = {10.3389/NEURO.11.003.2007},
timestamp = {Thu, 28 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fini/LarsonFGCBM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/MandlGNFLSSWX07,
author = {Thomas Mandl and
Fredric C. Gey and
Giorgio Maria Di Nunzio and
Nicola Ferro and
Ray R. Larson and
Mark Sanderson and
Diana Santos and
Christa Womser{-}Hacker and
Xing Xie},
editor = {Carol Peters and
Valentin Jijkoun and
Thomas Mandl and
Henning M{\"{u}}ller and
Douglas W. Oard and
Anselmo Pe{\~{n}}as and
Vivien Petras and
Diana Santos},
title = {GeoCLEF 2007: The {CLEF} 2007 Cross-Language Geographic Information
Retrieval Track Overview},
booktitle = {Advances in Multilingual and Multimodal Information Retrieval, 8th
Workshop of the Cross-Language Evaluation Forum, {CLEF} 2007, Budapest,
Hungary, September 19-21, 2007, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {5152},
pages = {745--772},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-85760-0\_96},
doi = {10.1007/978-3-540-85760-0\_96},
timestamp = {Tue, 07 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/clef/MandlGNFLSSWX07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/MandlGNFLSSWX07a,
author = {Thomas Mandl and
Fredric C. Gey and
Giorgio Maria Di Nunzio and
Nicola Ferro and
Ray R. Larson and
Mark Sanderson and
Diana Santos and
Christa Womser{-}Hacker and
Xing Xie},
editor = {Alessandro Nardi and
Carol Peters and
Nicola Ferro},
title = {GeoCLEF 2007: the {CLEF} 2007 Cross-Language Geographic Information
Retrieval Track Overview},
booktitle = {Working Notes for {CLEF} 2007 Workshop co-located with the 11th European
Conference on Digital Libraries {(ECDL} 2007), Budapest, Hungary,
September 19-21, 2007},
series = {{CEUR} Workshop Proceedings},
volume = {1173},
publisher = {CEUR-WS.org},
year = {2007},
url = {https://ceur-ws.org/Vol-1173/CLEF2007wn-GeoCLEF-MandlEt2007.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:41 +0100},
biburl = {https://dblp.org/rec/conf/clef/MandlGNFLSSWX07a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/er/GuptaLCGFCM07,
author = {Amarnath Gupta and
Stephen D. Larson and
Christopher Condit and
Sandeep Gupta and
Lisa Fong and
Li Chen and
Maryann E. Martone},
editor = {Jean{-}Luc Hainaut and
Elke A. Rundensteiner and
Markus Kirchberg and
Michela Bertolotto and
Mathias Brochhausen and
Yi{-}Ping Phoebe Chen and
Samira Si{-}Said Cherfi and
Martin Doerr and
Hyoil Han and
Sven Hartmann and
Jeffrey Parsons and
Geert Poels and
Colette Rolland and
Juan Trujillo and
Eric S. K. Yu and
Esteban Zim{\'{a}}nyi},
title = {Toward an Ontological Database for Subcellular Neuroanatomy},
booktitle = {Advances in Conceptual Modeling - Foundations and Applications, {ER}
2007 Workshops CMLSA, FP-UML, ONISW, QoIS, RIGiM,SeCoGIS, Auckland,
New Zealand, November 5-9, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4802},
pages = {64--73},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-76292-8\_8},
doi = {10.1007/978-3-540-76292-8\_8},
timestamp = {Wed, 13 Jul 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/er/GuptaLCGFCM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW07,
author = {David E. Shaw and
Martin M. Deneroff and
Ron O. Dror and
Jeffrey Kuskin and
Richard H. Larson and
John K. Salmon and
Cliff Young and
Brannon Batson and
Kevin J. Bowers and
Jack C. Chao and
Michael P. Eastwood and
Joseph Gagliardo and
J. P. Grossman and
C. Richard Ho and
Doug Ierardi and
Istv{\'{a}}n Kolossv{\'{a}}ry and
John L. Klepeis and
Timothy Layman and
Christine McLeavey and
Mark A. Moraes and
Rolf Mueller and
Edward C. Priest and
Yibing Shan and
Jochen Spengler and
Michael Theobald and
Brian Towles and
Stanley C. Wang},
editor = {Dean M. Tullsen and
Brad Calder},
title = {Anton, a special-purpose machine for molecular dynamics simulation},
booktitle = {34th International Symposium on Computer Architecture {(ISCA} 2007),
June 9-13, 2007, San Diego, California, {USA}},
pages = {1--12},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1250662.1250664},
doi = {10.1145/1250662.1250664},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isca/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ntcir/GeyLSBMWSRMNF07,
author = {Fredric C. Gey and
Ray R. Larson and
Mark Sanderson and
Kerstin Bischoff and
Thomas Mandl and
Christa Womser{-}Hacker and
Diana Santos and
Paulo Rocha and
Andr{\'{e}}s Montoyo and
Giorgio Maria Di Nunzio and
Nicola Ferro},
title = {Challenges to Evaluation of Multilingual Geographic Information Retrieval
in GeoCLEF},
booktitle = {Proceedings of the 1st International Workshop on Evaluating Information
Access, {EVIA} 2007, National Center of Sciences, Tokyo, Japan, May
15, 2008},
publisher = {National Institute of Informatics {(NII)}},
year = {2007},
url = {http://research.nii.ac.jp/ntcir/workshop/OnlineProceedings6/EVIA/16.pdf},
timestamp = {Mon, 09 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ntcir/GeyLSBMWSRMNF07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/owled/FongLGCBCWLTM07,
author = {Lisa Fong and
Stephen D. Larson and
Amarnath Gupta and
Christopher Condit and
William J. Bug and
Li Chen and
Ruth West and
Stephan Lamont and
Masako Terada and
Maryann E. Martone},
editor = {Christine Golbreich and
Aditya Kalyanpur and
Bijan Parsia},
title = {An Ontology-Driven Knowledge Environment For Subcellular Neuroanatomy},
booktitle = {Proceedings of the {OWLED} 2007 Workshop on {OWL:} Experiences and
Directions, Innsbruck, Austria, June 6-7, 2007},
series = {{CEUR} Workshop Proceedings},
volume = {258},
publisher = {CEUR-WS.org},
year = {2007},
url = {https://ceur-ws.org/Vol-258/paper34.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:02 +0100},
biburl = {https://dblp.org/rec/conf/owled/FongLGCBCWLTM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmod/ZhouLFL07,
author = {Jingren Zhou and
Per{-}{\AA}ke Larson and
Johann Christoph Freytag and
Wolfgang Lehner},
editor = {Chee Yong Chan and
Beng Chin Ooi and
Aoying Zhou},
title = {Efficient exploitation of similar subexpressions for query processing},
booktitle = {Proceedings of the {ACM} {SIGMOD} International Conference on Management
of Data, Beijing, China, June 12-14, 2007},
pages = {533--544},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1247480.1247540},
doi = {10.1145/1247480.1247540},
timestamp = {Thu, 11 Mar 2021 15:20:15 +0100},
biburl = {https://dblp.org/rec/conf/sigmod/ZhouLFL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/GeyLSBMWSRNF06,
author = {Fredric C. Gey and
Ray R. Larson and
Mark Sanderson and
Kerstin Bischoff and
Thomas Mandl and
Christa Womser{-}Hacker and
Diana Santos and
Paulo Rocha and
Giorgio Maria Di Nunzio and
Nicola Ferro},
editor = {Carol Peters and
Paul D. Clough and
Fredric C. Gey and
Jussi Karlgren and
Bernardo Magnini and
Douglas W. Oard and
Maarten de Rijke and
Maximilian Stempfhuber},
title = {GeoCLEF 2006: The {CLEF} 2006 Cross-Language Geographic Information
Retrieval Track Overview},
booktitle = {Evaluation of Multilingual and Multi-modal Information Retrieval,
7th Workshop of the Cross-Language Evaluation Forum, {CLEF} 2006,
Alicante, Spain, September 20-22, 2006, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {4730},
pages = {852--876},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/978-3-540-74999-8\_109},
doi = {10.1007/978-3-540-74999-8\_109},
timestamp = {Mon, 09 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/clef/GeyLSBMWSRNF06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/GeyLSBMWSRNF06a,
author = {Fredric C. Gey and
Ray R. Larson and
Mark Sanderson and
Kerstin Bischoff and
Thomas Mandl and
Christa Womser{-}Hacker and
Diana Santos and
Paulo Rocha and
Giorgio Maria Di Nunzio and
Nicola Ferro},
editor = {Alessandro Nardi and
Carol Peters and
Jos{\'{e}} Luis Vicedo Gonz{\'{a}}lez and
Nicola Ferro},
title = {GeoCLEF 2006: the {CLEF} 2006 Cross-Language Geographic Information
Retrieval Track Overview},
booktitle = {Working Notes for {CLEF} 2006 Workshop co-located with the 10th European
Conference on Digital Libraries {(ECDL} 2006), Alicante, Spain, September
20-22, 2006},
series = {{CEUR} Workshop Proceedings},
volume = {1172},
publisher = {CEUR-WS.org},
year = {2006},
url = {https://ceur-ws.org/Vol-1172/CLEF2006wn-GeoCLEF-GeyEt2006.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:38 +0100},
biburl = {https://dblp.org/rec/conf/clef/GeyLSBMWSRNF06a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhpca/CraigJKBLODH05,
author = {Anthony P. Craig and
Robert L. Jacob and
Brian Kauffman and
Thomas Bettge and
Jay Walter Larson and
Everest T. Ong and
Chris H. Q. Ding and
Yun He},
title = {{CPL6:} The New Extensible, High Performance Parallel Coupler for
the Community Climate System Model},
journal = {Int. J. High Perform. Comput. Appl.},
volume = {19},
number = {3},
pages = {309--327},
year = {2005},
url = {https://doi.org/10.1177/1094342005056117},
doi = {10.1177/1094342005056117},
timestamp = {Mon, 18 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ijhpca/CraigJKBLODH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip8-2/AtkinsonKLMLH05,
author = {Chris Atkinson and
Bonnie Kaplan and
Kent Larson and
Henrique M. G. Martins and
Jay Lundell and
Martin Harris},
editor = {Carsten S{\o}rensen and
Youngjin Yoo and
Kalle Lyytinen and
Janice I. DeGross},
title = {Ubiquitous Computing for Health and Medicine},
booktitle = {Designing Ubiquitous Information Environments: Socio-Technical Issues
and Challenges - {IFIP} {TC8} {WG} 8.2 International Working Conference,
August 1-3, 2005, Cleveland, Ohio, {USA}},
series = {{IFIP}},
volume = {185},
pages = {355--358},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/0-387-28918-6\_28},
doi = {10.1007/0-387-28918-6\_28},
timestamp = {Tue, 26 Jun 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ifip8-2/AtkinsonKLMLH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uai/SoutheyBLPBBR05,
author = {Finnegan Southey and
Michael H. Bowling and
Bryce Larson and
Carmelo Piccione and
Neil Burch and
Darse Billings and
D. Chris Rayner},
title = {Bayes? Bluff: Opponent Modelling in Poker},
booktitle = {{UAI} '05, Proceedings of the 21st Conference in Uncertainty in Artificial
Intelligence, Edinburgh, Scotland, July 26-29, 2005},
pages = {550--558},
publisher = {{AUAI} Press},
year = {2005},
url = {https://dslpitt.org/uai/displayArticleDetails.jsp?mmnu=1\&smnu=2\&article\_id=1216\&proceeding\_id=21},
timestamp = {Wed, 03 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uai/SoutheyBLPBBR05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/vldb/2005,
editor = {Klemens B{\"{o}}hm and
Christian S. Jensen and
Laura M. Haas and
Martin L. Kersten and
Per{-}{\AA}ke Larson and
Beng Chin Ooi},
title = {Proceedings of the 31st International Conference on Very Large Data
Bases, Trondheim, Norway, August 30 - September 2, 2005},
publisher = {{ACM}},
year = {2005},
url = {https://dl.acm.org/citation.cfm?id=1083592},
isbn = {1-59593-154-6},
timestamp = {Tue, 20 Feb 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/vldb/2005.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/para/HillDBSSSCTZHBCCKMNSSWIYJL04,
author = {Chris Hill and
Cecelia DeLuca and
Venkatramani Balaji and
Max Suarez and
Arlindo M. da Silva and
William B. Sawyer and
Carlos A. Cruz and
Atanas Trayanov and
Leonid Zaslavsky and
Robert Hallberg and
Byron A. Boville and
Anthony P. Craig and
Nancy Collins and
Erik Kluzek and
John Michalakes and
David Neckels and
Earl Schwab and
Shepard Smithline and
Jon Wolfe and
Mark Iredell and
Weiyu Yang and
Robert L. Jacob and
Jay Walter Larson},
editor = {Jack J. Dongarra and
Kaj Madsen and
Jerzy Wasniewski},
title = {Implementing Applications with the Earth System Modeling Framework},
booktitle = {Applied Parallel Computing, State of the Art in Scientific Computing,
7th International Workshop, {PARA} 2004, Lyngby, Denmark, June 20-23,
2004, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {3732},
pages = {563--572},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/11558958\_67},
doi = {10.1007/11558958\_67},
timestamp = {Fri, 28 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/para/HillDBSSSCTZHBCCKMNSSWIYJL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/SchroderSL02,
author = {Christoph T. Schr{\"{o}}der and
Waymond R. Scott and
Greg D. Larson},
title = {Elastic waves interacting with buried land mines: a study using the
{FDTD} method},
journal = {{IEEE} Trans. Geosci. Remote. Sens.},
volume = {40},
number = {6},
pages = {1405--1415},
year = {2002},
url = {https://doi.org/10.1109/TGRS.2002.800435},
doi = {10.1109/TGRS.2002.800435},
timestamp = {Tue, 12 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tgrs/SchroderSL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcae/WeaverLA02,
author = {Christopher T. Weaver and
Eric Larson and
Todd M. Austin},
editor = {Edward F. Gehringer},
title = {Effective support of simulation in computer architecture instruction},
booktitle = {Proceedings of the 2002 workshop on Computer architecture education
- Held in conjunction with the 29th International Symposium on Computer
Architecture, WCAE@ISCA 2002, Anchorage, Alaska, USA, May 26, 2002},
pages = {9},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/1275462.1275476},
doi = {10.1145/1275462.1275476},
timestamp = {Tue, 06 Nov 2018 16:57:55 +0100},
biburl = {https://dblp.org/rec/conf/wcae/WeaverLA02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcse/StehlikRLBN99,
author = {Mark Stehlik and
Susan H. Rodger and
Kathleen Larson and
Alyce Brady and
Christopher H. Nevison},
editor = {Jane Prey and
Robert E. Noonan},
title = {Current and future direction of the advanced placement exam},
booktitle = {Proceedings of the 30th {SIGCSE} Technical Symposium on Computer Science
Education, {SIGCSE} 1999, New Orleans, Louisiana, USA, March 14-28,
1999},
pages = {358},
publisher = {{ACM}},
year = {1999},
url = {https://doi.org/10.1145/299649.299811},
doi = {10.1145/299649.299811},
timestamp = {Tue, 23 Mar 2021 10:54:19 +0100},
biburl = {https://dblp.org/rec/conf/sigcse/StehlikRLBN99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/NagakuraCWL99,
author = {Takehiko Nagakura and
Marlos Christedeulides and
Michael Webb and
Kent Larson},
editor = {Marla Schweppe},
title = {Drive-In house},
booktitle = {Proceedings of the 26th Annual Conference on Computer Graphics and
Interactive Techniques, {SIGGRAPH} 1999, Los Angeles, CA, USA, August
8-13, 1999, Electronic Art and Animation Catalog},
pages = {128},
publisher = {{ACM}},
year = {1999},
url = {https://doi.org/10.1145/312379.312909},
doi = {10.1145/312379.312909},
timestamp = {Tue, 06 Nov 2018 16:59:14 +0100},
biburl = {https://dblp.org/rec/conf/siggraph/NagakuraCWL99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpcn/DingLLGS98,
author = {Chris H. Q. Ding and
Peter M. Lyster and
Jay Walter Larson and
Jing Guo and
Arlindo M. da Silva},
editor = {Peter M. A. Sloot and
Marian Bubak and
Louis O. Hertzberger},
title = {Atmosperic Data Assimilation on Distributed-Memory Parallel Supercomputers},
booktitle = {High-Performance Computing and Networking, International Conference
and Exhibition, {HPCN} Europe 1998, Amsterdam, The Netherlands, April
21-23, 1998, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1401},
pages = {115--124},
publisher = {Springer},
year = {1998},
url = {https://doi.org/10.1007/BFb0037138},
doi = {10.1007/BFB0037138},
timestamp = {Fri, 28 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpcn/DingLLGS98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/LarsonRP97,
author = {Gregory Ward Larson and
Holly E. Rushmeier and
Christine D. Piatko},
title = {A Visibility Matching Tone Reproduction Operator for High Dynamic
Range Scenes},
journal = {{IEEE} Trans. Vis. Comput. Graph.},
volume = {3},
number = {4},
pages = {291--306},
year = {1997},
url = {https://doi.org/10.1109/2945.646233},
doi = {10.1109/2945.646233},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tvcg/LarsonRP97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/LysterEGHLLLRSSSSSTTZDF97,
author = {M. P. Lyster and
K. Ekers and
Jing Guo and
M. Harber and
D. Lamich and
J. W. Larson and
Robert Lucchesi and
Richard B. Rood and
S. Schubert and
William B. Sawyer and
Meta Sienkiewicz and
Arlindo M. da Silva and
J. Stobie and
Lawrence Takacs and
R. Todling and
Jose Zero and
Chris H. Q. Ding and
Robert D. Ferraro},
title = {Parallel Computing at the {NASA} Data Assimilation Office {(DAO)}},
booktitle = {Proceedings of the {ACM/IEEE} Conference on Supercomputing, {SC} 1997,
November 15-21, 1997, San Jose, CA, {USA}},
pages = {26},
publisher = {{ACM}},
year = {1997},
url = {https://doi.org/10.1145/509593.509619},
doi = {10.1145/509593.509619},
timestamp = {Tue, 11 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sc/LysterEGHLLLRSSSSSTTZDF97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/siggraph/LarsonRP97,
author = {Gregory Ward Larson and
Holly E. Rushmeier and
Christine D. Piatko},
editor = {Lynn Pocock and
Rick Hopkins and
David S. Ebert and
Judith Crow},
title = {A visibility matching tone reproduction operator for high dynamic
range scenes},
booktitle = {{ACM} {SIGGRAPH} 97 Visual Proceedings: The art and interdisciplinary
programs of {SIGGRAPH} '97, Los Angeles, California, USA, August 3-8,
1997},
pages = {155},
publisher = {{ACM}},
year = {1997},
url = {https://doi.org/10.1145/259081.259242},
doi = {10.1145/259081.259242},
timestamp = {Tue, 06 Nov 2018 16:59:12 +0100},
biburl = {https://dblp.org/rec/conf/siggraph/LarsonRP97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jiis/ChuYCMCL96,
author = {Wesley W. Chu and
Hua Yang and
Kuorong Chiang and
Michael Minock and
Gladys Chow and
Chris Larson},
title = {CoBase: {A} Scalable and Extensible Cooperative Information System},
journal = {J. Intell. Inf. Syst.},
volume = {6},
number = {2/3},
pages = {223--259},
year = {1996},
url = {https://doi.org/10.1007/BF00122129},
doi = {10.1007/BF00122129},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jiis/ChuYCMCL96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dtj/LarsonPWH95,
author = {Ray R. Larson and
Christian Plaunt and
Allison Woodruff and
Marti A. Hearst},
title = {The Sequoia 2000 Electronic Repository},
journal = {Digit. Tech. J.},
volume = {7},
number = {3},
year = {1995},
url = {https://www.hpl.hp.com/hpjournal/dtj/vol7num3/vol7num3art4.pdf},
timestamp = {Mon, 23 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dtj/LarsonPWH95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/LarsonV92,
author = {Christopher J. Larson and
Gregory L. Verdine},
title = {A high-capacity column for affinity purification of sequence-specific
DNA-binding proteins},
journal = {Nucleic Acids Res.},
volume = {20},
number = {13},
pages = {3525},
year = {1992},
url = {https://doi.org/10.1093/nar/20.13.3525},
doi = {10.1093/NAR/20.13.3525},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/LarsonV92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uist/MillerL92,
author = {Christopher A. Miller and
Raymond Larson},
editor = {Jock D. Mackinlay and
Mark W. Green},
title = {An Explanatory and "Argumentative" Interface for a Model-based Diagnostic
System},
booktitle = {Proceedings of the Fifth {ACM} Symposium on User Interface Software
and Technology, {UIST} 1992, Monteray, CA, USA, November 15-18, 1992},
pages = {43--52},
publisher = {{ACM}},
year = {1992},
url = {https://doi.org/10.1145/142621.142627},
doi = {10.1145/142621.142627},
timestamp = {Fri, 02 Dec 2022 08:27:08 +0100},
biburl = {https://dblp.org/rec/conf/uist/MillerL92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/is/ChristodoulakisML89,
author = {Stavros Christodoulakis and
Yannis Manolopoulos and
Per{-}{\AA}ke Larson},
title = {Analysis of Overflow Handling for Variable Length Records},
journal = {Inf. Syst.},
volume = {14},
number = {2},
pages = {151--162},
year = {1989},
url = {https://doi.org/10.1016/0306-4379(89)90043-4},
doi = {10.1016/0306-4379(89)90043-4},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/is/ChristodoulakisML89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ior/SchaackL86,
author = {Christian Schaack and
Richard C. Larson},
title = {An \emph{N}-Server Cutoff Priority Queue},
journal = {Oper. Res.},
volume = {34},
number = {2},
pages = {257--266},
year = {1986},
url = {https://doi.org/10.1287/opre.34.2.257},
doi = {10.1287/OPRE.34.2.257},
timestamp = {Tue, 31 Mar 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ior/SchaackL86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-10-17 13:44 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
