Search dblp for Publications

export results for "stream:streams/journals/sigir:"

more than 1000 matches, exporting first 1000 hits only!

 download as .bib file

@article{DBLP:journals/sigir/000118,
  author    = {Diane Kelly},
  title     = {{SIGIR} Community Survey on Preprint Services},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {11--33},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274787},
  doi       = {10.1145/3274784.3274787},
  timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/000118.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgichteinBD18,
  author    = {Eugene Agichtein and
               Eric Brill and
               Susan T. Dumais},
  title     = {Improving Web Search Ranking by Incorporating User Behavior Information},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {11--18},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308778},
  doi       = {10.1145/3308774.3308778},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AgichteinBD18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AhlersWSA18,
  author    = {Dirk Ahlers and
               Erik Wilde and
               Rossano Schifanella and
               Jalal S. Alowibdi},
  title     = {Report on the Eighth International Workshop on Location and the Web
               (LocWeb 2018)},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {145--152},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308798},
  doi       = {10.1145/3308774.3308798},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AhlersWSA18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlbakourCGMPV18,
  author    = {Dyaa Albakour and
               David Corney and
               Julio Gonzalo and
               Miguel Martinez{-}Alvarez and
               Barbara Poblete and
               Andreas Vlachos},
  title     = {Report on the 2nd International Workshop on Recent Trends in News
               Information Retrieval (NewsIR'18)},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {140--146},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274799},
  doi       = {10.1145/3274784.3274799},
  timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/AlbakourCGMPV18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BellotCFMMNSST18,
  author    = {Patrice Bellot and
               Linda Cappellato and
               Nicola Ferro and
               Josiane Mothe and
               Fionn Murtagh and
               Jian{-}Yun Nie and
               Eric SanJuan and
               Laure Soulier and
               Chiraz Trabelsi},
  title     = {Report on {CLEF} 2018: Experimental {IR} Meets Multilinguality, Multimodality,
               and Interaction},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {72--82},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308785},
  doi       = {10.1145/3308774.3308785},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/BellotCFMMNSST18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BogersGHFKPS18,
  author    = {Toine Bogers and
               Maria G{\"{a}}de and
               Mark Michael Hall and
               Luanne Freund and
               Marijn Koolen and
               Vivien Petras and
               Mette Skov},
  title     = {Report on the Workshop on Barriers to Interactive {IR} Resources Re-use
               {(BIIRRR} 2018)},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {119--128},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274795},
  doi       = {10.1145/3274784.3274795},
  timestamp = {Fri, 27 Mar 2020 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BogersGHFKPS18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BorattoS18,
  author    = {Ludovico Boratto and
               Giovanni Stilo},
  title     = {Report on the Workshop on Social Aspects in Personalization And Search
               (SoAPS)},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {147--149},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274800},
  doi       = {10.1145/3274784.3274800},
  timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BorattoS18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Buccio18,
  author    = {Emanuele Di Buccio},
  title     = {Report on the Quantum Information Access and Retrieval Theory Winter
               School},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {92--99},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308789},
  doi       = {10.1145/3308774.3308789},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Buccio18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Castillo18,
  author    = {Carlos Castillo},
  title     = {Fairness and Transparency in Ranking},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {64--71},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308783},
  doi       = {10.1145/3308774.3308783},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Castillo18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Cohan18,
  author    = {Arman Cohan},
  title     = {Text Summarization and Categorization for Scientific and Health-Related
               Data},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {169},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308802},
  doi       = {10.1145/3308774.3308802},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Cohan18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ColeA18,
  author    = {Amelia W. Cole and
               Linda Achilles},
  title     = {Autumn School for Information Retrieval and Foraging 2018},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {87--91},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308788},
  doi       = {10.1145/3308774.3308788},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ColeA18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Culpepper0S18,
  author    = {J. Shane Culpepper and
               Fernando Diaz and
               Mark D. Smucker},
  title     = {Research Frontiers in Information Retrieval: Report from the Third
               Strategic Workshop on Information Retrieval in Lorne {(SWIRL} 2018)},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {34--90},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274788},
  doi       = {10.1145/3274784.3274788},
  timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Culpepper0S18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DodsonZ18,
  author    = {Samuel Dodson and
               Steven Zimmerman},
  title     = {Autumn School for Information Retrieval and Information Foraging {(ASIRF}
               2017)},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {83--86},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308787},
  doi       = {10.1145/3308774.3308787},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DodsonZ18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FailsPK18,
  author    = {Jerry Alan Fails and
               Maria Soledad Pera and
               Natalia Kucirkova},
  title     = {Building Community: Report on the 2nd International and Interdisciplinary
               Perspectives on Children {\&} Recommender Systems (KidRec) at
               {IDC} 2018},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {138--144},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308797},
  doi       = {10.1145/3308774.3308797},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/FailsPK18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ferro018,
  author    = {Nicola Ferro and
               Diane Kelly},
  title     = {{SIGIR} Initiative to Implement {ACM} Artifact Review and Badging},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {4--10},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274786},
  doi       = {10.1145/3274784.3274786},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Ferro018.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FerroFGKCDDEGGK18,
  author    = {Nicola Ferro and
               Norbert Fuhr and
               Gregory Grefenstette and
               Joseph A. Konstan and
               Pablo Castells and
               Elizabeth M. Daly and
               Thierry Declerck and
               Michael D. Ekstrand and
               Werner Geyer and
               Julio Gonzalo and
               Tsvi Kuflik and
               Krister Lind{\'{e}}n and
               Bernardo Magnini and
               Jian{-}Yun Nie and
               Raffaele Perego and
               Bracha Shapira and
               Ian Soboroff and
               Nava Tintarev and
               Karin Verspoor and
               Martijn C. Willemsen and
               Justin Zobel},
  title     = {The Dagstuhl Perspectives Workshop on Performance Modeling and Prediction},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {91--101},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274789},
  doi       = {10.1145/3274784.3274789},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/FerroFGKCDDEGGK18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FerroS18,
  author    = {Nicola Ferro and
               Ian Soboroff},
  title     = {Report on {EVIA} 2017},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {162--166},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274804},
  doi       = {10.1145/3274784.3274804},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/FerroS18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fetahu18,
  author    = {Besnik Fetahu},
  title     = {Approaches for Enriching and Improving Textual Knowledge Bases},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {167--168},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274806},
  doi       = {10.1145/3274784.3274806},
  timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Fetahu18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GhoshGGCJM18,
  author    = {Saptarshi Ghosh and
               Kripabandhu Ghosh and
               Debasis Ganguly and
               Tanmoy Chakraborty and
               Gareth J. F. Jones and
               Marie{-}Francine Moens},
  title     = {Report on the Second Workshop on Exploitation of Social Media for
               Emergency Relief and Preparedness {(SMERP} 2018) at the Web Conference
               {(WWW)} 2018},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {163--168},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308800},
  doi       = {10.1145/3308774.3308800},
  timestamp = {Fri, 27 Mar 2020 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GhoshGGCJM18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jarvelin18,
  author    = {Kalervo J{\"{a}}rvelin},
  title     = {Salton Award Keynote: Information Interaction in Context},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {52--63},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308782},
  doi       = {10.1145/3308774.3308782},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Jarvelin18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JonesBLP18,
  author    = {Gareth J. F. Jones and
               Nicholas J. Belkin and
               S{\'{e}}amus Lawless and
               Gabriella Pasi},
  title     = {Report on the {CHIIR} 2018 Workshop on Evaluation of Personalisation
               in Information Retrieval {(WEPIR} 2018)},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {129--134},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274796},
  doi       = {10.1145/3274784.3274796},
  timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JonesBLP18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jorge0JNRCPM18,
  author    = {Al{\'{\i}}pio Jorge and
               Ricardo Campos and
               Adam Jatowt and
               S{\'{e}}rgio Nunes and
               Concei{\c{c}}{\~{a}}o Rocha and
               Jo{\~{a}}o Paulo Cordeiro and
               Arian Pasquali and
               V{\'{\i}}tor Mangaravite},
  title     = {{ECIR} 2018: Text2Story Workshop - Narrative Extraction from Texts},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {150--152},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274801},
  doi       = {10.1145/3274784.3274801},
  timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Jorge0JNRCPM18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kim18,
  author    = {Yubin Kim},
  title     = {Robust Selective Search},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {170--171},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308803},
  doi       = {10.1145/3308774.3308803},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Kim18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KoestenMGSR18,
  author    = {Laura Koesten and
               Philipp Mayr and
               Paul Groth and
               Elena Simperl and
               Maarten de Rijke},
  title     = {Report on the {DATA:} SEARCH'18 workshop - Searching Data on the Web},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {117--124},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308794},
  doi       = {10.1145/3308774.3308794},
  timestamp = {Tue, 04 Aug 2020 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/KoestenMGSR18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lin18,
  author    = {Jimmy Lin},
  title     = {The Neural Hype and Comparisons Against Weak Baselines},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {40--51},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308781},
  doi       = {10.1145/3308774.3308781},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Lin18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lipani18,
  author    = {Aldo Lipani},
  title     = {On Biases in Information Retrieval Models and Evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {172--173},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308804},
  doi       = {10.1145/3308774.3308804},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Lipani18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiuKCKS18,
  author    = {Yiqun Liu and
               Makoto P. Kato and
               Charles L. A. Clarke and
               Noriko Kando and
               Tetsuya Sakai},
  title     = {Report on {NTCIR-13:} The Thirteenth Round of {NII} Testbeds and Community
               for Information Access Research},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {102--110},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274791},
  doi       = {10.1145/3274784.3274791},
  timestamp = {Wed, 16 Sep 2020 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/LiuKCKS18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Maistro18,
  author    = {Maria Maistro},
  title     = {Exploiting User Signals and Stochastic Models to Improve Information
               Retrieval Systems and Evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {174--175},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308805},
  doi       = {10.1145/3308774.3308805},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Maistro18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MarkovR18,
  author    = {Ilya Markov and
               Maarten de Rijke},
  title     = {What Should We Teach in Information Retrieval?},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {19--39},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308780},
  doi       = {10.1145/3308774.3308780},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/MarkovR18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MayrCJ18,
  author    = {Philipp Mayr and
               Muthu Kumar Chandrasekaran and
               Kokil Jaidka},
  title     = {Report on the 3rd Joint Workshop on Bibliometric-enhanced Information
               Retrieval and Natural Language Processing for Digital Libraries {(BIRNDL}
               2018)},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {105--110},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308792},
  doi       = {10.1145/3308774.3308792},
  timestamp = {Thu, 25 Jul 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/MayrCJ18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MayrFC18,
  author    = {Philipp Mayr and
               Ingo Frommholz and
               Guillaume Cabanac},
  title     = {Report on the 7th International Workshop on Bibliometric-enhanced
               Information Retrieval {(BIR} 2018)},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {135--139},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274798},
  doi       = {10.1145/3274784.3274798},
  timestamp = {Mon, 16 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/MayrFC18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Mehrotra18,
  author    = {Rishabh Mehrotra},
  title     = {Inferring User Needs {\&} Tasks from User Interactions},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {176--177},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308806},
  doi       = {10.1145/3308774.3308806},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Mehrotra18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MejovaCTB18,
  author    = {Yelena Mejova and
               Ekaterina Chernyak and
               Elena Tutubalina and
               Pavel Braslavski},
  title     = {Report on the 12th Russian Summer School in Information Retrieval
               (RuSSIR 2018)},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {100--104},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308790},
  doi       = {10.1145/3308774.3308790},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/MejovaCTB18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PeraFGG18,
  author    = {Maria Soledad Pera and
               Jerry Alan Fails and
               Mirko Gelsomini and
               Franca Garzotto},
  title     = {Building Community: Report on KidRec Workshop on Children and Recommender
               Systems at RecSys 2017},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {153--161},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274803},
  doi       = {10.1145/3274784.3274803},
  timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/PeraFGG18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Radhakrishnan18,
  author    = {Priya Radhakrishnan},
  title     = {Named Entity Extraction for Knowledgebase Enhancement},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {169--170},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274807},
  doi       = {10.1145/3274784.3274807},
  timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Radhakrishnan18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Scells18,
  author    = {Harrisen Scells},
  title     = {11th European Summer School in Information Retrieval {(ESSIR} 2017)},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {1},
  pages     = {111--118},
  year      = {2018},
  url       = {https://doi.org/10.1145/3274784.3274793},
  doi       = {10.1145/3274784.3274793},
  timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Scells18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SoboroffFF18,
  author    = {Ian Soboroff and
               Nicola Ferro and
               Norbert Fuhr},
  title     = {Report on {GLARE} 2018: 1st Workshop on Generalization in Information
               Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {132--137},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308796},
  doi       = {10.1145/3308774.3308796},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/SoboroffFF18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Soldaini18,
  author    = {Luca Soldaini},
  title     = {The Knowledge and Language Gap in Medical Information Seeking},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {178--179},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308807},
  doi       = {10.1145/3308774.3308807},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Soldaini18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SpinaAJKR18,
  author    = {Damiano Spina and
               Jaime Arguello and
               Hideo Joho and
               Julia Kiseleva and
               Filip Radlinski},
  title     = {CAIR'18: Second International Workshop on Conversational Approaches
               to Information Retrieval at {SIGIR} 2018},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {111--116},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308793},
  doi       = {10.1145/3308774.3308793},
  timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/SpinaAJKR18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/VerberneHKWLRV18,
  author    = {Suzan Verberne and
               Jiyin He and
               Udo Kruschwitz and
               Gineke Wiggers and
               Birger Larsen and
               Tony Russell{-}Rose and
               Arjen P. de Vries},
  title     = {First International Workshop on Professional Search},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {153--162},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308799},
  doi       = {10.1145/3308774.3308799},
  timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/VerberneHKWLRV18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Xiong18,
  author    = {Chenyan Xiong},
  title     = {Text Representation, Retrieval, and Understanding with Knowledge Graphs},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {180--181},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308808},
  doi       = {10.1145/3308774.3308808},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Xiong18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Yilmaz18,
  author    = {Emine Yilmaz},
  title     = {{ACM} {SIGIR} Annual Business Meeting 2018: Secretary's Notes},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {5--10},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308776},
  doi       = {10.1145/3308774.3308776},
  timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Yilmaz18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZhangZZ18,
  author    = {Yongfeng Zhang and
               Yi Zhang and
               Min Zhang},
  title     = {Report on EARS'18: 1st International Workshop on ExplainAble Recommendation
               and Search},
  journal   = {{SIGIR} Forum},
  volume    = {52},
  number    = {2},
  pages     = {125--131},
  year      = {2018},
  url       = {https://doi.org/10.1145/3308774.3308795},
  doi       = {10.1145/3308774.3308795},
  timestamp = {Wed, 01 Apr 2020 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/ZhangZZ18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/000117,
  author    = {Mostafa Dehghani},
  title     = {Toward Document Understanding for Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {27--31},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190585},
  doi       = {10.1145/3190580.3190585},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/000117.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/0001KKRY17,
  author    = {Hui Fang and
               Jaap Kamps and
               Evangelos Kanoulas and
               Maarten de Rijke and
               Emine Yilmaz},
  title     = {Report on the 2017 {ACM} {SIGIR} International Conference Theory of
               Information Retrieval (ICTIR?17)},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {78--87},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190591},
  doi       = {10.1145/3190580.3190591},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/0001KKRY17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AhlersW17,
  author    = {Dirk Ahlers and
               Erik Wilde},
  title     = {Report on the Seventh International Workshop on Location and the Web
               (LocWeb 2017)},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {1},
  pages     = {52--57},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130332.3130342},
  doi       = {10.1145/3130332.3130342},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AhlersW17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AliannejadiHMST17,
  author    = {Mohammad Aliannejadi and
               Maram Hasanain and
               Jiaxin Mao and
               Jaspreet Singh and
               Johanne R. Trippas and
               Hamed Zamani and
               Laura Dietz},
  title     = {{ACM} {SIGIR} Student Liaison Program},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {42--45},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190587},
  doi       = {10.1145/3190580.3190587},
  timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/AliannejadiHMST17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanBBCCDDFHHR17,
  author    = {James Allan and
               Nicholas J. Belkin and
               Paul N. Bennett and
               Jamie Callan and
               Charles L. A. Clarke and
               Fernando Diaz and
               Susan T. Dumais and
               Nicola Ferro and
               Donna Harman and
               Djoerd Hiemstra and
               Ian Ruthven and
               Tetsuya Sakai and
               Mark D. Smucker and
               Justin Zobel},
  title     = {Overview of Special Issue},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {1--25},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130350},
  doi       = {10.1145/3130348.3130350},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/AllanBBCCDDFHHR17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanPL17,
  author    = {James Allan and
               Ron Papka and
               Victor Lavrenko},
  title     = {On-Line New Event Detection and Tracking},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {185--193},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130366},
  doi       = {10.1145/3130348.3130366},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AllanPL17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Amigo0MZ17,
  author    = {Enrique Amig{\'{o}} and
               Hui Fang and
               Stefano Mizzaro and
               ChengXiang Zhai},
  title     = {Report on the {SIGIR} 2017 Workshop on Axiomatic Thinking for Information
               Retrieval and Related Tasks {(ATIR)}},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {99--106},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190596},
  doi       = {10.1145/3190580.3190596},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Amigo0MZ17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AzzopardiMOH17,
  author    = {Leif Azzopardi and
               Craig Macdonald and
               Iadh Ounis and
               Martin Halvey},
  title     = {Report on the Information Retrieval Festival (IRFest2017)},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {1},
  pages     = {12--28},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130332.3130336},
  doi       = {10.1145/3130332.3130336},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AzzopardiMOH17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AzzopardiPSST17,
  author    = {Leif Azzopardi and
               Jeremy Pickens and
               Chirag Shah and
               Laure Soulier and
               Lynda Tamine},
  title     = {Report on the Second International Workshop on the Evaluation on Collaborative
               Information Seeking and Retrieval (ECol?2017 @ {CHIIR)}},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {122--127},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190599},
  doi       = {10.1145/3190580.3190599},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AzzopardiPSST17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belew17,
  author    = {Richard K. Belew},
  title     = {Adaptive Information Retrieval: Using a Connectionist Representation
               to Retrieve and Leasrn about Documents},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {106--115},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130359},
  doi       = {10.1145/3130348.3130359},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Belew17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BergerL17,
  author    = {Adam L. Berger and
               John D. Lafferty},
  title     = {Information Retrieval as Statistical Translation},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {219--226},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130371},
  doi       = {10.1145/3130348.3130371},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BergerL17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BharatH17,
  author    = {Krishna Bharat and
               Monika Henzinger},
  title     = {Improved Algorithms for Topic Distillation in a Hyperlinked Environment},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {194--201},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130367},
  doi       = {10.1145/3130348.3130367},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BharatH17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Boer17,
  author    = {Maaike H. T. de Boer},
  title     = {Semantic Mapping in Video Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {161--162},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190606},
  doi       = {10.1145/3190580.3190606},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Boer17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BogersKMLS17,
  author    = {Toine Bogers and
               Marijn Koolen and
               Cataldo Musto and
               Pasquale Lops and
               Giovanni Semeraro},
  title     = {Report on RecSys 2016Workshop on New Trends in Content-Based Recommender
               Systems},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {1},
  pages     = {45--51},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130332.3130341},
  doi       = {10.1145/3130332.3130341},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BogersKMLS17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BorattoKS17,
  author    = {Ludovico Boratto and
               Andreas Kaltenbrunner and
               Giovanni Stilo},
  title     = {Report on the Workshop on Social Media for Personalization And Search
               (SoMePeAS)},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {1},
  pages     = {42--44},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130332.3130339},
  doi       = {10.1145/3130332.3130339},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BorattoKS17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BraslavskiKKH17,
  author    = {Pavel Braslavski and
               Jaap Kamps and
               Julia Kiseleva and
               Alexander Halperin},
  title     = {Report on the 11th Russian Summer School in Information Retrieval
               (RuSSIR 2017)},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {94--98},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190594},
  doi       = {10.1145/3190580.3190594},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BraslavskiKKH17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BuckleyV17,
  author    = {Chris Buckley and
               Ellen M. Voorhees},
  title     = {Evaluating Evaluation Measure Stability},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {235--242},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130373},
  doi       = {10.1145/3130348.3130373},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BuckleyV17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CallanLC17,
  author    = {James P. Callan and
               Zhihong Lu and
               W. Bruce Croft},
  title     = {Searching Distributed Collections With Inference Networks},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {160--167},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130363},
  doi       = {10.1145/3130348.3130363},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CallanLC17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CappellatoFGGJK17,
  author    = {Linda Cappellato and
               Nicola Ferro and
               Lorraine Goeuriot and
               Julio Gonzalo and
               Gareth J. F. Jones and
               Liadh Kelly and
               S{\'{e}}amus Lawless and
               Thomas Mandl},
  title     = {Report on {CLEF} 2017: Experimental {IR} Meets Multilinguality, Multimodality,
               and Interaction},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {67--77},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190590},
  doi       = {10.1145/3190580.3190590},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/CappellatoFGGJK17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CarbinellG17,
  author    = {Jaime Carbinell and
               Jade Goldstein},
  title     = {The Use of MMR, Diversity-Based Reranking for Reordering Documents
               and Producing Summaries},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {209--210},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130369},
  doi       = {10.1145/3130348.3130369},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CarbinellG17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Catena17,
  author    = {Matteo Catena},
  title     = {Energy Efficiency in Large Scale Information Retrieval Systems},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {159--160},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190605},
  doi       = {10.1145/3190580.3190605},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Catena17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CraswellCRGM17,
  author    = {Nick Craswell and
               W. Bruce Croft and
               Maarten de Rijke and
               Jiafeng Guo and
               Bhaskar Mitra},
  title     = {Report on the Second {SIGIR} Workshop on Neural Information Retrieval
               (Neu-IR'17)},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {152--158},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190603},
  doi       = {10.1145/3190580.3190603},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CraswellCRGM17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CuttingKPT17,
  author    = {Douglas R. Cutting and
               David R. Karger and
               Jan O. Pedersen and
               John W. Tukey},
  title     = {Scatter/Gather: {A} Cluster-based Approach to Browsing Large Document
               Collections},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {148--159},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130362},
  doi       = {10.1145/3130348.3130362},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CuttingKPT17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DegenhardtKLRST17,
  author    = {Jon Degenhardt and
               Surya Kallumadi and
               Yiu{-}Chang Lin and
               Maarten de Rijke and
               Luo Si and
               Andrew Trotman and
               Sindhuja Venkatesh and
               Yinghui Xu},
  title     = {Report on the {SIGIR} 2017 Workshop on eCommerce {(ECOM17)}},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {128--138},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190600},
  doi       = {10.1145/3190580.3190600},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DegenhardtKLRST17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DietzXM17,
  author    = {Laura Dietz and
               Chenyan Xiong and
               Edgar Meij},
  title     = {Overview of The First Workshop on Knowledge Graphs and Semantics for
               Text Retrieval and Analysis {(KG4IR)}},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {139--144},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190601},
  doi       = {10.1145/3190580.3190601},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DietzXM17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fagan17,
  author    = {Joel L. Fagan},
  title     = {Automatic {P} h r a s e Indexing for Document Retrieval: An Examination
               of Syntactic and Non-Syntactic Methods},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {51--61},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130355},
  doi       = {10.1145/3130348.3130355},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Fagan17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FerroLMP17,
  author    = {Nicola Ferro and
               Claudio Lucchese and
               Maria Maistro and
               Raffaele Perego},
  title     = {Report on {LEARNER} 2017: 1st International Workshop on LEARning Next
               gEneration Rankers},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {145--151},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190602},
  doi       = {10.1145/3190580.3190602},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/FerroLMP17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fuhr17,
  author    = {Norbert Fuhr},
  title     = {Some Common Mistakes In {IR} Evaluation, And How They Can Be Avoided},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {32--41},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190586},
  doi       = {10.1145/3190580.3190586},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Fuhr17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FuhrGGGHJJLMNPS17,
  author    = {Norbert Fuhr and
               Anastasia Giachanou and
               Gregory Grefenstette and
               Iryna Gurevych and
               Andreas Hanselowski and
               Kalervo J{\"{a}}rvelin and
               Rosie Jones and
               Yiqun Liu and
               Josiane Mothe and
               Wolfgang Nejdl and
               Isabella Peters and
               Benno Stein},
  title     = {An Information Nutritional Label for Online Documents},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {46--66},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190588},
  doi       = {10.1145/3190580.3190588},
  timestamp = {Wed, 16 Sep 2020 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/FuhrGGGHJJLMNPS17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FurnasDDLHSL17,
  author    = {George W. Furnas and
               Scott C. Deerwester and
               Susan T. Dumais and
               Thomas K. Landauer and
               Richard A. Harshman and
               Lynn A. Streeter and
               Karen E. Lochbaum},
  title     = {Information Retrieval using a Singular Value Decomposition Model of
               Latent Semantic Structure},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {90--105},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130358},
  doi       = {10.1145/3130348.3130358},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/FurnasDDLHSL17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GhoshGGCJM17,
  author    = {Saptarshi Ghosh and
               Kripabandhu Ghosh and
               Debasis Ganguly and
               Tanmoy Chakraborty and
               Gareth J. F. Jones and
               Marie{-}Francine Moens},
  title     = {{ECIR} 2017 Workshop on Exploitation of Social Media for Emergency
               Relief and Preparedness {(SMERP} 2017)},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {1},
  pages     = {36--41},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130332.3130338},
  doi       = {10.1145/3130332.3130338},
  timestamp = {Fri, 27 Mar 2020 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GhoshGGCJM17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman17,
  author    = {Donna Harman},
  title     = {Towards Interactive Query Expansion},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {79--89},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130357},
  doi       = {10.1145/3130348.3130357},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Harman17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HerlockerKBR17,
  author    = {Jonathan L. Herlocker and
               Joseph A. Konstan and
               Al Borchers and
               John Riedl},
  title     = {An Algorithmic Framework for Performing Collaborative Filtering},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {227--234},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130372},
  doi       = {10.1145/3130348.3130372},
  timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/HerlockerKBR17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hofmann17,
  author    = {Thomas Hofmann},
  title     = {Probabilistic Latent Semantic Indexing},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {211--218},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130370},
  doi       = {10.1145/3130348.3130370},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Hofmann17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Htun17,
  author    = {Nyi Nyi Htun},
  title     = {Non-Uniform Information Access in Collaborative Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {163--164},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190607},
  doi       = {10.1145/3190580.3190607},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Htun17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ibrahim17,
  author    = {Muhammad Ibrahim},
  title     = {Scalability and Performance of Random Forest based Learning-to-Rank
               for Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {1},
  pages     = {73--74},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130332.3130346},
  doi       = {10.1145/3130332.3130346},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Ibrahim17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JarvelinK17,
  author    = {Kalervo J{\"{a}}rvelin and
               Jaana Kek{\"{a}}l{\"{a}}inen},
  title     = {{IR} evaluation methods for retrieving highly relevant documents},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {243--250},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130374},
  doi       = {10.1145/3130348.3130374},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JarvelinK17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JoachimsGPHG17,
  author    = {Thorsten Joachims and
               Laura A. Granka and
               Bing Pan and
               Helene Hembrooke and
               Geri Gay},
  title     = {Accurately Interpreting Clickthrough Data as Implicit Feedback},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {1},
  pages     = {4--11},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130332.3130334},
  doi       = {10.1145/3130332.3130334},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JoachimsGPHG17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JohoCASR17,
  author    = {Hideo Joho and
               Lawrence Cavedon and
               Jaime Arguello and
               Milad Shokouhi and
               Filip Radlinski},
  title     = {CAIR'17: First International Workshop on Conversational Approaches
               to Information Retrieval at {SIGIR} 2017},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {114--121},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190598},
  doi       = {10.1145/3190580.3190598},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JohoCASR17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jones17,
  author    = {Karen Sparck Jones},
  title     = {A Look Back and a Look Forward},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {62--78},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130356},
  doi       = {10.1145/3130348.3130356},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Jones17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KanoulasK17,
  author    = {Evangelos Kanoulas and
               Jussi Karlgren},
  title     = {Practical Issues in Information Access System Evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {1},
  pages     = {67--72},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130332.3130344},
  doi       = {10.1145/3130332.3130344},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/KanoulasK17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KatoYJY17,
  author    = {Makoto P. Kato and
               Takehiro Yamamoto and
               Hideo Joho and
               Masatoshi Yoshikawa},
  title     = {Asian Summer School in Information Access {(ASSIA} 2017)},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {88--93},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190593},
  doi       = {10.1145/3190580.3190593},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KatoYJY17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KatzerTFD17,
  author    = {Jeffrey Katzer and
               Judith A. Tessier and
               William B. Frakes and
               Padmini Das{-}Gupta},
  title     = {A Study of the Overlap Among Document Representations},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {26--34},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130352},
  doi       = {10.1145/3130348.3130352},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KatzerTFD17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KoolenKBBKY17,
  author    = {Marijn Koolen and
               Jaap Kamps and
               Toine Bogers and
               Nicholas J. Belkin and
               Diane Kelly and
               Emine Yilmaz},
  title     = {Report on the Second Workshop on Supporting Complex Search Tasks},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {1},
  pages     = {58--66},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130332.3130343},
  doi       = {10.1145/3130332.3130343},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KoolenKBBKY17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kopeinik17,
  author    = {Simone Kopeinik},
  title     = {Applying Cognitive Learner Models for Recommender Systems in Sparse
               Data Learning Environments},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {165},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190608},
  doi       = {10.1145/3190580.3190608},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Kopeinik17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kowald17,
  author    = {Dominik Kowald},
  title     = {Modeling Activation Processes in Human Memory to Improve Tag Recommendations},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {166},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190609},
  doi       = {10.1145/3190580.3190609},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Kowald17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LaffertyZ17,
  author    = {John D. Lafferty and
               Chengxiang Zhai},
  title     = {Document Language Models, Query Models, and Risk Minimization for
               Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {251--259},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130375},
  doi       = {10.1145/3130348.3130375},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LaffertyZ17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LavrenkoC17,
  author    = {Victor Lavrenko and
               W. Bruce Croft},
  title     = {Relevance-Based Language Models},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {260--267},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130376},
  doi       = {10.1145/3130348.3130376},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LavrenkoC17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MayrCJ17,
  author    = {Philipp Mayr and
               Muthu Kumar Chandrasekaran and
               Kokil Jaidka},
  title     = {Report on the 2nd Joint Workshop on Bibliometric-enhanced Information
               Retrieval and Natural Language Processing for Digital Libraries {(BIRNDL}
               2017)},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {107--113},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190597},
  doi       = {10.1145/3190580.3190597},
  timestamp = {Thu, 25 Jul 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/MayrCJ17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MayrFC17,
  author    = {Philipp Mayr and
               Ingo Frommholz and
               Guillaume Cabanac},
  title     = {Report on the 5th International Workshop on Bibliometric-enhanced
               Information Retrieval {(BIR} 2017)},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {1},
  pages     = {29--35},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130332.3130337},
  doi       = {10.1145/3130332.3130337},
  timestamp = {Thu, 25 Jul 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/MayrFC17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Pejtersen17,
  author    = {Annelise Mark Pejtersen},
  title     = {A Library System for Information Retrieval based on a Cognitive Task
               Analysis and Supported by an Icon-Based Interface},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {116--123},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130360},
  doi       = {10.1145/3130348.3130360},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Pejtersen17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PonteC17,
  author    = {Jay M. Ponte and
               W. Bruce Croft},
  title     = {A Language Modeling Approach to Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {202--208},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130368},
  doi       = {10.1145/3130348.3130368},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/PonteC17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Rijsbergen17,
  author    = {C. J. van Rijsbergen},
  title     = {A New Theoretical Framework For Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {44--50},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130354},
  doi       = {10.1145/3130348.3130354},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Rijsbergen17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sebastian17,
  author    = {Yakub Sebastian},
  title     = {Literature-Based Discovery by Learning Heterogeneous Bibliographic
               Information Networks},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {1},
  pages     = {75--76},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130332.3130347},
  doi       = {10.1145/3130332.3130347},
  timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Sebastian17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SinghalBM17,
  author    = {Amit Singhal and
               Chris Buckley and
               Manclar Mitra},
  title     = {Pivoted Document Length Normalization},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {176--184},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130365},
  doi       = {10.1145/3130348.3130365},
  timestamp = {Fri, 30 Aug 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/SinghalBM17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TeevanDH17,
  author    = {Jaime Teevan and
               Susan T. Dumais and
               Eric Horvitz},
  title     = {Personalizing Search via Automated Analysis of Interests and Activities},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {10--17},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190582},
  doi       = {10.1145/3190580.3190582},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/TeevanDH17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TurtleC17,
  author    = {Howard R. Turtle and
               W. Bruce Croft},
  title     = {Inference Networks for Document Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {124--147},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130361},
  doi       = {10.1145/3130348.3130361},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/TurtleC17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Vdorhees17,
  author    = {Ellen M. Vdorhees},
  title     = {The Cluster Hypothesis Revisited},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {35--43},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130353},
  doi       = {10.1145/3130348.3130353},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Vdorhees17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/XuC17,
  author    = {Jinxi Xu and
               W. Bruce Croft},
  title     = {Quary Expansion Using Local and Global Document Analysis},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {168--175},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130364},
  doi       = {10.1145/3130348.3130364},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/XuC17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZhaiL17,
  author    = {Chengxiang Zhai and
               John D. Lafferty},
  title     = {A Study of Smoothing Methods for Language Models Applied to Ad Hoc
               Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {2},
  pages     = {268--276},
  year      = {2017},
  url       = {https://doi.org/10.1145/3130348.3130377},
  doi       = {10.1145/3130348.3130377},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ZhaiL17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zobel17,
  author    = {Justin Zobel},
  title     = {What We Talk About When We Talk About Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {51},
  number    = {3},
  pages     = {18--26},
  year      = {2017},
  url       = {https://doi.org/10.1145/3190580.3190584},
  doi       = {10.1145/3190580.3190584},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Zobel17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiARP16,
  author    = {Maristella Agosti and
               Omar Alonso and
               Maarten de Rijke and
               Raffaele Perego},
  title     = {Data-Driven Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {10--14},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053410},
  doi       = {10.1145/3053408.3053410},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AgostiARP16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AhlersW16,
  author    = {Dirk Ahlers and
               Erik Wilde},
  title     = {Report on the Sixth International Workshop on Location and the Web
               (LocWeb 2016)},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {51--57},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053420},
  doi       = {10.1145/3053408.3053420},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AhlersW16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AzzopardiMHABBC16,
  author    = {Leif Azzopardi and
               Yashar Moshfeghi and
               Martin Halvey and
               Rami Suleiman Alkhawaldeh and
               Krisztian Balog and
               Emanuele Di Buccio and
               Diego Ceccarelli and
               Juan M. Fern{\'{a}}ndez{-}Luna and
               Charlie Hull and
               Jake Mannix and
               Sauparna Palchowdhury},
  title     = {Lucene4IR: Developing Information Retrieval Evaluation Resources using
               Lucene},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {58--75},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053421},
  doi       = {10.1145/3053408.3053421},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AzzopardiMHABBC16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BalogDDI16,
  author    = {Krisztian Balog and
               Jeffrey Dalton and
               Antoine Doucet and
               Yusra Ibrahim},
  title     = {Report on the Eighth Workshop on Exploiting Semantic Annotations in
               Information Retrieval {(ESAIR} '15)},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {49--57},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964806},
  doi       = {10.1145/2964797.2964806},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BalogDDI16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CabanacCFJKMW16,
  author    = {Guillaume Cabanac and
               Muthu Kumar Chandrasekaran and
               Ingo Frommholz and
               Kokil Jaidka and
               Min{-}Yen Kan and
               Philipp Mayr and
               Dietmar Wolfram},
  title     = {Report on the Joint Workshop on Bibliometric-enhanced Information
               Retrieval and Natural Language Processing for Digital Libraries {(BIRNDL}
               2016)},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {36--43},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053417},
  doi       = {10.1145/3053408.3053417},
  timestamp = {Thu, 25 Jul 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/CabanacCFJKMW16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Calumby16,
  author    = {Rodrigo Tripodi Calumby},
  title     = {Diversity-oriented Multimodal and Interactive Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {86},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964811},
  doi       = {10.1145/2964797.2964811},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Calumby16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ClarkeY16,
  author    = {Charles L. A. Clarke and
               Emine Yilmaz},
  title     = {{EVIA} 2016: The Seventh International Workshop on Evaluating Information
               Access},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {44--46},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053418},
  doi       = {10.1145/3053408.3053418},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ClarkeY16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Crane16,
  author    = {Matt Crane},
  title     = {Improved Indexing {\&} Searching Throughput},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {87},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964812},
  doi       = {10.1145/2964797.2964812},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Crane16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CraswellCGMR16,
  author    = {Nick Craswell and
               W. Bruce Croft and
               Jiafeng Guo and
               Bhaskar Mitra and
               Maarten de Rijke},
  title     = {Report on the {SIGIR} 2016 Workshop on Neural Information Retrieval
               (Neu-IR)},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {96--103},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053425},
  doi       = {10.1145/3053408.3053425},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CraswellCGMR16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DebattistaFU16,
  author    = {Jeremy Debattista and
               Javier D. Fern{\'{a}}ndez and
               J{\"{u}}rgen Umbrich},
  title     = {Report on the 2nd Workshop on Managing the Evolution and Preservation
               of the Data Web (MEPDaW 2016)},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {82--88},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053423},
  doi       = {10.1145/3053408.3053423},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DebattistaFU16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Diaz16,
  author    = {Fernando Diaz},
  title     = {Worst Practices for Designing Production Information Access Systems},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {2--11},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964799},
  doi       = {10.1145/2964797.2964799},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Diaz16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DietzBDV16,
  author    = {Laura Dietz and
               Elinor Brondwine and
               Shiri Dori{-}Hacohen and
               Ellen M. Voorhees},
  title     = {Women in {IR}},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {15--17},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053411},
  doi       = {10.1145/3053408.3053411},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DietzBDV16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Edwards16,
  author    = {Ashlee Edwards},
  title     = {Engaged or Frustrated?: Disambiguating engagement and frustration
               in search},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {88--89},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964813},
  doi       = {10.1145/2964797.2964813},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Edwards16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fafalios16,
  author    = {Pavlos Fafalios},
  title     = {Exploiting Linked Data in Exploratory Search},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {104--105},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053427},
  doi       = {10.1145/3053408.3053427},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Fafalios16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FerroCMMSKRCPLM16,
  author    = {Nicola Ferro and
               Fabio Crestani and
               Marie{-}Francine Moens and
               Josiane Mothe and
               Fabrizio Silvestri and
               Jaana Kek{\"{a}}l{\"{a}}inen and
               Paolo Rosso and
               Paul D. Clough and
               Gabriella Pasi and
               Christina Lioma and
               Stefano Mizzaro and
               Giorgio Maria Di Nunzio and
               Claudia Hauff and
               Omar Alonso and
               Pavel Serdyukov and
               Gianmaria Silvello},
  title     = {Report on {ECIR} 2016: 38th European Conference on Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {12--27},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964801},
  doi       = {10.1145/2964797.2964801},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/FerroCMMSKRCPLM16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FerroFJKLZ16,
  author    = {Nicola Ferro and
               Norbert Fuhr and
               Kalervo J{\"{a}}rvelin and
               Noriko Kando and
               Matthias Lippold and
               Justin Zobel},
  title     = {Increasing Reproducibility in {IR:} Findings from the Dagstuhl Seminar
               on "Reproducibility of Data-Oriented Experiments in e-Science"},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {68--82},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964808},
  doi       = {10.1145/2964797.2964808},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/FerroFJKLZ16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GoeuriotBJKMP16,
  author    = {Lorraine Goeuriot and
               Steven Bedrick and
               Gareth J. F. Jones and
               Anastasia Krithara and
               Henning M{\"{u}}ller and
               George Paliouras},
  title     = {Report on the {SIGIR} 2016 Workshop on Medical Information Retrieval
               (MedIR)},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {76--81},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053422},
  doi       = {10.1145/3053408.3053422},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GoeuriotBJKMP16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Gossen16,
  author    = {Tatiana Gossen},
  title     = {Targeted Search Engines for Children: Search User Interfaces and Information-Seeking
               Behaviour},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {106},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053428},
  doi       = {10.1145/3053408.3053428},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Gossen16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/IencoRRRT16,
  author    = {Dino Ienco and
               Mathieu Roche and
               Salvatore Romeo and
               Paolo Rosso and
               Andrea Tagarelli},
  title     = {{ECIR} 2016 Workshop on Modeling, Learning and Mining for Cross/Multilinguality
               (MultiLingMine '16)},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {89--95},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053424},
  doi       = {10.1145/3053408.3053424},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/IencoRRRT16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KatoKKSS16,
  author    = {Makoto P. Kato and
               Kazuaki Kishida and
               Noriko Kando and
               Tetsuya Sakai and
               Mark Sanderson},
  title     = {Report on {NTCIR-12:} The Twelfth Round of {NII} Testbeds and Community
               for Information Access Research},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {18--27},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053413},
  doi       = {10.1145/3053408.3053413},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KatoKKSS16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kong16,
  author    = {Weize Kong},
  title     = {Extending Faceted Search to the Open-Domain Web},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {90--91},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964814},
  doi       = {10.1145/2964797.2964814},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Kong16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KotovTBIVEB16,
  author    = {Alexander Kotov and
               Elena Treshcheva and
               Leonid Bessonov and
               Dmitry I. Ignatov and
               Yana Volkovich and
               Maria Eskevich and
               Pavel Braslavski},
  title     = {10th Russian Summer School in Information Retrieval (RuSSIR 2016)},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {28--35},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053415},
  doi       = {10.1145/3053408.3053415},
  timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/KotovTBIVEB16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Liu16,
  author    = {Xitong Liu},
  title     = {Entity Centric Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {92},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964815},
  doi       = {10.1145/2964797.2964815},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Liu16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Martinez-Alvarez16,
  author    = {Miguel Martinez{-}Alvarez and
               Udo Kruschwitz and
               Gabriella Kazai and
               Frank Hopfgartner and
               David Corney and
               Ricardo Campos and
               Dyaa Albakour},
  title     = {Report on the 1st International Workshop on Recent Trends in News
               Information Retrieval (NewsIR16)},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {58--67},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964807},
  doi       = {10.1145/2964797.2964807},
  timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Martinez-Alvarez16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MayrFC16,
  author    = {Philipp Mayr and
               Ingo Frommholz and
               Guillaume Cabanac},
  title     = {Report on the 3rd International Workshop on Bibliometric-enhanced
               Information Retrieval {(BIR} 2016)},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {28--34},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964803},
  doi       = {10.1145/2964797.2964803},
  timestamp = {Thu, 25 Jul 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/MayrFC16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MederHKK16,
  author    = {Michael Meder and
               Frank Hopfgartner and
               Gabriella Kazai and
               Udo Kruschwitz},
  title     = {GamifIR 2016: {SIGIR} 2016 Workshop on Gamification for Information
               Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {47--50},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053419},
  doi       = {10.1145/3053408.3053419},
  timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/MederHKK16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MullerKHFSPKCTN16,
  author    = {Henning M{\"{u}}ller and
               Jayashree Kalpathy{-}Cramer and
               Allan Hanbury and
               Keyvan Farahani and
               Rinat Sergeev and
               Jin H. Paik and
               Arno Klein and
               Antonio Criminisi and
               Andrew Trister and
               Thea Norman and
               David N. Kennedy and
               Ganapati Srinivasa and
               Artem Mamonov and
               Nina Preuss},
  title     = {Report on the Cloud-Based Evaluation Approaches Workshop 2015},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {38--41},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964804},
  doi       = {10.1145/2964797.2964804},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/MullerKHFSPKCTN16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/NielekWJT16,
  author    = {Radoslaw Nielek and
               Adam Wierzbicki and
               Adam Jatowt and
               Katsumi Tanaka},
  title     = {Report on the WebQuality 2015 Workshop},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {83--85},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964809},
  doi       = {10.1145/2964797.2964809},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/NielekWJT16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Odijk16,
  author    = {Daan Odijk},
  title     = {Context {\&} Semantics in News {\&} Web Search},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {93--94},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964816},
  doi       = {10.1145/2964797.2964816},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Odijk16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sappelli16,
  author    = {Maya Sappelli},
  title     = {Knowledge Work in Context: User Centered Knowledge Worker Support},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {2},
  pages     = {107--108},
  year      = {2016},
  url       = {https://doi.org/10.1145/3053408.3053429},
  doi       = {10.1145/3053408.3053429},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Sappelli16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Schuth16,
  author    = {Anne Schuth},
  title     = {Search Engines that Learn from Their Users},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {95--96},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964817},
  doi       = {10.1145/2964797.2964817},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Schuth16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SoulierTSAP16,
  author    = {Laure Soulier and
               Lynda Tamine and
               Tetsuya Sakai and
               Leif Azzopardi and
               Jeremy Pickens},
  title     = {Report on the First International Workshop on the Evaluation on Collaborative
               Information Seeking and Retrieval (ECol'2015)},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {42--48},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964805},
  doi       = {10.1145/2964797.2964805},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SoulierTSAP16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Whiting16,
  author    = {Stewart Whiting},
  title     = {Temporal Dynamics in Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {97--98},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964818},
  doi       = {10.1145/2964797.2964818},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Whiting16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zhao16,
  author    = {Xiaoxue Zhao},
  title     = {Cold-Start Collaborative Filtering},
  journal   = {{SIGIR} Forum},
  volume    = {50},
  number    = {1},
  pages     = {99--100},
  year      = {2016},
  url       = {https://doi.org/10.1145/2964797.2964819},
  doi       = {10.1145/2964797.2964819},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Zhao16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AhlersWM15,
  author    = {Dirk Ahlers and
               Erik Wilde and
               Bruno Martins},
  title     = {Report on the Fourth Workshop on Locatio and the Web (LocWeb 2014)},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {1},
  pages     = {35--40},
  year      = {2015},
  url       = {https://doi.org/10.1145/2795403.2795413},
  doi       = {10.1145/2795403.2795413},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AhlersWM15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AhlersWM15a,
  author    = {Dirk Ahlers and
               Erik Wilde and
               Bruno Martins},
  title     = {Report on the Fifth International Workshop on Location and the Web
               (LocWeb 2015)},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {123--128},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888442},
  doi       = {10.1145/2888422.2888442},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AhlersWM15a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoHK15,
  author    = {Omar Alonso and
               Marti A. Hearst and
               Jaap Kamps},
  title     = {Report on the First {SIGIR} Workshop on Graph Search and Beyond (GSB'15)},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {89--97},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888436},
  doi       = {10.1145/2888422.2888436},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AlonsoHK15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoKK15,
  author    = {Omar Alonso and
               Jaap Kamps and
               Jussi Karlgren},
  title     = {Report on the Seventh Workshop on Exploiting Semantic Annotations
               in Information Retrieval (ESAIR'14)},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {1},
  pages     = {27--34},
  year      = {2015},
  url       = {https://doi.org/10.1145/2795403.2795412},
  doi       = {10.1145/2795403.2795412},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AlonsoKK15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ArguelloCDLT15,
  author    = {Jaime Arguello and
               Matt Crane and
               Fernando Diaz and
               Jimmy J. Lin and
               Andrew Trotman},
  title     = {Report on the {SIGIR} 2015 Workshop on Reproducibility, Inexplicability,
               and Generalizability of Results {(RIGOR)}},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {107--116},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888439},
  doi       = {10.1145/2888422.2888439},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ArguelloCDLT15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin15,
  author    = {Nicholas J. Belkin},
  title     = {People, Interacting with Information},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {13--27},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888424},
  doi       = {10.1145/2888422.2888424},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Belkin15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BogersK15,
  author    = {Toine Bogers and
               Marijn Koolen},
  title     = {Report on RecSys 2015 Workshop on New Trends in Content-Based Recommender
               Systems},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {141--146},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888445},
  doi       = {10.1145/2888422.2888445},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BogersK15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BogersKC15,
  author    = {Toine Bogers and
               Marijn Koolen and
               Iv{\'{a}}n Cantador},
  title     = {Report on RecSys 2014: Workshop on New Trends in Content-Based Recommender
               Systems},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {1},
  pages     = {20--26},
  year      = {2015},
  url       = {https://doi.org/10.1145/2795403.2795411},
  doi       = {10.1145/2795403.2795411},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BogersKC15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BraslavskiMPVKK15,
  author    = {Pavel Braslavski and
               Ilya Markov and
               Panos M. Pardalos and
               Yana Volkovich and
               Sergei Koltsov and
               Olessia Koltsova and
               Dmitry I. Ignatov},
  title     = {9th Russian Summer School in Information Retrieval (RuSSIR 2015)},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {72--79},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888432},
  doi       = {10.1145/2888422.2888432},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BraslavskiMPVKK15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CappellatoFJKMP15,
  author    = {Linda Cappellato and
               Nicola Ferro and
               Gareth J. F. Jones and
               Jaap Kamps and
               Josiane Mothe and
               Karen Pinel{-}Sauvagnat and
               Eric SanJuan and
               Jacques Savoy},
  title     = {Report on {CLEF} 2015: Experimental {IR} Meets Multilinguality, Multimodality,
               and Interaction},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {47--56},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888428},
  doi       = {10.1145/2888422.2888428},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/CappellatoFJKMP15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Dalvi15,
  author    = {Bhavana Bharat Dalvi},
  title     = {Constrained Semi-supervised Learning in the Presence of Unanticipated
               Classes},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {147},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888447},
  doi       = {10.1145/2888422.2888447},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Dalvi15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Diaz015,
  author    = {Fernando Diaz and
               Diane Kelly},
  title     = {{SIGIR} 2015 Workshop Program Overview},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {80--82},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888434},
  doi       = {10.1145/2888422.2888434},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Diaz015.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DumaisCCJSR15,
  author    = {Susan T. Dumais and
               Edward Cutrell and
               Jonathan J. Cadiz and
               Gavin Jancke and
               Raman Sarin and
               Daniel C. Robbins},
  title     = {Stuff I've Seen: {A} System for Personal Information Retrieval and
               Re-Use},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {28--35},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888425},
  doi       = {10.1145/2888422.2888425},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DumaisCCJSR15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Freire15,
  author    = {Ana Freire},
  title     = {Query Scheduling Techniques and Power-Latency Trade-off Model for
               Large-Scale Search Engines},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {1},
  pages     = {66},
  year      = {2015},
  url       = {https://doi.org/10.1145/2795403.2795418},
  doi       = {10.1145/2795403.2795418},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Freire15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GadeHHKKSTW15,
  author    = {Maria G{\"{a}}de and
               Mark M. Hall and
               Hugo C. Huurdeman and
               Jaap Kamps and
               Marijn Koolen and
               Mette Skov and
               Elaine Toms and
               David Walsh},
  title     = {Report on the First Workshop on Supporting Complex Search Tasks},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {1},
  pages     = {50--56},
  year      = {2015},
  url       = {https://doi.org/10.1145/2795403.2795415},
  doi       = {10.1145/2795403.2795415},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GadeHHKKSTW15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GwizdkaM15,
  author    = {Jacek Gwizdka and
               Javed Mostafa},
  title     = {NeuroIR 2015: {SIGIR} 2015 Workshop on Neuro-Physiological Methods
               in {IR} Research},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {83--88},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888435},
  doi       = {10.1145/2888422.2888435},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GwizdkaM15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HalveyMJRRMK15,
  author    = {Martin Halvey and
               Philip J. McParlane and
               Joemon M. Jose and
               Keith van Rijsbergen and
               Stefan M. R{\"{u}}ger and
               R. Manmatha and
               Mohan S. Kankanhalli},
  title     = {{ICMR} 2014: 4th {ACM} International Conference on Multimedia Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {1},
  pages     = {10--15},
  year      = {2015},
  url       = {https://doi.org/10.1145/2795403.2795407},
  doi       = {10.1145/2795403.2795407},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HalveyMJRRMK15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HalveyVC15,
  author    = {Martin Halvey and
               Robert Villa and
               Paul D. Clough},
  title     = {{SIGIR} 2014: Workshop on Gathering Efficient Assessments of Relevance
               {(GEAR)}},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {1},
  pages     = {16--19},
  year      = {2015},
  url       = {https://doi.org/10.1145/2795403.2795409},
  doi       = {10.1145/2795403.2795409},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HalveyVC15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HanburyKRF15,
  author    = {Allan Hanbury and
               Gabriella Kazai and
               Andreas Rauber and
               Norbert Fuhr},
  title     = {{ECIR} 2015: 37th European Conference on Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {36--46},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888427},
  doi       = {10.1145/2888422.2888427},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HanburyKRF15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HopfgartnerBSKL15,
  author    = {Frank Hopfgartner and
               Torben Brodt and
               Jonas Seiler and
               Benjamin Kille and
               Andreas Lommatzsch and
               Martha A. Larson and
               Roberto Turrin and
               Andr{\'{a}}s Ser{\'{e}}ny},
  title     = {Benchmarking News Recommendations: The {CLEF} NewsREEL Use Case},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {129--136},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888443},
  doi       = {10.1145/2888422.2888443},
  timestamp = {Fri, 06 Dec 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HopfgartnerBSKL15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HopfgartnerHMKM15,
  author    = {Frank Hopfgartner and
               Allan Hanbury and
               Henning M{\"{u}}ller and
               Noriko Kando and
               Simon Mercer and
               Jayashree Kalpathy{-}Cramer and
               Martin Potthast and
               Tim Gollub and
               Anastasia Krithara and
               Jimmy J. Lin and
               Krisztian Balog and
               Ivan Eggel},
  title     = {Report on the Evaluation-as-a-Service (EaaS) Expert Workshop},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {1},
  pages     = {57--65},
  year      = {2015},
  url       = {https://doi.org/10.1145/2795403.2795416},
  doi       = {10.1145/2795403.2795416},
  timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/HopfgartnerHMKM15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KazaiLHKM15,
  author    = {Gabriella Kazai and
               Lumi and
               Frank Hopfgartner and
               Udo Kruschwitz and
               Michael Meder},
  title     = {{ECIR} 2015 Workshop on Gamification for Information Retrieval (GamifIR'15)},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {1},
  pages     = {41--49},
  year      = {2015},
  url       = {https://doi.org/10.1145/2795403.2795414},
  doi       = {10.1145/2795403.2795414},
  timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/KazaiLHKM15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KeJ15,
  author    = {Hao{-}Ren Ke and
               Hideo Joho},
  title     = {2nd Asian Summer School in Information Access {(ASSIA} 2015)},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {67--71},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888431},
  doi       = {10.1145/2888422.2888431},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KeJ15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Limsopatham15,
  author    = {Nut Limsopatham},
  title     = {A Framework for Enhancing the Query and Medical Record Representations
               for Patient Search},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {1},
  pages     = {68--69},
  year      = {2015},
  url       = {https://doi.org/10.1145/2795403.2795420},
  doi       = {10.1145/2795403.2795420},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Limsopatham15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Marujo15,
  author    = {Lu{\'{\i}}s Carlos dos Santos Marujo},
  title     = {Event-based Multi-document Summarization},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {148--149},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888448},
  doi       = {10.1145/2888422.2888448},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Marujo15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Moreno15,
  author    = {Jose G. Moreno},
  title     = {Text-Based Ephemeral Clustering for Web Image Retrieval on Mobile
               Devices},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {1},
  pages     = {67},
  year      = {2015},
  url       = {https://doi.org/10.1145/2795403.2795419},
  doi       = {10.1145/2795403.2795419},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Moreno15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Qureshi15,
  author    = {Muhammad Atif Qureshi},
  title     = {Utilising Wikipedia for Text Mining Applications},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {150--151},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888449},
  doi       = {10.1145/2888422.2888449},
  timestamp = {Sat, 30 May 2020 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Qureshi15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ShahCH15,
  author    = {Chirag Shah and
               Robert G. Capra and
               Preben Hansen},
  title     = {Workshop on Social and Collaborative Information Seeking {(SCIS)}},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {117--122},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888441},
  doi       = {10.1145/2888422.2888441},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ShahCH15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SteichenFLC15,
  author    = {Ben Steichen and
               Nicola Ferro and
               David Lewis and
               Ed H. Chi},
  title     = {1st International Workshop on Multilingual Web Access {(MWA} 2015)},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {137--140},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888444},
  doi       = {10.1145/2888422.2888444},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/SteichenFLC15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TrattnerPBM15,
  author    = {Christoph Trattner and
               Denis Parra and
               Peter Brusilovsky and
               Leandro Balby Marinho},
  title     = {Report on the {SIGIR} 2015 Workshop on Social Personalization and
               Search},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {102--106},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888438},
  doi       = {10.1145/2888422.2888438},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/TrattnerPBM15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Trevisiol15,
  author    = {Michele Trevisiol},
  title     = {Exploiting Implicit User Activity for Media Recommendation},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {1},
  pages     = {70},
  year      = {2015},
  url       = {https://doi.org/10.1145/2795403.2795421},
  doi       = {10.1145/2795403.2795421},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Trevisiol15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TsikrikaPVK15,
  author    = {Theodora Tsikrika and
               Symeon Papadopoulos and
               Stefanos Vrochidis and
               Yiannis Kompatsiaris},
  title     = {10th European Summer School in Information Retrieval {(ESSIR} 2015)},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {57--66},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888430},
  doi       = {10.1145/2888422.2888430},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/TsikrikaPVK15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/YangS15,
  author    = {Grace Hui Yang and
               Ian Soboroff},
  title     = {Privacy Preserving {IR} 2015: {A} {SIGIR} 2015 Workshop},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {98--101},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888437},
  doi       = {10.1145/2888422.2888437},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/YangS15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Yeniterzi15,
  author    = {Reyyan Yeniterzi},
  title     = {Effective and Efficient Approaches to Retrieving and Using Expertise
               in Social Media},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {2},
  pages     = {152--153},
  year      = {2015},
  url       = {https://doi.org/10.1145/2888422.2888450},
  doi       = {10.1145/2888422.2888450},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Yeniterzi15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZhaiCL15,
  author    = {ChengXiang Zhai and
               William W. Cohen and
               John D. Lafferty},
  title     = {Beyond Independent Relevance: Methods and Evaluation Metrics for Subtopic
               Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {49},
  number    = {1},
  pages     = {2--9},
  year      = {2015},
  url       = {https://doi.org/10.1145/2795403.2795405},
  doi       = {10.1145/2795403.2795405},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ZhaiCL15.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiFTV14,
  author    = {Maristella Agosti and
               Norbert Fuhr and
               Elaine G. Toms and
               Pertti Vakkari},
  title     = {Evaluation methodologies in information retrieval dagstuhl seminar
               13441},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {1},
  pages     = {36--41},
  year      = {2014},
  url       = {https://doi.org/10.1145/2641383.2641390},
  doi       = {10.1145/2641383.2641390},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/AgostiFTV14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlbakourMOCB14,
  author    = {M{-}Dyaa Albakour and
               Craig Macdonald and
               Iadh Ounis and
               Charles L. A. Clarke and
               Veli Bicer},
  title     = {Report on the 1st International Workshop on Information Access in
               Smart Cities (i-ASC 2014)},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {96--104},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701597},
  doi       = {10.1145/2701583.2701597},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AlbakourMOCB14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Alonso14,
  author    = {Omar Alonso},
  title     = {Visualization for Relevance Assessments},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {14--21},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701585},
  doi       = {10.1145/2701583.2701585},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Alonso14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BalogEKKS14,
  author    = {Krisztian Balog and
               David Elsweiler and
               Evangelos Kanoulas and
               Liadh Kelly and
               Mark D. Smucker},
  title     = {Report on the {CIKM} workshop on living labs for information retrieval
               evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {1},
  pages     = {21--28},
  year      = {2014},
  url       = {https://doi.org/10.1145/2641383.2641388},
  doi       = {10.1145/2641383.2641388},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BalogEKKS14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BelloginCST14,
  author    = {Alejandro Bellog{\'{\i}}n and
               Pablo Castells and
               Alan Said and
               Domonkos Tikk},
  title     = {Report on the workshop on reproducibility and replication in recommender
               systems evaluation (RepSys)},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {1},
  pages     = {29--35},
  year      = {2014},
  url       = {https://doi.org/10.1145/2641383.2641389},
  doi       = {10.1145/2641383.2641389},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BelloginCST14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BennettGKK14,
  author    = {Paul N. Bennett and
               Evgeniy Gabrilovich and
               Jaap Kamps and
               Jussi Karlgren},
  title     = {Report on the sixth workshop on exploiting semantic annotations in
               information retrieval (ESAIR'13)},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {1},
  pages     = {13--20},
  year      = {2014},
  url       = {https://doi.org/10.1145/2641383.2641387},
  doi       = {10.1145/2641383.2641387},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/BennettGKK14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berardi14,
  author    = {Giacomo Berardi},
  title     = {Semi-automated text classification},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {1},
  pages     = {42},
  year      = {2014},
  url       = {https://doi.org/10.1145/2641383.2641392},
  doi       = {10.1145/2641383.2641392},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Berardi14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Brandao14,
  author    = {Wladmir Cardoso Brand{\~{a}}o},
  title     = {Exploiting entities for query expansion},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {1},
  pages     = {43},
  year      = {2014},
  url       = {https://doi.org/10.1145/2641383.2641393},
  doi       = {10.1145/2641383.2641393},
  timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Brandao14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BraslavskiKWVI14,
  author    = {Pavel Braslavski and
               Nikolay Karpov and
               Marcel Worring and
               Yana Volkovich and
               Dmitry I. Ignatov},
  title     = {8th Russian Summer School in Information Retrieval (RuSSIR 2014)},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {105--110},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701598},
  doi       = {10.1145/2701583.2701598},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BraslavskiKWVI14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CappellatoCFHHHKKLSTV14,
  author    = {Linda Cappellato and
               Paul D. Clough and
               Nicola Ferro and
               Mark M. Hall and
               Martin Halvey and
               Allan Hanbury and
               Evangelos Kanoulas and
               Wessel Kraaij and
               Mihai Lupu and
               Mark Sanderson and
               Elaine Toms and
               Robert Villa},
  title     = {{CLEF} 2014: Information Access Evaluation meets Multilinguality,
               Multimodality, and Interaction},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {56--62},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701589},
  doi       = {10.1145/2701583.2701589},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/CappellatoCFHHHKKLSTV14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CarmelCGHW14,
  author    = {David Carmel and
               Ming{-}Wei Chang and
               Evgeniy Gabrilovich and
               Bo{-}June Paul Hsu and
               Kuansan Wang},
  title     = {ERD'14: Entity Recognition and Disambiguation Challenge},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {63--77},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701591},
  doi       = {10.1145/2701583.2701591},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CarmelCGHW14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Diaz14,
  author    = {Fernando Diaz},
  title     = {Experimentation Standards for Crisis Informatics},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {22--30},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701586},
  doi       = {10.1145/2701583.2701586},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Diaz14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ferro14,
  author    = {Nicola Ferro},
  title     = {{CLEF} 15th Birthday: Past, Present, and Future},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {31--55},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701587},
  doi       = {10.1145/2701583.2701587},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Ferro14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GoeuriotKJMZ14,
  author    = {Lorraine Goeuriot and
               Liadh Kelly and
               Gareth J. F. Jones and
               Henning M{\"{u}}ller and
               Justin Zobel},
  title     = {Report on the {SIGIR} 2014 Workshop on Medical Information Retrieval
               (MedIR)},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {78--82},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701592},
  doi       = {10.1145/2701583.2701592},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GoeuriotKJMZ14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JatowtCCT14,
  author    = {Adam Jatowt and
               Carlos Castillo and
               James Caverlee and
               Katsumi Tanaka},
  title     = {Report on the WebQuality 2014 Workshop},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {93--95},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701596},
  doi       = {10.1145/2701583.2701596},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JatowtCCT14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Koopman14,
  author    = {Bevan Koopman},
  title     = {Semantic Search as Inference: Applications in Health Informatics},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {116--117},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701601},
  doi       = {10.1145/2701583.2701601},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Koopman14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Marcheggiani14,
  author    = {Diego Marcheggiani},
  title     = {Beyond linear chain: a journey through conditional random fields for
               information extraction from text},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {1},
  pages     = {44},
  year      = {2014},
  url       = {https://doi.org/10.1145/2641383.2641394},
  doi       = {10.1145/2641383.2641394},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Marcheggiani14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Papadakos14,
  author    = {Panagiotis Papadakos},
  title     = {Interactive Exploration of Multi-Dimensional Information Spaces with
               Preference Support},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {118},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701602},
  doi       = {10.1145/2701583.2701602},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Papadakos14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ruocco14,
  author    = {Massimiliano Ruocco},
  title     = {Geo-Temporal Mining and Searching of Events from Web-based Image Collections},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {119--120},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701603},
  doi       = {10.1145/2701583.2701603},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Ruocco14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SaidLQ14,
  author    = {Alan Said and
               Ernesto William De Luca and
               Daniele Quercia},
  title     = {Report on the 4th Workshop on Context-awareness in Retrieval and Recommendation
               (CaRR 2014)},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {89--92},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701595},
  doi       = {10.1145/2701583.2701595},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/SaidLQ14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sakai14,
  author    = {Tetsuya Sakai},
  title     = {Statistical reform in information retrieval?},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {1},
  pages     = {3--12},
  year      = {2014},
  url       = {https://doi.org/10.1145/2641383.2641385},
  doi       = {10.1145/2641383.2641385},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Sakai14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SalampasisT14,
  author    = {Michail Salampasis and
               Yannis Tzitzikas},
  title     = {Report on the 3rd {MUMIA} Training School on Information Retrieval
               and Interactive Information Access, July 21-25, 2014, FORTH, Heraklion,
               Crete, Greece},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {111--115},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701599},
  doi       = {10.1145/2701583.2701599},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SalampasisT14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SiY14,
  author    = {Luo Si and
               Hui Yang},
  title     = {{PIR} 2014 The First International Workshop on Privacy-Preserving
               {IR:} When Information Retrieval Meets Privacy and Security},
  journal   = {{SIGIR} Forum},
  volume    = {48},
  number    = {2},
  pages     = {83--88},
  year      = {2014},
  url       = {https://doi.org/10.1145/2701583.2701593},
  doi       = {10.1145/2701583.2701593},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SiY14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiFS13,
  author    = {Maristella Agosti and
               Nicola Ferro and
               Gianmaria Silvello},
  title     = {{PROMISE} winter school 2013 bridging between information retrieval
               and databases},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {1},
  pages     = {46--52},
  year      = {2013},
  url       = {https://doi.org/10.1145/2492189.2492197},
  doi       = {10.1145/2492189.2492197},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/AgostiFS13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Albakour13,
  author    = {M{-}Dyaa Albakour},
  title     = {Adaptive domain modelling for information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {1},
  pages     = {59},
  year      = {2013},
  url       = {https://doi.org/10.1145/2492189.2492200},
  doi       = {10.1145/2492189.2492200},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Albakour13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BellotDGGKKKMMMPSSTTTTSSW13,
  author    = {Patrice Bellot and
               Antoine Doucet and
               Shlomo Geva and
               Sairam Gurajada and
               Jaap Kamps and
               Gabriella Kazai and
               Marijn Koolen and
               Arunav Mishra and
               V{\'{e}}ronique Moriceau and
               Josiane Mothe and
               Michael Preminger and
               Eric SanJuan and
               Ralf Schenkel and
               Xavier Tannier and
               Martin Theobald and
               Matthew Trappett and
               Andrew Trotman and
               Mark Sanderson and
               Falk Scholer and
               Qiuyue Wang},
  title     = {Report on {INEX} 2013},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {21--32},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568393},
  doi       = {10.1145/2568388.2568393},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BellotDGGKKKMMMPSSTTTTSSW13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Bodoff13,
  author    = {David Bodoff},
  title     = {Fuhr's challenge: conceptual research, or bust},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {1},
  pages     = {3--16},
  year      = {2013},
  url       = {https://doi.org/10.1145/2492189.2492191},
  doi       = {10.1145/2492189.2492191},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Bodoff13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BorlundMW13,
  author    = {Pia Borlund and
               Thomas Mandl and
               Christa Womser{-}Hacker},
  title     = {The second workshop of the european network for work information {(ENWI)}},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {74--77},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568401},
  doi       = {10.1145/2568388.2568401},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BorlundMW13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BraslavskiZRV13,
  author    = {Pavel Braslavski and
               Nikita Zhiltsov and
               Stefan M. R{\"{u}}ger and
               Yana Volkovich},
  title     = {7th Russian summer school in information retrieval (RuSSIR 2013)},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {96--100},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568404},
  doi       = {10.1145/2568388.2568404},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BraslavskiZRV13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Campos13,
  author    = {Ricardo Campos},
  title     = {Disambiguating implicit temporal queries for temporal information
               retrieval applications},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {137--138},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568411},
  doi       = {10.1145/2568388.2568411},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Campos13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CapraFSSW13,
  author    = {Robert Capra and
               Luanne Freund and
               Catherine L. Smith and
               Mark D. Smucker and
               Ryen W. White},
  title     = {{HCIR} 2013: the seventh international symposium on human-computer
               interaction and information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {33--40},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568394},
  doi       = {10.1145/2568388.2568394},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CapraFSSW13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CastellsHSL13,
  author    = {Pablo Castells and
               Frank Hopfgartner and
               Alan Said and
               Mounia Lalmas},
  title     = {Report on the {SIGIR} 2013 workshop on benchmarking adaptive retrieval
               and recommender systems},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {64--67},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568398},
  doi       = {10.1145/2568388.2568398},
  timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/CastellsHSL13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ClarkeFSY13,
  author    = {Charles L. A. Clarke and
               Luanne Freund and
               Mark D. Smucker and
               Emine Yilmaz},
  title     = {Report on the {SIGIR} 2013 workshop on modeling user behavior for
               information retrieval evaluation {(MUBE} 2013)},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {84--95},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568403},
  doi       = {10.1145/2568388.2568403},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ClarkeFSY13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Diaz-Aviles13,
  author    = {Ernesto Diaz{-}Aviles},
  title     = {Living analytics methods for the social web},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {139},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568412},
  doi       = {10.1145/2568388.2568412},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Diaz-Aviles13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FerroFMNPRST13,
  author    = {Nicola Ferro and
               Pamela Forner and
               Henning M{\"{u}}ller and
               Roberto Navigli and
               Roberto Paredes and
               Paolo Rosso and
               Benno Stein and
               Dan Tufis},
  title     = {{CLEF} 2013: information access evaluation meets multilinguality,
               multimodality, and visualization},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {15--20},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568392},
  doi       = {10.1145/2568388.2568392},
  timestamp = {Wed, 30 Oct 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/FerroFMNPRST13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FornerBBCFHKM13,
  author    = {Pamela Forner and
               Luisa Bentivogli and
               Martin Braschler and
               Khalid Choukri and
               Nicola Ferro and
               Allan Hanbury and
               Jussi Karlgren and
               Henning M{\"{u}}ller},
  title     = {{PROMISE} technology transfer day: spreading the word on information
               access evaluation at an industrial event},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {1},
  pages     = {53--58},
  year      = {2013},
  url       = {https://doi.org/10.1145/2492189.2492198},
  doi       = {10.1145/2492189.2492198},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/FornerBBCFHKM13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FoxF13,
  author    = {Edward A. Fox and
               Mohamed M. Farag},
  title     = {Report on the workshop on web archiving and digital libraries {(WADL}
               2013)},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {128--133},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568408},
  doi       = {10.1145/2568388.2568408},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/FoxF13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FuhrKKV13,
  author    = {Norbert Fuhr and
               Jaap Kamps and
               Wessel Kraaij and
               Suzan Verberne},
  title     = {Report on IIiX'12: the fourth information interaction in context symposium},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {1},
  pages     = {22--30},
  year      = {2013},
  url       = {https://doi.org/10.1145/2492189.2492194},
  doi       = {10.1145/2492189.2492194},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/FuhrKKV13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HalveyA13,
  author    = {Martin Halvey and
               Leif Azzopardi},
  title     = {Report on the Scottish informatics and computing science alliance's
               information retrieval workshop (IRFest)},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {109--115},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568406},
  doi       = {10.1145/2568388.2568406},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HalveyA13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HansenWLNR13,
  author    = {Preben Hansen and
               Max L. Wilson and
               Birger Larsen and
               Kristian Norling and
               Tony Russell{-}Rose},
  title     = {Report on EuroHCIR 2013: the 3rd european workshop on human-computer
               interaction and information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {78--83},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568402},
  doi       = {10.1145/2568388.2568402},
  timestamp = {Tue, 17 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/HansenWLNR13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hofmann13,
  author    = {Katja Hofmann},
  title     = {Fast and reliable online learning to rank for information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {140},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568413},
  doi       = {10.1145/2568388.2568413},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Hofmann13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JatowtCGT13,
  author    = {Adam Jatowt and
               Carlos Castillo and
               Zolt{\'{a}}n Gy{\"{o}}ngyi and
               Katsumi Tanaka},
  title     = {Report on the WebQuality 2013 workshop},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {134--136},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568409},
  doi       = {10.1145/2568388.2568409},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JatowtCGT13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JohoKSSS13,
  author    = {Hideo Joho and
               Noriko Kando and
               Tetsuya Sakai and
               Yohei Seki and
               Shigeo Sugimoto},
  title     = {Asian summer school in information access {(ASSIA} 2013)},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {58--63},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568397},
  doi       = {10.1145/2568388.2568397},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JohoKSSS13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jonassen13,
  author    = {Simon Jonassen},
  title     = {Efficient query processing in distributed search engines},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {1},
  pages     = {60--61},
  year      = {2013},
  url       = {https://doi.org/10.1145/2492189.2492201},
  doi       = {10.1145/2492189.2492201},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Jonassen13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KampsKMM13,
  author    = {Jaap Kamps and
               Jussi Karlgren and
               Peter Mika and
               Vanessa Murdock},
  title     = {Report on the fifth workshop on exploiting semantic annotations in
               information retrieval (ESAIR'12)},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {1},
  pages     = {38--45},
  year      = {2013},
  url       = {https://doi.org/10.1145/2492189.2492196},
  doi       = {10.1145/2492189.2492196},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/KampsKMM13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KellyAC13,
  author    = {Diane Kelly and
               Jaime Arguello and
               Robert Capra},
  title     = {{NSF} workshop on task-based information search systems},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {116--127},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568407},
  doi       = {10.1145/2568388.2568407},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KellyAC13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LawlessACC13,
  author    = {S{\'{e}}amus Lawless and
               Maristella Agosti and
               Owen Conlan and
               Paul D. Clough},
  title     = {{ENRICH} 2013: the first workshop on the exploration, navigation and
               retrieval of information in cultural heritage},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {68--73},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568400},
  doi       = {10.1145/2568388.2568400},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/LawlessACC13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LinE13,
  author    = {Jimmy J. Lin and
               Miles Efron},
  title     = {Evaluation as a service for information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {8--14},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568390},
  doi       = {10.1145/2568388.2568390},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LinE13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lopes13,
  author    = {Carla Teixeira Lopes},
  title     = {Context-based health information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {141--142},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568414},
  doi       = {10.1145/2568388.2568414},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Lopes13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/McCreadie13,
  author    = {Richard McCreadie},
  title     = {News vertical search using user-generated content},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {1},
  pages     = {62--63},
  year      = {2013},
  url       = {https://doi.org/10.1145/2492189.2492202},
  doi       = {10.1145/2492189.2492202},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/McCreadie13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MurdockCKK13,
  author    = {Vanessa Murdock and
               Charles L. A. Clarke and
               Jaap Kamps and
               Jussi Karlgren},
  title     = {Report on the workshop on search and exploration of x-rated information
               {(SEXI} 2013)},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {1},
  pages     = {31--37},
  year      = {2013},
  url       = {https://doi.org/10.1145/2492189.2492195},
  doi       = {10.1145/2492189.2492195},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/MurdockCKK13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Neumayer13,
  author    = {Robert Neumayer},
  title     = {Semantic and distributed entity search in the web of data},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {1},
  pages     = {64},
  year      = {2013},
  url       = {https://doi.org/10.1145/2492189.2492203},
  doi       = {10.1145/2492189.2492203},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Neumayer13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Pal13,
  author    = {Sukomal Pal},
  title     = {Sub-document level information retrieval: retrieval and evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {1},
  pages     = {65--66},
  year      = {2013},
  url       = {https://doi.org/10.1145/2492189.2492204},
  doi       = {10.1145/2492189.2492204},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Pal13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Santos13,
  author    = {Rodrygo L. T. Santos},
  title     = {Explicit web search result diversification},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {1},
  pages     = {67--68},
  year      = {2013},
  url       = {https://doi.org/10.1145/2492189.2492205},
  doi       = {10.1145/2492189.2492205},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Santos13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SerdyukovBK13,
  author    = {Pavel Serdyukov and
               Pavel Braslavski and
               Jaap Kamps},
  title     = {{ECIR} 2013: 35th european conference on information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {41--57},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568395},
  doi       = {10.1145/2568388.2568395},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SerdyukovBK13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TrotmanCS13,
  author    = {Andrew Trotman and
               Sally Jo Cunningham and
               Laurianne Sitbon},
  title     = {The seventeenth australasian document computing symposium},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {1},
  pages     = {17--21},
  year      = {2013},
  url       = {https://doi.org/10.1145/2492189.2492193},
  doi       = {10.1145/2492189.2492193},
  timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/TrotmanCS13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WhiteYHAH13,
  author    = {Ryen W. White and
               Elad Yom{-}Tov and
               Eric Horvitz and
               Eugene Agichtein and
               William R. Hersh},
  title     = {Report on the {SIGIR} 2013 workshop on health search and discovery},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {2},
  pages     = {101--108},
  year      = {2013},
  url       = {https://doi.org/10.1145/2568388.2568405},
  doi       = {10.1145/2568388.2568405},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/WhiteYHAH13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zuccon13,
  author    = {Guido Zuccon},
  title     = {Document ranking with quantum probabilities},
  journal   = {{SIGIR} Forum},
  volume    = {47},
  number    = {1},
  pages     = {69--70},
  year      = {2013},
  url       = {https://doi.org/10.1145/2492189.2492206},
  doi       = {10.1145/2492189.2492206},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Zuccon13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiCFMS12,
  author    = {Maristella Agosti and
               Tiziana Catarci and
               Nicola Ferro and
               Henning M{\"{u}}ller and
               Giuseppe Santucci},
  title     = {{PROMISE} winter school 2012 information retrieval meets information
               visualization},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {65--70},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215683},
  doi       = {10.1145/2215676.2215683},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/AgostiCFMS12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiFT12,
  author    = {Maristella Agosti and
               Nicola Ferro and
               Costantino Thanos},
  title     = {{DESIRE} 2011: workshop on data infrastructurEs for supporting information
               retrieval evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {51--55},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215681},
  doi       = {10.1145/2215676.2215681},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/AgostiFT12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanCMS12,
  author    = {James Allan and
               W. Bruce Croft and
               Alistair Moffat and
               Mark Sanderson},
  title     = {Frontiers, challenges, and opportunities for information retrieval:
               Report from {SWIRL} 2012 the second strategic workshop on information
               retrieval in Lorne},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {2--32},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215678},
  doi       = {10.1145/2215676.2215678},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AllanCMS12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoKK12,
  author    = {Omar Alonso and
               Jaap Kamps and
               Jussi Karlgren},
  title     = {Report on the fourth workshop on exploiting semantic annotations in
               information retrieval (ESAIR'11)},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {56--64},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215682},
  doi       = {10.1145/2215676.2215682},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AlonsoKK12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Arguello12,
  author    = {Jaime Arguello},
  title     = {Federated search in heterogeneous environments},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {78--79},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215686},
  doi       = {10.1145/2215676.2215686},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Arguello12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Athenikos12,
  author    = {Sofia J. Athenikos},
  title     = {Enabling entity retrieval by exploiting wikipedia as a semantic knowledge
               source},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {80},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215687},
  doi       = {10.1145/2215676.2215687},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Athenikos12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Baeza-YatesMVZCMBLLSL12,
  author    = {Ricardo Baeza{-}Yates and
               Mari{-}Carmen Marcos and
               Arjen P. de Vries and
               Hugo Zaragoza and
               Berkant Barla Cambazoglu and
               Vanessa Murdock and
               Alvaro Barreiro and
               David E. Losada and
               Ronny Lempel and
               Fabrizio Silvestri and
               Mounia Lalmas},
  title     = {{ECIR} 2012: 34th european conference on information retrieval research},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {34--41},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422262},
  doi       = {10.1145/2422256.2422262},
  timestamp = {Sun, 22 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Baeza-YatesMVZCMBLLSL12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BalogCVHMRSST12,
  author    = {Krisztian Balog and
               David Carmel and
               Arjen P. de Vries and
               Daniel M. Herzig and
               Peter Mika and
               Haggai Roitman and
               Ralf Schenkel and
               Pavel Serdyukov and
               Duc Thanh Tran},
  title     = {The first joint international workshop on entity-oriented and semantic
               search {(JIWES)}},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {87--94},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422268},
  doi       = {10.1145/2422256.2422268},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BalogCVHMRSST12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Bashir12,
  author    = {Shariq Bashir},
  title     = {Evaluating retrieval models using retrievability measurement},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {81},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215688},
  doi       = {10.1145/2215676.2215688},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Bashir12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BellotCDGGKKKLMMMMPRSSSSTTTTW12,
  author    = {Patrice Bellot and
               Timothy Chappell and
               Antoine Doucet and
               Shlomo Geva and
               Sairam Gurajada and
               Jaap Kamps and
               Gabriella Kazai and
               Marijn Koolen and
               Monica Landoni and
               Maarten Marx and
               Arunav Mishra and
               V{\'{e}}ronique Moriceau and
               Josiane Mothe and
               Michael Preminger and
               Georgina Ram{\'{\i}}rez and
               Mark Sanderson and
               Eric SanJuan and
               Falk Scholer and
               A. Schuh and
               Xavier Tannier and
               Martin Theobald and
               Matthew Trappett and
               Andrew Trotman and
               Qiuyue Wang},
  title     = {Report on {INEX} 2012},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {50--59},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422264},
  doi       = {10.1145/2422256.2422264},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BellotCDGGKKKLMMMMPRSSSSTTTTW12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BellotCDGKKKLMMMRSSSTTTTW12,
  author    = {Patrice Bellot and
               Timothy Chappell and
               Antoine Doucet and
               Shlomo Geva and
               Jaap Kamps and
               Gabriella Kazai and
               Marijn Koolen and
               Monica Landoni and
               Maarten Marx and
               V{\'{e}}ronique Moriceau and
               Josiane Mothe and
               Georgina Ram{\'{\i}}rez and
               Mark Sanderson and
               Eric SanJuan and
               Falk Scholer and
               Xavier Tannier and
               Martin Theobald and
               Matthew Trappett and
               Andrew Trotman and
               Qiuyue Wang},
  title     = {Report on {INEX} 2011},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {33--42},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215679},
  doi       = {10.1145/2215676.2215679},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BellotCDGKKKLMMMRSSSTTTTW12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Bendersky12,
  author    = {Michael Bendersky},
  title     = {Information retrieval with query hypergraphs},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {111},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422273},
  doi       = {10.1145/2422256.2422273},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Bendersky12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Blanke12,
  author    = {Tobias Blanke},
  title     = {Theoretical evaluation of {XML} retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {82--83},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215689},
  doi       = {10.1145/2215676.2215689},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Blanke12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CallanM12,
  author    = {Jamie Callan and
               Alistair Moffat},
  title     = {Panel on use of proprietary data},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {10--18},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422258},
  doi       = {10.1145/2422256.2422258},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CallanM12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CapraGKTW12,
  author    = {Robert Capra and
               Gene Golovchinsky and
               Bill Kules and
               Daniel Tunkelang and
               Ryen W. White},
  title     = {{HCIR} 2012: the sixth international symposium on human-computer interaction
               and information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {42--49},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422263},
  doi       = {10.1145/2422256.2422263},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CapraGKTW12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CastilloGJT12,
  author    = {Carlos Castillo and
               Zolt{\'{a}}n Gy{\"{o}}ngyi and
               Adam Jatowt and
               Katsumi Tanaka},
  title     = {Report on the WebQuality 2012 workshop},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {107--110},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422271},
  doi       = {10.1145/2422256.2422271},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CastilloGJT12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CatarciFFHKPSW12,
  author    = {Tiziana Catarci and
               Nicola Ferro and
               Pamela Forner and
               Djoerd Hiemstra and
               Jussi Karlgren and
               Anselmo Pe{\~{n}}as and
               Giuseppe Santucci and
               Christa Womser{-}Hacker},
  title     = {{CLEF} 2012: information access evaluation meets multilinguality,
               multimodality, and visual analytics},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {29--33},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422261},
  doi       = {10.1145/2422256.2422261},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/CatarciFFHKPSW12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DiazDRRS12,
  author    = {Fernando Diaz and
               Susan T. Dumais and
               Kira Radinsky and
               Maarten de Rijke and
               Milad Shokouhi},
  title     = {{\#}TAIA2012},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {102--106},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422270},
  doi       = {10.1145/2422256.2422270},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DiazDRRS12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FerroBHLPRSABBBBCNFFHHHJLLMMPPPRSST12,
  author    = {Maristella Agosti and
               Richard Berendsen and
               Toine Bogers and
               Martin Braschler and
               Paul Buitelaar and
               Khalid Choukri and
               Giorgio Maria Di Nunzio and
               Nicola Ferro and
               Pamela Forner and
               Allan Hanbury and
               Karin Friberg Heppin and
               Preben Hansen and
               Anni J{\"{a}}rvelin and
               Birger Larsen and
               Mihai Lupu and
               Ivano Masiero and
               Henning M{\"{u}}ller and
               Simone Peruzzo and
               Vivien Petras and
               Florina Piroi and
               Maarten de Rijke and
               Giuseppe Santucci and
               Gianmaria Silvello and
               Elaine G. Toms},
  title     = {{PROMISE} retreat report prospects and opportunities for information
               access evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {60--84},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422265},
  doi       = {10.1145/2422256.2422265},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/FerroBHLPRSABBBBCNFFHHHJLLMMPPPRSST12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fuhr12,
  author    = {Norbert Fuhr},
  title     = {Salton award lecture information retrieval as engineering science},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {19--28},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422259},
  doi       = {10.1145/2422256.2422259},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Fuhr12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/He12,
  author    = {Jiyin He},
  title     = {Exploring topic structure: coherence, diversity and relatedness},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {84},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215690},
  doi       = {10.1145/2215676.2215690},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/He12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kanhabua12,
  author    = {Nattiya Kanhabua},
  title     = {Time-aware approaches to information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {85},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215691},
  doi       = {10.1145/2215676.2215691},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Kanhabua12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KazaiEB12,
  author    = {Gabriella Kazai and
               Carsten Eickhoff and
               Peter Brusilovsky},
  title     = {Report on BooksOnline'11: 4th workshop on online books, complementary
               social media, and crowdsourcing},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {43--50},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215680},
  doi       = {10.1145/2215676.2215680},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KazaiEB12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LarsenLV12,
  author    = {Birger Larsen and
               Christina Lioma and
               Arjen P. de Vries},
  title     = {Report on {TBAS} 2012: workshop on task-based and aggregated search},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {71--77},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215684},
  doi       = {10.1145/2215676.2215684},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/LarsenLV12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lv12,
  author    = {Yuanhua Lv},
  title     = {Improving the effectiveness of language modeling approaches to information
               retrieval: bridging the theory-effectiveness gap},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {112--113},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422274},
  doi       = {10.1145/2422256.2422274},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Lv12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Radinsky12,
  author    = {Kira Radinsky},
  title     = {Learning to Predict the Future using Web Knowledge and Dynamics},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {114--115},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422275},
  doi       = {10.1145/2422256.2422275},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Radinsky12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sushmita12,
  author    = {Shanu Sushmita},
  title     = {Study of result presentation and interaction for aggregated search},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {86--87},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215692},
  doi       = {10.1145/2215676.2215692},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Sushmita12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Tigelaar12,
  author    = {Almer S. Tigelaar},
  title     = {Peer-to-peer information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {116},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422276},
  doi       = {10.1145/2422256.2422276},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Tigelaar12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TrotmanCOCCG12,
  author    = {Andrew Trotman and
               Charles L. A. Clarke and
               Iadh Ounis and
               J. Shane Culpepper and
               Marc{-}Allen Cartright and
               Shlomo Geva},
  title     = {Open source information petrieval: a report on the {SIGIR} 2012 workshop},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {95--101},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422269},
  doi       = {10.1145/2422256.2422269},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/TrotmanCOCCG12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Weerkamp12,
  author    = {Wouter Weerkamp},
  title     = {Finding people and their utterances in social media},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {88--89},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215693},
  doi       = {10.1145/2215676.2215693},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Weerkamp12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Whiting12,
  author    = {Stewart Whiting},
  title     = {The {ACM} {A.M.} turing centenary celebration},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {85--86},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422266},
  doi       = {10.1145/2422256.2422266},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Whiting12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Yang12,
  author    = {Hui Yang},
  title     = {Personal concept hierarahy construction},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {1},
  pages     = {90--91},
  year      = {2012},
  url       = {https://doi.org/10.1145/2215676.2215694},
  doi       = {10.1145/2215676.2215694},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Yang12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zhao12,
  author    = {Le Zhao},
  title     = {Modeling and solving term mismatch for full-text retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {46},
  number    = {2},
  pages     = {117--118},
  year      = {2012},
  url       = {https://doi.org/10.1145/2422256.2422277},
  doi       = {10.1145/2422256.2422277},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Zhao12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiLLL11,
  author    = {Maristella Agosti and
               Ernesto William De Luca and
               S{\'{e}}amus Lawless and
               Johannes Leveling},
  title     = {{PMHR} 2011: the first workshop on personalised multilingual hypertext
               retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {94--98},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093362},
  doi       = {10.1145/2093346.2093362},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/AgostiLLL11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlexanderABBCDDFGKKKKLMNNPSSTTTTVWW11,
  author    = {David Alexander and
               Paavo Arvola and
               Thomas Beckers and
               Patrice Bellot and
               Timothy Chappell and
               Christopher M. De Vries and
               Antoine Doucet and
               Norbert Fuhr and
               Shlomo Geva and
               Jaap Kamps and
               Gabriella Kazai and
               Marijn Koolen and
               Sangeetha Kutty and
               Monica Landoni and
               V{\'{e}}ronique Moriceau and
               Richi Nayak and
               Ragnar Nordlie and
               Nils Pharo and
               Eric SanJuan and
               Ralf Schenkel and
               Andrea Tagarelli and
               Xavier Tannier and
               James A. Thom and
               Andrew Trotman and
               Johanna Vainio and
               Qiuyue Wang and
               Chen Wu},
  title     = {Report on {INEX} 2010},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {2--17},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988854},
  doi       = {10.1145/1988852.1988854},
  timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/AlexanderABBCDDFGKKKKLMNNPSSTTTTVWW11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BalogVSW11,
  author    = {Krisztian Balog and
               Arjen P. de Vries and
               Pavel Serdyukov and
               Ji{-}Rong Wen},
  title     = {The first international workshop on entity-oriented search {(EOS)}},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {43--50},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093353},
  doi       = {10.1145/2093346.2093353},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BalogVSW11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BelkinCGKK11,
  author    = {Nicholas J. Belkin and
               Charles L. A. Clarke and
               Ning Gao and
               Jaap Kamps and
               Jussi Karlgren},
  title     = {Report on the {SIGIR} workshop on "entertain me": supporting complex
               search tasks},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {51--59},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093354},
  doi       = {10.1145/2093346.2093354},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BelkinCGKK11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BennettEJS11,
  author    = {Paul N. Bennett and
               Khalid El{-}Arini and
               Thorsten Joachims and
               Krysta M. Svore},
  title     = {Enriching information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {60--65},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093355},
  doi       = {10.1145/2093346.2093355},
  timestamp = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/BennettEJS11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BerendtHHLMV11,
  author    = {Bettina Berendt and
               Laura Hollink and
               Vera Hollink and
               Markus Luczak{-}R{\"{o}}sch and
               Knud M{\"{o}}ller and
               David Vallet},
  title     = {Usage analysis and the web of data},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {63--69},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988864},
  doi       = {10.1145/1988852.1988864},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BerendtHHLMV11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BoscarinoHJMRW11,
  author    = {Corrado Boscarino and
               Katja Hofmann and
               Valentin Jijkoun and
               Edgar Meij and
               Maarten de Rijke and
               Wouter Weerkamp},
  title     = {{DIR} 2011: the eleventh Dutch-Belgian information retrieval workshop},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {42--44},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988859},
  doi       = {10.1145/1988852.1988859},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BoscarinoHJMRW11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CapraGKRSTW11,
  author    = {Robert Capra and
               Gene Golovchinsky and
               Bill Kules and
               Daniel M. Russell and
               Catherine L. Smith and
               Daniel Tunkelang and
               Ryen W. White},
  title     = {{HCIR} 2011: the fifth international workshop on human-computer interaction
               and information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {102--107},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093364},
  doi       = {10.1145/2093346.2093364},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CapraGKRSTW11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CarteretteCKS11,
  author    = {Ben Carterette and
               Paul D. Clough and
               Evangelos Kanoulas and
               Mark Sanderson},
  title     = {Report on the {ECIR} 2011 workshop on information retrieval over query
               sessions},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {76--80},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093358},
  doi       = {10.1145/2093346.2093358},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CarteretteCKS11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CastilloGJT11,
  author    = {Carlos Castillo and
               Zolt{\'{a}}n Gy{\"{o}}ngyi and
               Adam Jatowt and
               Katsumi Tanaka},
  title     = {Report on the joint WICOW/AIRWeb workshop on web quality (WebQuality
               2011)},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {99--101},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093363},
  doi       = {10.1145/2093346.2093363},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CastilloGJT11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ChurchNSSWX11,
  author    = {Ken Ward Church and
               Jian{-}Yun Nie and
               Le Sun and
               Maosong Sun and
               Haifeng Wang and
               Endong Xun},
  title     = {Report on the first summer school on {NLP} and {IR} in Beijing},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {41--42},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093351},
  doi       = {10.1145/2093346.2093351},
  timestamp = {Mon, 14 Sep 2020 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/ChurchNSSWX11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CloughFFGHKLPR11,
  author    = {Paul D. Clough and
               Nicola Ferro and
               Pamela Forner and
               Julio Gonzalo and
               Bouke Huurnink and
               Jaana Kek{\"{a}}l{\"{a}}inen and
               Mounia Lalmas and
               Vivien Petras and
               Maarten de Rijke},
  title     = {{CLEF} 2011: conference on multilingual and multimodal information
               access evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {32--37},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093349},
  doi       = {10.1145/2093346.2093349},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/CloughFFGHKLPR11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Demartini11,
  author    = {Gianluca Demartini},
  title     = {From people to entities: typed search in the enterprise and the web},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {73},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988868},
  doi       = {10.1145/1988852.1988868},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Demartini11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Du11,
  author    = {Jia Tina Du},
  title     = {Multitasking, cognitive coordination and cognitive shifts during web
               searching},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {74},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988869},
  doi       = {10.1145/1988852.1988869},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Du11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fernandez11,
  author    = {Ronald T. Fern{\'{a}}ndez},
  title     = {Improving search effectiveness in sentence retrieval and novelty detection},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {75--76},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988870},
  doi       = {10.1145/1988852.1988870},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Fernandez11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Huurnink11,
  author    = {Bouke Huurnink},
  title     = {Search in audiovisual broadcast archives},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {77},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988871},
  doi       = {10.1145/1988852.1988871},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Huurnink11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JaimesLV11,
  author    = {Alejandro Jaimes and
               Mounia Lalmas and
               Yana Volkovich},
  title     = {First international workshop on social media engagement (SoME 2011)},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {56--62},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988863},
  doi       = {10.1145/1988852.1988863},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JaimesLV11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jarvelin11,
  author    = {Kalervo J{\"{a}}rvelin},
  title     = {{IR} research: systems, interaction, evaluation and theories},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {17--31},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093348},
  doi       = {10.1145/2093346.2093348},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Jarvelin11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KampsKS11,
  author    = {Jaap Kamps and
               Jussi Karlgren and
               Ralf Schenkel},
  title     = {Report on the third workshop on exploiting semantic annotations in
               information retrieval {(ESAIR)}},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {33--41},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988858},
  doi       = {10.1145/1988852.1988858},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KampsKS11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kaptein11,
  author    = {Rianne Kaptein},
  title     = {Effective focused retrieval by exploiting query context and document
               structure},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {108},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093366},
  doi       = {10.1145/2093346.2093366},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Kaptein11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KazaiB11,
  author    = {Gabriella Kazai and
               Peter Brusilovsky},
  title     = {Report on the BooksOnline'10: third workshop on research advances
               in large digital book repositories and complementary media},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {25--32},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988857},
  doi       = {10.1145/1988852.1988857},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KazaiB11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KellyKE11,
  author    = {Liadh Kelly and
               Jinyoung Kim and
               David Elsweiler},
  title     = {Workshop on evaluating personal search},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {81--86},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093359},
  doi       = {10.1145/2093346.2093359},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KellyKE11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KingL11,
  author    = {Irwin King and
               Hang Li},
  title     = {The fourth {ACM} international conference on web search and data mining
               {(WSDM} 2011)},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {38--40},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093350},
  doi       = {10.1145/2093346.2093350},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KingL11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Koolen11,
  author    = {Marijn Koolen},
  title     = {The meaning of structure: the value of link evidence for information
               retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {78--79},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988872},
  doi       = {10.1145/1988852.1988872},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Koolen11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LeaseCY11,
  author    = {Matthew Lease and
               Vitor R. Carvalho and
               Emine Yilmaz},
  title     = {Crowdsourcing for search and data mining},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {18--24},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988856},
  doi       = {10.1145/1988852.1988856},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LeaseCY11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LeaseY11,
  author    = {Matthew Lease and
               Emine Yilmaz},
  title     = {Crowdsourcing for information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {66--75},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093356},
  doi       = {10.1145/2093346.2093356},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/LeaseY11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MacdonaldCW11,
  author    = {Craig Macdonald and
               Charles L. A. Clarke and
               Jun Wang},
  title     = {The 1st international workshop on diversity in document retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {87--93},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093360},
  doi       = {10.1145/2093346.2093360},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/MacdonaldCW11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Meij11,
  author    = {Edgar Meij},
  title     = {Combining concepts and language models for information access},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {80},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988873},
  doi       = {10.1145/1988852.1988873},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Meij11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/NambiarS11,
  author    = {Ullas B. Nambiar and
               L. Venkata Subramaniam},
  title     = {Eighth workshop on information integration on the web (IIWeb 2011)},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {54--55},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988862},
  doi       = {10.1145/1988852.1988862},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/NambiarS11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/OardSFM11,
  author    = {Douglas W. Oard and
               Fabrizio Sebastiani and
               Jonathan Furner and
               Gary Marchionini},
  title     = {Publishing survey articles on information retrieval topics},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {70--72},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988866},
  doi       = {10.1145/1988852.1988866},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/OardSFM11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SimperlMVA11,
  author    = {Elena Paslaru Bontas Simperl and
               Devika P. Madalli and
               Denny Vrandecic and
               Enrique Alfonseca},
  title     = {DiversiWeb 2011},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {49--53},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988861},
  doi       = {10.1145/1988852.1988861},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SimperlMVA11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SteinPRBSK11,
  author    = {Benno Stein and
               Martin Potthast and
               Paolo Rosso and
               Alberto Barr{\'{o}}n{-}Cede{\~{n}}o and
               Efstathios Stamatatos and
               Moshe Koppel},
  title     = {Fourth international workshop on uncovering plagiarism, authorship,
               and social software misuse},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {1},
  pages     = {45--48},
  year      = {2011},
  url       = {https://doi.org/10.1145/1988852.1988860},
  doi       = {10.1145/1988852.1988860},
  timestamp = {Wed, 30 Oct 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SteinPRBSK11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zhang11,
  author    = {Junte Zhang},
  title     = {System evaluation of archival description and access},
  journal   = {{SIGIR} Forum},
  volume    = {45},
  number    = {2},
  pages     = {109--110},
  year      = {2011},
  url       = {https://doi.org/10.1145/2093346.2093367},
  doi       = {10.1145/2093346.2093367},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Zhang11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiBCFHPPRS10,
  author    = {Maristella Agosti and
               Martin Braschler and
               Khalid Choukri and
               Nicola Ferro and
               Donna Harman and
               Carol Peters and
               Emanuele Pianta and
               Maarten de Rijke and
               Alan F. Smeaton},
  title     = {{CLEF} 2010 conference on multilingual and multimodal information
               access evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {8--12},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924477},
  doi       = {10.1145/1924475.1924477},
  timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/AgostiBCFHPPRS10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoA10,
  author    = {Omar Alonso and
               Giambattista Amati},
  title     = {{SIGIR} 2010 workshop program overview},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {15--16},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924480},
  doi       = {10.1145/1924475.1924480},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AlonsoA10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Aly10,
  author    = {Robin Aly},
  title     = {Modeling representation uncertainty in concept-based multimedia retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {82},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924494},
  doi       = {10.1145/1924475.1924494},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Aly10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AzzopardiJKS10,
  author    = {Leif Azzopardi and
               Kalervo J{\"{a}}rvelin and
               Jaap Kamps and
               Mark D. Smucker},
  title     = {Report on the {SIGIR} 2010 workshop on the simulation of interaction},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {35--47},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924484},
  doi       = {10.1145/1924475.1924484},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AzzopardiJKS10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BeckersBDDVDFFGGHIKKKKLLMNNPSSTTTTV10,
  author    = {Thomas Beckers and
               Patrice Bellot and
               Gianluca Demartini and
               Ludovic Denoyer and
               Christopher M. De Vries and
               Antoine Doucet and
               Khairun Nisa Fachry and
               Norbert Fuhr and
               Patrick Gallinari and
               Shlomo Geva and
               Wei Chi Huang and
               Tereza Iofciu and
               Jaap Kamps and
               Gabriella Kazai and
               Marijn Koolen and
               Sangeetha Kutty and
               Monica Landoni and
               Miro Lehtonen and
               V{\'{e}}ronique Moriceau and
               Richi Nayak and
               Ragnar Nordlie and
               Nils Pharo and
               Eric SanJuan and
               Ralf Schenkel and
               Xavier Tannier and
               Martin Theobald and
               James A. Thom and
               Andrew Trotman and
               Arjen P. de Vries},
  title     = {Report on {INEX} 2009},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {1},
  pages     = {38--57},
  year      = {2010},
  url       = {https://doi.org/10.1145/1842890.1842897},
  doi       = {10.1145/1842890.1842897},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BeckersBDDVDFFGGHIKKKKLLMNNPSSTTTTV10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Bierig10,
  author    = {Ralf Bierig},
  title     = {Event and map content personalisation in a mobile and context-aware-environment},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {1},
  pages     = {87},
  year      = {2010},
  url       = {https://doi.org/10.1145/1842890.1842905},
  doi       = {10.1145/1842890.1842905},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Bierig10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Bilotti10,
  author    = {Matthew W. Bilotti},
  title     = {Linguistic and semantic passage retrieval strategies for question
               answering},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {83},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924495},
  doi       = {10.1145/1924475.1924495},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Bilotti10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BlancoCL10,
  author    = {Roi Blanco and
               Berkant Barla Cambazoglu and
               Claudio Lucchese},
  title     = {The 8th workshop on large-scale distributed systems for information
               retrieval (LSDS-IR'10)},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {54--58},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924486},
  doi       = {10.1145/1924475.1924486},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BlancoCL10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CapraKSTW10,
  author    = {Robert G. Capra and
               Bill Kules and
               Catherine L. Smith and
               Daniel Tunkelang and
               Ryen W. White},
  title     = {{HCIR} 2010: the fourth international workshop on human-computer interaction
               and information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {73--77},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924491},
  doi       = {10.1145/1924475.1924491},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CapraKSTW10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CarvalhoLY10,
  author    = {Vitor R. Carvalho and
               Matthew Lease and
               Emine Yilmaz},
  title     = {Crowdsourcing for search evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {17--22},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924481},
  doi       = {10.1145/1924475.1924481},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CarvalhoLY10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CroftBLX10,
  author    = {W. Bruce Croft and
               Michael Bendersky and
               Hang Li and
               Gu Xu},
  title     = {Query representation and understanding workshop},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {48--53},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924485},
  doi       = {10.1145/1924475.1924485},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CroftBLX10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DohertyGJS10,
  author    = {Aiden R. Doherty and
               Cathal Gurrin and
               Gareth J. F. Jones and
               Alan F. Smeaton},
  title     = {Information access for personal media archives},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {1},
  pages     = {33--37},
  year      = {2010},
  url       = {https://doi.org/10.1145/1842890.1842895},
  doi       = {10.1145/1842890.1842895},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DohertyGJS10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ElsweilerJKT10,
  author    = {David Elsweiler and
               Gareth J. F. Jones and
               Liadh Kelly and
               Jaime Teevan},
  title     = {Workshop on desktop search},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {28--34},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924483},
  doi       = {10.1145/1924475.1924483},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ElsweilerJKT10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GurrinHKLR10,
  author    = {Cathal Gurrin and
               Yulan He and
               Udo Kruschwitz and
               Suzanne Little and
               Stefan M. R{\"{u}}ger},
  title     = {{ECIR} 2010: 32nd european conference on information retrieval research},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {1},
  pages     = {2--18},
  year      = {2010},
  url       = {https://doi.org/10.1145/1842890.1842892},
  doi       = {10.1145/1842890.1842892},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GurrinHKLR10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HanburyZB10,
  author    = {Allan Hanbury and
               Veronika Zenz and
               Helmut Berger},
  title     = {1st international workshop on advances in patent information retrieval
               (AsPIRe'10)},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {1},
  pages     = {19--22},
  year      = {2010},
  url       = {https://doi.org/10.1145/1842890.1842893},
  doi       = {10.1145/1842890.1842893},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HanburyZB10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hauff10,
  author    = {Claudia Hauff},
  title     = {Predicting the effectiveness of queries and retrieval systems},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {1},
  pages     = {88},
  year      = {2010},
  url       = {https://doi.org/10.1145/1842890.1842906},
  doi       = {10.1145/1842890.1842906},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Hauff10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hopfgartner10,
  author    = {Frank Hopfgartner},
  title     = {Personalised video retrieval: application of implicit feedback and
               semantic user profiles},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {84--85},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924496},
  doi       = {10.1145/1924475.1924496},
  timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Hopfgartner10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JatowtT10,
  author    = {Adam Jatowt and
               Katsumi Tanaka},
  title     = {Report of the 4th workshop on information credibility on the web {(WICOW}
               2010)},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {78--81},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924492},
  doi       = {10.1145/1924475.1924492},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JatowtT10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ke10,
  author    = {Weimao Ke},
  title     = {Scalability of findability: decentralized search and retrieval in
               large information networks},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {86},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924497},
  doi       = {10.1145/1924475.1924497},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Ke10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KellyB10,
  author    = {Diane Kelly and
               Nicholas J. Belkin},
  title     = {The third information interaction in context symposium (IIiX'10)},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {13--14},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924478},
  doi       = {10.1145/1924475.1924478},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KellyB10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KosmopoulosGPA10,
  author    = {Aris Kosmopoulos and
               {\'{E}}ric Gaussier and
               Georgios Paliouras and
               Sujeevan Aseervatham},
  title     = {The {ECIR} 2010 large scale hierarchical classification workshop},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {1},
  pages     = {23--32},
  year      = {2010},
  url       = {https://doi.org/10.1145/1842890.1842894},
  doi       = {10.1145/1842890.1842894},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KosmopoulosGPA10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KraaijVHHW10,
  author    = {Wessel Kraaij and
               Suzan Verberne and
               Max Hinne and
               Maarten van der Heijden and
               Theo P. van der Weide},
  title     = {{DIR} 2010: the tenth Dutch-Belgian information retrieval workshop},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {64--66},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924489},
  doi       = {10.1145/1924475.1924489},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KraaijVHHW10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LarsonOJKK10,
  author    = {Martha A. Larson and
               Roeland Ordelman and
               Franciska de Jong and
               Joachim K{\"{o}}hler and
               Wessel Kraaij},
  title     = {Multimedia with a speech track: searching spontaneous conversational
               speech},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {1},
  pages     = {76--81},
  year      = {2010},
  url       = {https://doi.org/10.1145/1842890.1842901},
  doi       = {10.1145/1842890.1842901},
  timestamp = {Fri, 06 Dec 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LarsonOJKK10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Liu10,
  author    = {Jingjing Liu},
  title     = {Personalizing information retrieval using task stage, topic knowledge,
               and task products},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {87},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924498},
  doi       = {10.1145/1924475.1924498},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Liu10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MacdonaldSOS10,
  author    = {Craig Macdonald and
               Rodrygo L. T. Santos and
               Iadh Ounis and
               Ian Soboroff},
  title     = {Blog track research at {TREC}},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {1},
  pages     = {58--75},
  year      = {2010},
  url       = {https://doi.org/10.1145/1842890.1842899},
  doi       = {10.1145/1842890.1842899},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/MacdonaldSOS10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Roda10,
  author    = {Giovanna Roda},
  title     = {Connecting the dots},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {1},
  pages     = {82--86},
  year      = {2010},
  url       = {https://doi.org/10.1145/1842890.1842903},
  doi       = {10.1145/1842890.1842903},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Roda10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SerdyukovHR10,
  author    = {Pavel Serdyukov and
               Djoerd Hiemstra and
               Ian Ruthven},
  title     = {Towards accessible search systems},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {23--27},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924482},
  doi       = {10.1145/1924475.1924482},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SerdyukovHR10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Shah10,
  author    = {Chirag Shah},
  title     = {A framework for supporting user-centric collaborative information
               seeking},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {88},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924499},
  doi       = {10.1145/1924475.1924499},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Shah10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Trieschnigg10,
  author    = {Dolf Trieschnigg},
  title     = {Proof of concept: concept-based biomedical information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {89},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924500},
  doi       = {10.1145/1924475.1924500},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Trieschnigg10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Verberne10,
  author    = {Suzan Verberne},
  title     = {In search of the Why: developing a system for answering why-questions},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {90},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924501},
  doi       = {10.1145/1924475.1924501},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Verberne10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WebberSS10,
  author    = {William Webber and
               Tetsuya Sakai and
               Mark Sanderson},
  title     = {{EVIA} 2010: the third international workshop on evaluating information
               access},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {67--72},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924490},
  doi       = {10.1145/1924475.1924490},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/WebberSS10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZhaiWYVV10,
  author    = {Chengxiang Zhai and
               Kuansan Wang and
               David Yarowsky and
               Stephan Vogel and
               Evelyne Viegas},
  title     = {Web N-gram workshop 2010},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {2},
  pages     = {59--63},
  year      = {2010},
  url       = {https://doi.org/10.1145/1924475.1924487},
  doi       = {10.1145/1924475.1924487},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ZhaiWYVV10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zhang10,
  author    = {Yan Zhang},
  title     = {The construction of mental models of information-rich web spaces:
               the development process and the impact of task complexity},
  journal   = {{SIGIR} Forum},
  volume    = {44},
  number    = {1},
  pages     = {89},
  year      = {2010},
  url       = {https://doi.org/10.1145/1842890.1842907},
  doi       = {10.1145/1842890.1842907},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Zhang10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgichteinHS09,
  author    = {Eugene Agichtein and
               Marti A. Hearst and
               Ian Soboroff},
  title     = {The search and social media workshop at {SIGIR} 2009},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {2},
  pages     = {53--56},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670564.1670573},
  doi       = {10.1145/1670564.1670573},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AgichteinHS09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ashoori09,
  author    = {Elham Ashoori},
  title     = {Using topic shifts in content-oriented {XML} retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {1},
  pages     = {70},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670598.1670614},
  doi       = {10.1145/1670598.1670614},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Ashoori09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BilenkoGRZ09,
  author    = {Mikhail Bilenko and
               Evgeniy Gabrilovich and
               Matthew Richardson and
               Yi Zhang},
  title     = {Information retrieval and advertising},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {2},
  pages     = {29--33},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670564.1670569},
  doi       = {10.1145/1670564.1670569},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BilenkoGRZ09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BuscherGTBBEJ09,
  author    = {Georg Buscher and
               Jacek Gwizdka and
               Jaime Teevan and
               Nicholas J. Belkin and
               Ralf Bierig and
               Ludger van Elst and
               Joemon M. Jose},
  title     = {{SIGIR} 2009 workshop on understanding the user: logging and interpreting
               user interactions in information search and retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {2},
  pages     = {57--62},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670564.1670574},
  doi       = {10.1145/1670564.1670574},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BuscherGTBBEJ09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ChanP09,
  author    = {Chee{-}Yong Chan and
               Neoklis Polyzotis},
  title     = {Report on the 10th international workshop on web information and data
               management {(WIDM)}},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {1},
  pages     = {49--55},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670598.1670607},
  doi       = {10.1145/1670598.1670607},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ChanP09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CloughB09,
  author    = {Paul D. Clough and
               Bettina Berendt},
  title     = {Report on the TrebleCLEF query log analysis workshop 2009},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {2},
  pages     = {71--77},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670564.1670578},
  doi       = {10.1145/1670564.1670578},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CloughB09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DemartiniDDFGGHIKKKLNPSTTVWZ09,
  author    = {Gianluca Demartini and
               Ludovic Denoyer and
               Antoine Doucet and
               Khairun Nisa Fachry and
               Patrick Gallinari and
               Shlomo Geva and
               Darren Wei Che Huang and
               Tereza Iofciu and
               Jaap Kamps and
               Gabriella Kazai and
               Marijn Koolen and
               Monica Landoni and
               Ragnar Nordlie and
               Nils Pharo and
               Ralf Schenkel and
               Martin Theobald and
               Andrew Trotman and
               Arjen P. de Vries and
               Alan Woodley and
               Jianhan Zhu},
  title     = {Report on {INEX} 2008},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {1},
  pages     = {17--36},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670598.1670603},
  doi       = {10.1145/1670598.1670603},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DemartiniDDFGGHIKKKLNPSTTVWZ09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frommholz09,
  author    = {Ingo Frommholz},
  title     = {A probabilistic framework for information modelling and retrieval
               based on user annotations on digital objects},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {1},
  pages     = {71--72},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670598.1670615},
  doi       = {10.1145/1670598.1670615},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Frommholz09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GeyKK09,
  author    = {Fredric C. Gey and
               Jussi Karlgren and
               Noriko Kando},
  title     = {Information access in a multilingual world: transitioning from research
               to real-world applications},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {2},
  pages     = {24--28},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670564.1670568},
  doi       = {10.1145/1670564.1670568},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GeyKK09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JatowtT09,
  author    = {Adam Jatowt and
               Katsumi Tanaka},
  title     = {The 2nd workshop on information credibility on the web {(WICOW} 2008)},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {1},
  pages     = {37--41},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670598.1670605},
  doi       = {10.1145/1670598.1670605},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JatowtT09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JatowtT09a,
  author    = {Adam Jatowt and
               Katsumi Tanaka},
  title     = {The 3rd workshop on information credibility on the web {(WICOW} 2009)},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {2},
  pages     = {78--82},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670564.1670579},
  doi       = {10.1145/1670564.1670579},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JatowtT09a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JohoHJR09,
  author    = {Hideo Joho and
               Frank Hopfgartner and
               Joemon M. Jose and
               C. J. van Rijsbergen},
  title     = {{AIR} 2008: second international workshop on adaptive information
               retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {1},
  pages     = {63--65},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670598.1670611},
  doi       = {10.1145/1670598.1670611},
  timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/JohoHJR09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KampsGPSTV09,
  author    = {Jaap Kamps and
               Shlomo Geva and
               Carol Peters and
               Tetsuya Sakai and
               Andrew Trotman and
               Ellen M. Voorhees},
  title     = {Report on the {SIGIR} 2009 workshop on the future of {IR} evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {2},
  pages     = {13--23},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670564.1670567},
  doi       = {10.1145/1670564.1670567},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KampsGPSTV09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kelly09,
  author    = {Diane Kelly},
  title     = {{SIGIR} 2009 workshop program overview},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {2},
  pages     = {10--12},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670564.1670566},
  doi       = {10.1145/1670564.1670566},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Kelly09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KulesTW09,
  author    = {Bill Kules and
               Daniel Tunkelang and
               Ryen W. White},
  title     = {{HCIR} 2009: the third international workshop on human-computer interaction
               and information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {2},
  pages     = {83--87},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670564.1670580},
  doi       = {10.1145/1670564.1670580},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KulesTW09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LalmasTBS09,
  author    = {Mounia Lalmas and
               Anastasios Tombros and
               Pia Borlund and
               Jesper W. Schneider},
  title     = {Second international symposium on information interaction in context},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {1},
  pages     = {59--62},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670598.1670610},
  doi       = {10.1145/1670598.1670610},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LalmasTBS09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiLZ09,
  author    = {Hang Li and
               Tie{-}Yan Liu and
               ChengXiang Zhai},
  title     = {Learning to rank for information retrieval {(LR4IR} 2009)},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {2},
  pages     = {41--45},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670564.1670571},
  doi       = {10.1145/1670564.1670571},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LiLZ09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Liu09,
  author    = {Ying{-}Hsang Liu},
  title     = {The impact of MeSH (Medical Subject Headings) terms on information
               seeking effectiveness},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {2},
  pages     = {88},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670564.1670582},
  doi       = {10.1145/1670564.1670582},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Liu09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LuccheseSY09,
  author    = {Claudio Lucchese and
               Gleb Skobeltsyn and
               Wai Gen Yee},
  title     = {7th workshop on large-scale distributed systems for information retrieval
               (LSDS-IR'09)},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {2},
  pages     = {34--40},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670564.1670570},
  doi       = {10.1145/1670564.1670570},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LuccheseSY09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LupuHZT09,
  author    = {Mihai Lupu and
               Jimmy Huang and
               Jianhan Zhu and
               John Tait},
  title     = {{TREC-CHEM:} large scale chemical information retrieval evaluation
               at {TREC}},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {2},
  pages     = {63--70},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670564.1670576},
  doi       = {10.1145/1670564.1670576},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LupuHZT09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Macdonald09,
  author    = {Craig Macdonald},
  title     = {The voting model for people search},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {1},
  pages     = {73},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670598.1670616},
  doi       = {10.1145/1670598.1670616},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Macdonald09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MichelSY09,
  author    = {Sebastian Michel and
               Gleb Skobeltsyn and
               Wai Gen Yee},
  title     = {Workshop on large-scale distributed systems for information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {1},
  pages     = {42--48},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670598.1670606},
  doi       = {10.1145/1670598.1670606},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/MichelSY09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/RadlinskiBCJ09,
  author    = {Filip Radlinski and
               Paul N. Bennett and
               Ben Carterette and
               Thorsten Joachims},
  title     = {Redundancy, diversity and interdependent document relevance},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {2},
  pages     = {46--52},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670564.1670572},
  doi       = {10.1145/1670564.1670572},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/RadlinskiBCJ09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/RodaZLJSW09,
  author    = {Giovanna Roda and
               Veronika Zenz and
               Mihai Lupu and
               Kalervo J{\"{a}}rvelin and
               Mark Sanderson and
               Christa Womser{-}Hacker},
  title     = {So many topics, so little time},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {1},
  pages     = {9--16},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670598.1670601},
  doi       = {10.1145/1670598.1670601},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/RodaZLJSW09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SakaiSK09,
  author    = {Tetsuya Sakai and
               Mark Sanderson and
               Noriko Kando},
  title     = {{EVIA} 2008: the second international workshop on evaluating information
               access},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {1},
  pages     = {56--62},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670598.1670609},
  doi       = {10.1145/1670598.1670609},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SakaiSK09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sanderson09,
  author    = {Mark Sanderson},
  title     = {Workshop on novel methodologies for evaluation in information retrieval:
               held at {ECIR} 2008, Glasgow, UK, 30th March, 2008},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {1},
  pages     = {66--69},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670598.1670612},
  doi       = {10.1145/1670598.1670612},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Sanderson09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Szlavik09,
  author    = {Zolt{\'{a}}n Szl{\'{a}}vik},
  title     = {Content and structure summarisation for accessing {XML} documents},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {1},
  pages     = {74},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670598.1670617},
  doi       = {10.1145/1670598.1670617},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Szlavik09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZobelMP09,
  author    = {Justin Zobel and
               Alistair Moffat and
               Laurence Anthony F. Park},
  title     = {Against recall: is it persistence, cardinality, density, coverage,
               or totality?},
  journal   = {{SIGIR} Forum},
  volume    = {43},
  number    = {1},
  pages     = {3--8},
  year      = {2009},
  url       = {https://doi.org/10.1145/1670598.1670600},
  doi       = {10.1145/1670598.1670600},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ZobelMP09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoRS08,
  author    = {Omar Alonso and
               Daniel E. Rose and
               Benjamin Stewart},
  title     = {Crowdsourcing for relevance evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {9--15},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480508},
  doi       = {10.1145/1480506.1480508},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AlonsoRS08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoZ08,
  author    = {Omar Alonso and
               Hugo Zaragoza},
  title     = {Exploiting semantic annotations in information retrieval: {ESAIR}
               '08},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {55--58},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394262},
  doi       = {10.1145/1394251.1394262},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AlonsoZ08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Amer-YahiaHRSW08,
  author    = {Sihem Amer{-}Yahia and
               Djoerd Hiemstra and
               Thomas Roelleke and
               Divesh Srivastava and
               Gerhard Weikum},
  title     = {DB{\&}IR integration: report on the dagstuhl seminar},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {84--89},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480522},
  doi       = {10.1145/1480506.1480522},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Amer-YahiaHRSW08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AnickN08,
  author    = {Peter G. Anick and
               Hwee Tou Ng},
  title     = {The {SIGIR} 2008 workshop program},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {45},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480514},
  doi       = {10.1145/1480506.1480514},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AnickN08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Balog08,
  author    = {Krisztian Balog},
  title     = {The {SIGIR} 2008 workshop on future challenges in expertise retrieval
               (fCHER)},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {46--52},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480515},
  doi       = {10.1145/1480506.1480515},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Balog08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Balog08a,
  author    = {Krisztian Balog},
  title     = {People search in the enterprise},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {103},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480526},
  doi       = {10.1145/1480506.1480526},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Balog08a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin08,
  author    = {Nicholas J. Belkin},
  title     = {Some(what) grand challenges for information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {47--54},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394261},
  doi       = {10.1145/1394251.1394261},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Belkin08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BennettCCJ08,
  author    = {Paul N. Bennett and
               Ben Carterette and
               Olivier Chapelle and
               Thorsten Joachims},
  title     = {Beyond binary relevance: preferences, diversity, and set-level judgments},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {53--58},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480516},
  doi       = {10.1145/1480506.1480516},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BennettCCJ08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BlancoS08,
  author    = {Roi Blanco and
               Fabrizio Silvestri},
  title     = {{ECIR} 2008 Workshop on Efficiency Issues on Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {59--62},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394263},
  doi       = {10.1145/1394251.1394263},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BlancoS08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BoldiSV08,
  author    = {Paolo Boldi and
               Massimo Santini and
               Sebastiano Vigna},
  title     = {A large time-aware web graph},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {33--38},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480511},
  doi       = {10.1145/1480506.1480511},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BoldiSV08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Carterette08,
  author    = {Benjamin A. Carterette},
  title     = {Low-cost and robust evaluation of information retrieval systems},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {104},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480527},
  doi       = {10.1145/1480506.1480527},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Carterette08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CastilloCD08,
  author    = {Carlos Castillo and
               Kumar Chellapilla and
               Brian D. Davison},
  title     = {Adversarial Information Retrieval on the Web (AIRWeb 2007)},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {68--72},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394267},
  doi       = {10.1145/1394251.1394267},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CastilloCD08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DenoyerG08,
  author    = {Ludovic Denoyer and
               Patrick Gallinari},
  title     = {Report on the {XML} mining track at {INEX} 2007 categorization and
               clustering of {XML} documents},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {22--28},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394255},
  doi       = {10.1145/1394251.1394255},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DenoyerG08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Elsweiler08,
  author    = {David Elsweiler},
  title     = {Supporting human memory in personal information management},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {75--76},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394270},
  doi       = {10.1145/1394251.1394270},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Elsweiler08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Esuli08,
  author    = {Andrea Esuli},
  title     = {Automatic generation of lexical resources for opinion mining: models,
               algorithms and applications},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {105--106},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480528},
  doi       = {10.1145/1480506.1480528},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Esuli08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Freund08,
  author    = {Luanne Freund},
  title     = {Exploiting task-document relations in support of information retrieval
               in the workplace},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {107},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480529},
  doi       = {10.1145/1480506.1480529},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Freund08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FundulakiP08,
  author    = {Irini Fundulaki and
               Neoklis Polyzotis},
  title     = {Report on the 9th International Workshop on Web Information and Data
               Management {(WIDM} 2007)},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {36--43},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394258},
  doi       = {10.1145/1394251.1394258},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/FundulakiP08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HarmanH08,
  author    = {Donna Harman and
               Djoerd Hiemstra},
  title     = {Saving and accessing the old {IR} literature},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {16--21},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480509},
  doi       = {10.1145/1480506.1480509},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HarmanH08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JohoUVJR08,
  author    = {Hideo Joho and
               Jana Urban and
               Robert Villa and
               Joemon M. Jose and
               C. J. van Rijsbergen},
  title     = {{AIR} 2006: First International Workshop on Adaptive Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {63--66},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394265},
  doi       = {10.1145/1394251.1394265},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JohoUVJR08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KampsGT08,
  author    = {Jaap Kamps and
               Shlomo Geva and
               Andrew Trotman},
  title     = {Report on the {SIGIR} 2008 workshop on focused retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {59--65},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480517},
  doi       = {10.1145/1480506.1480517},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KampsGT08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KazaiD08,
  author    = {Gabriella Kazai and
               Antoine Doucet},
  title     = {Overview of the {INEX} 2007 Book Search track: BookSearch '07},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {2--15},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394253},
  doi       = {10.1145/1394251.1394253},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KazaiD08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KohlerLJKO08,
  author    = {Joachim K{\"{o}}hler and
               Martha A. Larson and
               Franciska de Jong and
               Wessel Kraaij and
               Roeland Ordelman},
  title     = {Spoken content retrieval: Searching spontaneous conversational speech},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {66--75},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480518},
  doi       = {10.1145/1480506.1480518},
  timestamp = {Fri, 06 Dec 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KohlerLJKO08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LarsonFOR08,
  author    = {Martha A. Larson and
               Kate Fernie and
               Johan Oomen and
               Juan Miguel Cigarr{\'{a}}n Recuero},
  title     = {Information access to cultural heritage},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {90--95},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480523},
  doi       = {10.1145/1480506.1480523},
  timestamp = {Fri, 06 Dec 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LarsonFOR08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiC08,
  author    = {Yaoyong Li and
               Hamish Cunningham},
  title     = {Geometric and quantum methods for information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {22--32},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480510},
  doi       = {10.1145/1480506.1480510},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LiC08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiLZ08,
  author    = {Hang Li and
               Tie{-}Yan Liu and
               ChengXiang Zhai},
  title     = {Learning to rank for information retrieval {(LR4IR} 2008)},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {76--79},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480519},
  doi       = {10.1145/1480506.1480519},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LiLZ08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiMNW08,
  author    = {Hang Li and
               Wei{-}Ying Ma and
               Jian{-}Yun Nie and
               Kam{-}Fai Wong},
  title     = {The Fourth Asian Information Retrieval Symposium {(AIRS} 08)},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {73--74},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394268},
  doi       = {10.1145/1394251.1394268},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LiMNW08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Metzler08,
  author    = {Donald Metzler},
  title     = {Beyond bags of words: effectively modeling dependence and features
               in information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {77},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394271},
  doi       = {10.1145/1394251.1394271},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Metzler08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MurdockL08,
  author    = {Vanessa Murdock and
               Mounia Lalmas},
  title     = {Workshop on aggregated search},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {80--83},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480520},
  doi       = {10.1145/1480506.1480520},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/MurdockL08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/OrlandiV08,
  author    = {Alessio Orlandi and
               Sebastiano Vigna},
  title     = {Compressed collections for simulated crawling},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {39--44},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480512},
  doi       = {10.1145/1480506.1480512},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/OrlandiV08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/OunisRP08,
  author    = {Iadh Ounis and
               Ian Ruthven and
               Vassilis Plachouras},
  title     = {30\({}^{\mbox{th}}\) European Conference in Information Retrieval
               {(ECIR} 2008)},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {44--46},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394260},
  doi       = {10.1145/1394251.1394260},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/OunisRP08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Tait08,
  author    = {John Tait},
  title     = {Information retrieval facility symposium in Vienna},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {67},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394266},
  doi       = {10.1145/1394251.1394266},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Tait08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TeevanJC08,
  author    = {Jaime Teevan and
               William Jones and
               Robert Capra},
  title     = {Personal information management {(PIM)} 2008},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {96--103},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480524},
  doi       = {10.1145/1480506.1480524},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/TeevanJC08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Thomas08,
  author    = {Paul Thomas},
  title     = {Server characterisation and selection for personal metasearch},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {2},
  pages     = {108--109},
  year      = {2008},
  url       = {https://doi.org/10.1145/1480506.1480530},
  doi       = {10.1145/1480506.1480530},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Thomas08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TsikrikaW08,
  author    = {Theodora Tsikrika and
               Thijs Westerveld},
  title     = {Multimedia retrieval at {INEX} 2007},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {16--21},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394254},
  doi       = {10.1145/1394251.1394254},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/TsikrikaW08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/VardeP08,
  author    = {Aparna S. Varde and
               Jian Pei},
  title     = {Advances in information and knowledge management},
  journal   = {{SIGIR} Forum},
  volume    = {42},
  number    = {1},
  pages     = {29--35},
  year      = {2008},
  url       = {https://doi.org/10.1145/1394251.1394257},
  doi       = {10.1145/1394251.1394257},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/VardeP08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoGB07,
  author    = {Omar Alonso and
               Michael Gertz and
               Ricardo A. Baeza{-}Yates},
  title     = {On the value of temporal information in information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {35--41},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328968},
  doi       = {10.1145/1328964.1328968},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AlonsoGB07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BaileyCSV07,
  author    = {Peter Bailey and
               Nick Craswell and
               Ian Soboroff and
               Arjen P. de Vries},
  title     = {The {CSIRO} enterprise search test collection},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {42--45},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328969},
  doi       = {10.1145/1328964.1328969},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BaileyCSV07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CallanACDESZ07,
  author    = {Jamie Callan and
               James Allan and
               Charles L. A. Clarke and
               Susan T. Dumais and
               David A. Evans and
               Mark Sanderson and
               ChengXiang Zhai},
  title     = {Meeting of the {MINDS:} an information retrieval research agenda},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {25--34},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328967},
  doi       = {10.1145/1328964.1328967},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CallanACDESZ07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DenoyerG07,
  author    = {Ludovic Denoyer and
               Patrick Gallinari},
  title     = {Report on the {XML} mining track at {INEX} 2005 and {INEX} 2006: categorization
               and clustering of {XML} documents},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {1},
  pages     = {79--90},
  year      = {2007},
  url       = {https://doi.org/10.1145/1273221.1273230},
  doi       = {10.1145/1273221.1273230},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DenoyerG07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fernandez-LunaPH07,
  author    = {Juan M. Fern{\'{a}}ndez{-}Luna and
               Benjamin Piwowarski and
               Juan F. Huete},
  title     = {Information retrieval and applications of graphical models {(IRGM}
               2007)},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {89--96},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328980},
  doi       = {10.1145/1328964.1328980},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Fernandez-LunaPH07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FrommholzL07,
  author    = {Ingo Frommholz and
               Ray R. Larson},
  title     = {Report on the {INEX} 2006 heterogeneous collection track},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {1},
  pages     = {75--78},
  year      = {2007},
  url       = {https://doi.org/10.1145/1273221.1273229},
  doi       = {10.1145/1273221.1273229},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/FrommholzL07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Gabrilovich07,
  author    = {Evgeniy Gabrilovich},
  title     = {Feature generation for textual information retrieval using world knowledge},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {123},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328988},
  doi       = {10.1145/1328964.1328988},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Gabrilovich07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HiemstraHJK07,
  author    = {Djoerd Hiemstra and
               Claudia Hauff and
               Franciska de Jong and
               Wessel Kraaij},
  title     = {SIGIR's 30th anniversary: an analysis of trends in {IR} research and
               the topology of its community},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {18--24},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328966},
  doi       = {10.1145/1328964.1328966},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HiemstraHJK07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JoachimsLLZ07,
  author    = {Thorsten Joachims and
               Hang Li and
               Tie{-}Yan Liu and
               ChengXiang Zhai},
  title     = {Learning to rank for information retrieval {(LR4IR} 2007)},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {58--62},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328974},
  doi       = {10.1145/1328964.1328974},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JoachimsLLZ07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JonesRS07,
  author    = {Karen Sparck Jones and
               Stephen E. Robertson and
               Mark Sanderson},
  title     = {Ambiguous requests: implications for retrieval tests, systems and
               theories},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {8--17},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328965},
  doi       = {10.1145/1328964.1328965},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JonesRS07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JongOOR07,
  author    = {Franciska de Jong and
               Douglas W. Oard and
               Roeland Ordelman and
               Stephan Raaijmakers},
  title     = {Searching spontaneous conversational speech},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {104--108},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328982},
  doi       = {10.1145/1328964.1328982},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JongOOR07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JunqueiraPSP07,
  author    = {Flavio Junqueira and
               Vassilis Plachouras and
               Fabrizio Silvestri and
               Ivana Podnar},
  title     = {Workshop on large-scale distributed systems for information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {83--88},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328979},
  doi       = {10.1145/1328964.1328979},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JunqueiraPSP07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KantorL07,
  author    = {Paul B. Kantor and
               Jimmy J. Lin},
  title     = {Presentation schemes for component analysis in {IR} experiments},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {1},
  pages     = {34--39},
  year      = {2007},
  url       = {https://doi.org/10.1145/1273221.1273224},
  doi       = {10.1145/1273221.1273224},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KantorL07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KellyL07,
  author    = {Diane Kelly and
               Jimmy J. Lin},
  title     = {Overview of the {TREC} 2006 ciQA task},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {1},
  pages     = {107--116},
  year      = {2007},
  url       = {https://doi.org/10.1145/1273221.1273231},
  doi       = {10.1145/1273221.1273231},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KellyL07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LalmasT07,
  author    = {Mounia Lalmas and
               Anastasios Tombros},
  title     = {Evaluating {XML} retrieval effectiveness at {INEX}},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {1},
  pages     = {40--57},
  year      = {2007},
  url       = {https://doi.org/10.1145/1273221.1273225},
  doi       = {10.1145/1273221.1273225},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LalmasT07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LazarinisFT07,
  author    = {Fotis Lazarinis and
               Jes{\'{u}}s Vilares Ferro and
               John Tait},
  title     = {Improving non-English web searching (iNEWS07)},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {72--76},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328977},
  doi       = {10.1145/1328964.1328977},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LazarinisFT07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Leidner07,
  author    = {Jochen L. Leidner},
  title     = {Toponym resolution in text: annotation, evaluation and applications
               of spatial grounding},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {124--126},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328989},
  doi       = {10.1145/1328964.1328989},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Leidner07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lu07,
  author    = {Jie Lu},
  title     = {Full-text federated search in peer-to-peer networks},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {1},
  pages     = {121},
  year      = {2007},
  url       = {https://doi.org/10.1145/1273221.1273233},
  doi       = {10.1145/1273221.1273233},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Lu07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MalikLT07,
  author    = {Saadia Malik and
               Birger Larsen and
               Anastasios Tombros},
  title     = {Report on the {INEX} 2005 interactive track},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {1},
  pages     = {67--74},
  year      = {2007},
  url       = {https://doi.org/10.1145/1273221.1273228},
  doi       = {10.1145/1273221.1273228},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/MalikLT07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Melucci07,
  author    = {Massimo Melucci},
  title     = {On rank correlation in information retrieval evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {1},
  pages     = {18--33},
  year      = {2007},
  url       = {https://doi.org/10.1145/1273221.1273223},
  doi       = {10.1145/1273221.1273223},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Melucci07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MoensTV07,
  author    = {Marie{-}Francine Moens and
               Tinne Tuytelaars and
               Arjen P. de Vries},
  title     = {7\({}^{\mbox{th}}\) Dutch-Belgian Information Retrieval Workshop March
               28--29, 2007 Katholieke Universiteit Leuven, Belgium},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {121--122},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328986},
  doi       = {10.1145/1328964.1328986},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/MoensTV07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Mothe07,
  author    = {Josiane Mothe},
  title     = {The {SIGIR} 2007 workshop program},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {55--57},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328973},
  doi       = {10.1145/1328964.1328973},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Mothe07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Murdock07,
  author    = {Vanessa Murdock},
  title     = {Aspects of sentence retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {127},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328990},
  doi       = {10.1145/1328964.1328990},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Murdock07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MurrayT07,
  author    = {G. Craig Murray and
               Jaime Teevan},
  title     = {Query log analysis: social and technological challenges},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {112--120},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328985},
  doi       = {10.1145/1328964.1328985},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/MurrayT07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PharoT07,
  author    = {Nils Pharo and
               Andrew Trotman},
  title     = {The use case track at {INEX} 2006},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {1},
  pages     = {64--66},
  year      = {2007},
  url       = {https://doi.org/10.1145/1273221.1273227},
  doi       = {10.1145/1273221.1273227},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/PharoT07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Popescu07,
  author    = {Adrian Popescu},
  title     = {The {RIAO} 2007 conference: a personal view},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {46--54},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328971},
  doi       = {10.1145/1328964.1328971},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Popescu07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/RoddenRW07,
  author    = {Kerry Rodden and
               Ian Ruthven and
               Ryen W. White},
  title     = {Workshop on web information seeking and interaction},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {63--67},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328975},
  doi       = {10.1145/1328964.1328975},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/RoddenRW07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SandersonSK07,
  author    = {Mark Sanderson and
               Tetsuya Sakai and
               Noriko Kando},
  title     = {{EVIA} 2007: the First International Workshop on Evaluating Information
               Access},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {109--111},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328984},
  doi       = {10.1145/1328964.1328984},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SandersonSK07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ShenTZ07,
  author    = {Xuehua Shen and
               Bin Tan and
               ChengXiang Zhai},
  title     = {Privacy protection in personalized search},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {1},
  pages     = {4--17},
  year      = {2007},
  url       = {https://doi.org/10.1145/1273221.1273222},
  doi       = {10.1145/1273221.1273222},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ShenTZ07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Si07,
  author    = {Luo Si},
  title     = {Federated search of text search engines in uncooperative environments},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {1},
  pages     = {120},
  year      = {2007},
  url       = {https://doi.org/10.1145/1273221.1273232},
  doi       = {10.1145/1273221.1273232},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Si07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SteinKS07,
  author    = {Benno Stein and
               Moshe Koppel and
               Efstathios Stamatatos},
  title     = {Plagiarism analysis, authorship identification, and near-duplicate
               detection PAN'07},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {68--71},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328976},
  doi       = {10.1145/1328964.1328976},
  timestamp = {Wed, 30 Oct 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SteinKS07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TrotmanGK07,
  author    = {Andrew Trotman and
               Shlomo Geva and
               Jaap Kamps},
  title     = {Report on the {SIGIR} 2007 workshop on focused retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {97--103},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328981},
  doi       = {10.1145/1328964.1328981},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/TrotmanGK07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WesterveldZ07,
  author    = {Thijs Westerveld and
               Roelof van Zwol},
  title     = {Multimedia retrieval at {INEX} 2006},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {1},
  pages     = {58--63},
  year      = {2007},
  url       = {https://doi.org/10.1145/1273221.1273226},
  doi       = {10.1145/1273221.1273226},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/WesterveldZ07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZwolRSM07,
  author    = {Roelof van Zwol and
               Stefan M. R{\"{u}}ger and
               Mark Sanderson and
               Yosi Mass},
  title     = {Multimedia information retrieval: "new challenges in audio visual
               search"},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {77--82},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328978},
  doi       = {10.1145/1328964.1328978},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ZwolRSM07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AnickL06,
  author    = {Peter G. Anick and
               Mounia Lalmas},
  title     = {The {SIGIR} 2006 workshop program},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {2},
  pages     = {25--26},
  year      = {2006},
  url       = {https://doi.org/10.1145/1189702.1189705},
  doi       = {10.1145/1189702.1189705},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AnickL06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Azzopardi06,
  author    = {Leif Azzopardi},
  title     = {Incorporating context within the language modeling approach for \emph{ad
               hoc} information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {1},
  pages     = {70},
  year      = {2006},
  url       = {https://doi.org/10.1145/1147197.1147211},
  doi       = {10.1145/1147197.1147211},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Azzopardi06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BonifatiL06,
  author    = {Angela Bonifati and
               Dongwon Lee},
  title     = {Report on the 7\({}^{\mbox{th}}\) {ACM} International Workshop on
               Web Information and Data Management {(WIDM} 2005)},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {1},
  pages     = {31--33},
  year      = {2006},
  url       = {https://doi.org/10.1145/1147197.1147201},
  doi       = {10.1145/1147197.1147201},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BonifatiL06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CastilloDBBLSV06,
  author    = {Carlos Castillo and
               Debora Donato and
               Luca Becchetti and
               Paolo Boldi and
               Stefano Leonardi and
               Massimo Santini and
               Sebastiano Vigna},
  title     = {A reference collection for web spam},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {2},
  pages     = {11--24},
  year      = {2006},
  url       = {https://doi.org/10.1145/1189702.1189703},
  doi       = {10.1145/1189702.1189703},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CastilloDBBLSV06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CloughSR06,
  author    = {Paul D. Clough and
               Mark Sanderson and
               Norman Reid},
  title     = {The Eurovision St Andrews collection of photographs},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {1},
  pages     = {21--30},
  year      = {2006},
  url       = {https://doi.org/10.1145/1147197.1147199},
  doi       = {10.1145/1147197.1147199},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CloughSR06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CrestaniP06,
  author    = {Fabio Crestani and
               Gabriella Pasi},
  title     = {Report on the first 5 years of the track on information access and
               retrieval of the {ACM} Symposium on Applied Computing},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {2},
  pages     = {66--69},
  year      = {2006},
  url       = {https://doi.org/10.1145/1189702.1189714},
  doi       = {10.1145/1189702.1189714},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CrestaniP06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Crouch06,
  author    = {Carolyn J. Crouch},
  title     = {Relevance feedback at {INEX} 2005},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {1},
  pages     = {58--59},
  year      = {2006},
  url       = {https://doi.org/10.1145/1147197.1147208},
  doi       = {10.1145/1147197.1147208},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Crouch06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DavisonNC06,
  author    = {Brian D. Davison and
               Marc Najork and
               Tim Converse},
  title     = {Adversarial information retrieval on the web (AIRWeb 2006)},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {2},
  pages     = {27--30},
  year      = {2006},
  url       = {https://doi.org/10.1145/1189702.1189706},
  doi       = {10.1145/1189702.1189706},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DavisonNC06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DenoyerG06,
  author    = {Ludovic Denoyer and
               Patrick Gallinari},
  title     = {The Wikipedia {XML} corpus},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {1},
  pages     = {64--69},
  year      = {2006},
  url       = {https://doi.org/10.1145/1147197.1147210},
  doi       = {10.1145/1147197.1147210},
  timestamp = {Thu, 28 Nov 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DenoyerG06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Doucet06,
  author    = {Antoine Doucet},
  title     = {Advanced document description, a sequential approach},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {1},
  pages     = {71--72},
  year      = {2006},
  url       = {https://doi.org/10.1145/1147197.1147212},
  doi       = {10.1145/1147197.1147212},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Doucet06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GevaW06,
  author    = {Shlomo Geva and
               Alan Woodley},
  title     = {The {NLP} task at {INEX} 2005},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {1},
  pages     = {60--63},
  year      = {2006},
  url       = {https://doi.org/10.1145/1147197.1147209},
  doi       = {10.1145/1147197.1147209},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GevaW06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GeyKLP06,
  author    = {Fredric C. Gey and
               Noriko Kando and
               Chin{-}Yew Lin and
               Carol Peters},
  title     = {New directions in multilingual information access},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {2},
  pages     = {31--39},
  year      = {2006},
  url       = {https://doi.org/10.1145/1189702.1189707},
  doi       = {10.1145/1189702.1189707},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GeyKLP06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jones06,
  author    = {Karen Sparck Jones},
  title     = {What's the value of {TREC:} is there a gap to jump or a chasm to bridge?},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {1},
  pages     = {10--20},
  year      = {2006},
  url       = {https://doi.org/10.1145/1147197.1147198},
  doi       = {10.1145/1147197.1147198},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Jones06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JonesP06,
  author    = {Christopher B. Jones and
               Ross Purves},
  title     = {GIR'05 2005 {ACM} workshop on geographical information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {1},
  pages     = {34--37},
  year      = {2006},
  url       = {https://doi.org/10.1145/1147197.1147202},
  doi       = {10.1145/1147197.1147202},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JonesP06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KraaijJ06,
  author    = {Wessel Kraaij and
               Franciska de Jong},
  title     = {The sixth Dutch-Belgian Information Retrieval workshop: {(DIR} 2006)},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {2},
  pages     = {70--72},
  year      = {2006},
  url       = {https://doi.org/10.1145/1189702.1189715},
  doi       = {10.1145/1189702.1189715},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KraaijJ06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LalmasK06,
  author    = {Mounia Lalmas and
               Gabriella Kazai},
  title     = {Report on the ad-hoc track of the {INEX} 2005 workshop},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {1},
  pages     = {49--57},
  year      = {2006},
  url       = {https://doi.org/10.1145/1147197.1147207},
  doi       = {10.1145/1147197.1147207},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LalmasK06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/NottelmannACN06,
  author    = {Henrik Nottelmann and
               Karl Aberer and
               Jamie Callan and
               Wolfgang Nejdl},
  title     = {The {CIKM} 2005 workshop on information retrieval in peer-to-peer
               networks},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {1},
  pages     = {38--40},
  year      = {2006},
  url       = {https://doi.org/10.1145/1147197.1147203},
  doi       = {10.1145/1147197.1147203},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/NottelmannACN06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PurvesJ06,
  author    = {Ross Purves and
               Christopher B. Jones},
  title     = {Workshop on geographic information retrieval held at SIGIR'06},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {2},
  pages     = {40--41},
  year      = {2006},
  url       = {https://doi.org/10.1145/1189702.1189708},
  doi       = {10.1145/1189702.1189708},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/PurvesJ06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Siddiqui06,
  author    = {Tanveer J. Siddiqui},
  title     = {Intelligent techniques for effective information retrieval: (a conceptual
               graph based approach)},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {2},
  pages     = {73--74},
  year      = {2006},
  url       = {https://doi.org/10.1145/1189702.1189717},
  doi       = {10.1145/1189702.1189717},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Siddiqui06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TrotmanG06,
  author    = {Andrew Trotman and
               Shlomo Geva},
  title     = {Report on the {SIGIR} 2006 workshop on {XML} element retrieval methodology},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {2},
  pages     = {42--48},
  year      = {2006},
  url       = {https://doi.org/10.1145/1189702.1189709},
  doi       = {10.1145/1189702.1189709},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/TrotmanG06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/UzunerAK06,
  author    = {{\"{O}}zlem Uzuner and
               Shlomo Argamon and
               Jussi Karlgren},
  title     = {Stylistics for text retrieval in practice: {SIGIR} 2006 workshop,
               Seattle, August 10, 2006},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {2},
  pages     = {49--51},
  year      = {2006},
  url       = {https://doi.org/10.1145/1189702.1189710},
  doi       = {10.1145/1189702.1189710},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/UzunerAK06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Voorhees06,
  author    = {Ellen M. Voorhees},
  title     = {The {TREC} 2005 robust track},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {1},
  pages     = {41--48},
  year      = {2006},
  url       = {https://doi.org/10.1145/1147197.1147205},
  doi       = {10.1145/1147197.1147205},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Voorhees06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WhiteMM06,
  author    = {Ryen W. White and
               Gheorghe Muresan and
               Gary Marchionini},
  title     = {Report on {ACM} {SIGIR} 2006 workshop on evaluating exploratory search
               systems},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {2},
  pages     = {52--60},
  year      = {2006},
  url       = {https://doi.org/10.1145/1189702.1189711},
  doi       = {10.1145/1189702.1189711},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/WhiteMM06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/YeeBB06,
  author    = {Wai Gen Yee and
               Michel Beigbeder and
               Wray L. Buntine},
  title     = {{SIGIR06} workshop report: Open Source Information Retrieval systems
               {(OSIR06)}},
  journal   = {{SIGIR} Forum},
  volume    = {40},
  number    = {2},
  pages     = {61--65},
  year      = {2006},
  url       = {https://doi.org/10.1145/1189702.1189712},
  doi       = {10.1145/1189702.1189712},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/YeeBB06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ArgamonKS05,
  author    = {Shlomo Argamon and
               Jussi Karlgren and
               James G. Shanahan},
  title     = {Future short term goals of research in computational analysis of stylistics
               in text},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {2},
  pages     = {17--18},
  year      = {2005},
  url       = {https://doi.org/10.1145/1113343.1113347},
  doi       = {10.1145/1113343.1113347},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ArgamonKS05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BaragliaLS05,
  author    = {Ranieri Baraglia and
               Domenico Laforenza and
               Fabrizio Silvestri},
  title     = {{SIGIR} workshop report: the {SIGIR} heterogeneous and distributed
               information retrieval workshop},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {2},
  pages     = {19--24},
  year      = {2005},
  url       = {https://doi.org/10.1145/1113343.1113348},
  doi       = {10.1145/1113343.1113348},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BaragliaLS05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Browne05,
  author    = {Paul Browne},
  title     = {Video information retrieval using objects and ostensive relevance
               feedback},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {54},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067286},
  doi       = {10.1145/1067268.1067286},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Browne05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Buntine05,
  author    = {Wray L. Buntine},
  title     = {Open source search: a data mining platform},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {4--10},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067270},
  doi       = {10.1145/1067268.1067270},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Buntine05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CarmelYS05,
  author    = {David Carmel and
               Elad Yom{-}Tov and
               Ian Soboroff},
  title     = {{SIGIR} workshop report: predicting query difficulty - methods and
               applications},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {2},
  pages     = {25--28},
  year      = {2005},
  url       = {https://doi.org/10.1145/1113343.1113349},
  doi       = {10.1145/1113343.1113349},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CarmelYS05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Castillo05,
  author    = {Carlos Castillo},
  title     = {Effective web crawling},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {55--56},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067287},
  doi       = {10.1145/1067268.1067287},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Castillo05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Chau05,
  author    = {Michael Chau},
  title     = {Searching and mining the web for personalized and specialized information},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {57},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067288},
  doi       = {10.1145/1067268.1067288},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Chau05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ChenS05,
  author    = {Shu{-}Ching Chen and
               Mei{-}Ling Shyu},
  title     = {The second {ACM} international workshop on multimedia databases {(MMDB}
               2004) held at {ACM} {CIKM} 2004},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {26--30},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067276},
  doi       = {10.1145/1067268.1067276},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ChenS05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ClarkeCS05,
  author    = {Charles L. A. Clarke and
               Nick Craswell and
               Ian Soboroff},
  title     = {The {TREC} terabyte retrieval track},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {25},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067274},
  doi       = {10.1145/1067268.1067274},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ClarkeCS05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Crouch05,
  author    = {Carolyn J. Crouch},
  title     = {Relevance feedback at the {INEX} 2004 workshop},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {41--42},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067282},
  doi       = {10.1145/1067268.1067282},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Crouch05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DominichON05,
  author    = {S{\'{a}}ndor Dominich and
               Iadh Ounis and
               Jian{-}Yun Nie},
  title     = {{ACM} {SIGIR} workshop on mathematical/formal methods in information
               retrieval {MF/IR} 2005},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {2},
  pages     = {29--30},
  year      = {2005},
  url       = {https://doi.org/10.1145/1113343.1113350},
  doi       = {10.1145/1113343.1113350},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DominichON05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Doraisamy05,
  author    = {Shyamala Doraisamy},
  title     = {Polyphonic music retrieval: the n-gram approach},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {58},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067289},
  doi       = {10.1145/1067268.1067289},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Doraisamy05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GevaS05,
  author    = {Shlomo Geva and
               Tony R. Sahama},
  title     = {The {NLP} task at {INEX} 2004},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {50--53},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067284},
  doi       = {10.1145/1067268.1067284},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GevaS05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Halttunen05,
  author    = {Kai Halttunen},
  title     = {Two information retrieval learning environments: their design and
               evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {59--60},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067290},
  doi       = {10.1145/1067268.1067290},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Halttunen05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hersh05,
  author    = {William R. Hersh},
  title     = {Report on the {TREC} 2004 genomics track},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {21--24},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067273},
  doi       = {10.1145/1067268.1067273},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Hersh05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/IngwersenJ05,
  author    = {Peter Ingwersen and
               Kalervo J{\"{a}}rvelin},
  title     = {Information retrieval in context: IRiX},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {2},
  pages     = {31--39},
  year      = {2005},
  url       = {https://doi.org/10.1145/1113343.1113351},
  doi       = {10.1145/1113343.1113351},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/IngwersenJ05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kraaij05,
  author    = {Wessel Kraaij},
  title     = {Variations on language modeling for information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {61},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067291},
  doi       = {10.1145/1067268.1067291},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Kraaij05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LaenderL05,
  author    = {Alberto H. F. Laender and
               Dongwon Lee},
  title     = {Report on the 6th {ACM} international workshop on web information
               and data management {(WIDM} 2004) held at {CIKM} 2004},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {31--33},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067277},
  doi       = {10.1145/1067268.1067277},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LaenderL05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LosadaF05,
  author    = {David E. Losada and
               Juan M. Fern{\'{a}}ndez{-}Luna},
  title     = {Report on the 27th European conference on information retrieval research
               {(ECIR} 2005)},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {37--40},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067280},
  doi       = {10.1145/1067268.1067280},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LosadaF05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ManmathaRH05,
  author    = {Raghavan Manmatha and
               Stefan M. R{\"{u}}ger and
               Alexander G. Hauptmann},
  title     = {Multimedia information retrieval: workshop report},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {2},
  pages     = {40--41},
  year      = {2005},
  url       = {https://doi.org/10.1145/1113343.1113352},
  doi       = {10.1145/1113343.1113352},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ManmathaRH05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Martinet05,
  author    = {Jean Martinet},
  title     = {A relational vector-space model of information retrieval adapted to
               images},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {62},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067292},
  doi       = {10.1145/1067268.1067292},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Martinet05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MoffatZ05,
  author    = {Alistair Moffat and
               Justin Zobel},
  title     = {Recommended reading for {IR} research students},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {2},
  pages     = {3--14},
  year      = {2005},
  url       = {https://doi.org/10.1145/1113343.1113344},
  doi       = {10.1145/1113343.1113344},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/MoffatZ05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Oard05,
  author    = {Douglas W. Oard},
  title     = {The {SIGIR} 2005 workshop program},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {2},
  pages     = {15--16},
  year      = {2005},
  url       = {https://doi.org/10.1145/1113343.1113346},
  doi       = {10.1145/1113343.1113346},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Oard05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Petratos05,
  author    = {Panagiotis Petratos},
  title     = {A heuristic information retrieval study: an investigation of methods
               for enhanced searching of distributed data objects exploiting bidirectional
               relevance feedback},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {2},
  pages     = {58},
  year      = {2005},
  url       = {https://doi.org/10.1145/1113343.1113359},
  doi       = {10.1145/1113343.1113359},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Petratos05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Schneider05,
  author    = {Jesper W. Schneider},
  title     = {Verification of bibliometric methods' applicability for thesaurus
               construction},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {63--64},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067293},
  doi       = {10.1145/1067268.1067293},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Schneider05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Seki05,
  author    = {Yohei Seki},
  title     = {Automatic summarization focusing on document genre and text structure},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {65--67},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067294},
  doi       = {10.1145/1067268.1067294},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Seki05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Stokoe05,
  author    = {Christopher Stokoe},
  title     = {Automated word sense disambiguation for web information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {68},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067295},
  doi       = {10.1145/1067268.1067295},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Stokoe05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TombrosML05,
  author    = {Anastasios Tombros and
               Saadia Malik and
               Birger Larsen},
  title     = {Report on the {INEX} 2004 interactive track},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {43--49},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067283},
  doi       = {10.1145/1067268.1067283},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/TombrosML05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TrotmanL05,
  author    = {Andrew Trotman and
               Mounia Lalmas},
  title     = {Report on the {INEX} 2005 workshop on element retrieval methodology},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {2},
  pages     = {46--51},
  year      = {2005},
  url       = {https://doi.org/10.1145/1113343.1113355},
  doi       = {10.1145/1113343.1113355},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/TrotmanL05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/VechtomovaJD05,
  author    = {Olga Vechtomova and
               Rosie Jones and
               Ga{\"{e}}l Dias},
  title     = {Report on the {ACM} International Workshop on Methodologies and Evaluation
               of Lexical Cohesion Techniques in Real-World Applications {(ELECTRA}
               2005) held at {SIGIR} 2005},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {2},
  pages     = {42--45},
  year      = {2005},
  url       = {https://doi.org/10.1145/1113343.1113353},
  doi       = {10.1145/1113343.1113353},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/VechtomovaJD05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Voorhees05,
  author    = {Ellen M. Voorhees},
  title     = {The {TREC} robust retrieval track},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {11--20},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067272},
  doi       = {10.1145/1067268.1067272},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Voorhees05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Westerveld05,
  author    = {Thijs Westerveld},
  title     = {Using generative probabilistic models for multimedia retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {69},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067296},
  doi       = {10.1145/1067268.1067296},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Westerveld05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WesterveldVJ05,
  author    = {Thijs Westerveld and
               Arjen P. de Vries and
               Franciska M. G. de Jong},
  title     = {Workshop on the evaluation of multimedia retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {34--36},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067279},
  doi       = {10.1145/1067268.1067279},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/WesterveldVJ05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/White05,
  author    = {Ryen W. White},
  title     = {Implicit feedback for interactive information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {70},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067297},
  doi       = {10.1145/1067268.1067297},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/White05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WhiteKB05,
  author    = {Ryen W. White and
               Bill Kules and
               Benjamin B. Bederson},
  title     = {Exploratory search interfaces: categorization, clustering and beyond:
               report on the {XSI} 2005 workshop at the Human-Computer Interaction
               Laboratory, University of Maryland},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {2},
  pages     = {52--56},
  year      = {2005},
  url       = {https://doi.org/10.1145/1113343.1113356},
  doi       = {10.1145/1113343.1113356},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/WhiteKB05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ye05,
  author    = {Jiamin Ye},
  title     = {Aggregated feature video retrieval for {MPEG-7} via clustering},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {1},
  pages     = {71},
  year      = {2005},
  url       = {https://doi.org/10.1145/1067268.1067298},
  doi       = {10.1145/1067268.1067298},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Ye05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zhang05,
  author    = {Yi Zhang},
  title     = {Bayesian graphical models for adaptive filtering},
  journal   = {{SIGIR} Forum},
  volume    = {39},
  number    = {2},
  pages     = {57},
  year      = {2005},
  url       = {https://doi.org/10.1145/1113343.1113358},
  doi       = {10.1145/1113343.1113358},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Zhang05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Baeza-YatesMRV04,
  author    = {Ricardo A. Baeza{-}Yates and
               Yo{\"{e}}lle S. Maarek and
               Thomas R{\"{o}}lleke and
               Arjen P. de Vries},
  title     = {Third edition of the "XML and information retrieval" workshop first
               workshop on integration of {IR} and {DB} {(WIRD)} jointly held at
               SIGIR'2004, Sheffield, UK, July 29\({}^{\mbox{th}}\), 2004},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {2},
  pages     = {24--30},
  year      = {2004},
  url       = {https://doi.org/10.1145/1041394.1041400},
  doi       = {10.1145/1041394.1041400},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Baeza-YatesMRV04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BrownHV04,
  author    = {Eric W. Brown and
               William R. Hersh and
               Alfonso Valencia},
  title     = {{SIGIR} 2003 workshop on text analysis and search for bioinformatics},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {2},
  pages     = {31--36},
  year      = {2004},
  url       = {https://doi.org/10.1145/1041394.1041401},
  doi       = {10.1145/1041394.1041401},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BrownHV04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CallanF04,
  author    = {Jamie Callan and
               Norbert Fuhr},
  title     = {The {SIGIR} peer-to-peer information retrieval workshop},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {2},
  pages     = {37--40},
  year      = {2004},
  url       = {https://doi.org/10.1145/1041394.1041402},
  doi       = {10.1145/1041394.1041402},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CallanF04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Can04,
  author    = {Fazli Can},
  title     = {Review of "Mining the Web: discovering knowledge from hypertext data"
               by Soumen Chakrabati. Morgan Kaufman 2003},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {73--74},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986294},
  doi       = {10.1145/986278.986294},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Can04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ChenS04,
  author    = {Shu{-}Ching Chen and
               Mei{-}Ling Shyu},
  title     = {Workshop report: the first {ACM} international workshop on multimedia
               databases {(MMDB} 2003) at {ACM} {CIKM} 2003},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {55--60},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986289},
  doi       = {10.1145/986278.986289},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ChenS04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ChiangLL04,
  author    = {Roger H. L. Chiang and
               Alberto H. F. Laender and
               Ee{-}Peng Lim},
  title     = {Report on the fifth {ACM} international workshop on Web information
               and data management {(WIDM} 2003)},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {65--68},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986291},
  doi       = {10.1145/986278.986291},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ChiangLL04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Diekema04,
  author    = {Anne Diekema},
  title     = {Translation events in cross-language information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {75},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986296},
  doi       = {10.1145/986278.986296},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Diekema04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/EguchiOIKK04,
  author    = {Koji Eguchi and
               Keizo Oyama and
               Emi Ishida and
               Noriko Kando and
               Kazuko Kuriyama},
  title     = {An evaluation of the Web retrieval task at the third {NTCIR} workshop},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {39--45},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986285},
  doi       = {10.1145/986278.986285},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/EguchiOIKK04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FuhrL04,
  author    = {Norbert Fuhr and
               Mounia Lalmas},
  title     = {Report on the {INEX} 2003 workshop},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {46--51},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986287},
  doi       = {10.1145/986278.986287},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/FuhrL04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FukumotoKM04,
  author    = {Jun{-}ichi Fukumoto and
               Tsuneaki Kato and
               Fumito Masui},
  title     = {An evaluation of question answering challenge {(QAC-1)} at the {NTCIR}
               workshop 3},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {25--28},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986283},
  doi       = {10.1145/986278.986283},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/FukumotoKM04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GaizauskasHG04,
  author    = {Robert J. Gaizauskas and
               Mark Hepple and
               Mark A. Greenwood},
  title     = {Information retrieval for question answering a {SIGIR} 2004 workshop},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {2},
  pages     = {41--44},
  year      = {2004},
  url       = {https://doi.org/10.1145/1041394.1041403},
  doi       = {10.1145/1041394.1041403},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GaizauskasHG04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HarmanB04,
  author    = {Donna Harman and
               Chris Buckley},
  title     = {{SIGIR} 2004 workshop: {RIA} and "where can {IR} go from here?"},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {2},
  pages     = {45--49},
  year      = {2004},
  url       = {https://doi.org/10.1145/1041394.1041404},
  doi       = {10.1145/1041394.1041404},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HarmanB04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hedlund04,
  author    = {Turid Hedlund},
  title     = {Dictionary-based cross-language information retrieval: principles,
               system design and evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {76},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986297},
  doi       = {10.1145/986278.986297},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Hedlund04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hersh04,
  author    = {William R. Hersh},
  title     = {Report on {TREC} 2003 genomics track first-year results and future
               plans},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {69--72},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986292},
  doi       = {10.1145/986278.986292},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Hersh04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/IngwersenB04,
  author    = {Peter Ingwersen and
               Nicholas J. Belkin},
  title     = {Information retrieval in context - IRiX: workshop at {SIGIR} 2004
               - Sheffield},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {2},
  pages     = {50--52},
  year      = {2004},
  url       = {https://doi.org/10.1145/1041394.1041405},
  doi       = {10.1145/1041394.1041405},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/IngwersenB04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/IwayamaFKT04,
  author    = {Makoto Iwayama and
               Atsushi Fujii and
               Noriko Kando and
               Akihiko Takano},
  title     = {Report on the patent retrieval task at {NTCIR} workshop 3},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {22--24},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986282},
  doi       = {10.1145/986278.986282},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/IwayamaFKT04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JohoS04,
  author    = {Hideo Joho and
               Mark Sanderson},
  title     = {The {SPIRIT} collection: an overview of a large web collection},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {2},
  pages     = {57--61},
  year      = {2004},
  url       = {https://doi.org/10.1145/1041394.1041395},
  doi       = {10.1145/1041394.1041395},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JohoS04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jones04,
  author    = {Karen Sparck Jones},
  title     = {What's new about the Semantic Web?: some questions},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {2},
  pages     = {18--23},
  year      = {2004},
  url       = {https://doi.org/10.1145/1041394.1041398},
  doi       = {10.1145/1041394.1041398},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Jones04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KandoA04,
  author    = {Noriko Kando and
               Jun Adachi},
  title     = {Report from the {NTCIR} workshop 3},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {10--16},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986280},
  doi       = {10.1145/986278.986280},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KandoA04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kelly04,
  author    = {Diane Kelly},
  title     = {Understanding implicit feedback and document preference: a naturalistic
               user study},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {77},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986298},
  doi       = {10.1145/986278.986298},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Kelly04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KishidaCLCKKME04,
  author    = {Kazuaki Kishida and
               Kuang{-}hua Chen and
               Sukhoon Lee and
               Hsin{-}Hsi Chen and
               Noriko Kando and
               Kazuko Kuriyama and
               Sung{-}Hyon Myaeng and
               Koji Eguchi},
  title     = {Cross-lingual information retrieval {(CLIR)} task at the {NTCIR} workshop
               3},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {17--20},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986281},
  doi       = {10.1145/986278.986281},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KishidaCLCKKME04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kruschwitz04,
  author    = {Udo Kruschwitz},
  title     = {Exploiting markup structure for intelligent search},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {2},
  pages     = {62},
  year      = {2004},
  url       = {https://doi.org/10.1145/1041394.1041408},
  doi       = {10.1145/1041394.1041408},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Kruschwitz04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Nanas04,
  author    = {Nikolaos Nanas},
  title     = {Towards Nootropia: a non-linear approach to adaptive document filtering},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {78},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986299},
  doi       = {10.1145/986278.986299},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Nanas04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/OHara04,
  author    = {Kieron O'Hara},
  title     = {Ontologies and technologies: knowledge representation or misrepresentation},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {2},
  pages     = {11--17},
  year      = {2004},
  url       = {https://doi.org/10.1145/1041394.1041397},
  doi       = {10.1145/1041394.1041397},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/OHara04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/OkumuraFNH04,
  author    = {Manabu Okumura and
               Takahiro Fukusima and
               Hidetsugu Nanba and
               Tsutomu Hirao},
  title     = {Text Summarization Challenge 2 text summarization evaluation at {NTCIR}
               workshop 3},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {29--38},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986284},
  doi       = {10.1145/986278.986284},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/OkumuraFNH04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Pomerantz04,
  author    = {Jeffrey Pomerantz},
  title     = {Question taxonomies for digital reference},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {79},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986300},
  doi       = {10.1145/986278.986300},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Pomerantz04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PurvesJ04,
  author    = {Ross Purves and
               Christopher B. Jones},
  title     = {Workshop on geographic information retrieval, {SIGIR} 2004},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {2},
  pages     = {53--56},
  year      = {2004},
  url       = {https://doi.org/10.1145/1041394.1041406},
  doi       = {10.1145/1041394.1041406},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/PurvesJ04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/RizziS04,
  author    = {Stefano Rizzi and
               Il{-}Yeol Song},
  title     = {Report on the {ACM} sixth international workshop on data warehousing
               and {OLAP} {(DOLAP} 2003)},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {61--64},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986290},
  doi       = {10.1145/986278.986290},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/RizziS04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Shiri04,
  author    = {Ali Asghar Shiri},
  title     = {End-user interaction with thesaurus-enhanced search interfaces: an
               evaluation of search term selection for query expansion},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {80},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986301},
  doi       = {10.1145/986278.986301},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Shiri04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Vries04,
  author    = {Arjen P. de Vries},
  title     = {The 4th Dutch-Belgium information retrieval workshop},
  journal   = {{SIGIR} Forum},
  volume    = {38},
  number    = {1},
  pages     = {52--54},
  year      = {2004},
  url       = {https://doi.org/10.1145/986278.986288},
  doi       = {10.1145/986278.986288},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Vries04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
  author    = {James Allan and
               Jay Aslam and
               Nicholas J. Belkin and
               Chris Buckley and
               James P. Callan and
               W. Bruce Croft and
               Susan T. Dumais and
               Norbert Fuhr and
               Donna Harman and
               David J. Harper and
               Djoerd Hiemstra and
               Thomas Hofmann and
               Eduard H. Hovy and
               Wessel Kraaij and
               John D. Lafferty and
               Victor Lavrenko and
               David D. Lewis and
               Liz Liddy and
               R. Manmatha and
               Andrew McCallum and
               Jay M. Ponte and
               John M. Prager and
               Dragomir R. Radev and
               Philip Resnik and
               Stephen E. Robertson and
               Ronald Rosenfeld and
               Salim Roukos and
               Mark Sanderson and
               Richard M. Schwartz and
               Amit Singhal and
               Alan F. Smeaton and
               Howard R. Turtle and
               Ellen M. Voorhees and
               Ralph M. Weischedel and
               Jinxi Xu and
               ChengXiang Zhai},
  title     = {Challenges in information retrieval and language modeling: report
               of a workshop held at the center for intelligent information retrieval,
               University of Massachusetts Amherst, September 2002},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {1},
  pages     = {31--47},
  year      = {2003},
  url       = {https://doi.org/10.1145/945546.945549},
  doi       = {10.1145/945546.945549},
  timestamp = {Fri, 30 Aug 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BauerL03,
  author    = {Travis Bauer and
               David B. Leake},
  title     = {Detecting context-differentiating terms using competitive learning},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {2},
  pages     = {4--17},
  year      = {2003},
  url       = {https://doi.org/10.1145/959258.959259},
  doi       = {10.1145/959258.959259},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BauerL03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CaidiK03,
  author    = {Nadia Caidi and
               Anita Komlodi},
  title     = {Digital libraries across cultures: design and usability issues outcomes
               of the "cross-cultural usability for digital libraries" workshop at
               {JCDL} '03},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {2},
  pages     = {62--64},
  year      = {2003},
  url       = {https://doi.org/10.1145/959258.959270},
  doi       = {10.1145/959258.959270},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CaidiK03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CallanCS03,
  author    = {Jamie Callan and
               Fabio Crestani and
               Mark Sanderson},
  title     = {{SIGIR} 2003 workshop on distributed information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {2},
  pages     = {33--37},
  year      = {2003},
  url       = {https://doi.org/10.1145/959258.959263},
  doi       = {10.1145/959258.959263},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CallanCS03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DingROJ03,
  author    = {Ying Ding and
               Cornelis Joost van Rijsbergen and
               Iadh Ounis and
               Joemon M. Jose},
  title     = {Report on {ACM} {SIGIR} workshop on "semantic web" {SWIR} 2003},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {2},
  pages     = {45--49},
  year      = {2003},
  url       = {https://doi.org/10.1145/959258.959265},
  doi       = {10.1145/959258.959265},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DingROJ03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Downie03,
  author    = {J. Stephen Downie},
  title     = {Report on the panels and workshops of the music information retrieval
               {(MIR)} and music digital library {(MDL)} evaluation frameworks project},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {2},
  pages     = {38--44},
  year      = {2003},
  url       = {https://doi.org/10.1145/959258.959264},
  doi       = {10.1145/959258.959264},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Downie03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DumaisJBW03,
  author    = {Susan T. Dumais and
               Thorsten Joachims and
               Krishna Bharat and
               Andreas S. Weigend},
  title     = {{SIGIR} 2003 workshop report: implicit measures of user interests
               and preferences},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {2},
  pages     = {50--54},
  year      = {2003},
  url       = {https://doi.org/10.1145/959258.959266},
  doi       = {10.1145/959258.959266},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DumaisJBW03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FallTBK03,
  author    = {Caspar J. Fall and
               A. T{\"{o}}rcsv{\'{a}}ri and
               K. Benzineb and
               G. Karetka},
  title     = {Automated categorization in the international patent classification},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {1},
  pages     = {10--25},
  year      = {2003},
  url       = {https://doi.org/10.1145/945546.945547},
  doi       = {10.1145/945546.945547},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/FallTBK03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FrakesF03,
  author    = {William B. Frakes and
               Christopher J. Fox},
  title     = {Strength and similarity of affix removal stemming algorithms},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {1},
  pages     = {26--30},
  year      = {2003},
  url       = {https://doi.org/10.1145/945546.945548},
  doi       = {10.1145/945546.945548},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/FrakesF03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jin03,
  author    = {Rong Jin},
  title     = {Statistical approaches toward automatic title generation},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {2},
  pages     = {79},
  year      = {2003},
  url       = {https://doi.org/10.1145/959258.959274},
  doi       = {10.1145/959258.959274},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Jin03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KellyT03,
  author    = {Diane Kelly and
               Jaime Teevan},
  title     = {Implicit feedback for inferring user preference: a bibliography},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {2},
  pages     = {18--28},
  year      = {2003},
  url       = {https://doi.org/10.1145/959258.959260},
  doi       = {10.1145/959258.959260},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KellyT03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MostafaB03,
  author    = {Javed Mostafa and
               Katy B{\"{o}}rner},
  title     = {Information visualization interfaces for retrieval and analysis {(IVIRA)}
               workshop summary},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {2},
  pages     = {59--61},
  year      = {2003},
  url       = {https://doi.org/10.1145/959258.959269},
  doi       = {10.1145/959258.959269},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/MostafaB03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sebastiani03,
  author    = {Fabrizio Sebastiani},
  title     = {Report on the 25th European conference on information retrieval research
               {(ECIR-03)}},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {2},
  pages     = {29--32},
  year      = {2003},
  url       = {https://doi.org/10.1145/959258.959261},
  doi       = {10.1145/959258.959261},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Sebastiani03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SmeatonKGMS03,
  author    = {Alan F. Smeaton and
               Gary Keogh and
               Cathal Gurrin and
               Kieran McDonald and
               Tom S{\o}dring},
  title     = {Analysis of papers from twenty-five years of {SIGIR} conferences:
               what have we been doing for the last quarter of a century?},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {1},
  pages     = {49--53},
  year      = {2003},
  url       = {https://doi.org/10.1145/945546.945550},
  doi       = {10.1145/945546.945550},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SmeatonKGMS03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SoboroffVC03,
  author    = {Ian Soboroff and
               Ellen M. Voorhees and
               Nick Craswell},
  title     = {Summary of the {SIGIR} 2003 workshop on defining evaluation methodologies
               for terabyte-scale test collections},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {2},
  pages     = {55--58},
  year      = {2003},
  url       = {https://doi.org/10.1145/959258.959267},
  doi       = {10.1145/959258.959267},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SoboroffVC03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Soergel03,
  author    = {Dagobert Soergel},
  title     = {Building a more meaningful Web: from traditional knowledge organization
               systems to new semantic tools},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {2},
  pages     = {65--72},
  year      = {2003},
  url       = {https://doi.org/10.1145/959258.959271},
  doi       = {10.1145/959258.959271},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Soergel03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WarnerN03,
  author    = {Simeon Warner and
               Michael L. Nelson},
  title     = {Report on the metadata harvesting workshop at {JCDL} 2003},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {2},
  pages     = {73--78},
  year      = {2003},
  url       = {https://doi.org/10.1145/959258.959272},
  doi       = {10.1145/959258.959272},
  timestamp = {Mon, 16 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/WarnerN03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Baeza-YatesFM02,
  author    = {Ricardo A. Baeza{-}Yates and
               Norbert Fuhr and
               Yo{\"{e}}lle S. Maarek},
  title     = {Second edition of the "XML and information retrieval" workshop held
               at SIGIR'2002, Tampere, Finland, Aug 15\({}^{\mbox{th}}\), 2002},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {53--57},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792560},
  doi       = {10.1145/792550.792560},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Baeza-YatesFM02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BlandfordB02,
  author    = {Ann Blandford and
               George Buchanan},
  title     = {Workshop report: usability of digital libraries @ JCDL'02},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {83--89},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792566},
  doi       = {10.1145/792550.792566},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/BlandfordB02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BornerC02,
  author    = {Katy B{\"{o}}rner and
               Chaomei Chen},
  title     = {Workshop report: visual interfaces to digital libraries at {JCDL}
               '02},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {90--92},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792567},
  doi       = {10.1145/792550.792567},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BornerC02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Broder02,
  author    = {Andrei Z. Broder},
  title     = {A taxonomy of web search},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {3--10},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792552},
  doi       = {10.1145/792550.792552},
  timestamp = {Wed, 28 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Broder02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CallanKG02,
  author    = {Jamie Callan and
               Paul B. Kantor and
               David A. Grossman},
  title     = {Information retrieval and {OCR:} from converting content to grasping
               meaning},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {58--61},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792561},
  doi       = {10.1145/792550.792561},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CallanKG02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CodenBS02,
  author    = {Anni Coden and
               Eric W. Brown and
               Savitha Srinivasan},
  title     = {{ACM} {SIGIR} 2001 workshop "Information Retrieval Techniques for
               Speech Applications"},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {1},
  pages     = {10--13},
  year      = {2002},
  url       = {https://doi.org/10.1145/584449.584454},
  doi       = {10.1145/584449.584454},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CodenBS02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CrestaniGR02,
  author    = {Fabio Crestani and
               Mark A. Girolami and
               C. J. van Rijsbergen},
  title     = {Report on the 24th European colloquium on information retrieval research
               {(ECIR} 2002)},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {1},
  pages     = {6--9},
  year      = {2002},
  url       = {https://doi.org/10.1145/584449.584453},
  doi       = {10.1145/584449.584453},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CrestaniGR02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DominichLR02,
  author    = {S{\'{a}}ndor Dominich and
               Mounia Lalmas and
               C. J. van Rijsbergen},
  title     = {Report on {ACM} sigir workshop on mathematical/formal methods in information
               retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {1},
  pages     = {18--19},
  year      = {2002},
  url       = {https://doi.org/10.1145/584449.584456},
  doi       = {10.1145/584449.584456},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DominichLR02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DominichLR02a,
  author    = {S{\'{a}}ndor Dominich and
               Mounia Lalmas and
               Keith van Rijsbergen},
  title     = {Report on {ACM} {SIGIR} workshop on mathematical/formal methods in
               information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {62--67},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792562},
  doi       = {10.1145/792550.792562},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DominichLR02a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Dumais02,
  author    = {Susan T. Dumais},
  title     = {Annual report for SIGIR, July 2001 - June 2002},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {1},
  pages     = {2--4},
  year      = {2002},
  url       = {https://doi.org/10.1145/584449.584451},
  doi       = {10.1145/584449.584451},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Dumais02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DumaisLS02,
  author    = {Susan T. Dumais and
               David D. Lewis and
               Fabrizio Sebastiani},
  title     = {Report on the workshop on Operational Text Classification Systems
               {(OTC-02)}},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {68--71},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792563},
  doi       = {10.1145/792550.792563},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DumaisLS02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GeyKP02,
  author    = {Fredric C. Gey and
               Noriko Kando and
               Carol Peters},
  title     = {Cross language information retrieval: a research roadmap},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {72--80},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792564},
  doi       = {10.1145/792550.792564},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GeyKP02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hammer02,
  author    = {Joachim Hammer},
  title     = {Report on the {ACM} fourth international workshop on data warehousing
               and {OLAP} {(DOLAP} 2001)},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {1},
  pages     = {14--17},
  year      = {2002},
  url       = {https://doi.org/10.1145/584449.584455},
  doi       = {10.1145/584449.584455},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Hammer02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HenzingerMS02,
  author    = {Monika Rauch Henzinger and
               Rajeev Motwani and
               Craig Silverstein},
  title     = {Challenges in web search engines},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {11--22},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792553},
  doi       = {10.1145/792550.792553},
  timestamp = {Thu, 02 Jan 2020 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HenzingerMS02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hersh02,
  author    = {William R. Hersh},
  title     = {{TREC} genomics pre-track workshop report},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {81--82},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792565},
  doi       = {10.1145/792550.792565},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Hersh02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hill02,
  author    = {Linda L. Hill},
  title     = {Workshop report: Digital gazetteers: integration into distributed
               digital library services},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {93--97},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792568},
  doi       = {10.1145/792550.792568},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Hill02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Litman02,
  author    = {Jessica Litman},
  title     = {Digital copyright and the progress of science},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {44--52},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792558},
  doi       = {10.1145/792550.792558},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Litman02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Mostafa02,
  author    = {Javed Mostafa},
  title     = {Summary of workshop on document search interface design at the JCDL'02},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {98--99},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792569},
  doi       = {10.1145/792550.792569},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Mostafa02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Munson02,
  author    = {Ethan V. Munson},
  title     = {Symposium on document engineering},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {1},
  pages     = {20--22},
  year      = {2002},
  url       = {https://doi.org/10.1145/584449.584457},
  doi       = {10.1145/584449.584457},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Munson02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SmeatonKGMS02,
  author    = {Alan F. Smeaton and
               Gary Keogh and
               Cathal Gurrin and
               Kieran McDonald and
               Tom S{\o}dring},
  title     = {Analysis of papers from twenty-five years of {SIGIR} conferences:
               what have we been doing for the last quarter of a century?},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {39--43},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792556},
  doi       = {10.1145/792550.792556},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SmeatonKGMS02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Soboroff02,
  author    = {Ian Soboroff},
  title     = {Do {TREC} web collections look like the web?},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {23--31},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792554},
  doi       = {10.1145/792550.792554},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Soboroff02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SpinkOOJ02,
  author    = {Amanda Spink and
               Seda {\"{O}}zmutlu and
               Huseyin Cenk {\"{O}}zmutlu and
               Bernard J. Jansen},
  title     = {{U.S.} versus European web searching trends},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {32--38},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792555},
  doi       = {10.1145/792550.792555},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SpinkOOJ02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zhai02,
  author    = {ChengXiang Zhai},
  title     = {Risk minimization and language modeling in text retrieval dissertation
               abstract},
  journal   = {{SIGIR} Forum},
  volume    = {36},
  number    = {2},
  pages     = {100--101},
  year      = {2002},
  url       = {https://doi.org/10.1145/792550.792571},
  doi       = {10.1145/792550.792571},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Zhai02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BergmarkPZ01,
  author    = {Donna Bergmark and
               Paradee Phempoonpanich and
               Shumin Zhao},
  title     = {Scraping the {ACM} Digital Library},
  journal   = {{SIGIR} Forum},
  volume    = {35},
  number    = {2},
  pages     = {1--7},
  year      = {2001},
  url       = {https://doi.org/10.1145/511144.511146},
  doi       = {10.1145/511144.511146},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BergmarkPZ01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BornerC01,
  author    = {Katy B{\"{o}}rner and
               Chaomei Chen},
  title     = {Visual interfaces to digital libraries: the first international workshop
               at the first {ACM+IEEE} joint conference on digital libraries},
  journal   = {{SIGIR} Forum},
  volume    = {35},
  number    = {1},
  pages     = {12--15},
  year      = {2001},
  url       = {https://doi.org/10.1145/948716.948722},
  doi       = {10.1145/948716.948722},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BornerC01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ChenC01,
  author    = {Kuang{-}hua Chen and
               Hsin{-}Hsi Chen},
  title     = {Cross-Language Chinese Text Retrieval in {NTCIR} Workshop: towards
               Cross-Language multilingual Text Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {35},
  number    = {2},
  pages     = {12--19},
  year      = {2001},
  url       = {https://doi.org/10.1145/511144.511149},
  doi       = {10.1145/511144.511149},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ChenC01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CroftCL01,
  author    = {W. Bruce Croft and
               James P. Callan and
               John D. Lafferty},
  title     = {Workshop on language modeling and information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {35},
  number    = {1},
  pages     = {4--6},
  year      = {2001},
  url       = {https://doi.org/10.1145/948716.948719},
  doi       = {10.1145/948716.948719},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CroftCL01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kluev01,
  author    = {Vitaliy Kluev},
  title     = {Compiling Document Collections from the Internet},
  journal   = {{SIGIR} Forum},
  volume    = {34},
  number    = {2},
  pages     = {9--14},
  year      = {2001},
  url       = {https://doi.org/10.1145/381258.381264},
  doi       = {10.1145/381258.381264},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Kluev01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LewisS01,
  author    = {David D. Lewis and
               Fabrizio Sebastiani},
  title     = {Report on the Workshop on Operational Text Classification systems
               {(OTC-01)}},
  journal   = {{SIGIR} Forum},
  volume    = {35},
  number    = {2},
  pages     = {8--11},
  year      = {2001},
  url       = {https://doi.org/10.1145/511144.511148},
  doi       = {10.1145/511144.511148},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LewisS01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LimH01,
  author    = {Ee{-}Peng Lim and
               Roger Chiang Hsiang{-}Li},
  title     = {Report on the third International Workshop on Web Information and
               Data Management (WIDM'2001)},
  journal   = {{SIGIR} Forum},
  volume    = {35},
  number    = {2},
  pages     = {20--21},
  year      = {2001},
  url       = {https://doi.org/10.1145/511144.511150},
  doi       = {10.1145/511144.511150},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LimH01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Oard01,
  author    = {Douglas W. Oard},
  title     = {Interactive cross-language information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {35},
  number    = {1},
  pages     = {1--3},
  year      = {2001},
  url       = {https://doi.org/10.1145/948716.948718},
  doi       = {10.1145/948716.948718},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Oard01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SmeatonC01,
  author    = {Alan F. Smeaton and
               James P. Callan},
  title     = {Joint {DELOS-NSF} workshop on personalisation and recommender systems
               in digital libraries},
  journal   = {{SIGIR} Forum},
  volume    = {35},
  number    = {1},
  pages     = {7--11},
  year      = {2001},
  url       = {https://doi.org/10.1145/948716.948720},
  doi       = {10.1145/948716.948720},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SmeatonC01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Voorhees01,
  author    = {Ellen M. Voorhees},
  title     = {Report on {TREC-9}},
  journal   = {{SIGIR} Forum},
  volume    = {34},
  number    = {2},
  pages     = {1--8},
  year      = {2001},
  url       = {https://doi.org/10.1145/381258.381260},
  doi       = {10.1145/381258.381260},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Voorhees01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Wacholder01,
  author    = {Nina Wacholder},
  title     = {The technology of phrase browsing applications: workshop held in conjunction
               with the first {ACM-IEEE} joint conference on digital libraries},
  journal   = {{SIGIR} Forum},
  volume    = {35},
  number    = {1},
  pages     = {16--20},
  year      = {2001},
  url       = {https://doi.org/10.1145/948716.948723},
  doi       = {10.1145/948716.948723},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Wacholder01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Callan00,
  author    = {James P. Callan},
  title     = {{SIGIR} Announces Member Plus Program},
  journal   = {{SIGIR} Forum},
  volume    = {34},
  number    = {1},
  pages     = {15},
  year      = {2000},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Callan00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CarmelMS00,
  author    = {David Carmel and
               Yo{\"{e}}lle S. Maarek and
               Aya Soffer},
  title     = {{XML} and Information Retrieval: a {SIGIR} 2000 Workshop},
  journal   = {{SIGIR} Forum},
  volume    = {34},
  number    = {1},
  pages     = {31--36},
  year      = {2000},
  url       = {https://doi.org/10.1145/373593.373624},
  doi       = {10.1145/373593.373624},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/CarmelMS00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DominichLR00,
  author    = {S{\'{a}}ndor Dominich and
               Mounia Lalmas and
               C. J. van Rijsbergen},
  title     = {{ACM} {SIGIR} 2000 Workshop on Mathematical/Formal Methods in Information
               Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {34},
  number    = {1},
  pages     = {18--23},
  year      = {2000},
  url       = {https://doi.org/10.1145/373593.373617},
  doi       = {10.1145/373593.373617},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DominichLR00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Dumais00,
  author    = {Susan T. Dumais},
  title     = {Annual Report for SIGIR, July 1999 - June 2000},
  journal   = {{SIGIR} Forum},
  volume    = {34},
  number    = {1},
  pages     = {11--14},
  year      = {2000},
  url       = {https://doi.org/10.1145/373593.373613},
  doi       = {10.1145/373593.373613},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Dumais00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HershO00,
  author    = {William R. Hersh and
               Paul Over},
  title     = {{SIGIR} Workshop on Interactive Retrieval at {TREC} and Beyond},
  journal   = {{SIGIR} Forum},
  volume    = {34},
  number    = {1},
  pages     = {24--27},
  year      = {2000},
  url       = {https://doi.org/10.1145/373593.373619},
  doi       = {10.1145/373593.373619},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HershO00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KandoL00,
  author    = {Noriko Kando and
               Mun{-}Kew Leong},
  title     = {Workshop on Patent Retrieval {(SIGIR} 2000 Workshop Report)},
  journal   = {{SIGIR} Forum},
  volume    = {34},
  number    = {1},
  pages     = {28--30},
  year      = {2000},
  url       = {https://doi.org/10.1145/373593.373621},
  doi       = {10.1145/373593.373621},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KandoL00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PorterB00,
  author    = {Martin Porter and
               Richard Boulton},
  title     = {Object Muscat, an Open search engine},
  journal   = {{SIGIR} Forum},
  volume    = {34},
  number    = {1},
  pages     = {16--17},
  year      = {2000},
  url       = {https://doi.org/10.1145/373593.373615},
  doi       = {10.1145/373593.373615},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/PorterB00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Robertson00,
  author    = {Stephen E. Robertson},
  title     = {Salton Award Lecture: On theoretical argument in information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {34},
  number    = {1},
  pages     = {1--10},
  year      = {2000},
  url       = {https://doi.org/10.1145/373593.373597},
  doi       = {10.1145/373593.373597},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Robertson00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiM99,
  author    = {Maristella Agosti and
               Massimo Melucci},
  title     = {Evaluation of Web Document Retrieval: {A} SIGIR'99 Workshop},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {1},
  pages     = {23--27},
  year      = {1999},
  url       = {https://doi.org/10.1145/331403.331409},
  doi       = {10.1145/331403.331409},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/AgostiM99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BelkinD99,
  author    = {Nicholas J. Belkin and
               Susan T. Dumais},
  title     = {Annual Report for SIGIR, July 1998 - June 1999},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {2},
  pages     = {1--3},
  year      = {1999},
  url       = {https://doi.org/10.1145/344250.606664},
  doi       = {10.1145/344250.606664},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BelkinD99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Golovchinsky99,
  author    = {Gene Golovchinsky},
  title     = {Reaction to {SIGIR} 99 Panel on User Interface Issues},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {1},
  pages     = {18--19},
  year      = {1999},
  url       = {https://doi.org/10.1145/331403.331407},
  doi       = {10.1145/331403.331407},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Golovchinsky99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harper99,
  author    = {David J. Harper},
  title     = {Report on CIR99, the 2nd {UK} Conference on "The Challenge of Image
               Retrieval"},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {1},
  pages     = {20--22},
  year      = {1999},
  url       = {https://doi.org/10.1145/331403.331408},
  doi       = {10.1145/331403.331408},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Harper99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hawking99,
  author    = {David Hawking},
  title     = {Plans for the {TREC-9} Web Track},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {2},
  pages     = {17--18},
  year      = {1999},
  url       = {https://doi.org/10.1145/344250.344254},
  doi       = {10.1145/344250.344254},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Hawking99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HershO99,
  author    = {William R. Hersh and
               Paul Over},
  title     = {{TREC-8} Interactive Track},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {2},
  pages     = {8--11},
  year      = {1999},
  url       = {https://doi.org/10.1145/344250.344251},
  doi       = {10.1145/344250.344251},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HershO99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hill99,
  author    = {Linda L. Hill},
  title     = {Networked Knowledge Orginzation Systems {(NKOS)} Workshop},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {1},
  pages     = {32--33},
  year      = {1999},
  url       = {https://doi.org/10.1145/331403.331411},
  doi       = {10.1145/331403.331411},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Hill99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HullR99,
  author    = {David A. Hull and
               Stephen E. Robertson},
  title     = {The {TREC-9} Filtering Track},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {2},
  pages     = {16},
  year      = {1999},
  url       = {https://doi.org/10.1145/344250.344253},
  doi       = {10.1145/344250.344253},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HullR99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MilosavljevicPPW99,
  author    = {Maria Milosavljevic and
               Fran{\c{c}}ois Paradis and
               C{\'{e}}cile Paris and
               Ross Wilkinson},
  title     = {Customised Information Delivery: {A} {SIGIR} 99 Workshop},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {1},
  pages     = {28--31},
  year      = {1999},
  url       = {https://doi.org/10.1145/331403.331410},
  doi       = {10.1145/331403.331410},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/MilosavljevicPPW99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SakaiKOIKKTFMUSTTNAK99,
  author    = {Tetsuya Sakai and
               Tsuyoshi Kitani and
               Yasushi Ogawa and
               Tetsuya Ishikawa and
               Haruo Kimoto and
               Ikuo Keshi and
               Jun Toyoura and
               Toshikazu Fukushima and
               Kunio Matsui and
               Yoshihiro Ueda and
               Takenobu Tokunaga and
               Hiroshi Tsuruoka and
               Hidekazu Nakawatase and
               Teru Agata and
               Noriko Kando},
  title     = {{BMIR-J2:} {A} Test Collection for Evaluation of Japanese Information
               Retrieval Systems},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {1},
  pages     = {13--17},
  year      = {1999},
  url       = {https://doi.org/10.1145/331403.331406},
  doi       = {10.1145/331403.331406},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SakaiKOIKKTFMUSTTNAK99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SilversteinHMM99,
  author    = {Craig Silverstein and
               Monika Rauch Henzinger and
               Hannes Marais and
               Michael Moricz},
  title     = {Analysis of a Very Large Web Search Engine Query Log},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {1},
  pages     = {6--12},
  year      = {1999},
  url       = {https://doi.org/10.1145/331403.331405},
  doi       = {10.1145/331403.331405},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SilversteinHMM99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SoboroffNP99,
  author    = {Ian Soboroff and
               Charles K. Nicholas and
               Michael J. Pazzani},
  title     = {Workshop on Recommender Systems: Algorithms and Evaluation},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {1},
  pages     = {36--43},
  year      = {1999},
  url       = {https://doi.org/10.1145/331403.331413},
  doi       = {10.1145/331403.331413},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SoboroffNP99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SrihariZMR99,
  author    = {Rohini K. Srihari and
               Zhongfei Zhang and
               R. Manmatha and
               Chandu Ravela},
  title     = {Indexing and Retrieval, SIGIR'99 Workshop Summary},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {1},
  pages     = {34--35},
  year      = {1999},
  url       = {https://doi.org/10.1145/331403.331412},
  doi       = {10.1145/331403.331412},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SrihariZMR99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Varian99,
  author    = {Hal R. Varian},
  title     = {Economics and Search},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {1},
  pages     = {1--5},
  year      = {1999},
  url       = {https://doi.org/10.1145/331403.331404},
  doi       = {10.1145/331403.331404},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Varian99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/VoorheesH99,
  author    = {Ellen M. Voorhees and
               Donna Harman},
  title     = {The Text REtrieval Conference {(TREC):} History and Plans for {TREC-9}},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {2},
  pages     = {12--15},
  year      = {1999},
  url       = {https://doi.org/10.1145/344250.344252},
  doi       = {10.1145/344250.344252},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/VoorheesH99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X99a,
  title     = {Minutes of the 22nd {SIGIR} Business Meeting},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {2},
  pages     = {4--7},
  year      = {1999},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X99a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X99b,
  title     = {{SIGIR} Membership Directory 1999},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {2},
  pages     = {19--49},
  year      = {1999},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X99b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X99c,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {2},
  pages     = {50--53},
  year      = {1999},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X99c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X99e,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {1},
  pages     = {44--45},
  year      = {1999},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X99e.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin98,
  author    = {Nicholas J. Belkin},
  title     = {Chair's Message},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {2},
  pages     = {1--2},
  year      = {1998},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Belkin98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BrownS98,
  author    = {Eric W. Brown and
               Alan F. Smeaton},
  title     = {Hypertext Information Retrieval for the Web},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {2},
  pages     = {8--13},
  year      = {1998},
  url       = {https://doi.org/10.1145/305110.305114},
  doi       = {10.1145/305110.305114},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BrownS98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ClarkeCP98,
  author    = {Charles L. A. Clarke and
               Gordon V. Cormack and
               Christopher R. Palmer},
  title     = {An Overview of MultiText},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {2},
  pages     = {14--15},
  year      = {1998},
  url       = {https://doi.org/10.1145/305110.305117},
  doi       = {10.1145/305110.305117},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ClarkeCP98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hawking98,
  author    = {David Hawking},
  title     = {Efficiency/Effectiveness Trade-Offs in Query Processing},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {2},
  pages     = {16--22},
  year      = {1998},
  url       = {https://doi.org/10.1145/305110.305119},
  doi       = {10.1145/305110.305119},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Hawking98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JansenSBS98,
  author    = {Bernard J. Jansen and
               Amanda Spink and
               Judy Bateman and
               Tefko Saracevic},
  title     = {Real Life Information Retrieval: {A} Study of User Queries on the
               Web},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {1},
  pages     = {5--17},
  year      = {1998},
  url       = {https://doi.org/10.1145/281250.281253},
  doi       = {10.1145/281250.281253},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JansenSBS98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KandoKYO98,
  author    = {Noriko Kando and
               Kyo Kageura and
               Masaharu Yoshioka and
               Keizo Oyama},
  title     = {Phrase Processing Methods for Japanese Text Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {2},
  pages     = {23--28},
  year      = {1998},
  url       = {https://doi.org/10.1145/305110.305120},
  doi       = {10.1145/305110.305120},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KandoKYO98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kirsch98,
  author    = {Steve Kirsch},
  title     = {Infoseek's Experiences Searching the Internet},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {2},
  pages     = {3--7},
  year      = {1998},
  url       = {https://doi.org/10.1145/305110.305112},
  doi       = {10.1145/305110.305112},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Kirsch98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lesk98,
  author    = {Michael Lesk},
  title     = {Real World Searching Panel at {SIGIR} 97},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {1},
  pages     = {1--4},
  year      = {1998},
  url       = {https://doi.org/10.1145/281250.281252},
  doi       = {10.1145/281250.281252},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Lesk98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Schmidt-WescheG98,
  author    = {Birgit Schmidt{-}Wesche and
               Gene Golovchinsky},
  title     = {Query Input and User Expectations, Summary Report},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {2},
  pages     = {31--34},
  year      = {1998},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Schmidt-WescheG98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SrihariZMR98,
  author    = {Rohini K. Srihari and
               Zhongfei Zhang and
               R. Manmatha and
               Chandu Ravela},
  title     = {Multimedia Indexing and Retrieval, Summary Report},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {2},
  pages     = {29--30},
  year      = {1998},
  url       = {https://doi.org/10.1145/305110.305130},
  doi       = {10.1145/305110.305130},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SrihariZMR98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X98,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {1},
  year      = {1998},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X98a,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {1},
  pages     = {35--47},
  year      = {1998},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X98a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X98b,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {2},
  year      = {1998},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X98b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X98c,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {2},
  pages     = {35--37},
  year      = {1998},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X98c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZobelM98,
  author    = {Justin Zobel and
               Alistair Moffat},
  title     = {Exploring the Similarity Space},
  journal   = {{SIGIR} Forum},
  volume    = {32},
  number    = {1},
  pages     = {18--34},
  year      = {1998},
  url       = {https://doi.org/10.1145/281250.281256},
  doi       = {10.1145/281250.281256},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ZobelM98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin97,
  author    = {Nicholas J. Belkin},
  title     = {Remarks on the Presentation of the Gerard Salton Award for Excellence
               in Research in Information Retrieval to Tefko Saracevic, July 1997},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {2},
  pages     = {14--15},
  year      = {1997},
  url       = {https://doi.org/10.1145/270886.270888},
  doi       = {10.1145/270886.270888},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Belkin97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin97a,
  author    = {Nicholas J. Belkin},
  title     = {Chair's Message},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {2},
  pages     = {1},
  year      = {1997},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Belkin97a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Buckley97,
  author    = {Chris Buckley},
  title     = {The {SMART} Lab Report: The Modern {SMART} Years {(1980-1996)}},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {1},
  pages     = {17--22},
  year      = {1997},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Buckley97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FoxW97,
  author    = {Edward A. Fox and
               Harry Wu},
  title     = {The {SMART} Lab Report: The Transition Years {(1975-1982)}},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {1},
  pages     = {12--17},
  year      = {1997},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/FoxW97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Groman97,
  author    = {Robert C. Groman},
  title     = {Searching Multimedia Databases by Content (Book Review)},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {2},
  pages     = {34},
  year      = {1997},
  url       = {https://doi.org/10.1145/270886.606663},
  doi       = {10.1145/270886.606663},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Groman97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman97,
  author    = {Donna Harman},
  title     = {Dedication to Professor Gerard Salton},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {1},
  pages     = {1},
  year      = {1997},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Harman97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman97a,
  author    = {Donna Harman},
  title     = {The {SMART} Lab Report: The Early Cornell Years {(1965-1970)}},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {1},
  pages     = {6--12},
  year      = {1997},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Harman97a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hetzler97,
  author    = {Elizabeth G. Hetzler},
  title     = {Beyond Word Relations - {SIGIR} '97 Workshop},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {2},
  pages     = {28--33},
  year      = {1997},
  url       = {https://doi.org/10.1145/270886.270890},
  doi       = {10.1145/270886.270890},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Hetzler97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lesk97,
  author    = {Michael Lesk},
  title     = {The {SMART} Lab Report: The Harvard Years {(1961-1968)}},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {1},
  pages     = {2--6},
  year      = {1997},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Lesk97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lewis97,
  author    = {David D. Lewis},
  title     = {Minutes of the 1997 {ACM} {SIGIR} Business Meeting},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {2},
  pages     = {2--6},
  year      = {1997},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Lewis97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton97,
  author    = {Gerard Salton},
  title     = {A Blueprint for Automatic Indexing},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {1},
  pages     = {23--36},
  year      = {1997},
  url       = {https://doi.org/10.1145/263868.263871},
  doi       = {10.1145/263868.263871},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton97a,
  author    = {Gerard Salton},
  title     = {Letter to Members of {ACM/SIGIR}},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {1},
  pages     = {37--38},
  year      = {1997},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton97a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton97b,
  author    = {Gerard Salton},
  title     = {Expert Systems and Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {1},
  pages     = {39--42},
  year      = {1997},
  url       = {https://doi.org/10.1145/263868.263873},
  doi       = {10.1145/263868.263873},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton97b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton97c,
  author    = {Gerard Salton},
  title     = {Publications},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {1},
  pages     = {43--56},
  year      = {1997},
  url       = {https://doi.org/10.1145/263868.263874},
  doi       = {10.1145/263868.263874},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton97c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Saracevic97,
  author    = {Tefko Saracevic},
  title     = {{USERS} {LOST:} Reflections on the Past, Future, and Limits of Information
               Science},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {2},
  pages     = {16--27},
  year      = {1997},
  url       = {https://doi.org/10.1145/270886.270889},
  doi       = {10.1145/270886.270889},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Saracevic97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Willett97,
  author    = {Peter Willett},
  title     = {Lab Report Special Section: Information Retrieval Research in the
               University of Sheffield},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {2},
  pages     = {7--13},
  year      = {1997},
  url       = {https://doi.org/10.1145/270886.270887},
  doi       = {10.1145/270886.270887},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Willett97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X97,
  title     = {{SIGIR} Membership Directory 1997},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {1},
  pages     = {57--88},
  year      = {1997},
  url       = {https://doi.org/10.1145/263868.263875},
  doi       = {10.1145/263868.263875},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/X97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X97a,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {2},
  year      = {1997},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X97a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X97b,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {2},
  pages     = {35--37},
  year      = {1997},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X97b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X97c,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {31},
  number    = {1},
  year      = {1997},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X97c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin96,
  author    = {Nicholas J. Belkin},
  title     = {Chair's Message},
  journal   = {{SIGIR} Forum},
  volume    = {30},
  number    = {1},
  pages     = {1--2},
  year      = {1996},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Belkin96.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Davenport96,
  author    = {David Davenport},
  title     = {Information Retrieval: {A} Health Care Perspective (Book Review)},
  journal   = {{SIGIR} Forum},
  volume    = {30},
  number    = {2},
  pages     = {14--15},
  year      = {1996},
  url       = {https://doi.org/10.1145/254590.606643},
  doi       = {10.1145/254590.606643},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Davenport96.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox96,
  author    = {Edward A. Fox},
  title     = {Lab Report Special Section: Virginia Tech Department of Computer Science
               Information Access Laboratory},
  journal   = {{SIGIR} Forum},
  volume    = {30},
  number    = {1},
  pages     = {3--10},
  year      = {1996},
  url       = {https://doi.org/10.1145/381984.381985},
  doi       = {10.1145/381984.381985},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox96.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Groman96,
  author    = {Robert C. Groman},
  title     = {Elsevier Science's Home Page: Sign of the Times},
  journal   = {{SIGIR} Forum},
  volume    = {30},
  number    = {1},
  pages     = {42--43},
  year      = {1996},
  url       = {https://doi.org/10.1145/381984.381988},
  doi       = {10.1145/381984.381988},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Groman96.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman96,
  author    = {Donna Harman},
  title     = {Report on Building and Using Test Collections Panel, {SIGIR} 1996},
  journal   = {{SIGIR} Forum},
  volume    = {30},
  number    = {2},
  pages     = {5--10},
  year      = {1996},
  url       = {https://doi.org/10.1145/254590.254592},
  doi       = {10.1145/254590.254592},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Harman96.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HuibersLR96,
  author    = {Theo W. C. Huibers and
               Mounia Lalmas and
               C. J. van Rijsbergen},
  title     = {Information Retrieval and Situation Theory},
  journal   = {{SIGIR} Forum},
  volume    = {30},
  number    = {1},
  pages     = {11--25},
  year      = {1996},
  url       = {https://doi.org/10.1145/381984.381986},
  doi       = {10.1145/381984.381986},
  timestamp = {Tue, 10 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/HuibersLR96.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lewis96,
  author    = {David D. Lewis},
  title     = {Minutes of the 1996 {ACM} {SIGIR} Business Meeting},
  journal   = {{SIGIR} Forum},
  volume    = {30},
  number    = {2},
  pages     = {1--4},
  year      = {1996},
  url       = {https://doi.org/10.1145/254590.254591},
  doi       = {10.1145/254590.254591},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Lewis96.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SmeatonR96,
  author    = {Alan F. Smeaton and
               Edie M. Rasmussen},
  title     = {The EuroIEMasters Project: {A} European Masters Degree in Information
               Engineering},
  journal   = {{SIGIR} Forum},
  volume    = {30},
  number    = {2},
  pages     = {11--13},
  year      = {1996},
  url       = {https://doi.org/10.1145/254590.254593},
  doi       = {10.1145/254590.254593},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SmeatonR96.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WongKY96,
  author    = {Jacqueline W. T. Wong and
               Wing{-}Kay Kan and
               Gilbert H. Young},
  title     = {{ACTION:} Automatic Classification For Full-Text Documents},
  journal   = {{SIGIR} Forum},
  volume    = {30},
  number    = {1},
  pages     = {26--41},
  year      = {1996},
  url       = {https://doi.org/10.1145/381984.381987},
  doi       = {10.1145/381984.381987},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/WongKY96.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X96,
  title     = {News: {TIPSTER} Phase {III} Begins},
  journal   = {{SIGIR} Forum},
  volume    = {30},
  number    = {1},
  pages     = {44--45},
  year      = {1996},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X96.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X96a,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {30},
  number    = {1},
  year      = {1996},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X96a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X96b,
  title     = {Calendar of Events, Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {30},
  number    = {1},
  pages     = {46--49},
  year      = {1996},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X96b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X96c,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {30},
  number    = {2},
  year      = {1996},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X96c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X96d,
  title     = {Calendar of Events, Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {30},
  number    = {2},
  pages     = {16--15},
  year      = {1996},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X96d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin95,
  author    = {Nicholas J. Belkin},
  title     = {Chair's Message},
  journal   = {{SIGIR} Forum},
  volume    = {29},
  number    = {2},
  pages     = {1--2},
  year      = {1995},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Belkin95.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Croft95,
  author    = {W. Bruce Croft},
  title     = {Lab Report Special Section: The University of Massachusetts Center
               for Intelligent Information Retrival},
  journal   = {{SIGIR} Forum},
  volume    = {29},
  number    = {1},
  pages     = {1--7},
  year      = {1995},
  url       = {https://doi.org/10.1145/207556.207557},
  doi       = {10.1145/207556.207557},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Croft95.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Grandi95,
  author    = {Fabio Grandi},
  title     = {On the Signature Weight in "Multiple" m Signature Files},
  journal   = {{SIGIR} Forum},
  volume    = {29},
  number    = {1},
  pages     = {20--25},
  year      = {1995},
  url       = {https://doi.org/10.1145/207556.207560},
  doi       = {10.1145/207556.207560},
  timestamp = {Tue, 30 Jun 2020 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Grandi95.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman95,
  author    = {Donna Harman},
  title     = {Lab Report Special Section: Natural Language Processing and Information
               Retrieval Group Information Access and User Interfaces Division National
               Institute of Standards and Technology},
  journal   = {{SIGIR} Forum},
  volume    = {29},
  number    = {2},
  pages     = {6--12},
  year      = {1995},
  url       = {https://doi.org/10.1145/219587.219590},
  doi       = {10.1145/219587.219590},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Harman95.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Korfhage95,
  author    = {Robert Korfhage},
  title     = {Some Thoughts on Similarity Measures},
  journal   = {{SIGIR} Forum},
  volume    = {29},
  number    = {1},
  pages     = {8},
  year      = {1995},
  url       = {https://doi.org/10.1145/207556.207558},
  doi       = {10.1145/207556.207558},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Korfhage95.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lewis95,
  author    = {David D. Lewis},
  title     = {Minutes - 1995 {ACM} {SIGIR} Annual Meeting},
  journal   = {{SIGIR} Forum},
  volume    = {29},
  number    = {2},
  pages     = {3--5},
  year      = {1995},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Lewis95.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lewis95a,
  author    = {David D. Lewis},
  title     = {A Sequential Algorithm for Training Text Classifiers: Corrigendum
               and Additional Data},
  journal   = {{SIGIR} Forum},
  volume    = {29},
  number    = {2},
  pages     = {13--19},
  year      = {1995},
  url       = {https://doi.org/10.1145/219587.219592},
  doi       = {10.1145/219587.219592},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Lewis95a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PejtersenBGHSV95,
  author    = {Annelise Mark Pejtersen and
               Jacob Buur and
               T. Govindaraj and
               Micheline Hancock{-}Beaulieu and
               Diane H. Sonnenwald and
               Kim J. Vicente},
  title     = {Supporting Semantic Information Retrieval in Communication Networks
               by Multimedia Techniques},
  journal   = {{SIGIR} Forum},
  volume    = {29},
  number    = {1},
  pages     = {9--19},
  year      = {1995},
  url       = {https://doi.org/10.1145/207556.207559},
  doi       = {10.1145/207556.207559},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/PejtersenBGHSV95.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X95,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {29},
  number    = {1},
  year      = {1995},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X95.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X95a,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {29},
  number    = {1},
  pages     = {26--33},
  year      = {1995},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X95a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X95b,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {29},
  number    = {2},
  year      = {1995},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X95b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X95c,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {29},
  number    = {2},
  pages     = {35--49},
  year      = {1995},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X95c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZezulaCT95,
  author    = {Pavel Zezula and
               Paolo Ciaccia and
               Paolo Tiberio},
  title     = {Key-Based Partitioned Bit-Sliced Signature File},
  journal   = {{SIGIR} Forum},
  volume    = {29},
  number    = {2},
  pages     = {20--34},
  year      = {1995},
  url       = {https://doi.org/10.1145/219587.219593},
  doi       = {10.1145/219587.219593},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ZezulaCT95.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Donaldson94,
  author    = {Cameron Donaldson},
  title     = {InQuisiX\({}^{\mbox{TM}}\) An Electronic Catalog for Software Reuse},
  journal   = {{SIGIR} Forum},
  volume    = {28},
  number    = {1},
  pages     = {8--12},
  year      = {1994},
  url       = {https://doi.org/10.1145/181886.181887},
  doi       = {10.1145/181886.181887},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Donaldson94.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox94,
  author    = {Edward A. Fox},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {28},
  number    = {1},
  pages     = {1--2},
  year      = {1994},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox94.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox94a,
  author    = {Christopher J. Fox},
  title     = {Editor's Message},
  journal   = {{SIGIR} Forum},
  volume    = {28},
  number    = {1},
  pages     = {3},
  year      = {1994},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox94a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox94b,
  author    = {Edward A. Fox},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {28},
  number    = {2},
  pages     = {1--3},
  year      = {1994},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox94b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Gudivada94,
  author    = {Venkat N. Gudivada},
  title     = {{TESSA} - An Image Testbed for Evaluating 2-D Spatial Similarity Algorithms},
  journal   = {{SIGIR} Forum},
  volume    = {28},
  number    = {2},
  pages     = {17--36},
  year      = {1994},
  url       = {https://doi.org/10.1145/195498.195502},
  doi       = {10.1145/195498.195502},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Gudivada94.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Marcus94,
  author    = {Richard S. Marcus},
  title     = {The {RIAO} 94 Conference and the Status of Information Retrieval:
               {A} Personal View},
  journal   = {{SIGIR} Forum},
  volume    = {28},
  number    = {2},
  pages     = {7--16},
  year      = {1994},
  url       = {https://doi.org/10.1145/195498.195500},
  doi       = {10.1145/195498.195500},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Marcus94.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ParkASA94,
  author    = {Ki{-}Hong Park and
               Jun{-}ichi Aoe and
               Masami Shishibori and
               Hisatoshi Arita},
  title     = {An Automatic Selection Method of Key Search Algorithms Based on Expert
               Knowledge Bases},
  journal   = {{SIGIR} Forum},
  volume    = {28},
  number    = {1},
  pages     = {13--26},
  year      = {1994},
  url       = {https://doi.org/10.1145/181886.181888},
  doi       = {10.1145/181886.181888},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ParkASA94.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Stanfill94,
  author    = {Craig Stanfill},
  title     = {Minutes - 1993 {SIGIR} Annual Meeting},
  journal   = {{SIGIR} Forum},
  volume    = {28},
  number    = {1},
  pages     = {4--7},
  year      = {1994},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Stanfill94.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Taghva94,
  author    = {Kazem Taghva},
  title     = {Information Retrieval Education Survey},
  journal   = {{SIGIR} Forum},
  volume    = {28},
  number    = {2},
  pages     = {4--6},
  year      = {1994},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Taghva94.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X94,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {28},
  number    = {1},
  year      = {1994},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X94.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X94a,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {28},
  number    = {1},
  pages     = {27--45},
  year      = {1994},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X94a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X94b,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {28},
  number    = {2},
  year      = {1994},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X94b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X94c,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {28},
  number    = {2},
  pages     = {37--49},
  year      = {1994},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X94c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Can93,
  author    = {Fazli Can},
  title     = {Information Retrieval Data Structures {\&} Algorithms, by William
               B. Frakes and Ricardo Baeza-Yates (Book Review)},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {3},
  pages     = {24--25},
  year      = {1993},
  url       = {https://doi.org/10.1145/182119.1096164},
  doi       = {10.1145/182119.1096164},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Can93.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox93,
  author    = {Edward A. Fox},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {1},
  pages     = {1--2},
  year      = {1993},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox93.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox93a,
  author    = {Edward A. Fox},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {3},
  pages     = {1--3},
  year      = {1993},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox93a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman93,
  author    = {Donna Harman},
  title     = {Report on {TREC-2} (Text REtrieval Conference) 30 August - 2 September,
               Gaithersburg, {USA}},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {3},
  pages     = {14--18},
  year      = {1993},
  url       = {https://doi.org/10.1145/182119.182121},
  doi       = {10.1145/182119.182121},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Harman93.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman93a,
  author    = {Donna Harman},
  title     = {The Third Text REtrieval Conference {(TREC-3)} January 1994 - November
               1994},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {3},
  pages     = {19--23},
  year      = {1993},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Harman93a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey93,
  author    = {Susanne M. Humphrey},
  title     = {Selected IR-Releated Dissertation Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {1},
  pages     = {22--47},
  year      = {1993},
  url       = {https://doi.org/10.1145/174263.1096175},
  doi       = {10.1145/174263.1096175},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Humphrey93.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Koshman93,
  author    = {Sherry Koshman},
  title     = {{SIGIR} 1993 - Report},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {3},
  pages     = {5--11},
  year      = {1993},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Koshman93.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Mukhopadhyay93,
  author    = {Debajyoti Mukhopadhyay},
  title     = {A Generic Information Retrieval System to Support Interoperability},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {1},
  pages     = {14--21},
  year      = {1993},
  url       = {https://doi.org/10.1145/174263.174265},
  doi       = {10.1145/174263.174265},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Mukhopadhyay93.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Perlman93,
  author    = {Gary Perlman},
  title     = {The {HCI} Bibliography Project},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {3},
  pages     = {29--31},
  year      = {1993},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Perlman93.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TianTY93,
  author    = {Zhiyu Tian and
               Shibai Tong and
               Shiyuan Yang},
  title     = {A New Hashing Function: Statistical Bahaviour and Algorithm},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {1},
  pages     = {3--13},
  year      = {1993},
  url       = {https://doi.org/10.1145/174263.174264},
  doi       = {10.1145/174263.174264},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/TianTY93.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X93,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {3},
  pages     = {32--55},
  year      = {1993},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X93.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X93a,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {1},
  year      = {1993},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X93a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X93b,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {1},
  pages     = {48--60},
  year      = {1993},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X93b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X93c,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {3},
  year      = {1993},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X93c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X93d,
  title     = {Member Survey},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {3},
  pages     = {4},
  year      = {1993},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X93d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X93e,
  title     = {{SIGIR} 1994 - Call for Papers},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {3},
  pages     = {13},
  year      = {1993},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X93e.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X93f,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {27},
  number    = {3},
  pages     = {26--27},
  year      = {1993},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X93f.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Croft92,
  author    = {W. Bruce Croft},
  title     = {The University of Massachusetts {TIPSTER} Project},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {2},
  pages     = {29--33},
  year      = {1992},
  url       = {https://doi.org/10.1145/146565.146568},
  doi       = {10.1145/146565.146568},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Croft92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DuvalO92,
  author    = {Erik Duval and
               Henk J. Olivi{\'{e}}},
  title     = {Towards the Integration of a Query Mechanism and Navigation for Retrieval
               of Data on Multimedia Documents},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {2},
  pages     = {8--25},
  year      = {1992},
  url       = {https://doi.org/10.1145/146565.146566},
  doi       = {10.1145/146565.146566},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/DuvalO92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox92,
  author    = {Edward A. Fox},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {1},
  pages     = {1},
  year      = {1992},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox92a,
  author    = {Edward A. Fox},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {2},
  pages     = {2--3},
  year      = {1992},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox92a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frakes92,
  author    = {William B. Frakes},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {2},
  pages     = {1},
  year      = {1992},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Frakes92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GallantHCQCS92,
  author    = {Stephen I. Gallant and
               Robert Hecht{-}Nielsen and
               William R. Caid and
               Kent Pu Qing and
               Joel Carleton and
               David Sudbeck},
  title     = {HNC's MatchPlus System},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {2},
  pages     = {34--38},
  year      = {1992},
  url       = {https://doi.org/10.1145/146565.146569},
  doi       = {10.1145/146565.146569},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GallantHCQCS92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman92,
  author    = {Donna Harman},
  title     = {The {DARPA} {TIPSTER} Project},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {2},
  pages     = {26--28},
  year      = {1992},
  url       = {https://doi.org/10.1145/146565.146567},
  doi       = {10.1145/146565.146567},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Harman92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey92,
  author    = {Susanne M. Humphrey},
  title     = {Selected IR-Related Dissertation Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {1},
  pages     = {17--46},
  year      = {1992},
  url       = {https://doi.org/10.1145/134374.1096744},
  doi       = {10.1145/134374.1096744},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Humphrey92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiCG92,
  author    = {Tong Li and
               Victoria Chiu and
               Fredric C. Gey},
  title     = {X-Window Interface to SMART, an Advanced Text Retrieval System},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {1},
  pages     = {5--16},
  year      = {1992},
  url       = {https://doi.org/10.1145/134374.134375},
  doi       = {10.1145/134374.134375},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LiCG92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiddyM92,
  author    = {Elizabeth D. Liddy and
               Sung{-}Hyon Myaeng},
  title     = {{DR-LINK:} Document Retrieval Using Linguistic Knowledge},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {2},
  pages     = {39--43},
  year      = {1992},
  url       = {https://doi.org/10.1145/146565.146570},
  doi       = {10.1145/146565.146570},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/LiddyM92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Stanfill92,
  author    = {Craig Stanfill},
  title     = {{SIGIR} Annual Business Meeting Copenhagen, Denmark 23 June 1992},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {2},
  pages     = {4--7},
  year      = {1992},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Stanfill92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Weiner92,
  author    = {John Weiner},
  title     = {Letter to the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {1},
  pages     = {2--4},
  year      = {1992},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Weiner92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X92,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {1},
  year      = {1992},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X92a,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {1},
  pages     = {47--56},
  year      = {1992},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X92a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X92b,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {2},
  year      = {1992},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X92b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X92c,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {26},
  number    = {2},
  pages     = {44--63},
  year      = {1992},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X92c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Aoki91,
  author    = {Paul M. Aoki},
  title     = {Implementation of Extended Indexes in {POSTGRES}},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {1},
  pages     = {2--9},
  year      = {1991},
  url       = {https://doi.org/10.1145/122642.122643},
  doi       = {10.1145/122642.122643},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Aoki91.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BruzaW91,
  author    = {Peter Bruza and
               Theo P. van der Weide},
  title     = {The Modelling and Retrieval of Documents Using Index Expressions},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {2},
  pages     = {91--103},
  year      = {1991},
  url       = {https://doi.org/10.1145/122665.122668},
  doi       = {10.1145/122665.122668},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BruzaW91.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Can91,
  author    = {Fazli Can},
  title     = {Hypertext and Hypermedia by Jakob Nielsen (Book Review)},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {1},
  pages     = {24--25},
  year      = {1991},
  url       = {https://doi.org/10.1145/122642.1096778},
  doi       = {10.1145/122642.1096778},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Can91.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox91,
  author    = {Christopher J. Fox},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {1},
  pages     = {1},
  year      = {1991},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox91.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox91a,
  author    = {Edward A. Fox},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {2},
  pages     = {2--3},
  year      = {1991},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox91a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frakes91,
  author    = {William B. Frakes},
  title     = {ReNews - The Electronic Software Reuse Newsletter},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {1},
  pages     = {18--23},
  year      = {1991},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Frakes91.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frakes91a,
  author    = {William B. Frakes},
  title     = {Editor's Message},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {2},
  pages     = {1},
  year      = {1991},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Frakes91a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey91,
  author    = {Susanne M. Humphrey},
  title     = {Selected IR-Related Dissertation Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {1},
  pages     = {26--60},
  year      = {1991},
  url       = {https://doi.org/10.1145/122642.1096779},
  doi       = {10.1145/122642.1096779},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Humphrey91.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey91a,
  author    = {Susanne M. Humphrey},
  title     = {Selected IR-Related Dissertation Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {2},
  pages     = {106--136},
  year      = {1991},
  url       = {https://doi.org/10.1145/122665.1096777},
  doi       = {10.1145/122665.1096777},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Humphrey91a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HumphreyF91,
  author    = {Susanne M. Humphrey and
               William B. Frakes},
  title     = {Bibliography of Software Reuse: 1988-1991},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {2},
  pages     = {24--90},
  year      = {1991},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/HumphreyF91.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jones91,
  author    = {Karen Sparck Jones},
  title     = {Notes and References on Early Automatic Classification Work},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {1},
  pages     = {10--17},
  year      = {1991},
  url       = {https://doi.org/10.1145/122642.122644},
  doi       = {10.1145/122642.122644},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Jones91.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KorfhageY91,
  author    = {Robert Korfhage and
               Jing{-}Jye Yang},
  title     = {A Cautionary Tale},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {2},
  pages     = {104--105},
  year      = {1991},
  url       = {https://doi.org/10.1145/122665.122669},
  doi       = {10.1145/122665.122669},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KorfhageY91.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lesk91,
  author    = {Michael Lesk},
  title     = {{SIGIR} '91: The Move Things Change, the More They Stay The Same},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {2},
  pages     = {4--7},
  year      = {1991},
  url       = {https://doi.org/10.1145/122665.122666},
  doi       = {10.1145/122665.122666},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Lesk91.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Maarek91,
  author    = {Yo{\"{e}}lle S. Maarek},
  title     = {Software Library Construction from an {IR} Perspective},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {2},
  pages     = {8--18},
  year      = {1991},
  url       = {https://doi.org/10.1145/122665.122667},
  doi       = {10.1145/122665.122667},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Maarek91.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X91,
  title     = {AdaNET},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {2},
  pages     = {19--23},
  year      = {1991},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X91.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X91a,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {1},
  year      = {1991},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X91a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X91b,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {1},
  pages     = {61--80},
  year      = {1991},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X91b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X91c,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {2},
  year      = {1991},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X91c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X91d,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {25},
  number    = {2},
  pages     = {137--152},
  year      = {1991},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X91d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Aoe90,
  author    = {Jun{-}ichi Aoe},
  title     = {A Method for Building Knowledge Bases with Morphological Semantics},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {1-2},
  pages     = {11--18},
  year      = {1990},
  url       = {https://doi.org/10.1145/378881.378887},
  doi       = {10.1145/378881.378887},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Aoe90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Aoe90a,
  author    = {Jun{-}ichi Aoe},
  title     = {A Compendium of Key Search References},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {3},
  pages     = {26--42},
  year      = {1990},
  url       = {https://doi.org/10.1145/101306.101308},
  doi       = {10.1145/101306.101308},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Aoe90a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin90,
  author    = {Nicholas J. Belkin},
  title     = {{ACM} {SIGIR} Annual General Meeting, Brussels, 7 September 1990},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {3},
  pages     = {3--5},
  year      = {1990},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Belkin90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Bruza90,
  author    = {Peter Bruza},
  title     = {Language and Representation in Information Retrieval by D. C. Blair
               (Book Review)},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {3},
  pages     = {74--75},
  year      = {1990},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Bruza90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BruzaW90,
  author    = {Peter Bruza and
               Theo P. van der Weide},
  title     = {Assessing the Quality of Hypertext Views},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {3},
  pages     = {6--25},
  year      = {1990},
  url       = {https://doi.org/10.1145/101306.101307},
  doi       = {10.1145/101306.101307},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/BruzaW90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Can90,
  author    = {Fazli Can},
  title     = {An Introduction to Text Processing, Peter D. Smith (Book Review)},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {3},
  pages     = {72--73},
  year      = {1990},
  url       = {https://doi.org/10.1145/101306.1096780},
  doi       = {10.1145/101306.1096780},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Can90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Craft90,
  author    = {W. Bruce Croft},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {3},
  pages     = {2},
  year      = {1990},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Craft90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox90,
  author    = {Christopher J. Fox},
  title     = {A Stop List for General Text},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {1-2},
  pages     = {19--35},
  year      = {1990},
  url       = {https://doi.org/10.1145/378881.378888},
  doi       = {10.1145/378881.378888},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox90a,
  author    = {Christopher J. Fox},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {1-2},
  pages     = {1},
  year      = {1990},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox90a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frakes90,
  author    = {William B. Frakes},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {3},
  pages     = {1},
  year      = {1990},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Frakes90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FrakesP90,
  author    = {William B. Frakes and
               Thomas P. Pole},
  title     = {Proteus: {A} Software Reuse Library System that Supports Multiple
               Representation Methods},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {3},
  pages     = {43--55},
  year      = {1990},
  url       = {https://doi.org/10.1145/101306.101309},
  doi       = {10.1145/101306.101309},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/FrakesP90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey90,
  author    = {Susanne M. Humphrey},
  title     = {Selected IR-Related Dissertation Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {1-2},
  pages     = {40--83},
  year      = {1990},
  url       = {https://doi.org/10.1145/378881.378890},
  doi       = {10.1145/378881.378890},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Humphrey90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey90a,
  author    = {Susanne M. Humphrey},
  title     = {Selected IR-Related Dessertation Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {3},
  pages     = {85--111},
  year      = {1990},
  url       = {https://doi.org/10.1145/101306.1096783},
  doi       = {10.1145/101306.1096783},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Humphrey90a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Nielsen90,
  author    = {Jakob Nielsen},
  title     = {Three Medium-Sized Hypertexts on {CD-ROM}},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {1-2},
  pages     = {2--10},
  year      = {1990},
  url       = {https://doi.org/10.1145/378881.378885},
  doi       = {10.1145/378881.378885},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Nielsen90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Paice90,
  author    = {Chris D. Paice},
  title     = {Another Stemmer},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {3},
  pages     = {56--61},
  year      = {1990},
  url       = {https://doi.org/10.1145/101306.101310},
  doi       = {10.1145/101306.101310},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Paice90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton90,
  author    = {Gerard Salton},
  title     = {IR-Related Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {1-2},
  pages     = {36--39},
  year      = {1990},
  url       = {https://doi.org/10.1145/378881.378889},
  doi       = {10.1145/378881.378889},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton90a,
  author    = {Gerard Salton},
  title     = {Information Retrieval Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {3},
  pages     = {76--84},
  year      = {1990},
  url       = {https://doi.org/10.1145/101306.1096782},
  doi       = {10.1145/101306.1096782},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton90a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Savoy90,
  author    = {Jacques Savoy},
  title     = {Statistical Behavior of Fast Hashing of Variable-Length Text Strings},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {3},
  pages     = {62--71},
  year      = {1990},
  url       = {https://doi.org/10.1145/101306.101311},
  doi       = {10.1145/101306.101311},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Savoy90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X90,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {1-2},
  year      = {1990},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X90a,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {1-2},
  pages     = {84--114},
  year      = {1990},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X90a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X90b,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {3},
  year      = {1990},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X90b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X90c,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {24},
  number    = {3},
  pages     = {112--132},
  year      = {1990},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X90c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Aoe89,
  author    = {Jun{-}Ichi Aoe},
  title     = {Storing a Tree Structure by Using Decimal Notations},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  pages     = {8--21},
  year      = {1989},
  url       = {https://doi.org/10.1145/74697.74698},
  doi       = {10.1145/74697.74698},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Aoe89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Aoe89a,
  author    = {Jun{-}Ichi Aoe},
  title     = {An Efficient Implementation of String Pattern Matching Machines for
               a Finite Number of Keywords},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  pages     = {22--33},
  year      = {1989},
  url       = {https://doi.org/10.1145/74697.74699},
  doi       = {10.1145/74697.74699},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Aoe89a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Baeza-Yates89,
  author    = {Ricardo A. Baeza{-}Yates},
  title     = {Algorithms for String Searching: {A} Survey},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  pages     = {34--58},
  year      = {1989},
  url       = {https://doi.org/10.1145/74697.74700},
  doi       = {10.1145/74697.74700},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Baeza-Yates89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Baeza-YatesG89,
  author    = {Ricardo A. Baeza{-}Yates and
               Gaston H. Gonnet},
  title     = {A New Approach to Text Searching (correction)},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  pages     = {7},
  year      = {1989},
  url       = {https://doi.org/10.1145/75335.75352},
  doi       = {10.1145/75335.75352},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Baeza-YatesG89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin89,
  author    = {Nicholas J. Belkin},
  title     = {Minutes from {SIGIR} Meeting 1989},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  pages     = {3--6},
  year      = {1989},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Belkin89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ColinL89,
  author    = {Cathi Colin and
               Robert Levinson},
  title     = {Partial Order Maintenance},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  pages     = {59--88},
  year      = {1989},
  url       = {https://doi.org/10.1145/74697.74701},
  doi       = {10.1145/74697.74701},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/ColinL89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Croft89,
  author    = {W. Bruce Croft},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  pages     = {2},
  year      = {1989},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Croft89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frakes89,
  author    = {William B. Frakes},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  pages     = {1},
  year      = {1989},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Frakes89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GeyC89,
  author    = {Fredric C. Gey and
               Wingkei Chan},
  title     = {Comparing Vector Space Retrieval with the {RUBRIC} Expert System},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {1-2},
  pages     = {5--15},
  year      = {1989},
  url       = {https://doi.org/10.1145/1095483.1095484},
  doi       = {10.1145/1095483.1095484},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/GeyC89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HarmanC89,
  author    = {Donna Harman and
               Gerald Candela},
  title     = {A Very Fast Prototype Retrieval System Using Statistical Ranking},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  pages     = {100--110},
  year      = {1989},
  url       = {https://doi.org/10.1145/74697.74703},
  doi       = {10.1145/74697.74703},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HarmanC89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey89,
  author    = {Susanne M. Humphrey},
  title     = {Selected IR-Related Dessertation Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {1-2},
  pages     = {26--35},
  year      = {1989},
  url       = {https://doi.org/10.1145/1095483.1095486},
  doi       = {10.1145/1095483.1095486},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Humphrey89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey89a,
  author    = {Susanne M. Humphrey},
  title     = {Selected IR-Related Dissertation Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  pages     = {114--122},
  year      = {1989},
  url       = {https://doi.org/10.1145/74697.1096799},
  doi       = {10.1145/74697.1096799},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Humphrey89a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KuoC89,
  author    = {Shufen Kuo and
               George R. Cross},
  title     = {An Improved Algorithm to Find the Length of the Longest Common Subsequence
               of Two Strings},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  pages     = {89--99},
  year      = {1989},
  url       = {https://doi.org/10.1145/74697.74702},
  doi       = {10.1145/74697.74702},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KuoC89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Raghavan89,
  author    = {Vijay V. Raghavan},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {1-2},
  pages     = {1},
  year      = {1989},
  timestamp = {Mon, 26 Oct 2015 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Raghavan89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton89,
  author    = {Gerard Salton},
  title     = {Abstracts from Recent Issues of Journals in the Retrieval Area},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {1-2},
  pages     = {16--25},
  year      = {1989},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton89a,
  author    = {Gerard Salton},
  title     = {Abstracts Chosen from Recent Issues of Journals in the Retrieval Area},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  pages     = {123--138},
  year      = {1989},
  url       = {https://doi.org/10.1145/74697.1096800},
  doi       = {10.1145/74697.1096800},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton89a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Singer89,
  author    = {Robin Singer},
  title     = {Crafting Knowledge Based Systems, Expert Systems Made Realistic (book
               review)},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  pages     = {111--113},
  year      = {1989},
  url       = {https://doi.org/10.1145/74697.1096798},
  doi       = {10.1145/74697.1096798},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Singer89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WeyerO89,
  author    = {Stephen A. Weyer and
               Tim Oren},
  title     = {{IR} Activities at Apple Computer Inc., ... Institutional Sponsor
               Report},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {1-2},
  pages     = {4},
  year      = {1989},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/WeyerO89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X89,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {1-2},
  year      = {1989},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X89.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X89a,
  title     = {Institutional Sponsorship Program},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {1-2},
  pages     = {2--3},
  year      = {1989},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X89a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X89b,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {1-2},
  pages     = {36--48},
  year      = {1989},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X89b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X89c,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  year      = {1989},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X89c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X89d,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {23},
  number    = {3-4},
  pages     = {139--157},
  year      = {1989},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X89d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Croft88,
  author    = {W. Bruce Croft},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {1-2},
  pages     = {1},
  year      = {1988},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Croft88.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox88,
  author    = {Edward A. Fox},
  title     = {New from the Vice Chairman},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {1-2},
  pages     = {2},
  year      = {1988},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox88.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox88a,
  author    = {Edward A. Fox},
  title     = {{SIGIR} Session at {ASIS} 50th Anniversary Conference / Microsoft's
               Third Int. {CDROM} Conference},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {1-2},
  pages     = {27--28},
  year      = {1988},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox88a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frakes88,
  author    = {William B. Frakes},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {3-4},
  pages     = {1},
  year      = {1988},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Frakes88.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hanson88,
  author    = {Robin Hanson},
  title     = {Toward Hypertext Publishing: Issues and Choices in Database Design},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {1-2},
  pages     = {9--26},
  year      = {1988},
  url       = {https://doi.org/10.1145/43936.43938},
  doi       = {10.1145/43936.43938},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Hanson88.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HarmanBFHG88,
  author    = {Donna Harman and
               Dennis Benson and
               Larry Fitzpatrick and
               Rand Huntzinger and
               Charles Goldstein},
  title     = {{IRX:} An Information Retrieval System for Experimentation and User
               Applications},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {3-4},
  pages     = {2--10},
  year      = {1988},
  url       = {https://doi.org/10.1145/54347.54348},
  doi       = {10.1145/54347.54348},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HarmanBFHG88.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey88,
  author    = {Susanne M. Humphrey},
  title     = {Selected IR-Related Dissertation Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {1-2},
  pages     = {38--51},
  year      = {1988},
  url       = {https://doi.org/10.1145/43936.1096827},
  doi       = {10.1145/43936.1096827},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Humphrey88.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey88a,
  author    = {Susanne M. Humphrey},
  title     = {Disertation Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {3-4},
  pages     = {29--51},
  year      = {1988},
  url       = {https://doi.org/10.1145/54347.1096814},
  doi       = {10.1145/54347.1096814},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Humphrey88a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/McGuiness88,
  author    = {Deborah L. McGuinness},
  title     = {Remarks on the 11th International Conference on Research and Development
               in Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {3-4},
  pages     = {52--59},
  year      = {1988},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/McGuiness88.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Meadow88,
  author    = {Charles T. Meadow},
  title     = {Comment on Some Recent Comments on Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {1-2},
  pages     = {5--8},
  year      = {1988},
  url       = {https://doi.org/10.1145/43936.43937},
  doi       = {10.1145/43936.43937},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Meadow88.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton88,
  author    = {Gerard Salton},
  title     = {Abstracts Selected from Recent Issues of Journals in the Retrieval
               Area},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {1-2},
  pages     = {29--37},
  year      = {1988},
  url       = {https://doi.org/10.1145/43936.1096826},
  doi       = {10.1145/43936.1096826},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton88.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WoodS88,
  author    = {Murray Wood and
               Ian Sommerville},
  title     = {An Information Retrieval System for Software Components},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {3-4},
  pages     = {11--28},
  year      = {1988},
  url       = {https://doi.org/10.1145/54347.54349},
  doi       = {10.1145/54347.54349},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/WoodS88.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X88,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {1-2},
  year      = {1988},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X88.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X88a,
  title     = {Institutional Sponsorship Program},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {1-2},
  pages     = {3--4},
  year      = {1988},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X88a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X88b,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {1-2},
  pages     = {52--68},
  year      = {1988},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X88b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X88c,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {3-4},
  year      = {1988},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X88c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X88d,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {22},
  number    = {3-4},
  pages     = {60--68},
  year      = {1988},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X88d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Eastman87,
  author    = {Caroline M. Eastman},
  title     = {The First International Conference on Expert Database Systems: {A}
               Summary},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {1-2},
  pages     = {6--10},
  year      = {1987},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Eastman87.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox87,
  author    = {Edward A. Fox},
  title     = {Workshop on Distributed Expert-Based Information Systems: {A} Perspective},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {3-4},
  pages     = {18--20},
  year      = {1987},
  url       = {https://doi.org/10.1145/30075.30078},
  doi       = {10.1145/30075.30078},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox87.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox87a,
  author    = {Edward A. Fox},
  title     = {From the Editor / Growth of IRList Digest},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {1-2},
  pages     = {1},
  year      = {1987},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox87a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FrakesN87,
  author    = {William B. Frakes and
               Brian A. Nejmeh},
  title     = {Software Reuse Through Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {1-2},
  pages     = {30--36},
  year      = {1987},
  url       = {https://doi.org/10.1145/24634.24636},
  doi       = {10.1145/24634.24636},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/FrakesN87.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman87,
  author    = {Donna Harman},
  title     = {From the Treasurer},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {1-2},
  pages     = {2},
  year      = {1987},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Harman87.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey87,
  author    = {Susanne M. Humphrey},
  title     = {Selected IR-Related Dissertation Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {3-4},
  pages     = {38--45},
  year      = {1987},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Humphrey87.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Marcus87,
  author    = {Robert Marcus},
  title     = {Some Observations on Retrieval From a Large Technical Document Database},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {1-2},
  pages     = {37--38},
  year      = {1987},
  url       = {https://doi.org/10.1145/24634.24637},
  doi       = {10.1145/24634.24637},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Marcus87.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Rijsbergen87,
  author    = {C. J. van Rijsbergen},
  title     = {A New Theoretical Framework for Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {1-2},
  pages     = {23--29},
  year      = {1987},
  url       = {https://doi.org/10.1145/24634.24635},
  doi       = {10.1145/24634.24635},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Rijsbergen87.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton87,
  author    = {Gerard Salton},
  title     = {Abstracts of Articles in the Information Retrieval Area},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {1-2},
  pages     = {39--50},
  year      = {1987},
  url       = {https://doi.org/10.1145/24634.1096830},
  doi       = {10.1145/24634.1096830},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton87.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton87a,
  author    = {Gerard Salton},
  title     = {Expert Systems and Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {3-4},
  pages     = {3--9},
  year      = {1987},
  url       = {https://doi.org/10.1145/30075.30076},
  doi       = {10.1145/30075.30076},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton87a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton87b,
  author    = {Gerard Salton},
  title     = {Selected from Recent Issues of Journals},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {3-4},
  pages     = {22--37},
  year      = {1987},
  url       = {https://doi.org/10.1145/30075.1096829},
  doi       = {10.1145/30075.1096829},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton87b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Tague87,
  author    = {Jean Tague},
  title     = {Informativeness as an Ordinal Utility Function for Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {3-4},
  pages     = {10--17},
  year      = {1987},
  url       = {https://doi.org/10.1145/30075.30077},
  doi       = {10.1145/30075.30077},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Tague87.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Wyle87,
  author    = {Mitchell Wyle},
  title     = {Annotated Bibliography Relating to Automatic Indexing in Information
               Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {1-2},
  pages     = {51--60},
  year      = {1987},
  url       = {https://doi.org/10.1145/24634.1096831},
  doi       = {10.1145/24634.1096831},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Wyle87.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X87,
  title     = {Remarks on the {ACM} {SIGIR} Conference in Pisa, September 1986},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {1-2},
  pages     = {4--5},
  year      = {1987},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X87.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X87a,
  title     = {Fiscal Year 1986 Research Projects Funded by the Information Science
               Program},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {1-2},
  pages     = {11--22},
  year      = {1987},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X87a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X87b,
  title     = {Database System Concept by Henry F. Korth and Abraham Silberschatz},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {3-4},
  pages     = {21},
  year      = {1987},
  url       = {https://doi.org/10.1145/30075.1096828},
  doi       = {10.1145/30075.1096828},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/X87b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X87c,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {1-2},
  year      = {1987},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X87c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X87d,
  title     = {New Arrangement between {SIGIR} and IP{\&}M},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {1-2},
  pages     = {3},
  year      = {1987},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X87d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X87e,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {21},
  number    = {1-2},
  pages     = {61--65},
  year      = {1987},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X87e.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Dalphin86,
  author    = {John F. Dalphin},
  title     = {Recommendations for Visitors for the Computing Sciences Accreditation
               Commitee},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {8},
  year      = {1986},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Dalphin86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Doszkocs86,
  author    = {Tamas E. Doszkocs},
  title     = {Natural Language User Interfaces for Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {15--16},
  year      = {1986},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Doszkocs86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frakes86,
  author    = {William B. Frakes},
  title     = {Information and Misinformation: An Investigation of the Notions of
               Information, Misinformation, Informing and Misinforming by C. J. Fox
               (Review)},
  journal   = {{SIGIR} Forum},
  volume    = {20},
  number    = {1-4},
  pages     = {22},
  year      = {1986},
  url       = {https://doi.org/10.1145/15497.1096832},
  doi       = {10.1145/15497.1096832},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Frakes86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Goldfarb86,
  author    = {Lev Goldfarb},
  title     = {Metric Data Models and Associated Search Strategies},
  journal   = {{SIGIR} Forum},
  volume    = {20},
  number    = {1-4},
  pages     = {7--11},
  year      = {1986},
  url       = {https://doi.org/10.1145/15497.15498},
  doi       = {10.1145/15497.15498},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Goldfarb86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey86,
  author    = {Susanne M. Humphrey},
  title     = {Automated Classification and Retrieval Program: Indexing Aid Project},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {16--17},
  year      = {1986},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Humphrey86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kraft86,
  author    = {Donald H. Kraft},
  title     = {Research into Fuzzy Extensions of Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {20},
  number    = {1-4},
  pages     = {12--13},
  year      = {1986},
  url       = {https://doi.org/10.1145/15497.15499},
  doi       = {10.1145/15497.15499},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Kraft86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lesk86,
  author    = {Michael Lesk},
  title     = {Information in Data: Using the Oxford English Dictionary on a Computer},
  journal   = {{SIGIR} Forum},
  volume    = {20},
  number    = {1-4},
  pages     = {18--21},
  year      = {1986},
  url       = {https://doi.org/10.1145/15497.15502},
  doi       = {10.1145/15497.15502},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Lesk86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lesk86a,
  author    = {Michael Lesk},
  title     = {Writing to be Searched: {A} Workshop on Document Generation Principles},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {9--14},
  year      = {1986},
  url       = {https://doi.org/10.1145/16287.16288},
  doi       = {10.1145/16287.16288},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Lesk86a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Martin86,
  author    = {Ann Martin},
  title     = {Database: {A} Primer by C. J. Date (Review)},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {23--24},
  year      = {1986},
  url       = {https://doi.org/10.1145/16287.1096835},
  doi       = {10.1145/16287.1096835},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Martin86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Rada86,
  author    = {Roy Rada},
  title     = {A Methodological Approach to Automatic Thesaurus Construction},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {17--18},
  year      = {1986},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Rada86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Rada86a,
  author    = {Roy Rada},
  title     = {Which Way for a Classification Scheme for Computers and Medicine},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {21--22},
  year      = {1986},
  url       = {https://doi.org/10.1145/16287.16290},
  doi       = {10.1145/16287.16290},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Rada86a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Raghavan86,
  author    = {Vijay V. Raghavan},
  title     = {Abstracts Selected from Recent Issues of Journals in the Retrieval
               Area},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {25--31},
  year      = {1986},
  url       = {https://doi.org/10.1145/16287.1096836},
  doi       = {10.1145/16287.1096836},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Raghavan86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Raghavan86a,
  author    = {Vijay V. Raghavan},
  title     = {Report on {SIGIR} Business Meeting},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {1},
  year      = {1986},
  timestamp = {Mon, 26 Oct 2015 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Raghavan86a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Raghavan86b,
  author    = {Vijay V. Raghavan},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {2},
  year      = {1986},
  timestamp = {Mon, 26 Oct 2015 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Raghavan86b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Raghavan86c,
  author    = {Vijay V. Raghavan},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {20},
  number    = {1-4},
  pages     = {1},
  year      = {1986},
  timestamp = {Mon, 26 Oct 2015 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Raghavan86c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton86,
  author    = {Gerard Salton},
  title     = {Abstracts Selected from {SIGIR-84} Conference at Cambridge},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {32--35},
  year      = {1986},
  url       = {https://doi.org/10.1145/16287.1096837},
  doi       = {10.1145/16287.1096837},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SaltonR86,
  author    = {Gerard Salton and
               Vijay V. Raghavan},
  title     = {Abstracts Selected from 1984 Issues of Journals in the Retrieval Area},
  journal   = {{SIGIR} Forum},
  volume    = {20},
  number    = {1-4},
  pages     = {30--42},
  year      = {1986},
  url       = {https://doi.org/10.1145/15497.1096834},
  doi       = {10.1145/15497.1096834},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SaltonR86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SaltonR86a,
  author    = {Gerard Salton and
               Vijay V. Raghavan},
  title     = {Abstracts Selected from 1983 Issues of Journals in the Retreival Area},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {36--48},
  year      = {1986},
  url       = {https://doi.org/10.1145/16287.1096838},
  doi       = {10.1145/16287.1096838},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/SaltonR86a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/White86,
  author    = {John R. White},
  title     = {Extended Terms for {SIG} Officers},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {6--7},
  year      = {1986},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/White86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Williamson86,
  author    = {Donna Williamson},
  title     = {Information Retrieval Research at the National Library of Medicine},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {15},
  year      = {1986},
  url       = {https://doi.org/10.1145/16287.16289},
  doi       = {10.1145/16287.16289},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Williamson86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Williamson86a,
  author    = {Donna Williamson},
  title     = {The {IRX} Project},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {19},
  year      = {1986},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Williamson86a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Williamson86b,
  author    = {Donna Williamson},
  title     = {The Online Reference Works Program},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {19--20},
  year      = {1986},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Williamson86b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WongZ86,
  author    = {S. K. Michael Wong and
               Wojciech Ziarko},
  title     = {A Unified Approach for Artificial Intelligence and Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {20},
  number    = {1-4},
  pages     = {14--15},
  year      = {1986},
  url       = {https://doi.org/10.1145/15497.15500},
  doi       = {10.1145/15497.15500},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/WongZ86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WongZ86a,
  author    = {S. K. Michael Wong and
               Wojciech Ziarko},
  title     = {A Concept-Learning Information Retrieval System - Basic Ideas},
  journal   = {{SIGIR} Forum},
  volume    = {20},
  number    = {1-4},
  pages     = {16--17},
  year      = {1986},
  url       = {https://doi.org/10.1145/15497.15501},
  doi       = {10.1145/15497.15501},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/WongZ86a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X86,
  title     = {Abstracts Selected from Recent Issues of Journals},
  journal   = {{SIGIR} Forum},
  volume    = {20},
  number    = {1-4},
  pages     = {23--29},
  year      = {1986},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X86.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X86a,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  year      = {1986},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X86a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X86b,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {3--5},
  year      = {1986},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X86b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X86c,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {19},
  number    = {1-4},
  pages     = {49--52},
  year      = {1986},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X86c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X86d,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {20},
  number    = {1-4},
  year      = {1986},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X86d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X86e,
  title     = {Announcement: {SIGIR} 1986},
  journal   = {{SIGIR} Forum},
  volume    = {20},
  number    = {1-4},
  pages     = {2--6},
  year      = {1986},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X86e.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X86f,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {20},
  number    = {1-4},
  pages     = {43--49},
  year      = {1986},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X86f.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Eastman85,
  author    = {Caroline M. Eastman},
  title     = {News from {NSF}},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {2-4},
  pages     = {18--19},
  year      = {1985},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Eastman85.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Girill85,
  author    = {T. R. Girill},
  title     = {Online Access Aids for Documentation: {A} Bibliographic Outline},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {2-4},
  pages     = {24--27},
  year      = {1985},
  url       = {https://doi.org/10.1145/1095475.1095476},
  doi       = {10.1145/1095475.1095476},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Girill85.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lesk85,
  author    = {Michael Lesk},
  title     = {Report on the {BCS/IR} - {SIGIR} Meeting},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {2-4},
  pages     = {3--4},
  year      = {1985},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Lesk85.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lesk85a,
  author    = {Michael Lesk},
  title     = {{SIGIR} 1985},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {2-4},
  pages     = {10--15},
  year      = {1985},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Lesk85a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Raghavan85,
  author    = {Vijay V. Raghavan},
  title     = {Workshop Report, University of Regina, June 10-11, 1985},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {2-4},
  pages     = {17},
  year      = {1985},
  timestamp = {Thu, 22 Oct 2015 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Raghavan85.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton85,
  author    = {Gerard Salton},
  title     = {Thoughts Regarding the {RIAO-85} Conference in Grenoble},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {2-4},
  pages     = {5--9},
  year      = {1985},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton85.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton85a,
  author    = {Gerard Salton},
  title     = {Some Characteristics of Future Information Systems},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {2-4},
  pages     = {28--39},
  year      = {1985},
  url       = {https://doi.org/10.1145/1095475.1095477},
  doi       = {10.1145/1095475.1095477},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton85a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X85,
  title     = {{SIGIR} 1985 Panel},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {2-4},
  pages     = {15--16},
  year      = {1985},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X85.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X85a,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {2-4},
  year      = {1985},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X85a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X85b,
  title     = {Objectices of {ACM} {SIGIR} Officers},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {2-4},
  pages     = {2},
  year      = {1985},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X85b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X85c,
  title     = {1984 {NSF} Award Listing},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {2-4},
  pages     = {20--21},
  year      = {1985},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X85c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X85d,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {2-4},
  pages     = {22--23},
  year      = {1985},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X85d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X85e,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {2-4},
  pages     = {40--41},
  year      = {1985},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X85e.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Yu85,
  author    = {Clement T. Yu},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {2-4},
  pages     = {1},
  year      = {1985},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Yu85.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Agosti84,
  author    = {Maristella Agosti},
  title     = {Specialised Hardware for Database Management and Information Retrieval:
               {A} Classified Bibliography},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {1},
  pages     = {13--40},
  year      = {1984},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Agosti84.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Brown84,
  author    = {George Brown Jr.},
  title     = {Do we need an Information Policy?},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {1},
  pages     = {7--12},
  year      = {1984},
  url       = {https://doi.org/10.1145/1095469.1095470},
  doi       = {10.1145/1095469.1095470},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Brown84.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lesk84,
  author    = {Michael Lesk},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {1},
  pages     = {1--2},
  year      = {1984},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Lesk84.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton84,
  author    = {Gerard Salton},
  title     = {Abstracts from Current Issues of Journals in the Retrieval Area},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {1},
  pages     = {44--51},
  year      = {1984},
  url       = {https://doi.org/10.1145/1095469.1095471},
  doi       = {10.1145/1095469.1095471},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton84.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Smith84,
  author    = {Linda C. Smith},
  title     = {Minutes of the {SIGIR} Executive Committee Meeting 1983},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {1},
  pages     = {3--5},
  year      = {1984},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Smith84.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Smith84a,
  author    = {Linda C. Smith},
  title     = {{SIGIR} Conference 1983 - Report on Banquet Events},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {1},
  pages     = {6},
  year      = {1984},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Smith84a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X84,
  title     = {Annals of the History of Computing},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {1},
  pages     = {41--42},
  year      = {1984},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X84.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X84a,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {1},
  year      = {1984},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X84a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X84b,
  title     = {Book Reviews},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {1},
  pages     = {43},
  year      = {1984},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X84b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X84c,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {18},
  number    = {1},
  pages     = {52--53},
  year      = {1984},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X84c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Borko82,
  author    = {Harold Borko},
  title     = {Automatic Indexing: {A} Tutorial},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {3},
  pages     = {9--13},
  year      = {1982},
  url       = {https://doi.org/10.1145/1095454.1095456},
  doi       = {10.1145/1095454.1095456},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Borko82.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Croft82,
  author    = {W. Bruce Croft},
  title     = {Experiments with Automatic Text Filing and Retrieval in the Office
               Environment},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {4},
  pages     = {2--9},
  year      = {1982},
  url       = {https://doi.org/10.1145/1095450.1095451},
  doi       = {10.1145/1095450.1095451},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Croft82.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Crouch82,
  author    = {Carolyn J. Crouch},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {3},
  pages     = {1},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Crouch82.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Korfhage82,
  title     = {{ACM} 1982 Panel: Advances in Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {1},
  pages     = {4--5},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Korfhage82.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MahD82,
  author    = {Clinton P. Mah and
               Raymond J. D'Amore},
  title     = {Complete Statistical Indexing of Text by Overlapping Word Fragments},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {3},
  pages     = {6--16},
  year      = {1982},
  url       = {https://doi.org/10.1145/1095464.1095465},
  doi       = {10.1145/1095464.1095465},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/MahD82.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Noreault82,
  author    = {Terry Noreault},
  title     = {Vice Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {4},
  pages     = {2},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Noreault82.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Raghavan82,
  author    = {Vijay V. Raghavan},
  title     = {Approaches for Measuring the Stability of Clustering Methods},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {1},
  pages     = {6--20},
  year      = {1982},
  url       = {https://doi.org/10.1145/1095460.1095461},
  doi       = {10.1145/1095460.1095461},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Raghavan82.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton82,
  author    = {Gerard Salton},
  title     = {Abstracts Choosen from Current Issues of Journals in the Retrieval
               Area},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {1},
  pages     = {23--34},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton82.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton82a,
  author    = {Gerard Salton},
  title     = {A Blueprint for Automatic Boolean Query Processing},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {2},
  pages     = {6--24},
  year      = {1982},
  url       = {https://doi.org/10.1145/1095479.1095480},
  doi       = {10.1145/1095479.1095480},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton82a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton82b,
  author    = {Gerard Salton},
  title     = {Abstracts Choosen from Current Issues of Journals in the Retrieval
               Area},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {2},
  pages     = {25--31},
  year      = {1982},
  url       = {https://doi.org/10.1145/1095479.1095481},
  doi       = {10.1145/1095479.1095481},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton82b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton82c,
  author    = {Gerard Salton},
  title     = {Abstracts from Current Issues of Journals in the Retrieval Area},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {3},
  pages     = {30--36},
  year      = {1982},
  url       = {https://doi.org/10.1145/1095464.1095467},
  doi       = {10.1145/1095464.1095467},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton82c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton82d,
  author    = {Gerard Salton},
  title     = {Abstracts of Presentations Made at the Tutorial and Panel Discussion
               on Automatic Information Retrieval, ACM'81},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {3},
  pages     = {5--8},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton82d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton82e,
  author    = {Gerard Salton},
  title     = {Abstracts of Selected Journal Articles},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {3},
  pages     = {23--28},
  year      = {1982},
  url       = {https://doi.org/10.1145/1095454.1095458},
  doi       = {10.1145/1095454.1095458},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton82e.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton82f,
  author    = {Gerard Salton},
  title     = {Abstracts from Current Issues of Journals in the Retrieval Area},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {4},
  pages     = {10--16},
  year      = {1982},
  url       = {https://doi.org/10.1145/1095450.1095452},
  doi       = {10.1145/1095450.1095452},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton82f.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton82g,
  author    = {Gerard Salton},
  title     = {Chairman's Message / {SIGIR} News},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {3},
  pages     = {2--5},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton82g.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton82h,
  author    = {Gerard Salton},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {2},
  pages     = {1--2},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton82h.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton82i,
  author    = {Gerard Salton},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {1},
  pages     = {1--2},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton82i.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton82j,
  author    = {Gerard Salton},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {3},
  pages     = {1--2},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton82j.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Smith82,
  author    = {Linda C. Smith},
  title     = {Minutes of the Meeting-Representatives of SIGIR, {BCS} Information
               Retrieval Specialist Group, and Gesellschaft f{\"{u}}r Informatik},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {1},
  pages     = {3},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Smith82.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Smith82a,
  author    = {Linda C. Smith},
  title     = {Minutes of the {SIGIR} Executive Committee Meeting at the 44th {ASIS}
               Annual Meeting},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {3},
  pages     = {3--4},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Smith82a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X82,
  title     = {Research in Information Science and Technology},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {1},
  pages     = {21--22},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X82.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X82a,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {2},
  pages     = {32--38},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X82a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X82b,
  title     = {Abstracts of the Papers to be presented at the Sixth Annual International
               {ACM} {SIGIR} Conference 1983},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {3},
  pages     = {17--27},
  year      = {1982},
  url       = {https://doi.org/10.1145/1095464.1095466},
  doi       = {10.1145/1095464.1095466},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/X82b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X82c,
  title     = {Abstracts of Papers to be Presented at the Fifth Annual International
               {SIGIR} Conference},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {3},
  pages     = {14--22},
  year      = {1982},
  url       = {https://doi.org/10.1145/1095454.1095457},
  doi       = {10.1145/1095454.1095457},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/X82c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X82d,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {3},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X82d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X82e,
  title     = {Call for Papers: {SIGIT} 1984},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {3},
  pages     = {28--29},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X82e.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X82f,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {2},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X82f.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X82g,
  title     = {Minutes {SIGIR} Business Meeting 1982 / {SIGIR} News},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {2},
  pages     = {3--6},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X82g.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X82h,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {1},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X82h.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X82i,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {17},
  number    = {1},
  pages     = {35--40},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X82i.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X82j,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {3},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X82j.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X82k,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {4},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X82k.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X82l,
  title     = {CfP: International Computer Symposium 1982},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {4},
  pages     = {17},
  year      = {1982},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X82l.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Krishnayya81,
  author    = {J. G. Krishnayya},
  title     = {The Implementation of Complex Information Systems (Book Review)},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {4},
  pages     = {10--12},
  year      = {1981},
  url       = {https://doi.org/10.1145/1095398.1095401},
  doi       = {10.1145/1095398.1095401},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Krishnayya81.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton81,
  author    = {Gerard Salton},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {4},
  pages     = {1--3},
  year      = {1981},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton81.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton81a,
  author    = {Gerard Salton},
  title     = {Abstracts from Current Issues of Journals from the Retrieval Area},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {4},
  pages     = {13--18},
  year      = {1981},
  url       = {https://doi.org/10.1145/1095398.1095399},
  doi       = {10.1145/1095398.1095399},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton81a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton81b,
  author    = {Gerard Salton},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {2},
  pages     = {1--3},
  year      = {1981},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton81b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton81c,
  author    = {Gerard Salton},
  title     = {A Blueprint for Automatic Indexing},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {2},
  pages     = {22--38},
  year      = {1981},
  url       = {https://doi.org/10.1145/1095425.1095427},
  doi       = {10.1145/1095425.1095427},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton81c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton81d,
  author    = {Gerard Salton},
  title     = {Abstracts from Current Issues of Journals in the Retrieval Area},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {2},
  pages     = {39--45},
  year      = {1981},
  url       = {https://doi.org/10.1145/1095425.1095428},
  doi       = {10.1145/1095425.1095428},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton81d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Smith81,
  author    = {Linda C. Smith},
  title     = {Minutes of the {SIGIR} Business Meeting at {ACM} '80},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {2},
  pages     = {4--5},
  year      = {1981},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Smith81.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Smith81a,
  author    = {Linda C. Smith},
  title     = {Minutes of the {SIGIR} Executive Committee Meeting at the Fourth Annual
               International {SIGIR} Conference},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {2},
  pages     = {6--7},
  year      = {1981},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Smith81a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X81,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {4},
  year      = {1981},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X81.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X81a,
  title     = {{SIGIR} Conference 1981 - Announcement},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {4},
  pages     = {4--9},
  year      = {1981},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X81a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X81b,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {2},
  year      = {1981},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X81b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X81c,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {2},
  pages     = {8--11},
  year      = {1981},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X81c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X81d,
  title     = {{BCS} Information Retrieval Specialist Group - Third Research Colloquium
               1981 - Summaries of Papers},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {2},
  pages     = {12--21},
  year      = {1981},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X81d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X81e,
  title     = {Calls for Papers},
  journal   = {{SIGIR} Forum},
  volume    = {16},
  number    = {2},
  pages     = {46--48},
  year      = {1981},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X81e.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berra80,
  author    = {P. Bruce Berra},
  title     = {Outgoing Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {3},
  pages     = {7},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Berra80.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Crouch80,
  author    = {Carolyn J. Crouch},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {1},
  pages     = {1--2},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Crouch80.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Crouch80a,
  author    = {Carolyn J. Crouch},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {3},
  pages     = {1},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Crouch80a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Crouch80b,
  author    = {Carolyn J. Crouch},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {3},
  pages     = {1--2},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Crouch80b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Crouch80c,
  author    = {Carolyn J. Crouch},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {4},
  pages     = {1--2},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Crouch80c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Dattola80,
  author    = {Robert T. Dattola},
  title     = {Some Ideas for Estimating the Number of Relevant Documents},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {1},
  pages     = {13--21},
  year      = {1980},
  url       = {https://doi.org/10.1145/1095394.1095395},
  doi       = {10.1145/1095394.1095395},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Dattola80.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox80,
  author    = {Edward A. Fox},
  title     = {Lexical Relations: Enhancing Effectiveness of Information Retrieval
               Systems},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {3},
  pages     = {5--36},
  year      = {1980},
  url       = {https://doi.org/10.1145/1095403.1095404},
  doi       = {10.1145/1095403.1095404},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Fox80.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KingGS80,
  author    = {Chester King and
               Larry Goldstein and
               Gail Stocker},
  title     = {{MEDUS/A:} {A} User-Oriented Database Management System for Medical
               Research},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {3},
  pages     = {55--60},
  year      = {1980},
  url       = {https://doi.org/10.1145/1095403.1095406},
  doi       = {10.1145/1095403.1095406},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/KingGS80.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Krishnayya80,
  author    = {J. G. Krishnayya},
  title     = {Industrial Information Systems: {A} Manual for Higher Managements
               and Their Information Officer/Librarian Associates - Book Review},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {4},
  pages     = {11--12},
  year      = {1980},
  url       = {https://doi.org/10.1145/1095387.1095392},
  doi       = {10.1145/1095387.1095392},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Krishnayya80.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/McGill80,
  author    = {Michael McGill},
  title     = {Information Retrieval Activities at the School of Information Studies
               Syracuse University},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {4},
  pages     = {13--16},
  year      = {1980},
  url       = {https://doi.org/10.1145/1095387.1095388},
  doi       = {10.1145/1095387.1095388},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/McGill80.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton80,
  author    = {Gerard Salton},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {1},
  pages     = {3--5},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton80.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton80a,
  author    = {Gerard Salton},
  title     = {Abstracts from Current Issues of Journals from the Retrieval Area},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {1},
  pages     = {22--27},
  year      = {1980},
  url       = {https://doi.org/10.1145/1095394.1095396},
  doi       = {10.1145/1095394.1095396},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton80a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton80b,
  author    = {Gerard Salton},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {3},
  pages     = {2},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton80b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton80c,
  author    = {Gerard Salton},
  title     = {Abstracts from Current Issues of Journals from the Retrieval Area},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {3},
  pages     = {47--54},
  year      = {1980},
  url       = {https://doi.org/10.1145/1095403.1095405},
  doi       = {10.1145/1095403.1095405},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton80c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton80d,
  author    = {Gerard Salton},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {3},
  pages     = {3--6},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton80d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton80e,
  author    = {Gerard Salton},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {4},
  pages     = {3--4},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton80e.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton80f,
  author    = {Gerard Salton},
  title     = {Abstracts from current issues of journals in the retrieval area},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {4},
  pages     = {17--21},
  year      = {1980},
  url       = {https://doi.org/10.1145/1095387.1095389},
  doi       = {10.1145/1095387.1095389},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Salton80f.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Wiersba80,
  author    = {R. K. Wiersba},
  title     = {Information Retrieval: Computational and Theoretical Aspects - Book
               Review},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {3},
  pages     = {10--16},
  year      = {1980},
  url       = {https://doi.org/10.1145/1095383.1095385},
  doi       = {10.1145/1095383.1095385},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Wiersba80.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X80,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {1},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X80.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X80a,
  title     = {{SIGIR} News and Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {1},
  pages     = {6--12},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X80a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X80b,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {1},
  pages     = {28--30},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X80b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X80c,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {3},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X80c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X80d,
  title     = {{SIGIR} News},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {3},
  pages     = {3},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X80d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X80e,
  title     = {{CACM} Database Format},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {3},
  pages     = {4},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X80e.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X80f,
  title     = {{SIGIR} 1980 - Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {3},
  pages     = {37--46},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X80f.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X80g,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {15},
  number    = {3},
  pages     = {61--63},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X80g.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X80h,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {3},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X80h.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X80i,
  title     = {{SIGIR} News},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {3},
  pages     = {8--9},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X80i.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X80j,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {3},
  pages     = {17--21},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X80j.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X80k,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {4},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X80k.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X80l,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {4},
  pages     = {5--10},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X80l.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X80m,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {4},
  pages     = {22--23},
  year      = {1980},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X80m.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ashworth79,
  author    = {E. R. Ashworth},
  title     = {Data Structures and Programming Techniques - Book Review},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {3},
  pages     = {8--11},
  year      = {1979},
  url       = {https://doi.org/10.1145/1095360.1095362},
  doi       = {10.1145/1095360.1095362},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Ashworth79.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berra79,
  author    = {P. Bruce Berra},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {1},
  pages     = {1},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Berra79.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berra79a,
  author    = {P. Bruce Berra},
  title     = {Review - Information Retrieval Specialist Group Collequium, University
               of Aston, Birmingham {(UK)} 1979},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {1},
  pages     = {18--19},
  year      = {1979},
  url       = {https://doi.org/10.1145/1095377.1095381},
  doi       = {10.1145/1095377.1095381},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Berra79a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berra79b,
  author    = {P. Bruce Berra},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {3},
  pages     = {1},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Berra79b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berra79c,
  author    = {P. Bruce Berra},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {4},
  pages     = {2},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Berra79c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jones79,
  author    = {Karen Sparck Jones},
  title     = {Modern On-Line Systems: Challenges To Research},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {3},
  pages     = {15--25},
  year      = {1979},
  url       = {https://doi.org/10.1145/1095360.1095364},
  doi       = {10.1145/1095360.1095364},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Jones79.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Koll79,
  author    = {Matthew B. Koll},
  title     = {{WEIRD:} An Approach to Concept-Based Information Retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {4},
  pages     = {32--50},
  year      = {1979},
  url       = {https://doi.org/10.1145/1095366.1095368},
  doi       = {10.1145/1095366.1095368},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Koll79.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/McGill79,
  author    = {Michael McGill},
  title     = {From the Editor},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {4},
  pages     = {1},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/McGill79.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Murphy79,
  author    = {Rochester Murphy},
  title     = {Data Base Management Systems by A. Cardenas - Book Review},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {1},
  pages     = {2--3},
  year      = {1979},
  url       = {https://doi.org/10.1145/1095377.1095379},
  doi       = {10.1145/1095377.1095379},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Murphy79.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sauvain79,
  author    = {Richard W. Sauvain},
  title     = {Computer-Based Personal Retrieval System - Annotated Bibliography},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {4},
  pages     = {8--31},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Sauvain79.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Walton79,
  author    = {Ronald J. Walton},
  title     = {Minutes of the {SIGIR} Meeting at ACM'77},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {3},
  pages     = {4--5},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Walton79.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Walton79a,
  author    = {Ronald J. Walton},
  title     = {Minutes of the {SIGIR} Meeting at Rochester, NY, May 1979},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {3},
  pages     = {6},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Walton79a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X79,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {1},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X79.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X79a,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {1},
  pages     = {4--17},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X79a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X79b,
  title     = {Bylaws of {ACM} {SIGIR} - Draft},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {1},
  pages     = {20--25},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X79b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X79c,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {14},
  number    = {1},
  pages     = {26--31},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X79c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X79d,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {3},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X79d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X79e,
  title     = {Book Review Editor's Note / {CS} Book Clubs},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {3},
  pages     = {2--3},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X79e.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X79f,
  title     = {CfP: {SIGMOD} Conference 1979},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {3},
  pages     = {7},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X79f.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X79g,
  title     = {CfP: {SIGIR} Conference 1979},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {3},
  pages     = {12--13},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X79g.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X79h,
  title     = {Requests for Nomination},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {3},
  pages     = {14},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X79h.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X79i,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {3},
  pages     = {26--27},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X79i.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X79j,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {4},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X79j.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X79k,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {4},
  pages     = {3--7},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X79k.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X79l,
  title     = {CfP: {CODAS} 1980},
  journal   = {{SIGIR} Forum},
  volume    = {13},
  number    = {4},
  pages     = {51},
  year      = {1979},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X79l.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berra78,
  author    = {P. Bruce Berra},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {4},
  pages     = {1},
  year      = {1978},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Berra78.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Korfhage78,
  author    = {Robert Korfhage},
  title     = {The Impact of Personal Computers on Library-based Information Systems},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {4},
  pages     = {10--13},
  year      = {1978},
  url       = {https://doi.org/10.1145/1095334.1095337},
  doi       = {10.1145/1095334.1095337},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Korfhage78.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/McGill78,
  author    = {Michael McGill},
  title     = {Editor's Notes},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {4},
  pages     = {2},
  year      = {1978},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/McGill78.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X78,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {4},
  year      = {1978},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X78.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X78a,
  title     = {Announcement: {SIGIR} Conference 1978},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {4},
  pages     = {3--5},
  year      = {1978},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X78a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X78b,
  title     = {Book Review Section / Book Clubs for Computer Professionals},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {4},
  pages     = {6--9},
  year      = {1978},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X78b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X78c,
  title     = {Letters / Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {4},
  pages     = {14--17},
  year      = {1978},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X78c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berra77,
  author    = {P. Bruce Berra},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {2},
  pages     = {iii},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Berra77.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berra77a,
  author    = {P. Bruce Berra},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {3},
  pages     = {1},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Berra77a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berra77b,
  author    = {P. Bruce Berra},
  title     = {Data Base Machines},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {3},
  pages     = {4--23},
  year      = {1977},
  url       = {https://doi.org/10.1145/1095317.1095318},
  doi       = {10.1145/1095317.1095318},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Berra77b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berra77c,
  author    = {P. Bruce Berra},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {11},
  number    = {4},
  pages     = {1},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Berra77c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Crouch77,
  author    = {Carolyn J. Crouch},
  title     = {Minutes {SIGIR} Meeting Dallas 1977},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {2},
  pages     = {v},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Crouch77.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Groman77,
  author    = {Robert C. Groman},
  title     = {From the Book Review Editor},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {2},
  pages     = {vi},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Groman77.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/McGill77,
  author    = {Michael McGill},
  title     = {Eidtor's Note},
  journal   = {{SIGIR} Forum},
  volume    = {11},
  number    = {4},
  pages     = {2},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/McGill77.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Minker77,
  author    = {Jack Minker},
  title     = {Information Storage and Retrieval, {A} Survey and Functional Description},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {2},
  pages     = {1--108},
  year      = {1977},
  url       = {https://doi.org/10.1145/1095515.1095516},
  doi       = {10.1145/1095515.1095516},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Minker77.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {2},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X77.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77a,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {2},
  pages     = {i--ii},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X77a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77b,
  title     = {Nominees for Office {SIGIR}},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {2},
  pages     = {iv},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X77b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77c,
  title     = {Computer Data-Base Organization - Book Review},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {2},
  pages     = {vii--ix},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X77c.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77d,
  title     = {Letters},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {2},
  pages     = {x--xi},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X77d.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77e,
  title     = {CfP: {SIGIR} Conference 1978},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {2},
  pages     = {109},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X77e.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77f,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {3},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X77f.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77g,
  title     = {Book Reviews},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {3},
  pages     = {2--3},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X77g.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77h,
  title     = {Announcements},
  journal   = {{SIGIR} Forum},
  volume    = {12},
  number    = {3},
  pages     = {24--27},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X77h.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77i,
  title     = {Title},
  journal   = {{SIGIR} Forum},
  volume    = {11},
  number    = {4},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X77i.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77j,
  title     = {Workshops {\&} Conferences},
  journal   = {{SIGIR} Forum},
  volume    = {11},
  number    = {4},
  pages     = {3--6},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X77j.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77k,
  title     = {Abstracts from 1977 {ACM} Computer Science Conference},
  journal   = {{SIGIR} Forum},
  volume    = {11},
  number    = {4},
  pages     = {7--16},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X77k.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77l,
  title     = {Abstracts from {JASIS}},
  journal   = {{SIGIR} Forum},
  volume    = {11},
  number    = {4},
  pages     = {17--19},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X77l.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77m,
  author    = {Michael J. McGill},
  title     = {Abstracts},
  journal   = {{SIGIR} Forum},
  volume    = {11},
  number    = {4},
  pages     = {20--22},
  year      = {1977},
  timestamp = {Tue, 09 Jan 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/X77m.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77n,
  author    = {Terry Noreault},
  title     = {Review of "Data Base Processing Fundamentals, Modeling, Applications
               by David Kroenke"; Science Research Associates, 1977},
  journal   = {{SIGIR} Forum},
  volume    = {11},
  number    = {4},
  pages     = {23},
  year      = {1977},
  timestamp = {Tue, 09 Jan 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/X77n.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X77o,
  title     = {Announcement - {SIGIR} Conference 1978},
  journal   = {{SIGIR} Forum},
  volume    = {11},
  number    = {4},
  pages     = {24},
  year      = {1977},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/X77o.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AckermanELS76,
  author    = {S. J. Ackerman and
               Ahmed Emam and
               G. Jack Lipovski and
               Stanley Y. W. Su},
  title     = {Implementation of a Context-Addressed Pipeline\({}^{\mbox{3}}\) {SIMD}
               Architecture - Abstract},
  journal   = {{SIGIR} Forum},
  volume    = {10},
  number    = {4},
  pages     = {27--28},
  year      = {1976},
  url       = {https://doi.org/10.1145/1095286.1095298},
  doi       = {10.1145/1095286.1095298},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/AckermanELS76.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berra76,
  author    = {P. Bruce Berra},
  title     = {Incoming Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {11},
  number    = {1},
  pages     = {2},
  year      = {1976},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Berra76.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berra76a,
  author    = {P. Bruce Berra},
  title     = {Chairman's Message},
  journal   = {{SIGIR} Forum},
  volume    = {11},
  number    = {2},
  pages     = {1},
  year      = {1976},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Berra76a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BerraS76,
  author    = {P. Bruce Berra and
               Ashok K. Singhania},
  title     = {A Multiple Associative Memory Organization for Pipelining a Directory
               to a Very Large Data Base - Abstract},
  journal   = {{SIGIR} Forum},
  volume    = {10},
  number    = {4},
  pages     = {22},
  year      = {1976},
  url       = {https://doi.org/10.1145/1095286.1095294},
  doi       = {10.1145/1095286.1095294},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/BerraS76.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Buttler76,
  author    = {Margaret Buttler},
  title     = {Minutes {SIGIR} Meeting New York 1975},
  journal   = {{SIGIR} Forum},
  volume    = {11},
  number    = {1},
  pages     = {3},
  year      = {1976},
  timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/Buttler76.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Chu76,
  author    = {Yaohan Chu},
  title     = {Architecture of a Nonnumerical Accumulator - Abstract},
  journal   = {{SIGIR} Forum},
  volume    = {10},
  number    = {4},
  pages     = {7},
  year      = {1976},
  url       = {https://doi.org/10.1145/1095286.1095288},
  doi       = {10.1145/1095286.1095288},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Chu76.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of Schloss Dagstuhl - Leibniz Center for Informatics